4M4ZA

Sh3 and sh2 domains of human src-like adaptor protein 2 (slap2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
152
Chain Sequence
TAVALGSFPLSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src-like-adapter 2
publication title Crystal structure of Src-like adaptor protein 2 reveals close association of SH3 and SH2 domains through beta-sheet formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 36
structure length 152
sequence length 158
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4m4zA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4m4zA02
2XMFA 2O9VA 2E5KA 2BZ8A 5EHRA 1VYVA 4EIKA 1ABOA 2GSBA 1FYRA 4OMPA 5IBMA 1I3ZA 1AYBA 2DL4A 3PSKA 1M30A 2DX0A 1A09A 2RQVA 3VRPA 2YUNA 1W1FA 1SSHA 4ORZA 3VS4A 1QCFA 1YNZA 1WQUA 3ZNIA 3IMJA 3S8OA 2OAWA 3VGOA 1CSYA 2DL8A 2FPDA 4HXJA 4F17A 2JYQA 1GCQA 1O4CA 2EW3A 1OPKA 4HVWA 3UYOA 2DRMA 2HEQA 1CSKA 3R6NA 4CC7A 1KC2A 3VS2A 2XP1A 2C0TA 3GBQA 2MRKA 1UURA 4A4CA 1O4FA 1WYXA 2Y3AB 3EACA 1BLJA 2MOXA 4HVUA 2CSQA 1RLPC 2EU0A 3I9QA 3IN8A 4Y92A 1K0XA 1A1CA 1Y1UA 4U1PA 3M0QA 3O5ZA 3VS5A 3KFJA 2W10A 3OVEA 1CKBA 1YN8A 1O4QA 3MXYA 3RNJA 4K2RA 4E93A 4XZ0A 2KK6A 5KAZA 1BKLA 1V1CA 4AG2C 2K6DA 2EVRA 1X0NA 3QWYA 4K44A 4FL3A 4J9HA 3SHWA 1NEGA 1LUNA 1O4KA 1NLOC 2EYWA 1O4DA 2W0ZA 3VS6A 2CSIA 4LUEA 1F1WA 2AOBA 3OB2B 1OOTA 2DILA 3PVQA 4IIMA 1AOTF 2GNCA 5FWCA 3GQIB 5AXIA 2K79A 1UGVA 2GTOA 1PKSA 3REAB 2QDLA 1JXMA 1M3BA 1JYRA 5GJIA 2KROA 2MIOA 3S9KA 2LNXA 2CREA 3UA6A 2AKKA 1J3TA 4FSSA 2HCKA 1FBVA 2HDXA 3A98A 3BUWB 5FWBA 4D8KA 1CKAA 1NM7A 3VRRA 1ZFPE 5I22A 1O4MA 5L23A 1O4IA 1F2FA 1AVZC 2RVFA 4RTTA 1CWEA 3C7IA 3HHMB 3VRQA 4TZIA 5IHNA 1I0CA 2RN8A 4LN2A 1YWPA 2EYVA 1AWJA 4CC4B 1GBQA 2GQIA 1CWDL 2J06A 1ARKA 1KSWA 2LZ6B 1QWFA 1WLPB 3M0TA 4J9FA 1O43A 2KT1A 2ECDA 2HMHA 2ED0A 1AYDA 1QKWA 2ROLA 2DM1A 2C0OA 1GCQC 3EGUA 2L3PA 4X6SA 1SRMA 5I11A 4LNPA 2L3QA 1AYAA 3VRYA 2CS0A 5IXFA 1H9OA 2HUWA 1O4EA 1FYNA 2D0NA 2RPNA 2JTEA 3M0RA 1BB9A 4OHLA 1UTIA 2PNAA 2KRMA 1BHHB 5IXBA 2CR4A 1R1SA 5HKWA 3JV3A 1EFNA 4OHEA 1K76A 1ZUKA 1WXTA 1WIEA 3H0IA 2LJ0A 1W70A 2M51A 1O4PA 2BBUA 2LP5A 3M7FA 1FBZA 2D8JA 1Z9QA 3M0SA 1D4WA 2VIFA 1AZGB 1AOUF 3SEMA 5I6VA 2OI3A 1PHTA 3CD3A 3N84A 2P4RA 1A0NB 2LQWA 4JE4A 1O4BA 2DJQA 2RQTA 1JXOA 4JJDA 1K4US 4EIHA 2DNUA 1B07A 3UA7A 2C9WA 4RTUA 2NWMA 1TUDA 1BHFA 1HCSB 1R1PA 1O4OA 1AYCA 2CBLA 4GBQA 2FPFA 1NEBA 3TL0A 1AEYA 3EHRA 1A1AA 1U3OA 1PWTA 2A28A 3GXWA 1GCPA 4J9DA 5AULA 2FRYA 2AZVA 2IUGA 2L6KA 1G83A 4RTVA 2KXDA 1W6XA 4DEXA 4DEYA 1O4LA 2YU7A 1WA7A 1X27A 3LH5A 1KJWA 1NG2A 1AWWA 4P9ZA 1RJAA 1H92A 1A07A 2MC1A 1GFCA 1O49A 5FW9A 1OO4A 4OHDA 2MCNA 2Y1NA 1M8MA 1X2QA 3K2MA 2DLYA 1YP5A 1QWEA 2CT4A 1SHFA 1T3LA 2RMOA 5EC7A 2VKNA 1WX6A 2FG0A 1JQQA 1UE9A 3N7YA 2GTJA 2J05A 1KA6A 1TCEA 4F5BA 1O4AA 1YVHA 3BUOB 1ZX6A 1A81A 1KIKA 1PKTA 1WDXA 2L3SA 2BZYA 2YDLA 2KRNA 4GPLB 2ROTA 1BU1A 2LCTA 2CUDA 4R0KA 1OV3A 1ZSGA 1TZEE 2K7AB 3PFVA 2KNBB 2JMCA 2V1QA 3UATA 2J6FA 4XZ1A 1BFJA 2ENMA 1BMBA 2DVJA 1E6HA 2L3TA 1BFIA 2AOAA 2DL7A 1FMKA 2JM9A 2JXBA 2X3WD 2B86A 1FU6A 2IIMA 3KFVA 2KE9A 2RORA 2EGCA 1UHFA 1GL5A 1UJ0A 1SPRA 2KRSA 1O4HA 3T04A 3OP0A 2L0AA 2FPEA 2RF0A 2PNIA 4F5AA 2EYYA 3M0PA 3OV1A 1BHHA 4OHHA 2O9SA 1B3QA 1OEBA 1T0HA 2OJ2A 4ESRA 1U06A 1JEGA 1JYUA 1LCJA 4D8DA 1JO8A 2IUIA 3TKZA 2KNOA 1QLYA 1M3AA 1TUCA 3EG0A 3PE0A 1BK2A 4OHIA 1O4RA 2DLPA 1BG1A 1NZVA 1K9AA 2KYBA 1E6GA 1JWOA 2DE0X 1PICA 4RTXA 1BKMA 1X69A 1O46A 2L4KA 4H34A 2AK5A 1UUEA 2KYMA 4JJBA 5DF6A 1O4NA 1BM2A 1LUKA 5ECAA 1SPKA 1UDLA 1MILA 3I35A 2MQIA 4QT7A 1N5ZA 1UUSA 3BUNB 1NZLA 1WXBA 1ZLMA 1QKXA 1JU5C 2M0YA 2RMXA 4NWGA 1SHDA 2DBKA 2RQUA 3OB1B 4GLMA 4J9EA 2CIAA 3CXLA 5HKZA 1ZUUA 2JW4A 1GRIA 2J6OA 3IQLA 2K2MA 4JEGA 4QSYA 1WXUA 2VVKA 3QWXX 1NYGA 1VA7A 2KBTA 5IH2A 1AWXA 1RUWA 2DL5A 1YWOA 1MUZA 1PRLC 2KT8A 1X6CA 4L1BB 3NMZC 1X43A 2LCSA 2LJ3A 4F14A 2JS2A 1QG1E 1SHAA 2FO0A 1OPLA 4GL9E 3THKA 3CQTA 4A4BA 1UG1A 4HVVA 2Y1MA 4NWFA 2HDAA 1O42A 4F16A 1OO3A 2RQWA 2YUOA 2A37A 1NYFA 2ED1A 1KA7A 2HSPA 3US4A 2DRKA 3TSZA 3VRNA 3C0CA 1H3HA 5IHKA 3EAZA 1K0SA 1IO6A 4AFSC 3PLFB 4FBNA 2YUQA 2PLEA 2EGEA 5GJWB 2DCRA 3I5RA 2EYZA 1AZEA 2K7AA 3VROA 1CSZA 3NPFA 3REBB 2DMOA 3VS0A 2CH4W 1U5SA 1BF5A 2ECZA 2EGAA 1SRLA 1UFFA 1MW4A 1RPYA 1CJ1A 2YSXA 2FRWA 1Z3KA 1R1QA 3VS1A 3PJPA 1WFWA 1TG0A 3BKBA 1JYQA 5DC9A 1M61A 1RLQC 2KXCA 4AFQC 1JU5A 4K11A 3VRZA 3ULRB 1LUMA 1GBRA 1E7OA 1RI9A 2D1XA 1D1ZA 2OQ1A 4JGHA 1Y57A 2EBPA 1O4JA 2D8HA 4J9GA 2CDTA 3N8MA 4WCIA 5IHIA 1Z9ZA 2VWFA 1A1BA 1G2BA 3RBBB 2F2VA 1K1ZA 3EG1A 2J6KA 2FEIA 4AFUC 4GWFA 1AD5A 1M27C 2EL8A 4RTZA 1BLKA 1B47A 2F2WA 1BBZA 2PNBA 1M3CA 4AG1C 4OMLA 3H0FA 4Z89A 1HJDA 4LUDA 1A1EA 3NGPA 1O45A 3ZL7C 3TSWA 1AOJA 2CI8A 1O4GA 2ETZA 3UF4A 4A63B 4J9CA 4OMMA 1T0JA 5IBSA 1SPSA 2OZOA 1PRMC 1UECA 2LX7A 5EG3B 2BZXA 1NLPC 4KRTA 1X2KA 2CI9A 2GE9A 1RQQC 4LE9A 3I5SA 2PTKA 1P13A 2F2XA 2IUHA 1AB2A 2O2OA 2QMSA 2O88A 2CH4A 2ABLA 2J7IA 4Z8AA 3U23A 3EG2A 3IMDA 1XOVA 2AZSA 4JPBW 3MAZA 2DX1A 4DGXA 2HBWA 2A08A 2DLZA 2EKXA 2PLDA 2EOBA 2JMAA 1ZBJA 3PSJA 2JM8A 3VS3A 1O41A 1T3SA 1FU5A 2FCIA 1MV3A 1X6GA 2I0NA 4IIOA 2IZVA 4OMNA 4K45A 3IN7A 2DYBA 2KGTA 2JT4A 1PNJA 2LMJA 2V1RA 5HCKA 1XA6A 2YT6A 2DA9A 1GHUA 3M0UA 2GBQA 4JZ4A 2LQNA 2EQIA 4WWQA 2KR3A 2EO3A 1HD3A 3HCKA 3HIZB 1IS0A 3CBLA 4OMQA 4RTWA 4M4ZA 1A08A 1X6BA 1AWOA 1KFZA 2LNWA 3CWGA 1NRVA 1LCKA 3FJ5A 4J9BA 3WA4A 1Y0MA 2EYXA 2G6FX 3VS7A 5CDWA 2L2PA 2RQRA 2RSYA 4FL2A 1M27A 4EY0A 2K3BA 4OMOA 2RNAA 2GGRA 5EHPA 1D4TA 2H46E 3TVTA 4F59A 4P9VA 1IJRA 3MXCA 2YUPA 3EG3A 2DBMA 1SHBA 2K9GA 4RUGA 4J9IA 1ZUYA 4ROJA 4E68A 1UJYA 2KEAA 1I1JA 3PQZA 1YCSB 2YSQA 1SEMA 2O31A 1O44A 2DM0A 3PVLA 5GJHA 2SHPA 2H8HA 2X3XD 2ESWA 1QADA 2AKLA 2K79B 2MRJA 4U17A 3H41A 2B3OA 5DC4A 3H0HA 2CRHA 1UHCA 1FHSA 3BUMB 5HKYA 5BO4A 1SKJA 2LNHB 4JJCA 2AUGA 1ABQA 4HCKA 4CC2A 1VYUA 3S8NA 2C0IA 2PZ1A 2BTTA 1VYTA 2SEMA 5D0JA 1S1NA 5EEQA 2CT3A 1LUIA 4RTYA 2A36A 2HDVA 2EO6A 2H5KA 1GFDA 3PS5A 1HCTB 1SHGA 1HSQA 3NHNA 4Z88A 1MV0B 4E6RA 4DGPA 3BUXB 2CUBA 1LKKA 2DL3A 5EELA 2LJ1A 4JZ3A 4AFZC 4X1VA 3EHQA 5GJVB 1WI7A 2NUZA 2DF6A 4H1OA 3GXXA 3S8LA 4CC3A 1O47A 1YVLA 5DC0B 2MK2A 1H8KA 2SRCA 2EPDA 1O48A 5J3XA 4ZNXA 1LKLA 1I07A 2JS0A 2EKHA
chains in the Genus database with same CATH superfamily
2XMFA 1JJ2S 2O9VA 3CCSQ 5EHRA 3G6EQ 1PG5B 3FIFA 5GANf 2DL4A 4M77A 3GLXA 2DX0A 3CC4T 1A09A 1PD0A 3VS4A 1WHGA 1YNZA 3S8OA 1PM3A 3I55Q 1RACB 2HMAA 2E70A 2P0KA 1B34A 4MZPA 1BI0A 2DRMA 3R6NA 3JB9I 3OYFA 1WYXA 2MOXA 3A8LB 2CSQA 3V8JA 2EU0A 4M7DF 3IN8A 4EMGA 4E7ZA 4U1PA 3O5ZA 1G5VA 5D6XA 2EAYA 1S72Q 4XZ0A 2VUBA 2M1HA 3TQ7P 1LUNA 3OB2B 2CSIA 1OOTA 3PVQA 1AOTF 5FWCA 5CKEA 1PKSA 3CC2T 1M90R 3BW1A 1JXMA 2NLUA 5CR2A 4C92B 4PJMA 1KD1R 3M53A 2KGYA 1WJSA 4FSSA 1VQ6Q 1CKAA 4XTVA 1Q81U 5CK9A 1TH7A 3LGFA 3VUZA 3VRRA 4RTTA 1WJQA 3C7IA 3VRQA 1UGSB 2P0PA 4LN2A 5GMKe 4CC4B 2D0QB 5CO7A 1BI3A 3F70A 2RA2A 4TVRA 3VV0A 1C0MA 2LZ6B 4IUTA 1FWZA 4J9FA 3QBYA 4N4GA 3PFSA 2KAFA 1X01A 4C5GA 2ED0A 1AYDA 3HFNA 2ROLA 4C5IA 2L3PA 4X6SA 1Y7XA 5I11A 2CS0A 3NTHA 5LJ3h 1O4EA 2D0NA 4FYXB 2X35A 2JTEA 3G1JA 3M0RA 1BB9A 3L2UA 1Q86R 1UTIA 4JRKA 2PQWA 2KRMA 3ER0A 4MDWA 1OX8A 1R1SA 2CR4A 3E1SA 4C8QC 4OHEA 3P8HA 1VQOT 2M51A 3CCLQ 2JOYA 3I56T 1Z9QA 2E64A 3M0SA 1AZGB 1K8AC 1G3TA 2LQWA 1RAHB 1UGPB 1HCSB 1R1PA 4OB0B 1AYCA 4M75F 2FPFA 3X20B 3JCMe 5KCHA 3TL0A 4BD3A 3GPLA 1PWTA 3GXWA 4LDVA 2FRYA 1Y96A 2L6KA 4Y28E 2KDSA 4DEYA 2YWWA 1I5LA 3H9NA 1FMVA 3LH5A 1NG2A 2LQKA 3UDCA 1OO4A 3SWNB 4C0DC 2H3JA 1M8MA 1X2QA 3CCRQ 2VYTA 1WQ7A 3HPWA 2CZ0B 5EC7A 1WX6A 1NBEB 4FT4A 4PJLA 2FG0A 3N7YA 2YRDA 2J05A 5GANh 3GNFB 3J81E 1D3BB 4FYYB 1O4AA 4ZTJA 4M75B 4RCBA 1KG1A 1KIKA 1WQWA 3GP8A 2XK0A 1BU1A 2LNVA 1O9SA 2PVOB 2G3RA 4HKEA 4LD9K 4R0KA 2COYA 2JMCA 3PIPA 1PCXA 3SFMA 3KBGA 3A1PA 4A53A 2L3TA 2JXBA 1QP3A 3ZBDA 4XTZA 3KFVA 3OYGA 3JB9H 3WXMB 1GL5A 2XI9A 2KRSA 2DERA 1BHHA 1B3QA 1OEBA 4BB7A 1ZSZB 4M7DE 1LCJA 1MMAA 2IUIA 1ZHIA 1VQ8A 3TKZA 4C92D 1QLYA 3HKSA 3PE0A 2DLPA 3A8GB 4EMKC 1UGRB 3CCUQ 3L2RA 2KYMA 3OSSC 2HQHA 1O4NA 1BM2A 1LUKA 5DF6A 5ECAA 2E41A 4PFOA 1MILA 1YJ9Q 4HCBA 4QT7A 4M7DG 2VGNA 1WXBA 1ZQ1A 1ZLMA 2RMXA 2MF2A 2RQUA 5KYXA 1ZUUA 