4M4ZA

Sh3 and sh2 domains of human src-like adaptor protein 2 (slap2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
152
Chain Sequence
b'TAVALGSFPLSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src-like-adapter 2
publication title Crystal structure of Src-like adaptor protein 2 reveals close association of SH3 and SH2 domains through beta-sheet formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 36
structure length 152
sequence length 158
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4m4zA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4m4zA02
1M3AA 4AFQC 2RF0A 3KFVA 1YVHA 2FRYA 2DBMA 1O41A 2KXDA 1N5ZA 1VYUA 1EFNA 2J06A 2D8JA 1AD5A 5DC9A 2EGEA 1YWPA 4HVVA 2DJQA 1Y57A 1JWOA 4EY0A 1HCSB 1FMKA 1WA7A 5DF6A 2J6FA 4J9HA 2CUBA 1I0CA 1AOUF 2DX1A 2K6DA 1SPKA 2D1XA 2Y1NA 3PSJA 1VA7A 4J9FA 1Z9QA 3THKA 3UA6A 1F1WA 2VWFA 3OV1A 1O49A 2W10A 4J9BA 4AFZC 2PNBA 2VVKA 1ZUYA 4U17A 1OO3A 2ENMA 2KE9A 1JO8A 2I0NA 3NGPA 1O4EA 2B3OA 1GRIA 2YSXA 3REBB 2L3PA 3H0HA 1A08A 3PJPA 2EQIA 1D1ZA 2FEIA 4LUDA 4RTYA 2HBWA 2EVRA 2HEQA 5FWCA 1JQQA 1ZLMA 3VRYA 5IHNA 1LUIA 1I07A 1SRMA 1BHHB 1O4OA 4GWFA 1GCQC 2JT4A 1R1PA 3HHMB 1M3BA 3EGUA 4RTTA 3TVTA 2RN8A 1QWFA 2JM9A 1KA6A 3PSKA 2HCKA 4LE9A 2SEMA 1AWJA 4J9IA 3VS7A 1W70A 1UUEA 5IXFA 2KNBB 1UECA 2DCRA 1M61A 2H8HA 4JJDA 3ZL7C 3PFVA 2IZVA 4CC3A 1OEBA 3UYOA 2LNWA 3VS2A 1O4NA 3H0FA 4K45A 2FCIA 4JJCA 2A08A 1MW4A 1M3CA 1WQUA 1SPRA 1KIKA 1BK2A 2EGCA 2A28A 3JV3A 4OHEA 1PHTA 1AYAA 1ZUKA 4AFSC 3GBQA 2LMJA 2RQRA 2OAWA 3VS4A 2DL5A 2GTOA 4OHHA 5IBSA 1PKTA 2KNOA 4P9VA 4F5BA 1SHAA 2O9VA 2MRJA 1PWTA 1A81A 3QWXX 4ORZA 3REAB 4OMMA 1IJRA 5EC7A 4JPBW 5HKWA 2IIMA 2NUZA 3OB1B 3NHNA 1BBZA 2DLPA 2HDAA 1A1BA 4TZIA 1U5SA 2RQTA 2SRCA 3CQTA 1UJ0A 5DC4A 4GLMA 1HCTB 2X3XD 3LH5A 5GJHA 1WIEA 2X3WD 4HVUA 3QWYA 1UURA 4OHDA 1BF5A 3RBBB 2YT6A 2AOAA 2EYXA 1S1NA 2YUQA 4RTWA 