1X6CA

Solution structures of the sh2 domain of human protein-tyrosine phosphatase shp-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase, non-receptor type 6
publication title Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 118
sequence length 118
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1x6cA00
1FMKA 1AD5A 1O44A 2GE9A 2RVFA 1O4DA 3OB1B 1LUKA 4LUEA 3CXLA 2YU7A 2HMHA 1A07A 2DLZA 1RPYA 2ECDA 1PICA 2H46E 1FBZA 1FBVA 2EYVA 4DGPA 1AYDA 5EG3B 1O47A 1R1QA 3T04A 1HCTB 2MRJA 3BUNB 3VRYA 1O4FA 3VRZA 2RMXA 2L6KA 1A08A 3C7IA 5EEQA 1FU6A 3S8NA 2HDVA 1FYRA 4OHEA 2AUGA 4E68A 2L3TA 1F2FA 1O4MA 4K44A 5J3XA 1JYQA 3N84A 1QCFA 4EIHA 2HUWA 3PSJA 2DLYA 2LCTA 1R1PA 3HHMB 2EYYA 3IN7A 1O42A 3EACA 4X6SA 2EO6A 2SRCA 1BHHB 1GRIA 1H9OA 1R1SA 3ZNIA 2CS0A 2KNOA 2LQNA 3K2MA 1O45A 5IBSA 4H34A 1O49A 1O4BA 3VROA 2MC1A 2Y3AB 2C0OA 1O43A 2KK6A 1JYUA 2C0IA 2AOAA 3HIZB 3VS0A 2PNBA 4TZIA 1O4GA 1MILA 5HKWA 2LNXA 3VRPA 3N8MA 2K7AB 5AULA 1OO4A 1Y57A 1B47A 1WQUA 5DC9A 2FO0A 2IZVA 1KA7A 5AXIA 3NHNA 1NZLA 1ZFPE 3VS6A 4JEGA 1AYBA 2DCRA 3WA4A 1JU5A 2FCIA 1A81A 2C9WA 1QADA 1AOTF 1LKKA 3M7FA 1Z3KA 1YVHA 2EL8A 5EHPA 1O4LA 1SHDA 4GWFA 3PJPA 4DGXA 1KA6A 4NWGA 3PLFB 2YSXA 1UUSA 3GXXA 1O4NA 1D4TA 5CDWA 2ABLA 1O4QA 1XA6A 1O4PA 3TL0A 2SHPA 2OZOA 3BUXB 2Y1MA 4NWFA 2MRKA 1JYRA 5DC4A 2C0TA 1NZVA 4OHHA 1BM2A 3CBLA 1F1WA 1CSYA 1SHAA 2EOBA 2H5KA 3QWYA 1X0NA 1O41A 4GL9E 3MAZA 1I3ZA 3VRQA 5BO4A 3TKZA 1O4HA 1TZEE 3CWGA 2HCKA 2VIFA 1CWEA 3IMJA 1CWDL 1LUNA 2CR4A 2EU0A 4QSYA 3OVEA 1P13A 2EO3A 1JWOA 2PNAA 5HKZA 5KAZA 5HKYA 4XZ1A 1SKJA 3S9KA 4F59A 2Y1NA 2LNWA 1O4OA 1AYCA 1IJRA 2MQIA 3VRRA 1BLKA 4GPLB 3KFJA 4EY0A 1TCEA 4K45A 3VS4A 2OQ1A 5DF6A 1BG1A 1BKMA 4P9VA 1OO3A 5EHRA 2CBLA 4FBNA 1M27A 3VS5A 4P9ZA 4ROJA 1FHSA 1K9AA 1O46A 1BFJA 2IUIA 1HCSB 3BKBA 4XZ0A 4OHIA 5GJIA 4K11A 2RSYA 3OB2B 3BUMB 5I6VA 3GXWA 1BKLA 1FU5A 3GQIB 3MXYA 2CI8A 2IUHA 3VS2A 1O48A 3IMDA 2DVJA 3PFVA 1X27A 3IN8A 1BF5A 3OV1A 2ETZA 1BFIA 1M61A 1A1EA 1O4AA 3BUOB 2AOBA 2BBUA 1CJ1A 3MXCA 4FL3A 2DX0A 1G83A 1SPSA 1CSZA 3BUWB 3CD3A 1RJAA 1LUMA 2L4KA 3N7YA 3VS3A 2CRHA 5GJHA 1LCKA 3EAZA 1LKLA 1SPRA 1KC2A 3PSKA 4F5BA 2MK2A 1UURA 4A4BA 1O4RA 3UYOA 1OPLA 4JE4A 1O4IA 4L1BB 1BHFA 2QMSA 1A09A 1LUIA 4OHLA 3QWXX 1BLJA 3VGOA 4E93A 1KSWA 1LCJA 4OHDA 4U1PA 3VS1A 1O4KA 3PS5A 3S8LA 1O4CA 2XP1A 