2K2MA 3CCET 2DK3A 2XDBA 1NYGA 1VIFA 5IH2A 1AWXA 2DL5A 4FU6A 2KT8A 4OP0A 3E9GA 4L1BB 1QVFA 1QG1E 3OYYA 4N0AA 1TU0B 1OX9A 1UG1A 2RK1A 4HVVA 3OYLA 2FHDA 1O42A 3CBOA 2RQWA 5J3BA 2K2VA 1NYFA 2ED1A 1KA7A 2V8KA 4OMFB 3US4A 3VRNA 5FU7C 1YJNA 4BE0A 3GIBA 2VXEA 1IO6A 3OS2A 3HRTA 1NZ9A 3CMEA 2PLEA 3RDVA 2ZGWA 1M1KU 3I5RA 2K7AA 3MHXA 4BE1A 1JJ2P 5CKHA 1SRLA 1RPYA 5J26A 3CCJA 4OB1B 1WFWA 2O01E 2K5LA 3BKBA 1JYQA 2FZCB 1M61A 5DC9A 3CXCS 1JU5A 2XIDA 1YJWA 4Q5WA 2D1XA 2DZ9A 3PMTA 3HRUA 5GAOm 2DEUA 3ZEHA 4B6MA 2M0OA 1KQ1A 1Y57A 2VASA 2X51A 1M1KC 1O4JA 1KC8U 1XJWB 3OYKA 2CDTA 1YHQA 4M77F 5IHIA 3JAME 1SF9A 1G2BA 2P4TA 3INZA 1K1ZA 4M75E 1M27C 4R55A 3QDRB 4RTZA 3MPUB 2EL8A 4M75D 2PVGB 2F2WA 2PNBA 4AG1C 1HJDA 1LJOA 3LX7A 4RCCA 3CMAA 1A1EA 1Q7YU 1O45A 3ZL7C 2HZYA 4HCZA 3JCMQ 4OMMA 5IBSA 4XTYA 4M75G 3RR6A 2HKNA 1KHCA 4BDYA 4LDUA 3L2ZA 2LQ8A 2F2XA 2EQMA 3QKJA 2ABLA 2J7IA 3U23A 2RJEA 4M77B 5D6YA 5GAMe 1Q7YC 2PLDA 5J39A 2QEXT 2DXUA 5I2MA 1ZBJA 2ZZDA 3PSJA 3VYHB 3LH0A 1FU5A 4A4GA 1B34B 4IIOA 4K45A 3PIOA 1VQLT 2BKDN 2DYBA 2KGTA 1D0YA 3ZFJA 5HCKA 3RERA 2E4HA 2GF7A 2JTMA 2GBQA 4JZ4A 1OYXA 2E10A 3E2UA 5CVIA 1W2BP 3HCKA 4LDXA 3CBLA 4KH0B 3CCJQ 2G6FX 5CQYA 1N8RR 3RMSA 3DB4A 1M2VA 3KXTA 5DLQE 1VQ5Q 3V8LA 3MXCA 1IHWA 4KULA 3UT1A 4RUGA 4DBHA 2NYSA 1ZUYA 4J83A 1O44A 2O31A 5DLOA 3PVLA 2SHPA 2X3XD 2HL3A 5LJ5e 2X9HA 2MRJA 3H41A 5DC4A 2CRHA 3RMQA 4JJNK 5GMKj 4PKCC 1VYTA 1Q82R 1WJRA 1EIFA 1LUIA 3OS5A 4BACA 1GFDA 3CCVA 2DO3A 4E6RA 4C0DB 3BUXB 2CUBA 2QA4Q 1LKKA 2EQKA 4A4HA 4AFZC 4X1VA 2DF6A 3QG1A 4H1OA 3GXXA 3S8LA 3G4SQ 1O47A 2MK2A 3X25B 5J3XA 2BIVA 1LKLA 4F7UA 3JSCA 1Q81R 1BI2A 4X9CA 5DY9A 4FW2A 1NJIC 3PSKA 4M78C 2B8AA 2RQVA 4OB3B 3VGOA 3M56A 5HK3A 3OSVA 2JTFA 1VQMT 1GCQA 2EJGA 1O4CA 2RI2A 2EW3A 3UYOA 3HL8A 2HEQA 2PU9B 2XP1A 2C0TA 1U8RA 3OYAA 2DFUA 1BLJA 4HVUA 1EX4A 2LRQA 4KH1B 1A1CA 5KYUA 3M0QA 3GF5A 3OVEA 1CKBA 1YN8A 1YJNT 1O4QA 3MXYA 3CCQA 1VQPA 4E93A 1VQ4Q 1QQJA 3G71Q 2VXFA 5L8RE 1Y96B 3CMET 2ZCFB 4ZTFA 1D1BA 1NPPA 4JLIA 2W0ZA 3VS6A 4M77E 4FT2A 2DILA 2GNCA 3CCSA 5AXIA 3G6EA 3REAB 3CCMT 1U1TA 3DKMA 3BFMA 4WTOB 4M77D 1M3BA 1JYRA 5GJIA 1YITQ 2JNGA 2CREA 3OYDA 2AKKA 2X4JA 3I55A 1FBVA 2HDXA 3BUWB 5FWBA 3J80E 3JRZA 3V7SA 1ZFPE 2K57A 2LDMA 5L23A 3JCMc 2OTJQ 3CPFA 2RVFA 4M77G 2EFIA 1YHQT 3HHMB 2DYIA 2A3LA 5IHNA 1I0CA 1AWJA 1OQKA 4E7SA 1LNXA 2XHCA 1ARKA 1KQ2A 3M0TA 1O43A 1MMNA 4XK8E 1QKWA 4MDXA 1S72A 3LW5E 2C0OA 1GCQC 5FU7B 3L2VA 1SRMA 5KE2A 5IXFA 2QQSA 2HUWA 2K3XA 1D0XA 2FZKB 3CPWA 2QI2A 4OHLA 3QYGB 1BHHB 3OYMA 1EFNA 1RAFB 1WXTA 3H0IA 4BI8B 1O4PA 2LCCA 4QW2A 3M7FA 1FBZA 2D8JA 4JS4A 1KQSS 1VQ6A 3SEMA 3CD3A 3N84A 2YLBA 5CIUA 2ZPFB 2YRVA 3FRNA 3FC3A 1JXOA 2DNUA 3UA7A 2C9WA 1U1SA 2CBLA 1O4OA 3MO8A 1NEBA 1XTDA 2QGGA 2AZVA 5KYXB 3CXCP 2IUGA 4RTVA 1I81A 1RABB 1O4LA 3E19A 1R0CB 1RADB 1RAIB 2NUPA 1KJWA 3N5BB 1AWWA 1VQOQ 2MCNA 4XTWA 3EFOA 3SB2A 4RG8A 1YCYA 1QWEA 4ATOA 2RMOA 4C92F 1BCOA 1UE9A 4KBMB 2GTJA 3CCLA 1TCEA 5GAOq 4C8QA 3BUOB 4OB2B 4X34A 5GAN8 1A81A 3A8OB 4LD6A 1WDXA 1VQNQ 2BZYA 2YDLA 4B9XA 2KRNA 1I4K1 3CCVT 1OV3A 2K7AB 1TZEE 3PFVA 2KNBB 1QVPA 2RHYA 3UATA 3PGGA 4BY6C 1BFJA 4PJOC 1E6HA 2AOAA 2DL7A 2JM9A 2FVUA 1FU6A 2KE9A 2RORA 4Y91A 4DQ2A 2K4YA 5LJ3e 8ATCB 1SPRA 3T04A 1O4HA 3OP0A 5CQXA 1DJ7B 4OHHA 3CEYA 1T0HA 2E6NA 1R77A 1C6VX 1U06A 1PSEA 4FCYA 2MK5A 1JO8A 2ZPGB 1VIEA 1G3WA 2ZAEA 1TUCA 3CCRA 4M7AC 4PK4A 4NOYA 2R57A 2MPXC 1Q95G 1NZVA 2KYBA 4BI3A 3O8VA 1W2BS 1O46A 2L4KA 2AHJB 1AHJB 1UDLA 5GMKl 2F5TX 5KCOA 5CKFA 4QQ6A 2DD4A 4NWGA 3P8DA 1K8AU 4XTUA 5GAMj 2IG0A 4J9EA 5HKZA 2CP6A 2JW4A 2M16A 8AT1B 1GRIA 2MAMA 1VQ7A 3T9NA 1YI2Q 4XU0A 1YWOA 1MUZA 2XU8A 1X6CA 2COWA 2LJ3A 1SHAA 2KK4A 1M1FA 3CCST 3OW2P 2DZCA 2L3RA 2XD0A 4A4BA 4NWFA 2HDAA 2KMTA 5GANe 2YUOA 2A37A 2HSPA 4X9DA 3I55T 3M5AA 3PLFB 2I2LA 4FBNA 3CCUA 1UEBA 2EGEA 2DXTA 2HD0A 1QW1A 3FB9A 2EYZA 5LJ5j 1TTHB 2X4YA 4A4FA 1M2VB 3EG9A 1YJ9A 4EMKA 1CSZA 3CCEQ 4DBRA 3CBPA 3LWIA 1TG0A 3S3OA 3TEEA 3QSUA 2KXCA 4XTXA 4K11A 3VRZA 3ULRB 1S72T 1LUMA 1E7OA 3K2TA 2OQ1A 4F7UF 3L2QA 2D8HA 4EDUA 3RBBB 4J5YA 1BCMA 2FEIA 4AFUC 4GWFA 1AD5A 2XG8D 5D6WA 1VQ9Q 3L42A 2RB6A 3OYBA 1VQ6T 5KH6A 1VQ7Q 1AOJA 1T0JA 4A4KA 1SPSA 1PRMC 2LX7A 4F7UB 3MJXA 1X2KA 2HL5C 2HKQB 3UWNA 2RJCA 1RQQC 2A0FB 4C92E 2HQEA 2O2OA 3JCMb 3META 2CH4A 5FROA 1XOVA 3MAZA 4JPBW 1QVGA 4DGXA 2F5KA 2EKXA 4C0ZA 4UC4A 2EKOA 2JM8A 3VS3A 2EQJA 3NTIA 1O41A 2FCIA 4L59A 2I0NA 2IZVA 4OMNA 3OYNA 2LTOA 2LMJA 1XA6A 5KYWA 1GXIE 1K9MR 3X28B 1M1GA 4L5GA 3M0UA 3WVEB 4C92G 2EQIA 2JN0A 3OYIA 1HD3A 5KYUB 2QDYB 1IS0A 1WPYA 4J9BA 1VQKQ 3WA4A 1Y0MA 2K5IA 1M27A 2K3BA 3OYJA 2RNAA 2GGRA 1YIJQ 5EHPA 3GOXA 2YXYA 1WHLA 4C5EA 1SHBA 4QQGA 2E3IA 3FDRA 2LVMA 2WSEE 1ZBXA 1YCSB 2VGMA 3CC7Q 4QKUA 2DM0A 2AT1B 5GJHA 2QEXQ 2ESWA 3VYGA 1KK7A 2AKLA 4FM4B 2PVDB 2XICA 2EJ9A 4DA4A 1UHCA 5HKYA 2FL7A 3RIRA 1VQLQ 2LNHB 2AUGA 4CC2A 3JCMd 5FLXE 1KQSP 4J6XA 4E47A 1VYUA 4XQ3A 2C0IA 5FRNA 3S8NA 3S3NA 2XDPA 2HQXA 2QTXA 4RTYA 1IHVA 5A2QE 2HDVA 2HSEB 2HBPA 3PS5A 2ZPBB 1MV0B 1RAEB 4PJNA 3J7AF 5EELA 2LJ1A 4BDZA 4KGXB 3QIIA 3OQ5A 1M90U 1YVLA 3L1AA 2SRCA 1O48A 1KD1U 4NL2A 3C4SA 2NWMA 2JS0A 5I2SA 1N9RA 4JS5A 1VQ5A 1K73R 3TU4K 3M55A 2BZ8A 2V26A 5HKCA 2M02A 1ABOA 2GSBA 1WHKA 5IBMA 1I3ZA 1M30A 2OTLA 3VRPA 4HA8A 2YUNA 1W1FA 1SSHA 2RJDA 4BI4A 4ANJA 3JCMX 1QCFA 1WQUA 3IMJA 1CSYA 4J7IA 1M90C 4P5NA 1M8VA 4HXJA 4E7JA 2HNIA 1KD1C 5CCAA 1CSKA 4CC7A 1KC2A 3VS2A 2MRKA 3GBQA 1O4FA 2MMPA 3EACA 4M7DA 3V7RA 3I9QA 2YLCA 4Y92A 4D6WA 1K0XA 1Y1UA 2R5MA 3VS5A 4C8QF 1Q86U 2QA4A 4K2RA 2LCLA 5KAZA 2KK6A 4AG2C 5DM7R 1N6AA 2EVRA 4ZN3A 4F7UE 3CCUT 4K44A 4PLLA 3G4SA 2LX9A 2Y90A 2E6ZA 1O4KA 1O4DA 2NUPB 4GLKA 1F1WA 4LUEA 2AOBA 1SKUB 3OS0A 4XAXB 3GQIB 4MZMA 2K79A 1VQMQ 2QDLA 4OF1A 1Q86C 3EFOB 2MIOA 3BY7A 3S9KA 2JVVA 4F7UG 3UA6A 5C0MA 1J3TA 3A98A 4M78A 5I22A 1WHHA 4C8QB 1O4MA 1O4IA 3L2WA 1IRXA 1CWEA 4TZIA 2RN8A 1YWPA 2EYVA 1GBQA 2GQIA 3M4GA 1CWDL 2J06A 5LJ3j 1KSWA 2JJ9A 3HFOA 4N4IA 2KT1A 2QXFA 2ECDA 4QQDA 4ME7A 1VQ4A 3G71A 3R6OA 1G3SA 2OTLQ 3EGUA 2MWOA 2L3QA 2O4XA 3VRYA 3UPUA 3CCMQ 3SDZA 3QJ6A 4M7DC 3C95A 2PNAA 4LDYA 1M2OA 5HKWA 3JV3A 1ZA1B 1K76A 2K3YA 3QYHB 4AT1B 3OYCA 4ZGJB 3OW2S 4E2FB 1W70A 4QVDA 1YITA 1VQ8T 1H3ZA 2LP5A 3QHSA 2VIFA 1MNDA 1NPRA 1NJIU 5I6VA 2OI3A 1RAAB 2P4RA 2FYKA 2VB6A 3G7ZA 1O4BA 2RQTA 2OTJA 4JJDA 2CGHA 1B07A 1QMCA 4RTUA 1V76A 1W4SA 2EJFA 4XU1A 2CYZB 3RUXA 1A1AA 2P84A 2A28A 1GCPA 5AULA 1G83A 3OBYA 2KXDA 1D1CA 4DEXA 2YU7A 1WA7A 1KHIA 5GANj 3RKXA 1RJAA 1H92A 3CD6Q 1A07A 1O49A 2BE9B 2FB7A 2ZPIB 3K2MA 5AYFA 2DLYA 5IT9E 2CT4A 1SHFA 3EFSA 4NL3A 3A8HB 4PNOA 4J7FA 2DEQA 2X4XA 1XNIA 4GPLB 1VOMA 3EGDA 5GAMd 4RKUE 3EG9B 2V1QA 4EMKB 2J6FA 4WF2A 4ELZC 4XZ1A 1FXXA 2DVJA 1BFIA 5A0LA 5GAN4 3CC4Q 2X3WD 3BE3A 2IIMA 3EH1A 3CCJT 1RI0A 1UHFA 1UJ0A 1YJWT 2COZA 1BIAA 2L0AA 1XQHA 2PNIA 2EYYA 1VQ5T 2QQ9A 1BKBA 2GCXA 1VQOA 1JEGA 1JYUA 4D8DA 5AT1B 4A4EA 4C8QE 3EG0A 2QTVA 4OHIA 1TS9A 1O4RA 1BG1A 2RHZA 1JWOA 4C8QD 3A8MB 4QVCA 2BE7D 4H34A 2AK5A 1UUEA 4JJBA 2QQRA 2WACA 1SPKA 5LJ5d 3V7CA 1VQNA 3I35A 2MQIA 1N5ZA 3CMAT 1UUSA 1H641 4JUVA 1QKXA 2M0YA 2KY9A 1SHDA 4C8QG 3QZ5B 2EQUA 2DBKA 3OB1B 3CC2Q 2QA4T 3OYHA 2CIAA 3CXLA 5GAN3 3EGXA 2J6OA 2WSFE 4F04B 2DETA 4QSYA 1ZSZC 2VVKA 3QWXX 3V8KA 2QYZA 3G4ST 1PRLC 4PJOA 1AT1B 2D9TA 1WHJA 3OS1A 1X43A 4F14A 1K73C 2JS2A 3RKYA 3THKA 2Y1MA 4HCCA 5KYWB 1OO3A 3JCMg 1JB0E 1QVFP 2ZPEB 3TSZA 4J6YA 4E7HA 2F1LA 3C0CA 5IHKA 1JJ2A 1H3HA 1K0SA 4C5HA 2PUKB 4AFSC 4M7AA 2R58A 4KUIA 5GJWB 2DCRA 3FLGA 3E9FA 2RD1A 4IUPA 1Y71A 2E1HA 2IVWA 2CH4W 4EMHA 2EGAA 1G3YA 2YSXA 1CJ1A 2FRWA 1Z3KA 5GMKi 3PJPA 3VS1A 5GMKm 4JRPA 2Y4YA 1RLQC 3OBWA 3MP8A 4AFQC 5KE3A 3G71T 1GBRA 2Z0WA 1YI2A 3I56Q 1D1ZA 2D6FA 4JGHA 2CP3A 4ELYC 4J9GA 3N8MA 5HY6A 1N8RU 4WCIA 1Z9ZA 1A1BA 4CI0C 3JCMf 2J6KA 1TSFA 1IGQA 3DLMA 1YITT 2CKKA 1B47A 2DXBA 5CKDA 5LL6S 1B7TA 1BBZA 3JCMW 4OMLA 3H0FA 2CZ1B 3JCMV 2CI8A 1X6OA 2OTJT 1O4GA 3UF4A 4J9CA 5GAN7 1N8RC 1D0ZA 2OZOA 4JDSA 2BZXA 1NLPC 5IN1A 1Q82U 2CI9A 4LE9A 5EG2A 3CCEA 1AB2A 2IUHA 3LYVA 2QMSA 1IZ6A 2O88A 2MI6A 3M59A 1M1KR 3IMDA 2AZSA 2DX1A 2HBWA 2A08A 4QVZA 1OI1A 1W2BA 2RJFA 1MV3A 1M4ZA 2OX7A 1OZ2A 2EYQA 5KYYA 3IN7A 2PUOB 2JT4A 