3SEMA 1PRLC 2K79A 3VS0A 2IUGA 3CXLA 2L4KA 4NWGA 3EG1A 1AWWA 4EIHA 1FU6A 1FYRA 2CIAA 2DM0A 2CI8A 2SHPA 2EYVA 1GHUA 1LKKA 2GTJA 1T0HA 1Y0MA 5GJIA 3C7IA 2H5KA 1SPSA 3M0TA 4E93A 3K2MA 2DMOA 4ESRA 1UDLA 2M51A 4HCKA 1HJDA 2D8HA 3IQLA 1UUSA 1ZUUA 2RPNA 2C0TA 1A09A 5BO4A 1NYFA 2CH4W 1M8MA 1B47A 1ABOA 1E7OA 2HDXA 3H41A 2RMXA 4OMQA 1T0JA 4RUGA 5L23A 4XZ1A 1GBRA 3OB2B 2MCNA 1TG0A 1BB9A 4F16A 1JU5A 1AOTF 2J6OA 4J9GA 1O4HA 2OI3A 2YSQA 1O4PA 1OPKA 4LN2A 1UHCA 1CJ1A 2DE0X 4FL2A 1K9AA 3N8MA 3PLFB 4J9DA 1BU1A 1RUWA 1K0SA 4RTVA 2HSPA 4E68A 1ABQA 1O45A 2ECDA 4H34A 2HMHA 4QSYA 2LP5A 3M0RA 1YN8A 2RNAA 1R1QA 1BG1A 2EO6A 1KSWA 2FPDA 1NM7A 2DM1A 1TUDA 1I3ZA 4DGXA 4AG1C 3H0IA 2EYZA 4OMLA 1HD3A 1X43A 3A98A 3EG2A 3EG0A 3KFJA 1GFDA 5EELA 2DA9A 2JMAA 3TL0A 2GQIA 1A0NB 2AKLA 1MILA 3GQIB 2LJ3A 1RLPC 2KYMA 5FW9A 1U06A 1UHFA 3S9KA 2LQNA 3VRQA 3BUNB 1WLPB 2K7AA 4ROJA 2M0YA 2YUNA 1J3TA 1CSZA 1JEGA 1QWEA 3I5RA 5AXIA 1JYQA 2E5KA 1YVLA 3NPFA 3EACA 1BLJA 3PE0A 3GXWA 3I9QA 1Z3KA 3O5ZA 2W0ZA 2V1RA 2KR3A 1JXOA 3M0PA 1YP5A 1WDXA 2KT1A 3EHQA 2CDTA 4CC7A 2Y3AB 3ZNIA 1T3LA 2DBKA 4CC2A 2AZVA 1AWXA 2KGTA 1X6CA 4NWFA 3IMDA 4F5AA 2LJ1A 2G6FX 2MIOA 2AUGA 1E6GA 1X6BA 1XA6A 3PVLA 2DL7A 2KBTA 1GFCA 2YUOA 1AZEA 1IS0A 3EAZA 1NZVA 4Z8AA 5J3XA 2FG0A 2DYBA 3BKBA 2EGAA 4IIOA 4DGPA 2PNIA 1W6XA 2CSQA 2EU0A 1WX6A 1LKLA 3NMZC 1JYRA 4A4CA 5CDWA 2L6KA 2DL4A 3CD3A 4JEGA 2L3TA 1I1JA 2C0OA 5GJVB 2ESWA 1CWEA 5I6VA 4WCIA 2BZXA 3WA4A 1O4CA 1AYBA 2DF6A 1TCEA 2MK2A 1CSKA 2JTEA 2CREA 2RQVA 1H3HA 2RVFA 1UE9A 2ROTA 1BKMA 4J9EA 1GCQA 1M30A 2KRMA 2OJ2A 1O4LA 4XZ0A 1AEYA 1K1ZA 1U3OA 3VS5A 5ECAA 1H92A 2MOXA 2CRHA 3I35A 1UJYA 1NZLA 5DC0B 1KC2A 4P9ZA 1M27C 2EYYA 2HUWA 1NLOC 3MXCA 1WYXA 1OOTA 2KK6A 4Z89A 2EO3A 1O4IA 1SHFA 3ULRB 3N7YA 3PQZA 1O4GA 1XOVA 2LCSA 2ROLA 5I22A 1O44A 2EL8A 4L1BB 2ECZA 4FL3A 2QDLA 1WXBA 2VIFA 5HKYA 3S8OA 1OPLA 1SKJA 1QKWA 2AOBA 