5IBMA 4FL2A 5EELA 2LQWA 1IS0A 1SHBA 1AOUF 2RORA 1GHUA 2CIAA 1NRVA 1D1ZA 2JYQA 3UF4A 2PLEA 1O4EA 4H1OA 4M4ZA 3S8OA 1YVLA 3HCKA 1Y1UA 2DM0A 2K79B 4U17A 2B3OA 1A1BA 2EKXA 3OP0A 4F5AA 4JGHA 1BMBA 3US4A 3VS7A 1MW4A 1O4JA 1A1CA 1OPKA 1QG1E 1X6CA 5DC0B 2CI9A 4A4CA 4LUDA 1RQQC 3PQZA 2H8HA 4K2RA 2EYZA 2GSBA 2HDXA 1BHHA 4WWQA 1AB2A 1AYAA 4D8KA 1D4WA 2PLDA 1A1AA 2IUGA 5D0JA 2PTKA 3VRNA
chains in the Genus database with same CATH superfamily
1FMKA 1AD5A 1O44A 2GE9A 2RVFA 1O4DA 3OB1B 1LUKA 4LUEA 3CXLA 2YU7A 2HMHA 1A07A 2DLZA 1RPYA 2ECDA 1PICA 2H46E 1FBZA 1FBVA 2EYVA 4DGPA 1AYDA 5EG3B 1O47A 1R1QA 3T04A 1HCTB 2MRJA 3BUNB 3VRYA 1O4FA 3VRZA 2RMXA 2L6KA 1A08A 3C7IA 5EEQA 1FU6A 3S8NA 2HDVA 1FYRA 4OHEA 2AUGA 4E68A 2L3TA 1F2FA 1O4MA 4K44A 5J3XA 1JYQA 3N84A 1QCFA 4EIHA 2HUWA 3PSJA 2DLYA 2LCTA 1R1PA 3HHMB 2EYYA 3IN7A 1O42A 3EACA 4X6SA 2EO6A 2SRCA 1BHHB 1GRIA 1H9OA 1R1SA 3ZNIA 2CS0A 2KNOA 2LQNA 3K2MA 1O45A 5IBSA 4H34A 1O49A 1O4BA 3VROA 2MC1A 2Y3AB 2C0OA 1O43A 2KK6A 1JYUA 2C0IA 2AOAA 3HIZB 3VS0A 2PNBA 4TZIA 1O4GA 1MILA 5HKWA 2LNXA 3VRPA 3N8MA 2K7AB 5AULA 1OO4A 1Y57A 1B47A 1WQUA 5DC9A 2FO0A 2IZVA 1KA7A 5AXIA 3NHNA 1NZLA 1ZFPE 3VS6A 4JEGA 1AYBA 2DCRA 3WA4A 1JU5A 2FCIA 1A81A 2C9WA 3K2TA 1QADA 1AOTF 1LKKA 3M7FA 1Z3KA 1YVHA 2EL8A 5EHPA 1O4LA 1SHDA 4GWFA 3PJPA 4DGXA 1KA6A 4NWGA 3PLFB 2YSXA 1UUSA 3GXXA 1O4NA 1D4TA 5CDWA 2ABLA 1O4QA 1XA6A 1O4PA 3TL0A 2SHPA 2OZOA 3BUXB 2Y1MA 4NWFA 2MRKA 1JYRA 5DC4A 2C0TA 1NZVA 4OHHA 1BM2A 3CBLA 1F1WA 1CSYA 1SHAA 2EOBA 2H5KA 3QWYA 1X0NA 1O41A 4GL9E 3MAZA 1I3ZA 3VRQA 5BO4A 3TKZA 1O4HA 1TZEE 3CWGA 2HCKA 2VIFA 1CWEA 3IMJA 1CWDL 1LUNA 2CR4A 2EU0A 4QSYA 2KGYA 3OVEA 1P13A 2EO3A 1JWOA 2PNAA 5HKZA 5KAZA 5HKYA 4XZ1A 1SKJA 3S9KA 4F59A 2Y1NA 2LNWA 1O4OA 1AYCA 1IJRA 2MQIA 3VRRA 1BLKA 4GPLB 3KFJA 4EY0A 1TCEA 4K45A 3VS4A 2OQ1A 5DF6A 1BG1A 1BKMA 4P9VA 1OO3A 5EHRA 2CBLA 4FBNA 1M27A 3VS5A 4P9ZA 4ROJA 1FHSA 1K9AA 1O46A 3LYVA 1BFJA 2IUIA 1HCSB 2LRAA 3BKBA 4XZ0A 4OHIA 5GJIA 4K11A 2RSYA 3OB2B 3BUMB 5I6VA 3GXWA 1BKLA 1FU5A 3GQIB 3MXYA 2CI8A 2IUHA 3VS2A 1O48A 3IMDA 2DVJA 3PFVA 1X27A 3IN8A 1BF5A 3OV1A 2ETZA 1BFIA 1M61A 1A1EA 1O4AA 3BUOB 2AOBA 2BBUA 1CJ1A 3MXCA 4FL3A 2DX0A 1G83A 1SPSA 1CSZA 3BUWB 3CD3A 1RJAA 1LUMA 2L4KA 3N7YA 3VS3A 2CRHA 5GJHA 1LCKA 3EAZA 1LKLA 1SPRA 1KC2A 3PSKA 4F5BA 2MK2A 1UURA 4A4BA 1O4RA 3UYOA 1OPLA 