1LOJA 2DA9A 5M9OA 1Q82C 1O75A 2LQNA 1NE8A 4M7DB 4WWQA 3OA6A 3JB9F 2EO3A 1TUGB 4M78F 4M4ZA 3QUIA 1X6BA 2LNWA 4FSXA 1VQ9A 1KC8R 3HSBA 2DXCA 1LCKA 3X24B 3CWGA 2EYXA 5CDWA 3VS7A 2L2PA 2RQRA 3GNGA 2RSYA 2DKGA 3CCQT 1VQPT 4EY0A 3TVTA 4F59A 4LXCA 4B9WA 4M77C 4P9VA 2DAQA 3EG3A 2K9GA 3AHUA 4E68A 3MKDA 1UJYA 2KEAA 3PQZA 1Q81C 4N4HA 1Q7YR 1QADA 2K79B 4U17A 2B3OA 3G6ET 3H0HA 3M9QA 1VUBA 1ABQA 1MHNA 2RK2A 2PZ1A 5EEQA 4M78B 5D0JA 3HTRA 1S1NA 7AT1B 2RHXA 3C94A 2EO6A 2H5KA 1SHGA 3NHNA 4Z88A 4DGPA 4AMCA 5GMKh 3HHTB 1I8FA 4JZ3A 3RKWA 4JLGA 2Y4XA 3VUBA 2P0QA 1VQKA 2RHUA 5CKBA 1D1AA 5DC0B 1VQNT 4ZNXA 1I07A 1YIJA 3M54A 2O4XB 1N9SA 1V29B 2E5KA 3BDUA 2E3HA 1VYVA 1M9SA 4EIKA 2CP2A 4PL6A 3OY9A 4OMPA 1FYRA 4JRQA 1AYBA 3CC7A 3DB3A 1F1BB 4BUGA 5FU6C 2DIQA 4J8OA 4ORZA 2QEXA 3ZNIA 2OAWA 3LGLA 5C6SA 2DL8A 2FPDA 1P92A 4F17A 3OMCA 2JYQA 1EZZB 1VQLA 1OPKA 4HVWA 2OAUA 1YFNA 1I5OB 4C0GA 1UURA 2H3EB 2L5QA 4A4CA 2Y3AB 5LJ3d 3TCJA 3MEVA 4JRIA 1RLPC 3FJPA 2A7YA 3NTKA 3KFJA 2RI5A 2W10A 3JCMh 3RNJA 4IUQA 1LVKA 2X4WA 5HK0A 4FIBA 1BKLA 1V1CA 2K6DA 1X0NA 3QWYA 4IURA 5GAMg 4FL3A 4BE2A 2L8DA 4J9HA 3SHWA 1R0BG 1NEGA 2MYSA 5GAN2 1NLOC 2EYWA 1NJIR 3LYIA 1ZA2B 4IIMA 3MEWA 4O5VA 2RM4A 1UGVA 2GTOA 3ME9A 4IUVA 1SG5A 2KI7A 2KROA 1YI2T 2LNXA 2HCKA 4D8KA 1N27A 1NM7A 3QXEB 4KT0E 1F2FA 1AVZC 3QDFA 2NUTA 2QGFB 5GAOp 3CCLT 3QJYA 1QVGS 4M7DD 2CP7A 2HAXA 1OULA 4E7LA 4OVAA 3EGDB 4ZGDB 2R5AA 1QWFA 1WLPB 5LJ5g 2HMHA 3MCAB 5GAMf 2QQBA 2DM1A 4RMOA 4LDWA 2DPPB 5D7UA 5A0DA 3A5ZB 3X26B 5GANd 4LNPA 1AYAA 1BI1A 3MP6A 1H9OA 1FX7A 1FYNA 2RPNA 4RG2A 4A54A 6AT1B 1C1AA 5IXBA 1TWBA 1ZUKA 1LPLA 1VQMA 1WIEA 1PD1A 3OB9A 4M78E 4PJOF 2LJ0A 3CPWP 4DBFA 2BBUA 3JB9D 3FEOA 2EIFA 3CCRT 3EAEA 1D4WA 4M78D 1AOUF 2V8JA 3M58A 4NS5A 1QVFS 4R56A 1PHTA 1A0NB 4JE4A 1JBMA 2DJQA 4EIHA 1K4US 3P8BB 3CXCA 1TUDA 1BHFA 3JB9G 4GBQA 3MP1A 4M78G 1AEYA 3EHRA 5LJ5f 1U3OA 1VQ9T 4M7AF 2AIRB 1RL2A 4J9DA 2GFUA 3EGXB 4OGEA 1W6XA 1TXQA 1VQ7T 1R8OB 1X27A 2JUFA 4BY6B 4FYWB 4DOVA 4PJOB 4P9ZA 5GAOr 2BUDA 3VKIA 3CCMA 2MC1A 1GFCA 4OHDA 5FW9A 2Y1NA 1BIBA 3AT1B 1TOVA 1VQ8Q 1YP5A 4C92A 1T3LA 2VKNA 4HT8A 1OU9A 1JQQA 1D09B 1KA6A 4F5BA 1YVHA 1ZX6A 3SD4A 1IB8A 1PKTA 2L3SA 3S6WA 3LLRA 2QG9B 4M7AB 1WGSA 1SSFA 2ROTA 2LCTA 4ZGEB 2CUDA 4FW1A 1ZSGA 4MZTA 4PLIA 2L89A 1PC0A 4DBQA 1YJ9T 3D7SB 2ENMA 1BMBA 4V2SA 1FMKA 1KC8C 1X75C 2B86A 1VQKT 2V8IA 1Y07A 2GQVA 2EGCA 3DLLA 3HRSA 4N0AC 2XDDA 1YIJT 1JRIA 2FPEA 2RF0A 4F5AA 3M0PA 4YTLA 3OV1A 2IPOB 1MMGA 2O9SA 5FRMA 3CD6A 3H8ZA 2OJ2A 4MMKA 4ESRA 1IXDA 2RI3A 3CC7T 2KNOA 1M3AA 2DIGA 1BK2A 1YJNQ 2ATCB 2FZGB 2MWPA 2ZPHB 3OMGA 2QAZA 1MGQA 1K9AA 1E6GA 1PICA 2DE0X 1QCNA 4RTXA 1BKMA 1X69A 3CMEQ 5KYNA 2WSCE 2F69A 3LWHA 3RESA 3BUNB 1NZLA 1WHMA 1JU5C 2CZ7B 5GAOl 3QZ9B 4C92C 4GLMA 3CC4A 1YJWQ 2LRAA 3IQLA 5IAYA 4JEGA 1WXUA 4CRIA 3OW2A 1VA7A 2KBTA 1RUWA 2LC4A 2E12A 1PSFA 2DTOA 5GAMh 3SWNA 3NMZC 2YRCA 1YHQQ 2VV5A 2LCSA 2FO0A 1UGQB 1OPLA 4GL9E 3CQTA 5KYYB 4L6V5 4E7IA 3S3MA 4F16A 1ACMB 1D3BA 2CP0A 4M75A 2DRKA 2CZ6B 5GAN5 5FU6B 3EAZA 3CMAQ 2RHIA 2QASA 2YUQA 3OYEA 3QPHA 1AZEA 3VROA 3NPFA 3REBB 2DMOA 3VS0A 1WZOA 1U5SA 1YBYA 1BF5A 2ECZA 1UFFA 4ZN1A 2DVEA 1MW4A 4Z02A 2XKOC 4DOWA 1R1QA 3Q1JA 3NFCA 4GY5A 3CC2A 4PJOE 4VUBA 1K9MU 1IREB 3BDLA 4KUDK 1RI9A 5LJ5h 2CP5A 4FYVB 4PJOD 3JCMJ 1K8AR 2EBPA 4HT9A 4KGZB 1ZSZA 2DJZA 2QQAA 3PTAA 3ASKA 1MMDA 2VWFA 4XU3A 2F2VA 1UB4A 3QO3A 3EG1A 3KUFA 4PJOG 2KVQG 1K9MC 4M7AE 1OZ3A 3HP9A 3VJPA 1BLKA 3PT9A 1M3CA 4Z89A 3H6ZA 4LUDA 2E5QA 2GFAA 1HXDA 5LJ3g 3NGPA 4M7AD 3TSWA 1QP2A 1WNLA 2ETZA 3SWNC 4C0FA 4A63B 1UECA 1BYMA 5EG3B 1M5Q1 3C12A 4KRTA 2GE9A 3I5SA 2JZ2A 2PTKA 2C06A 4M7AG 1P13A 1OU8A 4Z8AA 4M75C 3EG2A 2OTLT 4IUUA 2DLZA 3I56A 2EOBA 2JMAA 3EFRA 4PJJA 3WVDB 1RAGB 1T3SA 5GAN6 1X6GA 2DD5A 2KSSA 2EWNA 5A0GA 2V1RA 1PNJA 2RH2A 3CCVQ 3MEAA 2YT6A 1QVGP 1GHUA 4PFPA 3MEUA 3PMIA 2KR3A 2DTIA 3M57A 1K73U 3HIZB 4OMQA 4RTWA 3EH2A 3TREA 1AWOA 1A08A 1KFZA 1NRVA 3FJ5A 4J6WA 5LJ3f 4O6JA 1MNEA 4FL2A 1QCOA 3VU3C 4EPCA 5I21A 4OMOA 1HK9A 1D4TA 2H46E 1FMWA 2QK0A 4II1A 2VC8A 1IJRA 2LT1A 2YUPA 1G8XA 2DBMA 3CBMA 4J9IA 4FL6A 3PNWC 4ROJA 9ATCB 1I1JA 1KQSA 2YSQA 1SEMA 2RO0A 1HYOA 1IGUA 4KGVB 2K5FA 2H8HA 2KQWA 3M4YA 5GANg 3JCMP 1FHSA 3BUMB 5BO4A 3URGA 5GAOn 1SKJA 4JJCA 4HCKA 2CS7A 4OGCA 2M9UA 3CPWS 2BTTA 2SEMA 4XU2A 2CT3A 5CAIA 3CD6T 4MMLA 4E7KA 2A36A 2NUTB 4PFZA 2DTHA 1HCTB 1HSQA 2LT4A 2DL3A 3CCQQ 1VQPQ 3JB9J 3EHQA 4IKFA 5GJVB 1WI7A 2NUZA 2YHTA 4CC3A 1H8KA 2E65A 2EPDA 1VQ4T 2EKHA
chains in the Genus database with same CATH topology
2XMFA 2O9VA 2E5KA 2BZ8A 5EHRA 1VYVA 4EIKA 1ABOA 2GSBA 1FYRA 4OMPA 5IBMA 1I3ZA 1AYBA 2DL4A 3PSKA 1M30A 2DX0A 1A09A 2RQVA 3VRPA 2YUNA 1W1FA 1SSHA 4ORZA 3VS4A 1QCFA 1YNZA 1WQUA 3ZNIA 3IMJA 3S8OA 2OAWA 3VGOA 1CSYA 2DL8A 2FPDA 4HXJA 4F17A 2JYQA 1GCQA 1O4CA 2EW3A 1OPKA 4HVWA 3UYOA 2DRMA 2HEQA 1CSKA 3R6NA 4CC7A 1KC2A 3VS2A 2XP1A 2C0TA 3GBQA 2MRKA 1UURA 4A4CA 1O4FA 1WYXA 2Y3AB 3EACA 1BLJA 2MOXA 4HVUA 2CSQA 1RLPC 2EU0A 3I9QA 3IN8A 4Y92A 1K0XA 1A1CA 1Y1UA 4U1PA 3M0QA 3O5ZA 3VS5A 3KFJA 2W10A 3OVEA 1CKBA 1YN8A 1O4QA 3MXYA 3RNJA 4K2RA 4E93A 4XZ0A 2KK6A 5KAZA 1BKLA 1V1CA 4AG2C 2K6DA 2EVRA 1X0NA 3QWYA 4K44A 4FL3A 4J9HA 3SHWA 1NEGA 1LUNA 1O4KA 1NLOC 2EYWA 1O4DA 2W0ZA 3VS6A 2CSIA 4LUEA 1F1WA 2AOBA 3OB2B 1OOTA 2DILA 3PVQA 4IIMA 1AOTF 2GNCA 5FWCA 3GQIB 5AXIA 2K79A 1UGVA 2GTOA 1PKSA 3REAB 2QDLA 1JXMA 1M3BA 1JYRA 5GJIA 2KROA 2MIOA 3S9KA 2LNXA 2CREA 3UA6A 2AKKA 1J3TA 4FSSA 2HCKA 1FBVA 2HDXA 3A98A 3BUWB 5FWBA 4D8KA 1CKAA 1NM7A 3VRRA 1ZFPE 5I22A 1O4MA 5L23A 1O4IA 1F2FA 1AVZC 2RVFA 4RTTA 1CWEA 3C7IA 3HHMB 3VRQA 4TZIA 5IHNA 1I0CA 2RN8A 4LN2A 1YWPA 2EYVA 1AWJA 4CC4B 1GBQA 2GQIA 1CWDL 2J06A 1ARKA 1KSWA 2LZ6B 1QWFA 1WLPB 3M0TA 4J9FA 1O43A 2KT1A 2ECDA 2HMHA 2ED0A 1AYDA 1QKWA 2ROLA 2DM1A 2C0OA 1GCQC 3EGUA 2L3PA 4X6SA 1SRMA 5I11A 4LNPA 2L3QA 1AYAA 3VRYA 2CS0A 5IXFA 1H9OA 2HUWA 1O4EA 1FYNA 2D0NA 2RPNA 2JTEA 3M0RA 1BB9A 4OHLA 1UTIA 2PNAA 2KRMA 1BHHB 5IXBA 2CR4A 1R1SA 5HKWA 3JV3A 1EFNA 4OHEA 1K76A 1ZUKA 1WXTA 1WIEA 3H0IA 2LJ0A 1W70A 2M51A 1O4PA 2BBUA 2LP5A 3M7FA 1FBZA 2D8JA 1Z9QA 3M0SA 1D4WA 2VIFA 1AZGB 1AOUF 3SEMA 5I6VA 2OI3A 1PHTA 3CD3A 3N84A 2P4RA 1A0NB 2LQWA 4JE4A 1O4BA 2DJQA 2RQTA 1JXOA 4JJDA 1K4US 4EIHA 2DNUA 1B07A 3UA7A 2C9WA 4RTUA 2NWMA 1TUDA 1BHFA 1HCSB 1R1PA 1O4OA 1AYCA 2CBLA 4GBQA 2FPFA 1NEBA 3TL0A 1AEYA 3EHRA 1A1AA 1U3OA 1PWTA 2A28A 3GXWA 1GCPA 4J9DA 5AULA 2FRYA 2AZVA 2IUGA 2L6KA 1G83A 4RTVA 2KXDA 1W6XA 4DEXA 4DEYA 1O4LA 2YU7A 1WA7A 1X27A 3LH5A 1KJWA 1NG2A 1AWWA 4P9ZA 1RJAA 1H92A 1A07A 2MC1A 1GFCA 1O49A 5FW9A 1OO4A 4OHDA 2MCNA 2Y1NA 1M8MA 1X2QA 3K2MA 2DLYA 1YP5A 1QWEA 2CT4A 1SHFA 1T3LA 2RMOA 5EC7A 2VKNA 1WX6A 2FG0A 1JQQA 1UE9A 3N7YA 2GTJA 2J05A 1KA6A 1TCEA 4F5BA 1O4AA 1YVHA 3BUOB 1ZX6A 1A81A 1KIKA 1PKTA 1WDXA 2L3SA 2BZYA 2YDLA 2KRNA 4GPLB 2ROTA 1BU1A 2LCTA 2CUDA 4R0KA 1OV3A 1ZSGA 1TZEE 2K7AB 3PFVA 2KNBB 2JMCA 2V1QA 3UATA 2J6FA 4XZ1A 1BFJA 2ENMA 1BMBA 2DVJA 1E6HA 2L3TA 1BFIA 2AOAA 2DL7A 1FMKA 2JM9A 2JXBA 2X3WD 2B86A 1FU6A 2IIMA 3KFVA 2KE9A 2RORA 2EGCA 1UHFA 1GL5A 1UJ0A 1SPRA 2KRSA 1O4HA 3T04A 3OP0A 2L0AA 2FPEA 2RF0A 2PNIA 4F5AA 2EYYA 3M0PA 3OV1A 1BHHA 4OHHA 2O9SA 1B3QA 1OEBA 1T0HA 2OJ2A 4ESRA 1U06A 1JEGA 1JYUA 1LCJA 4D8DA 1JO8A 2IUIA 3TKZA 2KNOA 1QLYA 1M3AA 1TUCA 3EG0A 3PE0A 1BK2A 4OHIA 1O4RA 2DLPA 1BG1A 1NZVA 1K9AA 2KYBA 1E6GA 1JWOA 2DE0X 1PICA 4RTXA 1BKMA 1X69A 1O46A 2L4KA 4H34A 2AK5A 1UUEA 2KYMA 4JJBA 5DF6A 1O4NA 1BM2A 1LUKA 5ECAA 1SPKA 1UDLA 1MILA 3I35A 2MQIA 4QT7A 1N5ZA 1UUSA 3BUNB 1NZLA 1WXBA 1ZLMA 1QKXA 1JU5C 2M0YA 2RMXA 4NWGA 1SHDA 2DBKA 2RQUA 3OB1B 4GLMA 4J9EA 2CIAA 3CXLA 5HKZA 1ZUUA 2JW4A 1GRIA 2J6OA 3IQLA 2K2MA 4JEGA 4QSYA 1WXUA 2VVKA 3QWXX 1NYGA 1VA7A 2KBTA 5IH2A 1AWXA 1RUWA 2DL5A 1YWOA 1MUZA 1PRLC 2KT8A 1X6CA 4L1BB 3NMZC 1X43A 2LCSA 2LJ3A 4F14A 2JS2A 1QG1E 1SHAA 2FO0A 1OPLA 4GL9E 3THKA 3CQTA 4A4BA 1UG1A 4HVVA 2Y1MA 4NWFA 2HDAA 1O42A 4F16A 1OO3A 2RQWA 2YUOA 2A37A 1NYFA 2ED1A 1KA7A 2HSPA 3US4A 2DRKA 3TSZA 3VRNA 3C0CA 1H3HA 5IHKA 3EAZA 1K0SA 1IO6A 4AFSC 3PLFB 4FBNA 2YUQA 2PLEA 2EGEA 5GJWB 2DCRA 3I5RA 2EYZA 1AZEA 2K7AA 3VROA 1CSZA 3NPFA 3REBB 2DMOA 3VS0A 2CH4W 1U5SA 1BF5A 2ECZA 