2JS2A 2K79B 4U1PA 1JU5C 1JXMA 4KRTA 4JGHA 2OQ1A 1WXUA 1LUNA 1O4JA 1BKLA 1QADA 4M4ZA 2EYWA 1VYVA 3EG3A 4K2RA 1X0NA 1R1SA 1RLQC 4AFUC 3UATA 1AZGB 1RQQC 2EW3A 2LCTA 3M7FA 1QLYA 2KRSA 1K0XA 1KFZA 5IXBA 1Z9ZA 1AVZC 1O4KA 1CSYA 2BZYA 2K9GA 2LQWA 4RTUA 3N84A 3EHRA 2KEAA 2ED0A 2F2VA 1W1FA 2O2OA 3MAZA 3S8LA 4R0KA 2CH4A 1H9OA 4RTXA 1D4WA 2J6KA 1GCPA 5KAZA 2V1QA 1X69A 1G2BA 2H46E 1GBQA 2L3QA 2PNAA 1AWOA 1AOJA 2B86A 3GXXA 4A4BA 4FBNA 1AB2A 2LX7A 1A1CA 2MRKA 5HCKA 4RTZA 1PRMC 1A1AA 2CSIA 2ED1A 5EG3B 2L0AA 2GGRA 4HXJA 3VRZA 5IHIA 2EPDA 2D0NA 3VRRA 1A1EA 2DX0A 1SHDA 2Y1MA 3UF4A 2KYBA 4OHLA 4K44A 3PS5A 2CR4A 1SRLA 2L2PA 3IN7A 1NYGA 2DLYA 3UA7A 1H8KA 1O4QA 1X2QA 2CUDA 3IMJA 2RQWA 1QKXA 1ZBJA 4CC4B 5AULA 1NLPC 2XMFA 2J05A 1UTIA 1LUMA 2KRNA 4LNPA 2MC1A 1SHGA 1PICA 2PTKA 1WXTA 4OMNA 4OHIA 2CT4A 1FBVA 1WI7A 2LJ0A 2K7AB 2AKKA 1NG2A 1ZSGA 1G83A 2BZ8A 2DLZA 2F2XA 1O4FA 2K2MA 3HIZB 2JXBA 3CBLA 4IIMA 2ABLA 1O47A 1O4BA 1OO4A 2DL8A 1B3QA 1O4AA 2YDLA 2EKXA 1BM2A 1BFIA 2GBQA 4H1OA 2LNHB 2LZ6B 3R6NA 3OVEA 2DILA 4DEXA 1BHHA 4HVWA 2PLEA 3TSWA 4F17A 1FBZA 1KJWA 1OV3A 5EEQA 1LCKA 3C0CA 2DNUA 1LCJA 5I11A 2FO0A 3U23A 2CT3A 2DVJA 2ETZA 1E6HA 3M0UA 3S8NA 1A07A 3T04A 1TUCA 4ZNXA 1MV0B 1JYUA 1F2FA 2JYQA 1FHSA 2F2WA 2O9SA 2P4RA 1B07A 5IBMA 2RSYA 2O88A 1VYTA 2AK5A 1O46A 2L3SA 4JZ4A 1RPYA 2IUHA 3BUMB 1BHFA 1BMBA 1TZEE 2CI9A 1NRVA 1K76A 2DL3A 4EIKA 2BTTA 2FPEA 2QMSA 3CWGA 4GPLB 4WWQA 5HKZA 4QT7A 2DRKA 2C9WA 2A37A 2C0IA 1YWOA 2RMOA 1CWDL 1O43A 1GL5A 2OZOA 1V1CA 2VKNA 4F59A 2GE9A 1T3SA 1P13A 5IHKA 3US4A 5IH2A 1UFFA 1MV3A 3BUOB 1SEMA 4K11A 1K4US 2FPFA 3MXYA 1NEGA 4A63B 1ARKA 2XP1A 3TSZA 1NEBA 1RJAA 2MQIA 1SHBA 5FWBA 3VRNA 3BUWB 4Y92A 4OMPA 2GNCA 1SSHA 1RI9A 3M0SA 1AYCA 2YUPA 4DEYA 2PZ1A 2IUIA 4AG2C 1UG1A 1YCSB 2GSBA 1FYNA 4GBQA 3VS1A 1CKBA 3IN8A 1AYDA 5EHPA 2A36A 2JS0A 2KT8A 4JZ3A 4D8KA 3OP0A 4OMOA 2EBPA 4Z88A 3HCKA 1O42A 