4JE4A 1O4IA 4L1BB 1BHFA 2QMSA 1A09A 1LUIA 4OHLA 3QWXX 1BLJA 3VGOA 4E93A 1KSWA 1LCJA 4OHDA 4U1PA 3VS1A 1O4KA 3PS5A 3S8LA 1O4CA 2XP1A 5IBMA 4FL2A 5EELA 2LQWA 1IS0A 1SHBA 1AOUF 2RORA 1GHUA 2CIAA 1NRVA 1D1ZA 2JYQA 3UF4A 2PLEA 1O4EA 4H1OA 4M4ZA 3S8OA 1YVLA 3HCKA 1Y1UA 2DM0A 2K79B 4U17A 2B3OA 1A1BA 2EKXA 3OP0A 4F5AA 4JGHA 1BMBA 3US4A 3VS7A 1MW4A 1O4JA 1A1CA 1OPKA 1QG1E 1X6CA 5DC0B 2CI9A 4A4CA 4LUDA 1RQQC 3PQZA 2H8HA 4K2RA 2EYZA 2GSBA 2HDXA 1BHHA 4WWQA 1AB2A 1AYAA 4D8KA 1D4WA 2PLDA 1A1AA 2IUGA 5D0JA 2PTKA 3VRNA
chains in the Genus database with same CATH topology
1FMKA 1AD5A 1O44A 2GE9A 2RVFA 1O4DA 3OB1B 1LUKA 4LUEA 3CXLA 2YU7A 2HMHA 1A07A 2DLZA 1RPYA 2ECDA 1PICA 2H46E 1FBZA 1FBVA 2EYVA 4DGPA 1AYDA 5EG3B 1O47A 1R1QA 3T04A 1HCTB 2MRJA 3BUNB 3VRYA 1O4FA 3VRZA 2RMXA 2L6KA 1A08A 3C7IA 5EEQA 1FU6A 3S8NA 2HDVA 1FYRA 4OHEA 2AUGA 4E68A 2L3TA 1F2FA 1O4MA 4K44A 5J3XA 1JYQA 3N84A 1QCFA 4EIHA 2HUWA 3PSJA 2DLYA 2LCTA 1R1PA 3HHMB 2EYYA 3IN7A 1O42A 3EACA 4X6SA 2EO6A 2SRCA 1BHHB 1GRIA 1H9OA 1R1SA 3ZNIA 2CS0A 2KNOA 2LQNA 3K2MA 1O45A 5IBSA 4H34A 1O49A 1O4BA 3VROA 2MC1A 2Y3AB 2C0OA 1O43A 2KK6A 1JYUA 2C0IA 2AOAA 3HIZB 3VS0A 2PNBA 4TZIA 1O4GA 1MILA 5HKWA 2LNXA 3VRPA 3N8MA 2K7AB 5AULA 1OO4A 1Y57A 1B47A 1WQUA 5DC9A 2FO0A 2IZVA 1KA7A 5AXIA 3NHNA 1NZLA 1ZFPE 3VS6A 4JEGA 1AYBA 2DCRA 3WA4A 1JU5A 2FCIA 1A81A 2C9WA 1QADA 1AOTF 1LKKA 3M7FA 1Z3KA 1YVHA 2EL8A 5EHPA 1O4LA 1SHDA 4GWFA 3PJPA 4DGXA 1KA6A 4NWGA 3PLFB 2YSXA 1UUSA 3GXXA 1O4NA 1D4TA 5CDWA 2ABLA 1O4QA 1XA6A 1O4PA 3TL0A 2SHPA 2OZOA 3BUXB 2Y1MA 4NWFA 2MRKA 1JYRA 5DC4A 2C0TA 1NZVA 4OHHA 1BM2A 3CBLA 1F1WA 1CSYA 1SHAA 2EOBA 2H5KA 3QWYA 1X0NA 1O41A 4GL9E 3MAZA 1I3ZA 3VRQA 5BO4A 3TKZA 1O4HA 1TZEE 3CWGA 2HCKA 2VIFA 1CWEA 3IMJA 1CWDL 1LUNA 2CR4A 2EU0A 4QSYA 3OVEA 1P13A 2EO3A 1JWOA 2PNAA 5HKZA 5KAZA 5HKYA 4XZ1A 1SKJA 3S9KA 4F59A 2Y1NA 2LNWA 1O4OA 1AYCA 1IJRA 2MQIA 3VRRA 1BLKA 4GPLB 3KFJA 4EY0A 1TCEA 4K45A 3VS4A 2OQ1A 5DF6A 1BG1A 1BKMA 4P9VA 1OO3A 5EHRA 2CBLA 4FBNA 1M27A 3VS5A 4P9ZA 4ROJA 1FHSA 1K9AA 1O46A 1BFJA 2IUIA 1HCSB 3BKBA 4XZ0A 4OHIA 5GJIA 4K11A 2RSYA 3OB2B 3BUMB 5I6VA 3GXWA 1BKLA 1FU5A 3GQIB 3MXYA 2CI8A 2IUHA 3VS2A 1O48A 3IMDA 2DVJA 3PFVA 1X27A 3IN8A 1BF5A 3OV1A 2ETZA 1BFIA 1M61A 1A1EA 1O4AA 3BUOB 2AOBA 2BBUA 1CJ1A 3MXCA 4FL3A 2DX0A 1G83A 1SPSA 1CSZA 3BUWB 3CD3A 1RJAA 1LUMA 