2EGAA 1SRLA 1UFFA 1MW4A 1RPYA 1CJ1A 2YSXA 2FRWA 1Z3KA 1R1QA 3VS1A 3PJPA 1WFWA 1TG0A 3BKBA 1JYQA 5DC9A 1M61A 1RLQC 2KXCA 4AFQC 1JU5A 4K11A 3VRZA 3ULRB 1LUMA 1GBRA 1E7OA 1RI9A 2D1XA 1D1ZA 2OQ1A 4JGHA 1Y57A 2EBPA 1O4JA 2D8HA 4J9GA 2CDTA 3N8MA 4WCIA 5IHIA 1Z9ZA 2VWFA 1A1BA 1G2BA 3RBBB 2F2VA 1K1ZA 3EG1A 2J6KA 2FEIA 4AFUC 4GWFA 1AD5A 1M27C 2EL8A 4RTZA 1BLKA 1B47A 2F2WA 1BBZA 2PNBA 1M3CA 4AG1C 4OMLA 3H0FA 4Z89A 1HJDA 4LUDA 1A1EA 3NGPA 1O45A 3ZL7C 3TSWA 1AOJA 2CI8A 1O4GA 2ETZA 3UF4A 4A63B 4J9CA 4OMMA 1T0JA 5IBSA 1SPSA 2OZOA 1PRMC 1UECA 2LX7A 5EG3B 2BZXA 1NLPC 4KRTA 1X2KA 2CI9A 2GE9A 1RQQC 4LE9A 3I5SA 2PTKA 1P13A 2F2XA 2IUHA 1AB2A 2O2OA 2QMSA 2O88A 2CH4A 2ABLA 2J7IA 4Z8AA 3U23A 3EG2A 3IMDA 1XOVA 2AZSA 4JPBW 3MAZA 2DX1A 4DGXA 2HBWA 2A08A 2DLZA 2EKXA 2PLDA 2EOBA 2JMAA 1ZBJA 3PSJA 2JM8A 3VS3A 1O41A 1T3SA 1FU5A 2FCIA 1MV3A 1X6GA 2I0NA 4IIOA 2IZVA 4OMNA 4K45A 3IN7A 2DYBA 2KGTA 2JT4A 1PNJA 2LMJA 2V1RA 5HCKA 1XA6A 2YT6A 2DA9A 1GHUA 3M0UA 2GBQA 4JZ4A 2LQNA 2EQIA 4WWQA 2KR3A 2EO3A 1HD3A 3HCKA 3HIZB 1IS0A 3CBLA 4OMQA 4RTWA 4M4ZA 1A08A 1X6BA 1AWOA 1KFZA 2LNWA 3CWGA 1NRVA 1LCKA 3FJ5A 4J9BA 3WA4A 1Y0MA 2EYXA 2G6FX 3VS7A 5CDWA 2L2PA 2RQRA 2RSYA 4FL2A 1M27A 4EY0A 2K3BA 4OMOA 2RNAA 2GGRA 5EHPA 1D4TA 2H46E 3TVTA 4F59A 4P9VA 1IJRA 3MXCA 2YUPA 3EG3A 2DBMA 1SHBA 2K9GA 4RUGA 4J9IA 1ZUYA 4ROJA 4E68A 1UJYA 2KEAA 1I1JA 3PQZA 1YCSB 2YSQA 1SEMA 2O31A 1O44A 2DM0A 3PVLA 5GJHA 2SHPA 2H8HA 2X3XD 2ESWA 1QADA 2AKLA 2K79B 2MRJA 4U17A 3H41A 2B3OA 5DC4A 3H0HA 2CRHA 1UHCA 1FHSA 3BUMB 5HKYA 5BO4A 1SKJA 2LNHB 4JJCA 2AUGA 1ABQA 4HCKA 4CC2A 1VYUA 3S8NA 2C0IA 2PZ1A 2BTTA 1VYTA 2SEMA 5D0JA 1S1NA 5EEQA 2CT3A 1LUIA 4RTYA 2A36A 2HDVA 2EO6A 2H5KA 1GFDA 3PS5A 1HCTB 1SHGA 1HSQA 3NHNA 4Z88A 1MV0B 4E6RA 4DGPA 3BUXB 2CUBA 1LKKA 2DL3A 5EELA 2LJ1A 4JZ3A 4AFZC 4X1VA 3EHQA 5GJVB 1WI7A 2NUZA 2DF6A 4H1OA 3GXXA 3S8LA 4CC3A 1O47A 1YVLA 5DC0B 2MK2A 1H8KA 2SRCA 2EPDA 1O48A 5J3XA 4ZNXA 1LKLA 1I07A 2JS0A 2EKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMF A;  2O9V A;  2E5K A;  2BZ8 A;  5EHR A;  1VYV A;  4EIK A;  1ABO A;  2GSB A;  1FYR A;  4OMP A;  5IBM A;  1I3Z A;  1AYB A;  2DL4 A;  3PSK A;  1M30 A;  2DX0 A;  1A09 A;  2RQV A;  3VRP A;  2YUN A;  1W1F A;  1SSH A;  4ORZ A;  3VS4 A;  1QCF A;  1YNZ A;  1WQU A;  3ZNI A;  3IMJ A;  3S8O A;  2OAW A;  3VGO A;  1CSY A;  2DL8 A;  2FPD A;  4HXJ A;  4F17 A;  2JYQ A;  1GCQ A;  1O4C A;  2EW3 A;  1OPK A;  4HVW A;  3UYO A;  2DRM A;  2HEQ A;  1CSK A;  3R6N A;  4CC7 A;  1KC2 A;  3VS2 A;  2XP1 A;  2C0T A;  3GBQ A;  2MRK A;  1UUR A;  4A4C A;  1O4F A;  1WYX A;  2Y3A B;  3EAC A;  1BLJ A;  2MOX A;  4HVU A;  2CSQ A;  1RLP C;  2EU0 A;  3I9Q A;  3IN8 A;  4Y92 A;  1K0X A;  1A1C A;  1Y1U A;  4U1P A;  3M0Q A;  3O5Z A;  3VS5 A;  3KFJ A;  2W10 A;  3OVE A;  1CKB A;  1YN8 A;  1O4Q A;  3MXY A;  3RNJ A;  4K2R A;  4E93 A;  4XZ0 A;  2KK6 A;  5KAZ A;  1BKL A;  1V1C A;  4AG2 C;  2K6D A;  2EVR A;  1X0N A;  3QWY A;  4K44 A;  4FL3 A;  4J9H A;  3SHW A;  1NEG A;  1LUN A;  1O4K A;  1NLO C;  2EYW A;  1O4D A;  2W0Z A;  3VS6 A;  2CSI A;  4LUE A;  1F1W A;  2AOB A;  3OB2 B;  1OOT A;  2DIL A;  3PVQ A;  4IIM A;  1AOT F;  2GNC A;  5FWC A;  3GQI B;  5AXI A;  2K79 A;  1UGV A;  2GTO A;  1PKS A;  3REA B;  2QDL A;  1JXM A;  1M3B A;  1JYR A;  5GJI A;  2KRO A;  2MIO A;  3S9K A;  2LNX A;  2CRE A;  3UA6 A;  2AKK A;  1J3T A;  4FSS A;  2HCK A;  1FBV A;  2HDX A;  3A98 A;  3BUW B;  5FWB A;  4D8K A;  1CKA A;  1NM7 A;  3VRR A;  1ZFP E;  5I22 A;  1O4M A;  5L23 A;  1O4I A;  1F2F A;  1AVZ C;  2RVF A;  4RTT A;  1CWE A;  3C7I A;  3HHM B;  3VRQ A;  4TZI A;  5IHN A;  1I0C A;  2RN8 A;  4LN2 A;  1YWP A;  2EYV A;  1AWJ A;  4CC4 B;  1GBQ A;  2GQI A;  1CWD L;  2J06 A;  1ARK A;  1KSW A;  2LZ6 B;  1QWF A;  1WLP B;  3M0T A;  4J9F A;  1O43 A;  2KT1 A;  2ECD A;  2HMH A;  2ED0 A;  1AYD A;  1QKW A;  2ROL A;  2DM1 A;  2C0O A;  1GCQ C;  3EGU A;  2L3P A;  4X6S A;  1SRM A;  5I11 A;  4LNP A;  2L3Q A;  1AYA A;  3VRY A;  2CS0 A;  5IXF A;  1H9O A;  2HUW A;  1O4E A;  1FYN A;  2D0N A;  2RPN A;  2JTE A;  3M0R A;  1BB9 A;  4OHL A;  1UTI A;  2PNA A;  2KRM A;  1BHH B;  5IXB A;  2CR4 A;  1R1S A;  5HKW A;  3JV3 A;  1EFN A;  4OHE A;  1K76 A;  1ZUK A;  1WXT A;  1WIE A;  3H0I A;  2LJ0 A;  1W70 A;  2M51 A;  1O4P A;  2BBU A;  2LP5 A;  3M7F A;  1FBZ A;  2D8J A;  1Z9Q A;  3M0S A;  1D4W A;  2VIF A;  1AZG B;  1AOU F;  3SEM A;  5I6V A;  2OI3 A;  1PHT A;  3CD3 A;  3N84 A;  2P4R A;  1A0N B;  2LQW A;  4JE4 A;  1O4B A;  2DJQ A;  2RQT A;  1JXO A;  4JJD A;  1K4U S;  4EIH A;  2DNU A;  1B07 A;  3UA7 A;  2C9W A;  4RTU A;  2NWM A;  1TUD A;  1BHF A;  1HCS B;  1R1P A;  1O4O A;  1AYC A;  2CBL A;  4GBQ A;  2FPF A;  1NEB A;  3TL0 A;  1AEY A;  3EHR A;  1A1A A;  1U3O A;  1PWT A;  2A28 A;  3GXW A;  1GCP A;  4J9D A;  5AUL A;  2FRY A;  2AZV A;  2IUG A;  2L6K A;  1G83 A;  4RTV A;  2KXD A;  1W6X A;  4DEX A;  4DEY A;  1O4L A;  2YU7 A;  1WA7 A;  1X27 A;  3LH5 A;  1KJW A;  1NG2 A;  1AWW A;  4P9Z A;  1RJA A;  1H92 A;  1A07 A;  2MC1 A;  1GFC A;  1O49 A;  5FW9 A;  1OO4 A;  4OHD A;  2MCN A;  2Y1N A;  1M8M A;  1X2Q A;  3K2M A;  2DLY A;  1YP5 A;  1QWE A;  2CT4 A;  1SHF A;  1T3L A;  2RMO A;  5EC7 A;  2VKN A;  1WX6 A;  2FG0 A;  1JQQ A;  1UE9 A;  3N7Y A;  2GTJ A;  2J05 A;  1KA6 A;  1TCE A;  4F5B A;  1O4A A;  1YVH A;  3BUO B;  1ZX6 A;  1A81 A;  1KIK A;  1PKT A;  1WDX A;  2L3S A;  2BZY A;  2YDL A;  2KRN A;  4GPL B;  2ROT A;  1BU1 A;  2LCT A;  2CUD A;  4R0K A;  1OV3 A;  1ZSG A;  1TZE E;  2K7A B;  3PFV A;  2KNB B;  2JMC A;  2V1Q A;  3UAT A;  2J6F A;  4XZ1 A;  1BFJ A;  2ENM A;  1BMB A;  2DVJ A;  1E6H A;  2L3T A;  1BFI A;  2AOA A;  2DL7 A;  1FMK A;  2JM9 A;  2JXB A;  2X3W D;  2B86 A;  1FU6 A;  2IIM A;  3KFV A;  2KE9 A;  2ROR A;  2EGC A;  1UHF A;  1GL5 A;  1UJ0 A;  1SPR A;  2KRS A;  1O4H A;  3T04 A;  3OP0 A;  2L0A A;  2FPE A;  2RF0 A;  2PNI A;  4F5A A;  2EYY A;  3M0P A;  3OV1 A;  1BHH A;  4OHH A;  2O9S A;  1B3Q A;  1OEB A;  1T0H A;  2OJ2 A;  4ESR A;  1U06 A;  1JEG A;  1JYU A;  1LCJ A;  4D8D A;  1JO8 A;  2IUI A;  3TKZ A;  2KNO A;  1QLY A;  1M3A A;  1TUC A;  3EG0 A;  3PE0 A;  1BK2 A;  4OHI A;  1O4R A;  2DLP A;  1BG1 A;  1NZV A;  1K9A A;  2KYB A;  1E6G A;  1JWO A;  2DE0 X;  1PIC A;  4RTX A;  1BKM A;  1X69 A;  1O46 A;  2L4K A;  4H34 A;  2AK5 A;  1UUE A;  2KYM A;  4JJB A;  5DF6 A;  1O4N A;  1BM2 A;  1LUK A;  5ECA A;  1SPK A;  1UDL A;  1MIL A;  3I35 A;  2MQI A;  4QT7 A;  1N5Z A;  1UUS A;  3BUN B;  1NZL A;  1WXB A;  1ZLM A;  1QKX A;  1JU5 C;  2M0Y A;  2RMX A;  4NWG A;  1SHD A;  2DBK A;  2RQU A;  3OB1 B;  4GLM A;  4J9E A;  2CIA A;  3CXL A;  5HKZ A;  1ZUU A;  2JW4 A;  1GRI A;  2J6O A;  3IQL A;  2K2M A;  4JEG A;  4QSY A;  1WXU A;  2VVK A;  3QWX X;  1NYG A;  1VA7 A;  2KBT A;  5IH2 A;  1AWX A;  1RUW A;  2DL5 A;  1YWO A;  1MUZ A;  1PRL C;  2KT8 A;  1X6C A;  4L1B B;  3NMZ C;  1X43 A;  2LCS A;  2LJ3 A;  4F14 A;  2JS2 A;  1QG1 E;  1SHA A;  2FO0 A;  1OPL A;  4GL9 E;  3THK A;  3CQT A;  4A4B A;  1UG1 A;  4HVV A;  2Y1M A;  4NWF A;  2HDA A;  1O42 A;  4F16 A;  1OO3 A;  2RQW A;  2YUO A;  2A37 A;  1NYF A;  2ED1 A;  1KA7 A;  2HSP A;  3US4 A;  2DRK A;  3TSZ A;  3VRN A;  3C0C A;  1H3H A;  5IHK A;  3EAZ A;  1K0S A;  1IO6 A;  4AFS C;  3PLF B;  4FBN A;  2YUQ A;  2PLE A;  2EGE A;  5GJW B;  2DCR A;  3I5R A;  2EYZ A;  1AZE A;  2K7A A;  3VRO A;  1CSZ A;  3NPF A;  3REB B;  2DMO A;  3VS0 A;  2CH4 W;  1U5S A;  1BF5 A;  2ECZ A;  2EGA A;  1SRL A;  1UFF A;  1MW4 A;  1RPY A;  1CJ1 A;  2YSX A;  2FRW A;  1Z3K A;  1R1Q A;  3VS1 A;  3PJP A;  1WFW A;  1TG0 A;  3BKB A;  1JYQ A;  5DC9 A;  1M61 A;  1RLQ C;  2KXC A;  4AFQ C;  1JU5 A;  4K11 A;  3VRZ A;  3ULR B;  1LUM A;  1GBR A;  1E7O A;  1RI9 A;  2D1X A;  1D1Z A;  2OQ1 A;  4JGH A;  1Y57 A;  2EBP A;  1O4J A;  2D8H A;  4J9G A;  2CDT A;  3N8M A;  4WCI A;  5IHI A;  1Z9Z A;  2VWF A;  1A1B A;  1G2B A;  3RBB B;  2F2V A;  1K1Z A;  3EG1 A;  2J6K A;  2FEI A;  4AFU C;  4GWF A;  1AD5 A;  1M27 C;  2EL8 A;  4RTZ A;  1BLK A;  1B47 A;  2F2W A;  1BBZ A;  2PNB A;  1M3C A;  4AG1 C;  4OML A;  3H0F A;  4Z89 A;  1HJD A;  4LUD A;  1A1E A;  3NGP A;  1O45 A;  