5EHRA 1CKAA 3VS3A 4F14A 2JM8A 1ZX6A 4LUEA 1PNJA 4GL9E 1X2KA 2RQUA 4J9CA 5GJWB 4E6RA 3VROA 1HSQA 2K3BA 1X27A 1X6GA 2HDVA 2CBLA 1D4TA 2JW4A 3TKZA 1QCFA 1BLKA 2EKHA 3VRPA 1WFWA 1YNZA 2YU7A 2NWMA 1BFJA 3RNJA 1Y1UA 2J7IA 1M27A 2LNXA 3BUXB 1UGVA 1O48A 2KROA 2JMCA 3VS6A 2CS0A 4X6SA 2KXCA 3FJ5A 1PKSA 2DRMA 2BBUA 1FU5A 2FRWA 3I5SA 1QG1E 1LUKA 4D8DA 1KA7A 3SHWA 2AZSA 4X1VA 1MUZA 1IO6A 1O4MA 2EOBA 5D0JA 1ZFPE 3PVQA 3VGOA 4JE4A 4FSSA 3M0QA 4JJBA 2RORA 2PLDA 2O31A 1O4DA 1O4RA
chains in the Genus database with same CATH superfamily
1M3AA 3VUBA 2FRYA 4J8OA 1W2BP 2KXDA 5I2MA 5DC9A 1YWPA 2AIRB 4FW2A 1JWOA 2XHCA 2J6FA 4J9HA 5GAN8 2DX1A 3HL8A 3G6ET 1YITT 2D1XA 1TWBA 3JB9F 1YJWA 2VWFA 2BIVA 2W10A 3JCMd 1VIEA 1TTHB 3JB9G 1YJ9Q 2I0NA 4L5GA 2G3RA 2L3PA 3H0HA 3MO8A 4N0AC 3OYLA 3OS1A 2FEIA 2HZYA 4LUDA 4RTYA 5FWCA 4HCCA 1JQQA 1ZLMA 3VRYA 5A2QE 2DD4A 1GCQC 4M78F 1AT1B 1DJ7B 2RI2A 4RTTA 3TVTA 3PSKA 1QWFA 2SEMA 3VS7A 3K2TA 3CCRA 4GY5A 4M78G 1UUEA 1UECA 3EG9B 4PJOD 2H8HA 1LNXA 2VV5A 3ZL7C 4JS4A 3CCJQ 3PIPA 2E12A 3H0FA 1M3CA 2QG9B 2BUDA 3JCMJ 5GMKl 1BK2A 5GAN7 5KYXA 4B6MA 1PHTA 1ZUKA 4AFSC 2DD5A 1NZ9A 2LMJA 3VS4A 2GTOA 1WZOA 1KD1U 2O9VA 1A81A 4ORZA 1KC8C 1VQPQ 4BB7A 2ZGWA 4JRPA 4JPBW 1O75A 1LJOA 1U5SA 2SRCA 1EX4A 1NJIR 3OYNA 3LH5A 4HVUA 3EFOA 2FZGB 4F7UE 2FZKB 3G71Q 5GAOq 2AOAA 1PRLC 4NWGA 1I5OB 3TCJA 3VV0A 1FYRA 2CIAA 2DM0A 2CI8A 2SHPA 2K5IA 1LKKA 2GTJA 1Y0MA 1RABB 3SWNA 3C7IA 4ZTFA 4PJOA 3QZ5B 4OP0A 4E93A 2DMOA 3QO3A 1NE8A 2KSSA 3LYIA 4HCKA 1HJDA 3HFOA 5HY6A 2RPNA 1A09A 1OQKA 1M8MA 1ABOA 1V29B 1BI0A 1E7OA 3EGDA 1MNDA 2JNGA 1YI2T 2ZCFB 4OMQA 4M78B 2PUKB 3CCVQ 2A3LA 4F16A 5C6SA 1AOTF 2J6OA 2JUFA 1YIJT 3JRZA 1K9AA 4J9DA 3CBOA 1IXDA 1K0SA 2VXFA 4E68A 4QSYA 1YN8A 2RNAA 3MEUA 3OYEA 4LD6A 2E1HA 4ZN3A 1Q82U 4AG1C 2E6ZA 2RI5A 2EYZA 3L2WA 1X43A 4ZGJB 2DA9A 2LVMA 2AKLA 3GQIB 3CXCS 2LJ3A 4O6JA 4L59A 1U06A 3S9KA 