2L4KA 3N7YA 3VS3A 2CRHA 5GJHA 1LCKA 3EAZA 1LKLA 1SPRA 1KC2A 3PSKA 4F5BA 2MK2A 1UURA 4A4BA 1O4RA 3UYOA 1OPLA 4JE4A 1O4IA 4L1BB 1BHFA 2QMSA 1A09A 1LUIA 4OHLA 3QWXX 1BLJA 3VGOA 4E93A 1KSWA 1LCJA 4OHDA 4U1PA 3VS1A 1O4KA 3PS5A 3S8LA 1O4CA 2XP1A 5IBMA 4FL2A 5EELA 2LQWA 1IS0A 1SHBA 1AOUF 2RORA 1GHUA 2CIAA 1NRVA 1D1ZA 2JYQA 3UF4A 2PLEA 1O4EA 4H1OA 4M4ZA 3S8OA 1YVLA 3HCKA 1Y1UA 2DM0A 2K79B 4U17A 2B3OA 1A1BA 2EKXA 3OP0A 4F5AA 4JGHA 1BMBA 3US4A 3VS7A 1MW4A 1O4JA 1A1CA 1OPKA 1QG1E 1X6CA 5DC0B 2CI9A 4A4CA 4LUDA 1RQQC 3PQZA 2H8HA 4K2RA 2EYZA 2GSBA 2HDXA 1BHHA 4WWQA 1AB2A 1AYAA 4D8KA 1D4WA 2PLDA 1A1AA 2IUGA 5D0JA 2PTKA 3VRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FMK A;  1AD5 A;  1O44 A;  2GE9 A;  2RVF A;  1O4D A;  3OB1 B;  1LUK A;  4LUE A;  3CXL A;  2YU7 A;  2HMH A;  1A07 A;  2DLZ A;  1RPY A;  2ECD A;  1PIC A;  2H46 E;  1FBZ A;  1FBV A;  2EYV A;  4DGP A;  1AYD A;  5EG3 B;  1O47 A;  1R1Q A;  3T04 A;  1HCT B;  2MRJ A;  3BUN B;  3VRY A;  1O4F A;  3VRZ A;  2RMX A;  2L6K A;  1A08 A;  3C7I A;  5EEQ A;  1FU6 A;  3S8N A;  2HDV A;  1FYR A;  4OHE A;  2AUG A;  4E68 A;  2L3T A;  1F2F A;  1O4M A;  4K44 A;  5J3X A;  1JYQ A;  3N84 A;  1QCF A;  4EIH A;  2HUW A;  3PSJ A;  2DLY A;  2LCT A;  1R1P A;  3HHM B;  2EYY A;  3IN7 A;  1O42 A;  3EAC A;  4X6S A;  2EO6 A;  2SRC A;  1BHH B;  1GRI A;  1H9O A;  1R1S A;  3ZNI A;  2CS0 A;  2KNO A;  2LQN A;  3K2M A;  1O45 A;  5IBS A;  4H34 A;  1O49 A;  1O4B A;  3VRO A;  2MC1 A;  2Y3A B;  2C0O A;  1O43 A;  2KK6 A;  1JYU A;  2C0I A;  2AOA A;  3HIZ B;  3VS0 A;  2PNB A;  4TZI A;  1O4G A;  1MIL A;  5HKW A;  2LNX A;  3VRP A;  3N8M A;  2K7A B;  5AUL A;  1OO4 A;  1Y57 A;  1B47 A;  1WQU A;  5DC9 A;  2FO0 A;  2IZV A;  1KA7 A;  5AXI A;  3NHN A;  1NZL A;  1ZFP E;  3VS6 A;  4JEG A;  1AYB A;  2DCR A;  3WA4 A;  1JU5 A;  2FCI A;  1A81 A;  2C9W A;  1QAD A;  1AOT F;  1LKK A;  3M7F A;  1Z3K A;  1YVH A;  2EL8 A;  5EHP A;  1O4L A;  1SHD A;  4GWF A;  3PJP A;  4DGX A;  1KA6 A;  4NWG A;  3PLF B;  2YSX A;  1UUS A;  3GXX A;  1O4N A;  1D4T A;  5CDW A;  2ABL A;  1O4Q A;  1XA6 A;  1O4P A;  3TL0 A;  2SHP A;  2OZO A;  3BUX B;  2Y1M A;  4NWF A;  2MRK A;  1JYR A;  5DC4 A;  2C0T A;  1NZV A;  4OHH A;  1BM2 A;  3CBL A;  1F1W A;  1CSY A;  1SHA A;  2EOB A;  2H5K A;  3QWY A;  1X0N A;  1O41 A;  4GL9 E;  3MAZ A;  1I3Z