3ZL7 C;  3TSW A;  1AOJ A;  2CI8 A;  1O4G A;  2ETZ A;  3UF4 A;  4A63 B;  4J9C A;  4OMM A;  1T0J A;  5IBS A;  1SPS A;  2OZO A;  1PRM C;  1UEC A;  2LX7 A;  5EG3 B;  2BZX A;  1NLP C;  4KRT A;  1X2K A;  2CI9 A;  2GE9 A;  1RQQ C;  4LE9 A;  3I5S A;  2PTK A;  1P13 A;  2F2X A;  2IUH A;  1AB2 A;  2O2O A;  2QMS A;  2O88 A;  2CH4 A;  2ABL A;  2J7I A;  4Z8A A;  3U23 A;  3EG2 A;  3IMD A;  1XOV A;  2AZS A;  4JPB W;  3MAZ A;  2DX1 A;  4DGX A;  2HBW A;  2A08 A;  2DLZ A;  2EKX A;  2PLD A;  2EOB A;  2JMA A;  1ZBJ A;  3PSJ A;  2JM8 A;  3VS3 A;  1O41 A;  1T3S A;  1FU5 A;  2FCI A;  1MV3 A;  1X6G A;  2I0N A;  4IIO A;  2IZV A;  4OMN A;  4K45 A;  3IN7 A;  2DYB A;  2KGT A;  2JT4 A;  1PNJ A;  2LMJ A;  2V1R A;  5HCK A;  1XA6 A;  2YT6 A;  2DA9 A;  1GHU A;  3M0U A;  2GBQ A;  4JZ4 A;  2LQN A;  2EQI A;  4WWQ A;  2KR3 A;  2EO3 A;  1HD3 A;  3HCK A;  3HIZ B;  1IS0 A;  3CBL A;  4OMQ A;  4RTW A;  4M4Z A;  1A08 A;  1X6B A;  1AWO A;  1KFZ A;  2LNW A;  3CWG A;  1NRV A;  1LCK A;  3FJ5 A;  4J9B A;  3WA4 A;  1Y0M A;  2EYX A;  2G6F X;  3VS7 A;  5CDW A;  2L2P A;  2RQR A;  2RSY A;  4FL2 A;  1M27 A;  4EY0 A;  2K3B A;  4OMO A;  2RNA A;  2GGR A;  5EHP A;  1D4T A;  2H46 E;  3TVT A;  4F59 A;  4P9V A;  1IJR A;  3MXC A;  2YUP A;  3EG3 A;  2DBM A;  1SHB A;  2K9G A;  4RUG A;  4J9I A;  1ZUY A;  4ROJ A;  4E68 A;  1UJY A;  2KEA A;  1I1J A;  3PQZ A;  1YCS B;  2YSQ A;  1SEM A;  2O31 A;  1O44 A;  2DM0 A;  3PVL A;  5GJH A;  2SHP A;  2H8H A;  2X3X D;  2ESW A;  1QAD A;  2AKL A;  2K79 B;  2MRJ A;  4U17 A;  3H41 A;  2B3O A;  5DC4 A;  3H0H A;  2CRH A;  1UHC A;  1FHS A;  3BUM B;  5HKY A;  5BO4 A;  1SKJ A;  2LNH B;  4JJC A;  2AUG A;  1ABQ A;  4HCK A;  4CC2 A;  1VYU A;  3S8N A;  2C0I A;  2PZ1 A;  2BTT A;  1VYT A;  2SEM A;  5D0J A;  1S1N A;  5EEQ A;  2CT3 A;  1LUI A;  4RTY A;  2A36 A;  2HDV A;  2EO6 A;  2H5K A;  1GFD A;  3PS5 A;  1HCT B;  1SHG A;  1HSQ A;  3NHN A;  4Z88 A;  1MV0 B;  4E6R A;  4DGP A;  3BUX B;  2CUB A;  1LKK A;  2DL3 A;  5EEL A;  2LJ1 A;  4JZ3 A;  4AFZ C;  4X1V A;  3EHQ A;  5GJV B;  1WI7 A;  2NUZ A;  2DF6 A;  4H1O A;  3GXX A;  3S8L A;  4CC3 A;  1O47 A;  1YVL A;  5DC0 B;  2MK2 A;  1H8K A;  2SRC A;  2EPD A;  1O48 A;  5J3X A;  4ZNX A;  1LKL A;  1I07 A;  2JS0 A;  2EKH A; 
#chains in the Genus database with same CATH topology
 2XMF A;  1JJ2 S;  2O9V A;  3CCS Q;  5EHR A;  3G6E Q;  1PG5 B;  3FIF A;  5GAN f;  2DL4 A;  4M77 A;  3GLX A;  2DX0 A;  3CC4 T;  1A09 A;  1PD0 A;  3VS4 A;  1WHG A;  1YNZ A;  3S8O A;  1PM3 A;  3I55 Q;  1RAC B;  2HMA A;  2E70 A;  2P0K A;  1B34 A;  4MZP A;  1BI0 A;  2DRM A;  3R6N A;  3JB9 I;  3OYF A;  1WYX A;  2MOX A;  3A8L B;  2CSQ A;  3V8J A;  2EU0 A;  4M7D F;  3IN8 A;  4EMG A;  4E7Z A;  4U1P A;  3O5Z A;  1G5V A;  5D6X A;  2EAY A;  1S72 Q;  4XZ0 A;  2VUB A;  2M1H A;  3TQ7 P;  1LUN A;  3OB2 B;  2CSI A;  1OOT A;  3PVQ A;  1AOT F;  5FWC A;  5CKE A;  1PKS A;  3CC2 T;  1M90 R;  3BW1 A;  1JXM A;  2NLU A;  5CR2 A;  4C92 B;  4PJM A;  1KD1 R;  3M53 A;  2KGY A;  1WJS A;  4FSS A;  1VQ6 Q;  1CKA A;  4XTV A;  1Q81 U;  5CK9 A;  1TH7 A;  3LGF A;  3VUZ A;  3VRR A;  4RTT A;  1WJQ A;  3C7I A;  3VRQ A;  1UGS B;  2P0P A;  4LN2 A;  5GMK e;  4CC4 B;  2D0Q B;  5CO7 A;  1BI3 A;  3F70 A;  2RA2 A;  4TVR A;  3VV0 A;  1C0M A;  2LZ6 B;  4IUT A;  1FWZ A;  4J9F A;  3QBY A;  4N4G A;  3PFS A;  2KAF A;  1X01 A;  4C5G A;  2ED0 A;  1AYD A;  3HFN A;  2ROL A;  4C5I A;  2L3P A;  4X6S A;  1Y7X A;  5I11 A;  2CS0 A;  3NTH A;  5LJ3 h;  1O4E A;  2D0N A;  4FYX B;  2X35 A;  2JTE A;  3G1J A;  3M0R A;  1BB9 A;  3L2U A;  1Q86 R;  1UTI A;  4JRK A;  2PQW A;  2KRM A;  3ER0 A;  4MDW A;  1OX8 A;  1R1S A;  2CR4 A;  3E1S A;  4C8Q C;  4OHE A;  3P8H A;  1VQO T;  2M51 A;  3CCL Q;  2JOY A;  3I56 T;  1Z9Q A;  2E64 A;  3M0S A;  1AZG B;  1K8A C;  1G3T A;  2LQW A;  1RAH B;  1UGP B;  1HCS B;  1R1P A;  4OB0 B;  1AYC A;  4M75 F;  2FPF A;  3X20 B;  3JCM e;  5KCH A;  3TL0 A;  4BD3 A;  3GPL A;  1PWT A;  3GXW A;  4LDV A;  2FRY A;  1Y96 A;  2L6K A;  4Y28 E;  2KDS A;  4DEY A;  2YWW A;  1I5L A;  3H9N A;  1FMV A;  3LH5 A;  1NG2 A;  2LQK A;  3UDC A;  1OO4 A;  3SWN B;  4C0D C;  2H3J A;  1M8M A;  1X2Q A;  3CCR Q;  2VYT A;  1WQ7 A;  3HPW A;  2CZ0 B;  5EC7 A;  1WX6 A;  1NBE B;  4FT4 A;  4PJL A;  2FG0 A;  3N7Y A;  2YRD A;  2J05 A;  5GAN h;  3GNF B;  3J81 E;  1D3B B;  4FYY B;  1O4A A;  4ZTJ A;  4M75 B;  4RCB A;  1KG1 A;  1KIK A;  1WQW A;  3GP8 A;  2XK0 A;  1BU1 A;  2LNV A;  1O9S A;  2PVO B;  2G3R A;  4HKE A;  4LD9 K;  4R0K A;  2COY A;  2JMC A;  3PIP A;  1PCX A;  3SFM A;  3KBG A;  3A1P A;  4A53 A;  2L3T A;  2JXB A;  1QP3 A;  3ZBD A;  4XTZ A;  3KFV A;  3OYG A;  3JB9 H;  3WXM B;  1GL5 A;  2XI9 A;  2KRS A;  2DER A;  1BHH A;  1B3Q A;  1OEB A;  4BB7 A;  1ZSZ B;  4M7D E;  1LCJ A;  1MMA A;  2IUI A;  1ZHI A;  1VQ8 A;  3TKZ A;  4C92 D;  1QLY A;  3HKS A;  3PE0 A;  2DLP A;  3A8G B;  4EMK C;  1UGR B;  3CCU Q;  3L2R A;  2KYM A;  3OSS C;  2HQH A;  1O4N A;  1BM2 A;  1LUK A;  5DF6 A;  5ECA A;  2E41 A;  4PFO A;  1MIL A;  1YJ9 Q;  4HCB A;  4QT7 A;  4M7D G;  2VGN A;  1WXB A;  1ZQ1 A;  1ZLM A;  2RMX A;  2MF2 A;  2RQU A;  5KYX A;  1ZUU A;  2K2M A;  3CCE T;  2DK3 A;  2XDB A;  1NYG A;  1VIF A;  5IH2 A;  1AWX A;  2DL5 A;  4FU6 A;  2KT8 A;  4OP0 A;  3E9G A;  4L1B B;  1QVF A;  1QG1 E;  3OYY A;  4N0A A;  1TU0 B;  1OX9 A;  1UG1 A;  2RK1 A;  4HVV A;  3OYL A;  2FHD A;  1O42 A;  3CBO A;  2RQW A;  5J3B A;  2K2V A;  1NYF A;  2ED1 A;  1KA7 A;  2V8K A;  4OMF B;  3US4 A;  3VRN A;  5FU7 C;  1YJN A;  4BE0 A;  3GIB A;  2VXE A;  1IO6 A;  3OS2 A;  3HRT A;  1NZ9 A;  3CME A;  2PLE A;  3RDV A;  2ZGW A;  1M1K U;  3I5R A;  2K7A A;  3MHX A;  4BE1 A;  1JJ2 P;  5CKH A;  1SRL A;  1RPY A;  5J26 A;  3CCJ A;  4OB1 B;  1WFW A;  2O01 E;  2K5L A;  3BKB A;  1JYQ A;  2FZC B;  1M61 A;  5DC9 A;  3CXC S;  1JU5 A;  2XID A;  1YJW A;  4Q5W A;  2D1X A;  2DZ9 A;  3PMT A;  3HRU A;  5GAO m;  2DEU A;  3ZEH A;  4B6M A;  2M0O A;  1KQ1 A;  1Y57 A;  2VAS A;  2X51 A;  1M1K C;  1O4J A;  1KC8 U;  1XJW B;  3OYK A;  2CDT A;  1YHQ A;  4M77 F;  5IHI A;  3JAM E;  1SF9 A;  1G2B A;  2P4T A;  3INZ A;  1K1Z A;  4M75 E;  1M27 C;  4R55 A;  3QDR B;  4RTZ A;  3MPU B;  2EL8 A;  4M75 D;  2PVG B;  2F2W A;  2PNB A;  4AG1 C;  1HJD A;  1LJO A;  3LX7 A;  4RCC A;  3CMA A;  1A1E A;  1Q7Y U;  1O45 A;  3ZL7 C;  2HZY A;  4HCZ A;  3JCM Q;  4OMM A;  5IBS A;  4XTY A;  4M75 G;  3RR6 A;  2HKN A;  1KHC A;  4BDY A;  4LDU A;  3L2Z A;  2LQ8 A;  2F2X A;  2EQM A;  3QKJ A;  2ABL A;  2J7I A;  3U23 A;  2RJE A;  4M77 B;  5D6Y A;  5GAM e;  1Q7Y C;  2PLD A;  5J39 A;  2QEX T;  2DXU A;  5I2M A;  1ZBJ A;  2ZZD A;  3PSJ A;  3VYH B;  3LH0 A;  1FU5 A;  4A4G A;  1B34 B;  4IIO A;  4K45 A;  3PIO A;  1VQL T;  2BKD N;  2DYB A;  2KGT A;  1D0Y A;  3ZFJ A;  5HCK A;  3RER A;  2E4H A;  2GF7 A;  2JTM A;  2GBQ A;  4JZ4 A;  1OYX A;  2E10 A;  3E2U A;  5CVI A;  1W2B P;  3HCK A;  4LDX A;  3CBL A;  4KH0 B;  3CCJ Q;  2G6F X;  5CQY A;  1N8R R;  3RMS A;  3DB4 A;  1M2V A;  3KXT A;  5DLQ E;  1VQ5 Q;  3V8L A;  3MXC A;  1IHW A;  4KUL A;  3UT1 A;  4RUG A;  4DBH A;  2NYS A;  1ZUY A;  4J83 A;  1O44 A;  2O31 A;  5DLO A;  3PVL A;  2SHP A;  2X3X D;  2HL3 A;  5LJ5 e;  2X9H A;  2MRJ A;  3H41 A;  5DC4 A;  2CRH A;  3RMQ A;  4JJN K;  5GMK j;  4PKC C;  1VYT A;  1Q82 R;  1WJR A;  1EIF A;  1LUI A;  3OS5 A;  4BAC A;  1GFD A;  3CCV A;  2DO3 A;  4E6R A;  4C0D B;  3BUX B;  2CUB A;  2QA4 Q;  1LKK A;  2EQK A;  4A4H A;  4AFZ C;  4X1V A;  2DF6 A;  3QG1 A;  4H1O A;  3GXX A;  3S8L A;  3G4S Q;  1O47 A;  2MK2 A;  3X25 B;  5J3X A;  2BIV A;  1LKL A;  4F7U A;  3JSC A;  1Q81 R;  1BI2 A;  4X9C A;  5DY9 A;  4FW2 A;  1NJI C;  3PSK A;  4M78 C;  2B8A A;  2RQV A;  4OB3 B;  3VGO A;  3M56 A;  5HK3 A;  3OSV A;  2JTF A;  1VQM T;  1GCQ A;  2EJG A;  1O4C A;  2RI2 A;  2EW3 A;  3UYO A;  3HL8 A;  2HEQ A;  2PU9 B;  2XP1 A;  2C0T A;  1U8R A;  3OYA A;  2DFU A;  1BLJ A;  4HVU A;  1EX4 A;  2LRQ A;  4KH1 B;  1A1C A;  5KYU A;  3M0Q A;  3GF5 A;  3OVE A;  1CKB A;  1YN8 A;  1YJN T;  1O4Q A;  3MXY A;  3CCQ A;  1VQP A;  4E93 A;  1VQ4 Q;  1QQJ A;  3G71 Q;  2VXF A;  5L8R E;  1Y96 B;  3CME T;  2ZCF B;  