2LQNA 3CCUA 2K7AA 2M0YA 1J3TA 3FEOA 1QWEA 3I5RA 1G8XA 5GAN3 1I81A 2DTOA 3PE0A 3I9QA 1Z3KA 2W0ZA 2MPXC 1JXOA 1YP5A 1WDXA 5CKFA 2FZCB 2Y3AB 4CC2A 1M1FA 1AWXA 2KGTA 1YJ9T 2BE7D 4R55A 3IMDA 3OYFA 1W4SA 2JTFA 3OBWA 1E6GA 1XA6A 3PVLA 4JUVA 1VQOQ 2DL7A 2KBTA 3CC4Q 1OX8A 1UGQB 4BI3A 4Z8AA 2E64A 1N8RC 4XTVA 4DGPA 3EGXA 2EU0A 3NMZC 4KGXB 5CDWA 3OSSC 1VQNA 4J5YA 1K73C 2L3TA 3OS0A 5FROA 4WCIA 3GOXA 1O4CA 5CVIA 2X4XA 1K8AU 1M1KR 1CSKA 2CREA 2LCLA 1BKMA 1QVGP 2CGHA 2JVVA 3OYMA 4XZ0A 3CPWS 3VS5A 2MOXA 4XTZA 1NZLA 5DC0B 4P9ZA 2HL3A 1O4IA 3NTKA 1Y96B 1VQPT 1WXBA 3FRNA 2OTLA 1SKJA 1WHHA 4OB1B 4P5NA 4KRTA 4QVZA 1S72T 4JRIA 4MDWA 3M9QA 3G71T 5D6WA 3GIBA 1Q86U 3X24B 3UDCA 1AZGB 2EW3A 1WHKA 3M7FA 1U1TA 1YHQQ 1TOVA 1QVFS 1KFZA 1Z9ZA 1AVZC 3D7SB 1KK7A 1CSYA 3VYGA 2X35A 3EHRA 2F2VA 2QQBA 3MKDA 2D6FA 2MAMA 4R0KA 5LJ5d 2QEXA 2J6KA 1GCPA 5KAZA 5A0DA 1IHWA 1G2BA 1GBQA 1AWOA 4M7DC 4ZN1A 1G3SA 1ZA2B 3V7CA 4E7JA 2Y4XA 2LX7A 1YJNA 2MRKA 5HCKA 3CMEQ 3CCVT 3INZA 2ED1A 2YHTA 1A1AA 4DBHA 2L0AA 1WGSA 1PSFA 2D0NA 2RJFA 3FB9A 3A8GB 3M4GA 3JCMV 1B7TA 3UF4A 2CR4A 2HMAA 3IN7A 4C0FA 2Z0WA 1NYGA 3C12A 2HBPA 2CUDA 5AYFA 4C8QA 1QKXA 4D6WA 3ASKA 1UTIA 2KRNA 2MC1A 1FX7A 4KH0B 1SHGA 1WXTA 4OMNA 4FU6A 1BKBA 1X75C 1FBVA 2MK5A 3HIZB 3CBLA 4IIMA 3OMCA 1OO4A 1B3QA 1KQSS 3G4SA 2K5LA 2P0PA 1BM2A 3P8HA 3R6NA 3OVEA 3G7ZA 2EJFA 4DEXA 1BHHA 3H6ZA 1D3BB 3SDZA 1M2OA 1LCKA 2DNUA 1LCJA 3URGA 2CT3A 4EPCA 3S8NA 1A07A 3VKIA 1TUCA 4ZNXA 2JYQA 2F2WA 2P4RA 1B07A 3CC2Q 1VYTA 2AK5A 1O46A 3BW1A 4EMKA 4XU2A 2RO0A 2QMSA 5LJ5e 3CWGA 2EFIA 4QT7A 2DRKA 5GAMe 1VQOT 2EQJA 4RMOA 2C9WA 1YWOA 2RMOA 1YJWQ 1O43A 2OZOA 1K9MU 3CCSA 3MPUB 2GE9A 3JCMg 3SWNC 5IH2A 1MV3A 4PJOC 4M77D 3BUOB 1K4US 4A63B 2VB6A 1RJAA 1TSFA 5FWBA 3BUWB 2R5MA 1KG1A 5L8RE 4DEYA 1UG1A 3E2UA 4GBQA 3HRUA 2JS0A 2KT8A 4AMCA 1M8VA 4JZ3A 3OP0A 1Q95G 5KYUA 4OMOA 4OMFB 1ZQ1A 3SD4A 3VS3A 3L2VA 