A;  3VRQ A;  5BO4 A;  3TKZ A;  1O4H A;  1TZE E;  3CWG A;  2HCK A;  2VIF A;  1CWE A;  3IMJ A;  1CWD L;  1LUN A;  2CR4 A;  2EU0 A;  4QSY A;  3OVE A;  1P13 A;  2EO3 A;  1JWO A;  2PNA A;  5HKZ A;  5KAZ A;  5HKY A;  4XZ1 A;  1SKJ A;  3S9K A;  4F59 A;  2Y1N A;  2LNW A;  1O4O A;  1AYC A;  1IJR A;  2MQI A;  3VRR A;  1BLK A;  4GPL B;  3KFJ A;  4EY0 A;  1TCE A;  4K45 A;  3VS4 A;  2OQ1 A;  5DF6 A;  1BG1 A;  1BKM A;  4P9V A;  1OO3 A;  5EHR A;  2CBL A;  4FBN A;  1M27 A;  3VS5 A;  4P9Z A;  4ROJ A;  1FHS A;  1K9A A;  1O46 A;  1BFJ A;  2IUI A;  1HCS B;  3BKB A;  4XZ0 A;  4OHI A;  5GJI A;  4K11 A;  2RSY A;  3OB2 B;  3BUM B;  5I6V A;  3GXW A;  1BKL A;  1FU5 A;  3GQI B;  3MXY A;  2CI8 A;  2IUH A;  3VS2 A;  1O48 A;  3IMD A;  2DVJ A;  3PFV A;  1X27 A;  3IN8 A;  1BF5 A;  3OV1 A;  2ETZ A;  1BFI A;  1M61 A;  1A1E A;  1O4A A;  3BUO B;  2AOB A;  2BBU A;  1CJ1 A;  3MXC A;  4FL3 A;  2DX0 A;  1G83 A;  1SPS A;  1CSZ A;  3BUW B;  3CD3 A;  1RJA A;  1LUM A;  2L4K A;  3N7Y A;  3VS3 A;  2CRH A;  5GJH A;  1LCK A;  3EAZ A;  1LKL A;  1SPR A;  1KC2 A;  3PSK A;  4F5B A;  2MK2 A;  1UUR A;  4A4B A;  1O4R A;  3UYO A;  1OPL A;  4JE4 A;  1O4I A;  4L1B B;  1BHF A;  2QMS A;  1A09 A;  1LUI A;  4OHL A;  3QWX X;  1BLJ A;  3VGO A;  4E93 A;  1KSW A;  1LCJ A;  4OHD A;  4U1P A;  3VS1 A;  1O4K A;  3PS5 A;  3S8L A;  1O4C A;  2XP1 A;  5IBM A;  4FL2 A;  5EEL A;  2LQW A;  1IS0 A;  1SHB A;  1AOU F;  2ROR A;  1GHU A;  2CIA A;  1NRV A;  1D1Z A;  2JYQ A;  3UF4 A;  2PLE A;  1O4E A;  4H1O A;  4M4Z A;  3S8O A;  1YVL A;  3HCK A;  1Y1U A;  2DM0 A;  2K79 B;  4U17 A;  2B3O A;  1A1B A;  2EKX A;  3OP0 A;  4F5A A;  4JGH A;  1BMB A;  3US4 A;  3VS7 A;  1MW4 A;  1O4J A;  1A1C A;  1OPK A;  1QG1 E;  1X6C A;  5DC0 B;  2CI9 A;  4A4C A;  4LUD A;  1RQQ C;  3PQZ A;  2H8H A;  4K2R A;  2EYZ A;  2GSB A;  2HDX A;  1BHH A;  4WWQ A;  1AB2 A;  1AYA A;  4D8K A;  1D4W A;  2PLD A;  1A1A A;  2IUG A;  5D0J A;  2PTK A;  3VRN A; 
#chains in the Genus database with same CATH topology