4ZTF A;  1D1B A;  1NPP A;  4JLI A;  2W0Z A;  3VS6 A;  4M77 E;  4FT2 A;  2DIL A;  2GNC A;  3CCS A;  5AXI A;  3G6E A;  3REA B;  3CCM T;  1U1T A;  3DKM A;  3BFM A;  4WTO B;  4M77 D;  1M3B A;  1JYR A;  5GJI A;  1YIT Q;  2JNG A;  2CRE A;  3OYD A;  2AKK A;  2X4J A;  3I55 A;  1FBV A;  2HDX A;  3BUW B;  5FWB A;  3J80 E;  3JRZ A;  3V7S A;  1ZFP E;  2K57 A;  2LDM A;  5L23 A;  3JCM c;  2OTJ Q;  3CPF A;  2RVF A;  4M77 G;  2EFI A;  1YHQ T;  3HHM B;  2DYI A;  2A3L A;  5IHN A;  1I0C A;  1AWJ A;  1OQK A;  4E7S A;  1LNX A;  2XHC A;  1ARK A;  1KQ2 A;  3M0T A;  1O43 A;  1MMN A;  4XK8 E;  1QKW A;  4MDX A;  1S72 A;  3LW5 E;  2C0O A;  1GCQ C;  5FU7 B;  3L2V A;  1SRM A;  5KE2 A;  5IXF A;  2QQS A;  2HUW A;  2K3X A;  1D0X A;  2FZK B;  3CPW A;  2QI2 A;  4OHL A;  3QYG B;  1BHH B;  3OYM A;  1EFN A;  1RAF B;  1WXT A;  3H0I A;  4BI8 B;  1O4P A;  2LCC A;  4QW2 A;  3M7F A;  1FBZ A;  2D8J A;  4JS4 A;  1KQS S;  1VQ6 A;  3SEM A;  3CD3 A;  3N84 A;  2YLB A;  5CIU A;  2ZPF B;  2YRV A;  3FRN A;  3FC3 A;  1JXO A;  2DNU A;  3UA7 A;  2C9W A;  1U1S A;  2CBL A;  1O4O A;  3MO8 A;  1NEB A;  1XTD A;  2QGG A;  2AZV A;  5KYX B;  3CXC P;  2IUG A;  4RTV A;  1I81 A;  1RAB B;  1O4L A;  3E19 A;  1R0C B;  1RAD B;  1RAI B;  2NUP A;  1KJW A;  3N5B B;  1AWW A;  1VQO Q;  2MCN A;  4XTW A;  3EFO A;  3SB2 A;  4RG8 A;  1YCY A;  1QWE A;  4ATO A;  2RMO A;  4C92 F;  1BCO A;  1UE9 A;  4KBM B;  2GTJ A;  3CCL A;  1TCE A;  5GAO q;  4C8Q A;  3BUO B;  4OB2 B;  4X34 A;  5GAN 8;  1A81 A;  3A8O B;  4LD6 A;  1WDX A;  1VQN Q;  2BZY A;  2YDL A;  4B9X A;  2KRN A;  1I4K 1;  3CCV T;  1OV3 A;  2K7A B;  1TZE E;  3PFV A;  2KNB B;  1QVP A;  2RHY A;  3UAT A;  3PGG A;  4BY6 C;  1BFJ A;  4PJO C;  1E6H A;  2AOA A;  2DL7 A;  2JM9 A;  2FVU A;  1FU6 A;  2KE9 A;  2ROR A;  4Y91 A;  4DQ2 A;  2K4Y A;  5LJ3 e;  8ATC B;  1SPR A;  3T04 A;  1O4H A;  3OP0 A;  5CQX A;  1DJ7 B;  4OHH A;  3CEY A;  1T0H A;  2E6N A;  1R77 A;  1C6V X;  1U06 A;  1PSE A;  4FCY A;  2MK5 A;  1JO8 A;  2ZPG B;  1VIE A;  1G3W A;  2ZAE A;  1TUC A;  3CCR A;  4M7A C;  4PK4 A;  4NOY A;  2R57 A;  2MPX C;  1Q95 G;  1NZV A;  2KYB A;  4BI3 A;  3O8V A;  1W2B S;  1O46 A;  2L4K A;  2AHJ B;  1AHJ B;  1UDL A;  5GMK l;  2F5T X;  5KCO A;  5CKF A;  4QQ6 A;  2DD4 A;  4NWG A;  3P8D A;  1K8A U;  4XTU A;  5GAM j;  2IG0 A;  4J9E A;  5HKZ A;  2CP6 A;  2JW4 A;  2M16 A;  8AT1 B;  1GRI A;  2MAM A;  1VQ7 A;  3T9N A;  1YI2 Q;  4XU0 A;  1YWO A;  1MUZ A;  2XU8 A;  1X6C A;  2COW A;  2LJ3 A;  1SHA A;  2KK4 A;  1M1F A;  3CCS T;  3OW2 P;  2DZC A;  2L3R A;  2XD0 A;  4A4B A;  4NWF A;  2HDA A;  2KMT A;  5GAN e;  2YUO A;  2A37 A;  2HSP A;  4X9D A;  3I55 T;  3M5A A;  3PLF B;  2I2L A;  4FBN A;  3CCU A;  1UEB A;  2EGE A;  2DXT A;  2HD0 A;  1QW1 A;  3FB9 A;  2EYZ A;  5LJ5 j;  1TTH B;  2X4Y A;  4A4F A;  1M2V B;  3EG9 A;  1YJ9 A;  4EMK A;  1CSZ A;  3CCE Q;  4DBR A;  3CBP A;  3LWI A;  1TG0 A;  3S3O A;  3TEE A;  3QSU A;  2KXC A;  4XTX A;  4K11 A;  3VRZ A;  3ULR B;  1S72 T;  1LUM A;  1E7O A;  3K2T A;  2OQ1 A;  4F7U F;  3L2Q A;  2D8H A;  4EDU A;  3RBB B;  4J5Y A;  1BCM A;  2FEI A;  4AFU C;  4GWF A;  1AD5 A;  2XG8 D;  5D6W A;  1VQ9 Q;  3L42 A;  2RB6 A;  3OYB A;  1VQ6 T;  5KH6 A;  1VQ7 Q;  1AOJ A;  1T0J A;  4A4K A;  1SPS A;  1PRM C;  2LX7 A;  4F7U B;  3MJX A;  1X2K A;  2HL5 C;  2HKQ B;  3UWN A;  2RJC A;  1RQQ C;  2A0F B;  4C92 E;  2HQE A;  2O2O A;  3JCM b;  3MET A;  2CH4 A;  5FRO A;  1XOV A;  3MAZ A;  4JPB W;  1QVG A;  4DGX A;  2F5K A;  2EKX A;  4C0Z A;  4UC4 A;  2EKO A;  2JM8 A;  3VS3 A;  2EQJ A;  3NTI A;  1O41 A;  2FCI A;  4L59 A;  2I0N A;  2IZV A;  4OMN A;  3OYN A;  2LTO A;  2LMJ A;  1XA6 A;  5KYW A;  1GXI E;  1K9M R;  3X28 B;  1M1G A;  4L5G A;  3M0U A;  3WVE B;  4C92 G;  2EQI A;  2JN0 A;  3OYI A;  1HD3 A;  5KYU B;  2QDY B;  1IS0 A;  1WPY A;  4J9B A;  1VQK Q;  3WA4 A;  1Y0M A;  2K5I A;  1M27 A;  2K3B A;  3OYJ A;  2RNA A;  2GGR A;  1YIJ Q;  5EHP A;  3GOX A;  2YXY A;  1WHL A;  4C5E A;  1SHB A;  4QQG A;  2E3I A;  3FDR A;  2LVM A;  2WSE E;  1ZBX A;  1YCS B;  2VGM A;  3CC7 Q;  4QKU A;  2DM0 A;  2AT1 B;  5GJH A;  2QEX Q;  2ESW A;  3VYG A;  1KK7 A;  2AKL A;  4FM4 B;  2PVD B;  2XIC A;  2EJ9 A;  4DA4 A;  1UHC A;  5HKY A;  2FL7 A;  3RIR A;  1VQL Q;  2LNH B;  2AUG A;  4CC2 A;  3JCM d;  5FLX E;  1KQS P;  4J6X A;  4E47 A;  1VYU A;  4XQ3 A;  2C0I A;  5FRN A;  3S8N A;  3S3N A;  2XDP A;  2HQX A;  2QTX A;  4RTY A;  1IHV A;  5A2Q E;  2HDV A;  2HSE B;  2HBP A;  3PS5 A;  2ZPB B;  1MV0 B;  1RAE B;  4PJN A;  3J7A F;  5EEL A;  2LJ1 A;  4BDZ A;  4KGX B;  3QII A;  3OQ5 A;  1M90 U;  1YVL A;  3L1A A;  2SRC A;  1O48 A;  1KD1 U;  4NL2 A;  3C4S A;  2NWM A;  2JS0 A;  5I2S A;  1N9R A;  4JS5 A;  1VQ5 A;  1K73 R;  3TU4 K;  3M55 A;  2BZ8 A;  2V26 A;  5HKC A;  2M02 A;  1ABO A;  2GSB A;  1WHK A;  5IBM A;  1I3Z A;  1M30 A;  2OTL A;  3VRP A;  4HA8 A;  2YUN A;  1W1F A;  1SSH A;  2RJD A;  4BI4 A;  4ANJ A;  3JCM X;  1QCF A;  1WQU A;  3IMJ A;  1CSY A;  4J7I A;  1M90 C;  4P5N A;  1M8V A;  4HXJ A;  4E7J A;  2HNI A;  1KD1 C;  5CCA A;  1CSK A;  4CC7 A;  1KC2 A;  3VS2 A;  2MRK A;  3GBQ A;  1O4F A;  2MMP A;  3EAC A;  4M7D A;  3V7R A;  3I9Q A;  2YLC A;  4Y92 A;  4D6W A;  1K0X A;  1Y1U A;  2R5M A;  3VS5 A;  4C8Q F;  1Q86 U;  2QA4 A;  4K2R A;  2LCL A;  5KAZ A;  2KK6 A;  4AG2 C;  5DM7 R;  1N6A A;  2EVR A;  4ZN3 A;  4F7U E;  3CCU T;  4K44 A;  4PLL A;  3G4S A;  2LX9 A;  2Y90 A;  2E6Z A;  1O4K A;  1O4D A;  2NUP B;  4GLK A;  1F1W A;  4LUE A;  2AOB A;  1SKU B;  3OS0 A;  4XAX B;  3GQI B;  4MZM A;  2K79 A;  1VQM Q;  2QDL A;  4OF1 A;  1Q86 C;  3EFO B;  2MIO A;  3BY7 A;  3S9K A;  2JVV A;  4F7U G;  3UA6 A;  5C0M A;  1J3T A;  3A98 A;  4M78 A;  5I22 A;  1WHH A;  4C8Q B;  1O4M A;  1O4I A;  3L2W A;  1IRX A;  1CWE A;  4TZI A;  2RN8 A;  1YWP A;  2EYV A;  1GBQ A;  2GQI A;  3M4G A;  1CWD L;  2J06 A;  5LJ3 j;  1KSW A;  2JJ9 A;  3HFO A;  4N4I A;  2KT1 A;  2QXF A;  2ECD A;  4QQD A;  4ME7 A;  1VQ4 A;  3G71 A;  3R6O A;  1G3S A;  2OTL Q;  3EGU A;  2MWO A;  2L3Q A;  2O4X A;  3VRY A;  3UPU A;  3CCM Q;  3SDZ A;  3QJ6 A;  4M7D C;  3C95 A;  2PNA A;  4LDY A;  1M2O A;  5HKW A;  3JV3 A;  1ZA1 B;  1K76 A;  2K3Y A;  3QYH B;  4AT1 B;  3OYC A;  4ZGJ B;  3OW2 S;  4E2F B;  1W70 A;  4QVD A;  1YIT A;  1VQ8 T;  1H3Z A;  2LP5 A;  3QHS A;  2VIF A;  1MND A;  1NPR A;  1NJI U;  5I6V A;  2OI3 A;  1RAA B;  2P4R A;  2FYK A;  2VB6 A;  3G7Z A;  1O4B A;  2RQT A;  2OTJ A;  4JJD A;  2CGH A;  1B07 A;  1QMC A;  4RTU A;  1V76 A;  1W4S A;  2EJF A;  4XU1 A;  2CYZ B;  3RUX A;  1A1A A;  2P84 A;  2A28 A;  1GCP A;  5AUL A;  1G83 A;  3OBY A;  2KXD A;  1D1C A;  4DEX A;  2YU7 A;  1WA7 A;  1KHI A;  5GAN j;  3RKX A;  1RJA A;  1H92 A;  3CD6 Q;  1A07 A;  1O49 A;  2BE9 B;  2FB7 A;  2ZPI B;  3K2M A;  5AYF A;  2DLY A;  5IT9 E;  2CT4 A;  1SHF A;  3EFS A;  4NL3 A;  3A8H B;  4PNO A;  4J7F A;  2DEQ A;  2X4X A;  1XNI A;  4GPL B;  1VOM A;  3EGD A;  5GAM d;  4RKU E;  3EG9 B;  2V1Q A;  4EMK B;  2J6F A;  4WF2 A;  4ELZ C;  4XZ1 A;  1FXX A;  2DVJ A;  1BFI A;  5A0L A;  5GAN 4;  3CC4 Q;  2X3W D;  3BE3 A;  2IIM A;  3EH1 A;  3CCJ T;  1RI0 A;  1UHF A;  1UJ0 A;  1YJW T;  2COZ A;  1BIA A;  2L0A A;  1XQH A;  2PNI A;  2EYY A;  1VQ5 T;  2QQ9 A;  1BKB A;  2GCX A;  1VQO A;  1JEG A;  1JYU A;  4D8D A;  5AT1 B;  4A4E A;  4C8Q E;  3EG0 A;  2QTV A;  4OHI A;  1TS9 A;  1O4R A;  1BG1 A;  2RHZ A;  1JWO A;  4C8Q D;  3A8M B;  4QVC A;  2BE7 D;  4H34 A;  2AK5 A;  1UUE A;  4JJB A;  2QQR A;  2WAC A;  1SPK A;  5LJ5 d;  3V7C A;  1VQN A;  3I35 A;  2MQI A;  1N5Z A;  3CMA T;  1UUS A;  1H64 1;  4JUV A;  1QKX A;  2M0Y A;  2KY9 A;  1SHD A;  4C8Q G;  3QZ5 B;  2EQU A;  2DBK A;  3OB1 B;  3CC2 Q;  2QA4 T;  3OYH A;  2CIA A;  3CXL A;  5GAN 3;  3EGX A;  2J6O A;  2WSF E;  4F04 B;  2DET A;  4QSY A;  1ZSZ C;  2VVK A;  3QWX X;  3V8K A;  2QYZ A;  3G4S T;  1PRL C;  4PJO A;  1AT1 B;  2D9T A;  1WHJ A;  3OS1 A;  1X43 A;  4F14 A;  1K73 C;  2JS2 A;  3RKY A;  3THK A;  2Y1M A;  4HCC A;  5KYW B;  1OO3 A;  3JCM g;  1JB0 E;  1QVF P;  2ZPE B;  3TSZ A;  4J6Y A;  4E7H A;  2F1L A;  3C0C A;  5IHK A;  1JJ2 A;  1H3H A;  1K0S A;  4C5H A;  2PUK B;  