1ZX6A 2QTVA 4LUEA 4M78E 2P0QA 4E6RA 4N4GA 1HSQA 2HDVA 2DPPB 5KCOA 3FLGA 3OYDA 2EKHA 1WFWA 3VUZA 1YCYA 4ATOA 2YU7A 2NWMA 4WTOB 3LWIA 3RNJA 3M55A 2LNXA 1UGVA 1O48A 2JMCA 3VS6A 4PFZA 2E5QA 1VQ6A 4M77A 3OW2S 1RAFB 3A8OB 1KA7A 3SHWA 2AZSA 1YHQT 2EOBA 2F5TX 5FU7C 2QYZA 3NTIA 1ZFPE 1Y71A 3ER0A 4JE4A 3MEWA 4JJBA 4X9DA 3CC7A 3RR6A 3CD6A 1YVHA 3CPWA 3I55Q 2LTOA 3CCEA 5DF6A 4C5HA 3S3OA 1I0CA 1VQKA 3CMET 1P92A 1Z9QA 3CEYA 3DLLA 2DFUA 2ZAEA 4XTWA 4AFZC 3QIIA 2VYTA 3MP1A 2VVKA 4U17A 5GMKi 3NGPA 1O4EA 1GRIA 4PL6A 2QTXA 4XU3A 1PD1A 4PJOF 3QXEB 1RL2A 3RESA 2FB7A 2GQVA 5IHNA 4HCBA 1I07A 1SRMA 1O4OA 4PJOG 2L89A 1BI3A 4J7IA 2PQWA 4FYWB 7AT1B 4GLKA 1AWJA 2PVDB 5GAN4 2CZ6B 4C5EA 2LT1A 4JJDA 2GCXA 2IZVA 3UYOA 3CCMA 3GPLA 4O5VA 1O4NA 2XK0A 3LW5E 4HA8A 1QCNA 1KIKA 3CC2T 3GNGA 3CCUQ 4OHEA 1OI1A 3GBQA 2RQRA 1M1GA 1OU8A 3PMTA 2XD0A 3LWHA 4P9VA 1JJ2A 2QQSA 5KYXB 1SHAA 2DIGA 3QWXX 3REAB 1KD1R 2NUTA 1VQMQ 2L5QA 5EC7A 1BBZA 2HDAA 4MZMA 3HHTB 2EWNA 5DC4A 5J39A 4BI4A 1C6VX 1G3WA 3OS2A 1BF5A 2EJGA 3TU4K 2EYXA 1S1NA 2YUQA 1KQSA 3N5BB 2K79A 3SEMA 3CXLA 3EG1A 1AWWA 4EIHA 1GHUA 2RI3A 4R56A 1IGQA 3L2ZA 1RAIB 4FIBA 5CKBA 4FW1A 4PFPA 1PD0A 2H5KA 4BE1A 2YRDA 4M7DD 3K2MA 1UDLA 2M51A 5LJ3d 2D8HA 3JCMX 1UUSA 4F7UA 4PJOB 2CH4W 1NJIC 3X28B 2JN0A 4C8QC 5DLQE 2HDXA 2COYA 3H41A 5D7UA 3OB2B 2MCNA 4FYYB 1BB9A 3RKXA 4QVDA 3L1AA 3M59A 5A0GA 4M7AE 1M4ZA 3QJYA 4FL2A 1ZBXA 3C94A 1RUWA 4RTVA 2HSPA 2OTLQ 1IGUA 2V8JA 2HMHA 4OB0B 3JSCA 3LH0A 3CCQA 1M90C 5DLOA 2X4JA 4YTLA 3I56Q 1KSWA 1M9SA 1NPRA 3A98A 3EG2A 4PLLA 4WF2A 3I55T 1GFDA 3J7AF 2GQIA 4M7DA 5FW9A 3VJPA 4EMKC 2LQ8A 4ELYC 4BI8B 5AXIA 2E5KA 1SF9A 3EACA 3SB2A 3GXWA 3O5ZA 2JZ2A 2KK4A 4OVAA 5LJ5g 5GAMg 4Y91A 1T3LA 5LJ5j 5GAMj 2OTJA 4C0DC 1FWZA 2FL7A 5LJ3e 2LJ1A 4ELZC 4C92E 2G6FX 3GNFB 4LDVA 1RAAB 5GMKe 3HKSA 2R57A 1IS0A 1ZSZC 3EAZA 1NZVA 5J3XA 2FG0A 2EGAA 2PNIA 2XDBA 1OYXA 4A4CA 4B9XA 