 1FMK A;  1AD5 A;  1O44 A;  2GE9 A;  2RVF A;  1O4D A;  3OB1 B;  1LUK A;  4LUE A;  3CXL A;  2YU7 A;  2HMH A;  1A07 A;  2DLZ A;  1RPY A;  2ECD A;  1PIC A;  2H46 E;  1FBZ A;  1FBV A;  2EYV A;  4DGP A;  1AYD A;  5EG3 B;  1O47 A;  1R1Q A;  3T04 A;  1HCT B;  2MRJ A;  3BUN B;  3VRY A;  1O4F A;  3VRZ A;  2RMX A;  2L6K A;  1A08 A;  3C7I A;  5EEQ A;  1FU6 A;  3S8N A;  2HDV A;  1FYR A;  4OHE A;  2AUG A;  4E68 A;  2L3T A;  1F2F A;  1O4M A;  4K44 A;  5J3X A;  1JYQ A;  3N84 A;  1QCF A;  4EIH A;  2HUW A;  3PSJ A;  2DLY A;  2LCT A;  1R1P A;  3HHM B;  2EYY A;  3IN7 A;  1O42 A;  3EAC A;  4X6S A;  2EO6 A;  2SRC A;  1BHH B;  1GRI A;  1H9O A;  1R1S A;  3ZNI A;  2CS0 A;  2KNO A;  2LQN A;  3K2M A;  1O45 A;  5IBS A;  4H34 A;  1O49 A;  1O4B A;  3VRO A;  2MC1 A;  2Y3A B;  2C0O A;  1O43 A;  2KK6 A;  1JYU A;  2C0I A;  2AOA A;  3HIZ B;  3VS0 A;  2PNB A;  4TZI A;  1O4G A;  1MIL A;  5HKW A;  2LNX A;  3VRP A;  3N8M A;  2K7A B;  5AUL A;  1OO4 A;  1Y57 A;  1B47 A;  1WQU A;  5DC9 A;  2FO0 A;  2IZV A;  1KA7 A;  5AXI A;  3NHN A;  1NZL A;  1ZFP E;  3VS6 A;  4JEG A;  1AYB A;  2DCR A;  3WA4 A;  1JU5 A;  2FCI A;  1A81 A;  2C9W A;  3K2T A;  1QAD A;  1AOT F;  1LKK A;  3M7F A;  1Z3K A;  1YVH A;  2EL8 A;  5EHP A;  1O4L A;  1SHD A;  4GWF A;  3PJP A;  4DGX A;  1KA6 A;  4NWG A;  3PLF B;  2YSX A;  1UUS A;  3GXX A;  1O4N A;  1D4T A;  5CDW A;  2ABL A;  1O4Q A;  1XA6 A;  1O4P A;  3TL0 A;  2SHP A;  2OZO A;  3BUX B;  2Y1M A;  4NWF A;  2MRK A;  1JYR A;  5DC4 A;  2C0T A;  1NZV A;  4OHH A;  1BM2 A;  3CBL A;  1F1W A;  1CSY A;  1SHA A;  2EOB A;  2H5K A;  3QWY A;  1X0N A;  1O41 A;  4GL9 E;  3MAZ A;  1I3Z A;  3VRQ A;  5BO4 A;  3TKZ A;  1O4H A;  1TZE E;  3CWG A;  2HCK A;  2VIF A;  1CWE A;  3IMJ A;  1CWD L;  1LUN A;  2CR4 A;  2EU0 A;  4QSY A;  2KGY A;  3OVE A;  1P13 A;  2EO3 A;  1JWO A;  2PNA A;  5HKZ A;  5KAZ A;  5HKY A;  4XZ1 A;  1SKJ A;  3S9K A;  4F59 A;  2Y1N A;  2LNW A;  1O4O A;  1AYC A;  1IJR A;  2MQI A;  3VRR A;  1BLK A;  4GPL B;  3KFJ A;  4EY0 A;  1TCE A;  4K45 A;  3VS4 A;  2OQ1 A;  5DF6 A;  1BG1 A;  1BKM A;  4P9V A;  1OO3 A;  5EHR A;  2CBL A;  4FBN A;  1M27 A;  3VS5 A;  4P9Z A;  4ROJ A;  1FHS A;  1K9A A;  1O46 A;  3LYV A;  1BFJ A;  2IUI A;  1HCS B;  2LRA A;  3BKB A;  4XZ0 A;  4OHI A;  5GJI A;  4K11 A;  2RSY A;  3OB2 B;  3BUM B;  5I6V A;  3GXW A;  1BKL A;  1FU5 A;  3GQI B;  3MXY A;  2CI8 A;  2IUH A;  3VS2 A;  1O48 A;  3IMD A;  2DVJ A;  3PFV A;  1X27 A;  3IN8 A;  1BF5 A;  3OV1 A;  2ETZ A;  1BFI A;  1M61 A;  1A1E A;  1O4A A;  3BUO B;  2AOB A;  2BBU A;  1CJ1 A;  3MXC A;  4FL3 A;  2DX0 A;  1G83 A;  1SPS A;  1CSZ A;  3BUW B;  3CD3 A;  1RJA A;  1LUM A;  