4AFS C;  4M7A A;  2R58 A;  4KUI A;  5GJW B;  2DCR A;  3FLG A;  3E9F A;  2RD1 A;  4IUP A;  1Y71 A;  2E1H A;  2IVW A;  2CH4 W;  4EMH A;  2EGA A;  1G3Y A;  2YSX A;  1CJ1 A;  2FRW A;  1Z3K A;  5GMK i;  3PJP A;  3VS1 A;  5GMK m;  4JRP A;  2Y4Y A;  1RLQ C;  3OBW A;  3MP8 A;  4AFQ C;  5KE3 A;  3G71 T;  1GBR A;  2Z0W A;  1YI2 A;  3I56 Q;  1D1Z A;  2D6F A;  4JGH A;  2CP3 A;  4ELY C;  4J9G A;  3N8M A;  5HY6 A;  1N8R U;  4WCI A;  1Z9Z A;  1A1B A;  4CI0 C;  3JCM f;  2J6K A;  1TSF A;  1IGQ A;  3DLM A;  1YIT T;  2CKK A;  1B47 A;  2DXB A;  5CKD A;  5LL6 S;  1B7T A;  1BBZ A;  3JCM W;  4OML A;  3H0F A;  2CZ1 B;  3JCM V;  2CI8 A;  1X6O A;  2OTJ T;  1O4G A;  3UF4 A;  4J9C A;  5GAN 7;  1N8R C;  1D0Z A;  2OZO A;  4JDS A;  2BZX A;  1NLP C;  5IN1 A;  1Q82 U;  2CI9 A;  4LE9 A;  5EG2 A;  3CCE A;  1AB2 A;  2IUH A;  3LYV A;  2QMS A;  1IZ6 A;  2O88 A;  2MI6 A;  3M59 A;  1M1K R;  3IMD A;  2AZS A;  2DX1 A;  2HBW A;  2A08 A;  4QVZ A;  1OI1 A;  1W2B A;  2RJF A;  1MV3 A;  1M4Z A;  2OX7 A;  1OZ2 A;  2EYQ A;  5KYY A;  3IN7 A;  2PUO B;  2JT4 A;  1LOJ A;  2DA9 A;  5M9O A;  1Q82 C;  1O75 A;  2LQN A;  1NE8 A;  4M7D B;  4WWQ A;  3OA6 A;  3JB9 F;  2EO3 A;  1TUG B;  4M78 F;  4M4Z A;  3QUI A;  1X6B A;  2LNW A;  4FSX A;  1VQ9 A;  1KC8 R;  3HSB A;  2DXC A;  1LCK A;  3X24 B;  3CWG A;  2EYX A;  5CDW A;  3VS7 A;  2L2P A;  2RQR A;  3GNG A;  2RSY A;  2DKG A;  3CCQ T;  1VQP T;  4EY0 A;  3TVT A;  4F59 A;  4LXC A;  4B9W A;  4M77 C;  4P9V A;  2DAQ A;  3EG3 A;  2K9G A;  3AHU A;  4E68 A;  3MKD A;  1UJY A;  2KEA A;  3PQZ A;  1Q81 C;  4N4H A;  1Q7Y R;  1QAD A;  2K79 B;  4U17 A;  2B3O A;  3G6E T;  3H0H A;  3M9Q A;  1VUB A;  1ABQ A;  1MHN A;  2RK2 A;  2PZ1 A;  5EEQ A;  4M78 B;  5D0J A;  3HTR A;  1S1N A;  7AT1 B;  2RHX A;  3C94 A;  2EO6 A;  2H5K A;  1SHG A;  3NHN A;  4Z88 A;  4DGP A;  4AMC A;  5GMK h;  3HHT B;  1I8F A;  4JZ3 A;  3RKW A;  4JLG A;  2Y4X A;  3VUB A;  2P0Q A;  1VQK A;  2RHU A;  5CKB A;  1D1A A;  5DC0 B;  1VQN T;  4ZNX A;  1I07 A;  1YIJ A;  3M54 A;  2O4X B;  1N9S A;  1V29 B;  2E5K A;  3BDU A;  2E3H A;  1VYV A;  1M9S A;  4EIK A;  2CP2 A;  4PL6 A;  3OY9 A;  4OMP A;  1FYR A;  4JRQ A;  1AYB A;  3CC7 A;  3DB3 A;  1F1B B;  4BUG A;  5FU6 C;  2DIQ A;  4J8O A;  4ORZ A;  2QEX A;  3ZNI A;  2OAW A;  3LGL A;  5C6S A;  2DL8 A;  2FPD A;  1P92 A;  4F17 A;  3OMC A;  2JYQ A;  1EZZ B;  1VQL A;  1OPK A;  4HVW A;  2OAU A;  1YFN A;  1I5O B;  4C0G A;  1UUR A;  2H3E B;  2L5Q A;  4A4C A;  2Y3A B;  5LJ3 d;  3TCJ A;  3MEV A;  4JRI A;  1RLP C;  3FJP A;  2A7Y A;  3NTK A;  3KFJ A;  2RI5 A;  2W10 A;  3JCM h;  3RNJ A;  4IUQ A;  1LVK A;  2X4W A;  5HK0 A;  4FIB A;  1BKL A;  1V1C A;  2K6D A;  1X0N A;  3QWY A;  4IUR A;  5GAM g;  4FL3 A;  4BE2 A;  2L8D A;  4J9H A;  3SHW A;  1R0B G;  1NEG A;  2MYS A;  5GAN 2;  1NLO C;  2EYW A;  1NJI R;  3LYI A;  1ZA2 B;  4IIM A;  3MEW A;  4O5V A;  2RM4 A;  1UGV A;  2GTO A;  3ME9 A;  4IUV A;  1SG5 A;  2KI7 A;  2KRO A;  1YI2 T;  2LNX A;  2HCK A;  4D8K A;  1N27 A;  1NM7 A;  3QXE B;  4KT0 E;  1F2F A;  1AVZ C;  3QDF A;  2NUT A;  2QGF B;  5GAO p;  3CCL T;  3QJY A;  1QVG S;  4M7D D;  2CP7 A;  2HAX A;  1OUL A;  4E7L A;  4OVA A;  3EGD B;  4ZGD B;  2R5A A;  1QWF A;  1WLP B;  5LJ5 g;  2HMH A;  3MCA B;  5GAM f;  2QQB A;  2DM1 A;  4RMO A;  4LDW A;  2DPP B;  5D7U A;  5A0D A;  3A5Z B;  3X26 B;  5GAN d;  4LNP A;  1AYA A;  1BI1 A;  3MP6 A;  1H9O A;  1FX7 A;  1FYN A;  2RPN A;  4RG2 A;  4A54 A;  6AT1 B;  1C1A A;  5IXB A;  1TWB A;  1ZUK A;  1LPL A;  1VQM A;  1WIE A;  1PD1 A;  3OB9 A;  4M78 E;  4PJO F;  2LJ0 A;  3CPW P;  4DBF A;  2BBU A;  3JB9 D;  3FEO A;  2EIF A;  3CCR T;  3EAE A;  1D4W A;  4M78 D;  1AOU F;  2V8J A;  3M58 A;  4NS5 A;  1QVF S;  4R56 A;  1PHT A;  1A0N B;  4JE4 A;  1JBM A;  2DJQ A;  4EIH A;  1K4U S;  3P8B B;  3CXC A;  1TUD A;  1BHF A;  3JB9 G;  4GBQ A;  3MP1 A;  4M78 G;  1AEY A;  3EHR A;  5LJ5 f;  1U3O A;  1VQ9 T;  4M7A F;  2AIR B;  1RL2 A;  4J9D A;  2GFU A;  3EGX B;  4OGE A;  1W6X A;  1TXQ A;  1VQ7 T;  1R8O B;  1X27 A;  2JUF A;  4BY6 B;  4FYW B;  4DOV A;  4PJO B;  4P9Z A;  5GAO r;  2BUD A;  3VKI A;  3CCM A;  2MC1 A;  1GFC A;  4OHD A;  5FW9 A;  2Y1N A;  1BIB A;  3AT1 B;  1TOV A;  1VQ8 Q;  1YP5 A;  4C92 A;  1T3L A;  2VKN A;  4HT8 A;  1OU9 A;  1JQQ A;  1D09 B;  1KA6 A;  4F5B A;  1YVH A;  1ZX6 A;  3SD4 A;  1IB8 A;  1PKT A;  2L3S A;  3S6W A;  3LLR A;  2QG9 B;  4M7A B;  1WGS A;  1SSF A;  2ROT A;  2LCT A;  4ZGE B;  2CUD A;  4FW1 A;  1ZSG A;  4MZT A;  4PLI A;  2L89 A;  1PC0 A;  4DBQ A;  1YJ9 T;  3D7S B;  2ENM A;  1BMB A;  4V2S A;  1FMK A;  1KC8 C;  1X75 C;  2B86 A;  1VQK T;  2V8I A;  1Y07 A;  2GQV A;  2EGC A;  3DLL A;  3HRS A;  4N0A C;  2XDD A;  1YIJ T;  1JRI A;  2FPE A;  2RF0 A;  4F5A A;  3M0P A;  4YTL A;  3OV1 A;  2IPO B;  1MMG A;  2O9S A;  5FRM A;  3CD6 A;  3H8Z A;  2OJ2 A;  4MMK A;  4ESR A;  1IXD A;  2RI3 A;  3CC7 T;  2KNO A;  1M3A A;  2DIG A;  1BK2 A;  1YJN Q;  2ATC B;  2FZG B;  2MWP A;  2ZPH B;  3OMG A;  2QAZ A;  1MGQ A;  1K9A A;  1E6G A;  1PIC A;  2DE0 X;  1QCN A;  4RTX A;  1BKM A;  1X69 A;  3CME Q;  5KYN A;  2WSC E;  2F69 A;  3LWH A;  3RES A;  3BUN B;  1NZL A;  1WHM A;  1JU5 C;  2CZ7 B;  5GAO l;  3QZ9 B;  4C92 C;  4GLM A;  3CC4 A;  1YJW Q;  2LRA A;  3IQL A;  5IAY A;  4JEG A;  1WXU A;  4CRI A;  3OW2 A;  1VA7 A;  2KBT A;  1RUW A;  2LC4 A;  2E12 A;  1PSF A;  2DTO A;  5GAM h;  3SWN A;  3NMZ C;  2YRC A;  1YHQ Q;  2VV5 A;  2LCS A;  2FO0 A;  1UGQ B;  1OPL A;  4GL9 E;  3CQT A;  5KYY B;  4L6V 5;  4E7I A;  3S3M A;  4F16 A;  1ACM B;  1D3B A;  2CP0 A;  4M75 A;  2DRK A;  2CZ6 B;  5GAN 5;  5FU6 B;  3EAZ A;  3CMA Q;  2RHI A;  2QAS A;  2YUQ A;  3OYE A;  3QPH A;  1AZE A;  3VRO A;  3NPF A;  3REB B;  2DMO A;  3VS0 A;  1WZO A;  1U5S A;  1YBY A;  1BF5 A;  2ECZ A;  1UFF A;  4ZN1 A;  2DVE A;  1MW4 A;  4Z02 A;  2XKO C;  4DOW A;  1R1Q A;  3Q1J A;  3NFC A;  4GY5 A;  3CC2 A;  4PJO E;  4VUB A;  1K9M U;  1IRE B;  3BDL A;  4KUD K;  1RI9 A;  5LJ5 h;  2CP5 A;  4FYV B;  4PJO D;  3JCM J;  1K8A R;  2EBP A;  4HT9 A;  4KGZ B;  1ZSZ A;  2DJZ A;  2QQA A;  3PTA A;  3ASK A;  1MMD A;  2VWF A;  4XU3 A;  2F2V A;  1UB4 A;  3QO3 A;  3EG1 A;  3KUF A;  4PJO G;  2KVQ G;  1K9M C;  4M7A E;  1OZ3 A;  3HP9 A;  3VJP A;  1BLK A;  3PT9 A;  1M3C A;  4Z89 A;  3H6Z A;  4LUD A;  2E5Q A;  2GFA A;  1HXD A;  5LJ3 g;  3NGP A;  4M7A D;  3TSW A;  1QP2 A;  1WNL A;  2ETZ A;  3SWN C;  4C0F A;  4A63 B;  1UEC A;  1BYM A;  5EG3 B;  1M5Q 1;  3C12 A;  4KRT A;  2GE9 A;  3I5S A;  2JZ2 A;  2PTK A;  2C06 A;  4M7A G;  1P13 A;  1OU8 A;  4Z8A A;  4M75 C;  3EG2 A;  2OTL T;  4IUU A;  2DLZ A;  3I56 A;  2EOB A;  2JMA A;  3EFR A;  4PJJ A;  3WVD B;  1RAG B;  1T3S A;  5GAN 6;  1X6G A;  2DD5 A;  2KSS A;  2EWN A;  5A0G A;  2V1R A;  1PNJ A;  2RH2 A;  3CCV Q;  3MEA A;  2YT6 A;  1QVG P;  1GHU A;  4PFP A;  3MEU A;  3PMI A;  2KR3 A;  2DTI A;  3M57 A;  1K73 U;  3HIZ B;  4OMQ A;  4RTW A;  3EH2 A;  3TRE A;  1AWO A;  1A08 A;  1KFZ A;  1NRV A;  3FJ5 A;  4J6W A;  5LJ3 f;  4O6J A;  1MNE A;  4FL2 A;  1QCO A;  3VU3 C;  4EPC A;  5I21 A;  4OMO A;  1HK9 A;  1D4T A;  2H46 E;  1FMW A;  2QK0 A;  4II1 A;  2VC8 A;  1IJR A;  2LT1 A;  2YUP A;  1G8X A;  2DBM A;  3CBM A;  4J9I A;  4FL6 A;  3PNW C;  4ROJ A;  9ATC B;  1I1J A;  1KQS A;  2YSQ A;  1SEM A;  2RO0 A;  1HYO A;  1IGU A;  4KGV B;  2K5F A;  2H8H A;  2KQW A;  3M4Y A;  5GAN g;  3JCM P;  1FHS A;  3BUM B;  5BO4 A;  3URG A;  5GAO n;  1SKJ A;  4JJC A;  4HCK A;  2CS7 A;  4OGC A;  2M9U A;  3CPW S;  2BTT A;  2SEM A;  4XU2 A;  2CT3 A;  5CAI A;  3CD6 T;  4MML A;  4E7K A;  2A36 A;  2NUT B;  4PFZ A;  2DTH A;  1HCT B;  1HSQ A;  2LT4 A;  2DL3 A;  3CCQ Q;  1VQP Q;  3JB9 J;  3EHQ A;  4IKF A;  5GJV B;  1WI7 A;  2NUZ A;  2YHT A;  4CC3 A;  1H8K A;  2E65 A;  2EPD A;  1VQ4 T;  2EKH A; 
#chains in the Genus database with same CATH homology