3FC3A 4DOVA 3CD3A 1I1JA 2DZ9A 4BE2A 3EGXB 2DIQA 1VQ9A 2RB6A 2JTEA 2RHZA 2EJ9A 1K8AR 2DYIA 1WPYA 2ROTA 4J9EA 2D0QB 1M30A 1D1CA 3CPWP 3G4SQ 5ECAA 1H92A 4E7KA 2K5FA 3CCUT 1IZ6A 6AT1B 4Y28E 4QQDA 4E47A 2B8AA 2PUOB 3JCMe 3MXCA 2KAFA 3GLXA 2DJZA 2EO3A 1WQWA 2DKGA 2K3YA 3N7YA 3PQZA 4M77C 5M9OA 4L1BB 4FL3A 1VQMT 1RAHB 2VUBA 4IUVA 1V76A 2F1LA 3UT1A 3S8OA 1QKWA 4U1PA 3G6EA 1WXUA 1O4JA 1QADA 3E9GA 2H3JA 3J80E 5KE3A 4K2RA 1PC0A 3CCSQ 1RLQC 1IB8A 4AFUC 5FU6B 3UATA 1Q86R 5LJ5h 1K0XA 5GAMh 3L2UA 2BZYA 2LQWA 5CCAA 3N84A 3HSBA 2ED0A 1W1FA 3MP6A 1BI2A 3BE3A 5GAOl 4QW2A 5GANd 4M7AC 2GFUA 3OYHA 2MMPA 1VQ4Q 5IAYA 4A4HA 2RJEA 2H46E 2L3QA 2PNAA 1VQLQ 1AB2A 2COWA 4HT8A 4XU0A 3OYGA 4E7LA 2HNIA 5EG3B 4HXJA 5IHIA 3MJXA 1Y07A 2EPDA 2CP0A 2KDSA 3A8HB 4FCYA 1SHDA 4XU1A 2Y1MA 4OHLA 3PS5A 4Q5WA 1JJ2P 2QK0A 2Y4YA 1W2BS 3QKJA 1O4QA 2CKKA 2RQWA 1KQ2A 4CC4B 3TREA 5AULA 1NLPC 2ZPHB 2XMFA 4VUBA 3X26B 1LUMA 3MCAB 4LNPA 1WNLA 2PTKA 4L6V5 4LD9K 2CT4A 2R58A 2HD0A 3I56T 2P84A 1WI7A 2LJ0A 1ZSGA 1G83A 2F2XA 1O4FA 2JXBA 1O4BA 1YBYA 1O4AA 2YDLA 2EKXA 1WJRA 3NTHA 4MZTA 2GBQA 2LNHB 2LZ6B 4C92C 2RHYA 4XK8E 4HVWA 3TSWA 4C5GA 1FBZA 4LXCA 4QVCA 3FJPA 2OX7A 3CC7Q 3OQ5A 5I11A 1UB4A 2FO0A 1R0BG 2ETZA 3CD6Q 1MV0B 1F2FA 4XTXA 4RG2A 4M77F 1RPYA 2IUHA 3JCMf 4MDXA 5FRMA 3OB9A 2DL3A 5GANe 1VQKQ 4M77G 4EIKA 2NUPA 2A37A 3CCJT 1GL5A 3KXTA 3NFCA 1V1CA 3V8JA 2DTIA 1T3SA 4JLGA 1P13A 1K9MR 2ZPFB 1YI2A 4HT9A 3LGFA 1UFFA 3QYGB 4M75E 2RHXA 2FPFA 2XU8A 1NEGA 1G5VA 3TSZA 1NEBA 1SHBA 2A7YA 2K4YA 1KQ1A 2FVUA 2GNCA 1SSHA 1RI9A 2HSEB 4JJNK 1UGPB 2IUIA 2O01E 1OULA 2GSBA 3META 3JCMP 1M2VA 1CKBA 1I4K1 3G4ST 1VQ8Q 5EHPA 5EG2A 4C8QD 2EBPA 4Z88A 1JRIA 4IKFA 5EHRA 2RD1A 1CKAA 1R0CB 4F14A 2JM8A 2VGMA 1PNJA 3QJ6A 1X2KA 2RQUA 4J9CA 3CCMQ 1RACB 1VQ7Q 3JCMc 2HL5C 2QQRA 2CBLA 4LDYA 2JW4A 1D4TA 3EH2A 3DLMA 1WHLA 3VRPA 3QSUA 5GMKm 1BFJA 3M53A 1M27A 3FDRA 2FYKA 3BUXB 