2L4K A;  3N7Y A;  3VS3 A;  2CRH A;  5GJH A;  1LCK A;  3EAZ A;  1LKL A;  1SPR A;  1KC2 A;  3PSK A;  4F5B A;  2MK2 A;  1UUR A;  4A4B A;  1O4R A;  3UYO A;  1OPL A;  4JE4 A;  1O4I A;  4L1B B;  1BHF A;  2QMS A;  1A09 A;  1LUI A;  4OHL A;  3QWX X;  1BLJ A;  3VGO A;  4E93 A;  1KSW A;  1LCJ A;  4OHD A;  4U1P A;  3VS1 A;  1O4K A;  3PS5 A;  3S8L A;  1O4C A;  2XP1 A;  5IBM A;  4FL2 A;  5EEL A;  2LQW A;  1IS0 A;  1SHB A;  1AOU F;  2ROR A;  1GHU A;  2CIA A;  1NRV A;  1D1Z A;  2JYQ A;  3UF4 A;  2PLE A;  1O4E A;  4H1O A;  4M4Z A;  3S8O A;  1YVL A;  3HCK A;  1Y1U A;  2DM0 A;  2K79 B;  4U17 A;  2B3O A;  1A1B A;  2EKX A;  3OP0 A;  4F5A A;  4JGH A;  1BMB A;  3US4 A;  3VS7 A;  1MW4 A;  1O4J A;  1A1C A;  1OPK A;  1QG1 E;  1X6C A;  5DC0 B;  2CI9 A;  4A4C A;  4LUD A;  1RQQ C;  3PQZ A;  2H8H A;  4K2R A;  2EYZ A;  2GSB A;  2HDX A;  1BHH A;  4WWQ A;  1AB2 A;  1AYA A;  4D8K A;  1D4W A;  2PLD A;  1A1A A;  2IUG A;  5D0J A;  2PTK A;  3VRN A; 
#chains in the Genus database with same CATH homology
 1FMK A;  1AD5 A;  1O44 A;  2GE9 A;  2RVF A;  1O4D A;  3OB1 B;  1LUK A;  4LUE A;  3CXL A;  2YU7 A;  2HMH A;  1A07 A;  2DLZ A;  1RPY A;  2ECD A;  1PIC A;  2H46 E;  1FBZ A;  1FBV A;  2EYV A;  4DGP A;  1AYD A;  5EG3 B;  1O47 A;  1R1Q A;  3T04 A;  1HCT B;  2MRJ A;  3BUN B;  3VRY A;  1O4F A;  3VRZ A;  2RMX A;  2L6K A;  1A08 A;  3C7I A;  5EEQ A;  1FU6 A;  3S8N A;  2HDV A;  1FYR A;  4OHE A;  2AUG A;  4E68 A;  2L3T A;  1F2F A;  1O4M A;  4K44 A;  5J3X A;  1JYQ A;  3N84 A;  1QCF A;  4EIH A;  2HUW A;  3PSJ A;  2DLY A;  2LCT A;  1R1P A;  3HHM B;  2EYY A;  3IN7 A;  1O42 A;  3EAC A;  4X6S A;  2EO6 A;  2SRC A;  1BHH B;  1GRI A;  1H9O A;  1R1S A;  3ZNI A;  2CS0 A;  2KNO A;  2LQN A;  3K2M A;  1O45 A;  5IBS A;  4H34 A;  1O49 A;  1O4B A;  3VRO A;  2MC1 A;  2Y3A B;  2C0O A;  1O43 A;  2KK6 A;  1JYU A;  2C0I A;  2AOA A;  3HIZ B;  3VS0 A;  2PNB A;  4TZI A;  1O4G A;  1MIL A;  5HKW A;  2LNX A;  3VRP A;  3N8M A;  2K7A B;  5AUL A;  1OO4 A;  1Y57 A;  1B47 A;  1WQU A;  5DC9 A;  2FO0 A;  2IZV A;  1KA7 A;  5AXI A;  3NHN A;  1NZL A;  1ZFP E;  3VS6 A;  4JEG A;  1AYB A;  2DCR A;  3WA4 A;  1JU5 A;  2FCI A;  1A81 A;  2C9W A;  1QAD A;  1AOT F;  1LKK A;  3M7F A;  1Z3K A;  1YVH A;  2EL8 A;  5EHP A;  1O4L A;  1SHD A;  4GWF A;  3PJP A;  4DGX A;  1KA6 A;  4NWG A;  3PLF