 2XMF A;  2O9V A;  2E5K A;  2BZ8 A;  5EHR A;  1VYV A;  4EIK A;  1ABO A;  2GSB A;  1FYR A;  4OMP A;  5IBM A;  1I3Z A;  1AYB A;  2DL4 A;  3PSK A;  1M30 A;  2DX0 A;  1A09 A;  2RQV A;  3VRP A;  2YUN A;  1W1F A;  1SSH A;  4ORZ A;  3VS4 A;  1QCF A;  1YNZ A;  1WQU A;  3ZNI A;  3IMJ A;  3S8O A;  2OAW A;  3VGO A;  1CSY A;  2DL8 A;  2FPD A;  4HXJ A;  4F17 A;  2JYQ A;  1GCQ A;  1O4C A;  2EW3 A;  1OPK A;  4HVW A;  3UYO A;  2DRM A;  2HEQ A;  1CSK A;  3R6N A;  4CC7 A;  1KC2 A;  3VS2 A;  2XP1 A;  2C0T A;  3GBQ A;  2MRK A;  1UUR A;  4A4C A;  1O4F A;  1WYX A;  2Y3A B;  3EAC A;  1BLJ A;  2MOX A;  4HVU A;  2CSQ A;  1RLP C;  2EU0 A;  3I9Q A;  3IN8 A;  4Y92 A;  1K0X A;  1A1C A;  1Y1U A;  4U1P A;  3M0Q A;  3O5Z A;  3VS5 A;  3KFJ A;  2W10 A;  3OVE A;  1CKB A;  1YN8 A;  1O4Q A;  3MXY A;  3RNJ A;  4K2R A;  4E93 A;  4XZ0 A;  2KK6 A;  5KAZ A;  1BKL A;  1V1C A;  4AG2 C;  2K6D A;  2EVR A;  1X0N A;  3QWY A;  4K44 A;  4FL3 A;  4J9H A;  3SHW A;  1NEG A;  1LUN A;  1O4K A;  1NLO C;  2EYW A;  1O4D A;  2W0Z A;  3VS6 A;  2CSI A;  4LUE A;  1F1W A;  2AOB A;  3OB2 B;  1OOT A;  2DIL A;  3PVQ A;  4IIM A;  1AOT F;  2GNC A;  5FWC A;  3GQI B;  5AXI A;  2K79 A;  1UGV A;  2GTO A;  1PKS A;  3REA B;  2QDL A;  1JXM A;  1M3B A;  1JYR A;  5GJI A;  2KRO A;  2MIO A;  3S9K A;  2LNX A;  2CRE A;  3UA6 A;  2AKK A;  1J3T A;  4FSS A;  2HCK A;  1FBV A;  2HDX A;  3A98 A;  3BUW B;  5FWB A;  4D8K A;  1CKA A;  1NM7 A;  3VRR A;  1ZFP E;  5I22 A;  1O4M A;  5L23 A;  1O4I A;  1F2F A;  1AVZ C;  2RVF A;  4RTT A;  1CWE A;  3C7I A;  3HHM B;  3VRQ A;  4TZI A;  5IHN A;  1I0C A;  2RN8 A;  4LN2 A;  1YWP A;  2EYV A;  1AWJ A;  4CC4 B;  1GBQ A;  2GQI A;  1CWD L;  2J06 A;  1ARK A;  1KSW A;  2LZ6 B;  1QWF A;  1WLP B;  3M0T A;  4J9F A;  1O43 A;  2KT1 A;  2ECD A;  2HMH A;  2ED0 A;  1AYD A;  1QKW A;  2ROL A;  2DM1 A;  2C0O A;  1GCQ C;  3EGU A;  2L3P A;  4X6S A;  1SRM A;  5I11 A;  4LNP A;  2L3Q A;  1AYA A;  3VRY A;  2CS0 A;  5IXF A;  1H9O A;  2HUW A;  1O4E A;  1FYN A;  2D0N A;  2RPN A;  2JTE A;  3M0R A;  1BB9 A;  4OHL A;  1UTI A;  2PNA A;  2KRM A;  1BHH B;  5IXB A;  2CR4 A;  1R1S A;  5HKW A;  3JV3 A;  1EFN A;  4OHE A;  1K76 A;  1ZUK A;  1WXT A;  1WIE A;  3H0I A;  2LJ0 A;  1W70 A;  2M51 A;  1O4P A;  2BBU A;  2LP5 A;  3M7F A;  1FBZ A;  2D8J A;  1Z9Q A;  3M0S A;  1D4W A;  2VIF A;  1AZG B;  1AOU F;  3SEM A;  5I6V A;  2OI3 A;  1PHT A;  3CD3 A;  3N84 A;  2P4R A;  1A0N B;  2LQW A;  4JE4 A;  1O4B A;  2DJQ A;  2RQT A;  1JXO A;  4JJD A;  1K4U S;  4EIH A;  2DNU A;  1B07 A;  3UA7 A;  2C9W A;  4RTU A;  2NWM A;  1TUD A;  1BHF A;  1HCS B;  1R1P A;  1O4O A;  1AYC A;  2CBL A;  4GBQ A;  2FPF A;  1NEB A;  3TL0 A;  1AEY A;  3EHR A;  1A1A A;  1U3O A;  1PWT A;  2A28 A;  3GXW A;  1GCP A;  4J9D A;  5AUL A;  2FRY A;  2AZV A;  2IUG A;  2L6K A;  1G83 A;  4RTV A;  2KXD A;  1W6X A;  4DEX A;  4DEY A;  1O4L A;  2YU7 A;  1WA7 A;  1X27 A;  3LH5 A;  1KJW A;  1NG2 A;  1AWW A;  4P9Z A;  1RJA A;  1H92 A;  1A07 A;  2MC1 A;  1GFC A;  1O49 A;  5FW9 A;  1OO4 A;  4OHD A;  2MCN A;  2Y1N A;  1M8M A;  1X2Q A;  3K2M A;  2DLY A;  1YP5 A;  1QWE A;  2CT4 A;  1SHF A;  1T3L A;  2RMO A;  5EC7 A;  2VKN A;  1WX6 A;  2FG0 A;  1JQQ A;  1UE9 A;  3N7Y A;  2GTJ A;  2J05 A;  1KA6 A;  1TCE A;  4F5B A;  1O4A A;  1YVH A;  3BUO B;  1ZX6 A;  1A81 A;  1KIK A;  1PKT A;  1WDX A;  2L3S A;  2BZY A;  2YDL A;  2KRN A;  4GPL B;  2ROT A;  1BU1 A;  2LCT A;  2CUD A;  4R0K A;  1OV3 A;  1ZSG A;  1TZE E;  2K7A B;  3PFV A;  2KNB B;  2JMC A;  2V1Q A;  3UAT A;  2J6F A;  4XZ1 A;  1BFJ A;  2ENM A;  1BMB A;  2DVJ A;  1E6H A;  2L3T A;  1BFI A;  2AOA A;  2DL7 A;  1FMK A;  2JM9 A;  2JXB A;  2X3W D;  2B86 A;  1FU6 A;  2IIM A;  3KFV A;  2KE9 A;  2ROR A;  2EGC A;  1UHF A;  1GL5 A;  1UJ0 A;  1SPR A;  2KRS A;  1O4H A;  3T04 A;  3OP0 A;  2L0A A;  2FPE A;  2RF0 A;  2PNI A;  4F5A A;  2EYY A;  3M0P A;  3OV1 A;  1BHH A;  4OHH A;  2O9S A;  1B3Q A;  1OEB A;  1T0H A;  2OJ2 A;  4ESR A;  1U06 A;  1JEG A;  1JYU A;  1LCJ A;  4D8D A;  1JO8 A;  2IUI A;  3TKZ A;  2KNO A;  1QLY A;  1M3A A;  1TUC A;  3EG0 A;  3PE0 A;  1BK2 A;  4OHI A;  1O4R A;  2DLP A;  1BG1 A;  1NZV A;  1K9A A;  2KYB A;  1E6G A;  1JWO A;  2DE0 X;  1PIC A;  4RTX A;  1BKM A;  1X69 A;  1O46 A;  2L4K A;  4H34 A;  2AK5 A;  1UUE A;  2KYM A;  4JJB A;  5DF6 A;  1O4N A;  1BM2 A;  1LUK A;  5ECA A;  1SPK A;  1UDL A;  1MIL A;  3I35 A;  2MQI A;  4QT7 A;  1N5Z A;  1UUS A;  3BUN B;  1NZL A;  1WXB A;  1ZLM A;  1QKX A;  1JU5 C;  2M0Y A;  2RMX A;  4NWG A;  1SHD A;  2DBK A;  2RQU A;  3OB1 B;  4GLM A;  4J9E A;  2CIA A;  3CXL A;  5HKZ A;  1ZUU A;  2JW4 A;  1GRI A;  2J6O A;  3IQL A;  2K2M A;  4JEG A;  4QSY A;  1WXU A;  2VVK A;  3QWX X;  1NYG A;  1VA7 A;  2KBT A;  5IH2 A;  1AWX A;  1RUW A;  2DL5 A;  1YWO A;  1MUZ A;  1PRL C;  2KT8 A;  1X6C A;  4L1B B;  3NMZ C;  1X43 A;  2LCS A;  2LJ3 A;  4F14 A;  2JS2 A;  1QG1 E;  1SHA A;  2FO0 A;  1OPL A;  4GL9 E;  3THK A;  3CQT A;  4A4B A;  1UG1 A;  4HVV A;  2Y1M A;  4NWF A;  2HDA A;  1O42 A;  4F16 A;  1OO3 A;  2RQW A;  2YUO A;  2A37 A;  1NYF A;  2ED1 A;  1KA7 A;  2HSP A;  3US4 A;  2DRK A;  3TSZ A;  3VRN A;  3C0C A;  1H3H A;  5IHK A;  3EAZ A;  1K0S A;  1IO6 A;  4AFS C;  3PLF B;  4FBN A;  2YUQ A;  2PLE A;  2EGE A;  5GJW B;  2DCR A;  3I5R A;  2EYZ A;  1AZE A;  2K7A A;  3VRO A;  1CSZ A;  3NPF A;  3REB B;  2DMO A;  3VS0 A;  2CH4 W;  1U5S A;  1BF5 A;  2ECZ A;  2EGA A;  1SRL A;  1UFF A;  1MW4 A;  1RPY A;  1CJ1 A;  2YSX A;  2FRW A;  1Z3K A;  1R1Q A;  3VS1 A;  3PJP A;  1WFW A;  1TG0 A;  3BKB A;  1JYQ A;  5DC9 A;  1M61 A;  1RLQ C;  2KXC A;  4AFQ C;  1JU5 A;  4K11 A;  3VRZ A;  3ULR B;  1LUM A;  1GBR A;  1E7O A;  1RI9 A;  2D1X A;  1D1Z A;  2OQ1 A;  4JGH A;  1Y57 A;  2EBP A;  1O4J A;  2D8H A;  4J9G A;  2CDT A;  3N8M A;  4WCI A;  5IHI A;  1Z9Z A;  2VWF A;  1A1B A;  1G2B A;  3RBB B;  2F2V A;  1K1Z A;  3EG1 A;  2J6K A;  2FEI A;  4AFU C;  4GWF A;  1AD5 A;  1M27 C;  2EL8 A;  4RTZ A;  1BLK A;  1B47 A;  2F2W A;  1BBZ A;  2PNB A;  1M3C A;  4AG1 C;  4OML A;  3H0F A;  4Z89 A;  1HJD A;  4LUD A;  1A1E A;  3NGP A;  1O45 A;  3ZL7 C;  3TSW A;  1AOJ A;  2CI8 A;  1O4G A;  2ETZ A;  3UF4 A;  4A63 B;  4J9C A;  4OMM A;  1T0J A;  5IBS A;  1SPS A;  2OZO A;  1PRM C;  1UEC A;  2LX7 A;  5EG3 B;  2BZX A;  1NLP C;  4KRT A;  1X2K A;  2CI9 A;  2GE9 A;  1RQQ C;  4LE9 A;  3I5S A;  2PTK A;  1P13 A;  2F2X A;  2IUH A;  1AB2 A;  2O2O A;  2QMS A;  2O88 A;  2CH4 A;  2ABL A;  2J7I A;  4Z8A A;  3U23 A;  3EG2 A;  3IMD A;  1XOV A;  2AZS A;  4JPB W;  3MAZ A;  2DX1 A;  4DGX A;  2HBW A;  2A08 A;  2DLZ A;  2EKX A;  2PLD A;  2EOB A;  2JMA A;  1ZBJ A;  3PSJ A;  2JM8 A;  3VS3 A;  1O41 A;  1T3S A;  1FU5 A;  2FCI A;  1MV3 A;  1X6G A;  2I0N A;  4IIO A;  2IZV A;  4OMN A;  4K45 A;  3IN7 A;  2DYB A;  2KGT A;  2JT4 A;  1PNJ A;  2LMJ A;  2V1R A;  5HCK A;  1XA6 A;  2YT6 A;  2DA9 A;  1GHU A;  3M0U A;  2GBQ A;  4JZ4 A;  2LQN A;  2EQI A;  4WWQ A;  2KR3 A;  2EO3 A;  1HD3 A;  3HCK A;  3HIZ B;  1IS0 A;  3CBL A;  4OMQ A;  4RTW A;  4M4Z A;  1A08 A;  1X6B A;  1AWO A;  1KFZ A;  2LNW A;  3CWG A;  1NRV A;  1LCK A;  3FJ5 A;  4J9B A;  3WA4 A;  1Y0M A;  2EYX A;  2G6F X;  3VS7 A;  5CDW A;  2L2P A;  2RQR A;  2RSY A;  4FL2 A;  1M27 A;  4EY0 A;  2K3B A;  4OMO A;  2RNA A;  2GGR A;  5EHP A;  1D4T A;  2H46 E;  3TVT A;  4F59 A;  4P9V A;  1IJR A;  3MXC A;  2YUP A;  3EG3 A;  2DBM A;  1SHB A;  2K9G A;  4RUG A;  4J9I A;  1ZUY A;  4ROJ A;  4E68 A;  1UJY A;  2KEA A;  1I1J A;  3PQZ A;  1YCS B;  2YSQ A;  1SEM A;  2O31 A;  1O44 A;  2DM0 A;  3PVL A;  5GJH A;  2SHP A;  2H8H A;  2X3X D;  2ESW A;  1QAD A;  2AKL A;  2K79 B;  2MRJ A;  4U17 A;  3H41 A;  2B3O A;  5DC4 A;  3H0H A;  2CRH A;  1UHC A;  1FHS A;  3BUM B;  5HKY A;  5BO4 A;  1SKJ A;  2LNH B;  4JJC A;  2AUG A;  1ABQ A;  4HCK A;  4CC2 A;  1VYU A;  3S8N A;  2C0I A;  2PZ1 A;  2BTT A;  1VYT A;  2SEM A;  5D0J A;  1S1N A;  5EEQ A;  2CT3 A;  1LUI A;  4RTY A;  2A36 A;  2HDV A;  2EO6 A;  2H5K A;  1GFD A;  3PS5 A;  1HCT B;  1SHG A;  1HSQ A;  3NHN A;  4Z88 A;  1MV0 B;  4E6R A;  4DGP A;  3BUX B;  2CUB A;  1LKK A;  2DL3 A;  5EEL A;  2LJ1 A;  4JZ3 A;  4AFZ C;  4X1V A;  3EHQ A;  5GJV B;  1WI7 A;  2NUZ A;  2DF6 A;  4H1O A;  3GXX A;  3S8L A;  4CC3 A;  1O47 A;  1YVL A;  5DC0 B;  2MK2 A;  1H8K A;  2SRC A;  2EPD A;  1O48 A;  5J3X A;  4ZNX A;  1LKL A;  1I07 A;  2JS0 A;  2EKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...