B;  2YSX A;  1UUS A;  3GXX A;  1O4N A;  1D4T A;  5CDW A;  2ABL A;  1O4Q A;  1XA6 A;  1O4P A;  3TL0 A;  2SHP A;  2OZO A;  3BUX B;  2Y1M A;  4NWF A;  2MRK A;  1JYR A;  5DC4 A;  2C0T A;  1NZV A;  4OHH A;  1BM2 A;  3CBL A;  1F1W A;  1CSY A;  1SHA A;  2EOB A;  2H5K A;  3QWY A;  1X0N A;  1O41 A;  4GL9 E;  3MAZ A;  1I3Z A;  3VRQ A;  5BO4 A;  3TKZ A;  1O4H A;  1TZE E;  3CWG A;  2HCK A;  2VIF A;  1CWE A;  3IMJ A;  1CWD L;  1LUN A;  2CR4 A;  2EU0 A;  4QSY A;  3OVE A;  1P13 A;  2EO3 A;  1JWO A;  2PNA A;  5HKZ A;  5KAZ A;  5HKY A;  4XZ1 A;  1SKJ A;  3S9K A;  4F59 A;  2Y1N A;  2LNW A;  1O4O A;  1AYC A;  1IJR A;  2MQI A;  3VRR A;  1BLK A;  4GPL B;  3KFJ A;  4EY0 A;  1TCE A;  4K45 A;  3VS4 A;  2OQ1 A;  5DF6 A;  1BG1 A;  1BKM A;  4P9V A;  1OO3 A;  5EHR A;  2CBL A;  4FBN A;  1M27 A;  3VS5 A;  4P9Z A;  4ROJ A;  1FHS A;  1K9A A;  1O46 A;  1BFJ A;  2IUI A;  1HCS B;  3BKB A;  4XZ0 A;  4OHI A;  5GJI A;  4K11 A;  2RSY A;  3OB2 B;  3BUM B;  5I6V A;  3GXW A;  1BKL A;  1FU5 A;  3GQI B;  3MXY A;  2CI8 A;  2IUH A;  3VS2 A;  1O48 A;  3IMD A;  2DVJ A;  3PFV A;  1X27 A;  3IN8 A;  1BF5 A;  3OV1 A;  2ETZ A;  1BFI A;  1M61 A;  1A1E A;  1O4A A;  3BUO B;  2AOB A;  2BBU A;  1CJ1 A;  3MXC A;  4FL3 A;  2DX0 A;  1G83 A;  1SPS A;  1CSZ A;  3BUW B;  3CD3 A;  1RJA A;  1LUM A;  2L4K A;  3N7Y A;  3VS3 A;  2CRH A;  5GJH A;  1LCK A;  3EAZ A;  1LKL A;  1SPR A;  1KC2 A;  3PSK A;  4F5B A;  2MK2 A;  1UUR A;  4A4B A;  1O4R A;  3UYO A;  1OPL A;  4JE4 A;  1O4I A;  4L1B B;  1BHF A;  2QMS A;  1A09 A;  1LUI A;  4OHL A;  3QWX X;  1BLJ A;  3VGO A;  4E93 A;  1KSW A;  1LCJ A;  4OHD A;  4U1P A;  3VS1 A;  1O4K A;  3PS5 A;  3S8L A;  1O4C A;  2XP1 A;  5IBM A;  4FL2 A;  5EEL A;  2LQW A;  1IS0 A;  1SHB A;  1AOU F;  2ROR A;  1GHU A;  2CIA A;  1NRV A;  1D1Z A;  2JYQ A;  3UF4 A;  2PLE A;  1O4E A;  4H1O A;  4M4Z A;  3S8O A;  1YVL A;  3HCK A;  1Y1U A;  2DM0 A;  2K79 B;  4U17 A;  2B3O A;  1A1B A;  2EKX A;  3OP0 A;  4F5A A;  4JGH A;  1BMB A;  3US4 A;  3VS7 A;  1MW4 A;  1O4J A;  1A1C A;  1OPK A;  1QG1 E;  1X6C A;  5DC0 B;  2CI9 A;  4A4C A;  4LUD A;  1RQQ C;  3PQZ A;  2H8H A;  4K2R A;  2EYZ A;  2GSB A;  2HDX A;  1BHH A;  4WWQ A;  1AB2 A;  1AYA A;  4D8K A;  1D4W A;  2PLD A;  1A1A A;  2IUG A;  5D0J A;  2PTK A;  3VRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...