1M90U 5I21A 1QP2A 2CS0A 4X6SA 2KXCA 3FJ5A 3CCST 1FU5A 1O9SA 4MMKA 1YJ9A 3I5SA 4D8DA 4BY6C 3EFSA 1IRXA 2P4TA 2DXUA 3A5ZB 4M77B 1D0YA 2WSEE 3JB9J 2PLDA 3X25B 3CMAQ 3RERA 4WWQA 2RF0A 2P0KA 1SG5A 3KFVA 3HTRA 1O41A 1VQ4T 1N5ZA 1D1BA 2D8JA 1AD5A 2EGEA 1VQLT 1VQ5Q 1Y57A 2XI9A 1WA7A 1AOUF 2K2VA 2K6DA 3OBYA 3MP8A 1SPKA 2CP2A 3UA6A 1F1WA 4IUPA 5GAN5 3CCLA 5LJ3g 1O49A 4J9BA 5LJ3j 2DTHA 1OO3A 4X9CA 2B3OA 5FRNA 3REBB 3HPWA 1Q7YR 3PJPA 2EQIA 4F04B 1D1ZA 4KGVB 1U8RA 4ANJA 4PLIA 4F7UF 2JT4A 5GAOn 3ZFJA 3HHMB 1VQPA 1M3BA 2I2LA 2JM9A 1KA6A 2YRCA 1W70A 3WVDB 4F7UG 1KC8U 5IXFA 2KNBB 1S72A 4NL2A 3KBGA 3PT9A 3CC7T 3PFVA 3G71A 3CC4T 1TU0B 4CC3A 2LNWA 4FT2A 3VS2A 3TQ7P 2FCIA 1MHNA 3JCMQ 4XTUA 4NOYA 2A28A 3DKMA 2E6NA 3JV3A 1AYAA 2QA4A 1I8FA 2OAWA 1VQKT 2DL5A 5CIUA 5IBSA 4OHHA 1UGRB 1ZSZA 3CXCA 2YLCA 4OB3B 4OMMA 1QVGS 5HKWA 2VC8A 2IIMA 3OB1B 3NHNA 3FIFA 4M7DF 1A1BA 2RQTA 5C0MA 3CCRQ 1HCTB 2NUTB 3Q1JA 1JB0E 1PM3A 1WIEA 2X3WD 4OHDA 1UURA 3RBBB 5D6YA 4M7DG 2LQKA 2YT6A 2M16A 5LJ3h 2L4KA 5KYWB 1FU6A 5GAOr 4M7AD 1UEBA 2EYVA 2KI7A 2XICA 2LRQA 1T0HA 2E70A 5J26A 1VQ8T 3M0TA 4ESRA 1KD1C 4IUQA 3IQLA 2H3EB 4KUIA 1NYFA 1B47A 3CCMT 2AT1B 1PG5B 1RADB 1VQ7T 1LPLA 4F7UB 5KYYA 2RMXA 1T0JA 4RUGA 2DAQA 2O4XB 4J9GA 2KY9A 2OI3A 2YSQA 4JRQA 3A8LB 1H641 1OPKA 2LX9A 5CKHA 1UHCA 1CJ1A 2D9TA 2DE0X 2HKNA 5IT9E 4OF1A 3PLFB 3ZEHA 1OX9A 1B34A 1OZ2A 3V7SA 2LNVA 2QDYB 3JCMh 1O45A 1WHGA 4H34A 2LP5A 3PFSA 4DBRA 5GAOp 1R1QA 3BDUA 4OB2B 2LCCA 1VQOA 4C92D 2FPDA 1NM7A 2DM1A 4DGXA 4M7AA 3CMAT 2DXCA 1UGSB 3WVEB 1Q81C 3KFJA 2RH2A 1H3ZA 1PCXA 1A0NB 1MILA 2MWPA 1N8RU 1VQ5T 1UHFA 5LJ5f 3VRQA 3BUNB 1WLPB 5GAMf 1CSZA 1JEGA 1K73U 4PNOA 1JYQA 3NPFA 4M7DB 4QQ6A 2V1RA 2YWWA 1G3TA 5GANg 1QVFA 4CC7A 3ZNIA 2AZVA 4NWFA 4F5AA 1FMVA 2MIOA 2DETA 1X6BA 3S3MA 2E41A 2YRVA 1GFCA 2DEUA 2WSCE 4LDUA 2EIFA 2L6KA 4A4EA 2DL4A 2IVWA 4JEGA 1TXQA 3M58A 2PVGB 5GJVB 2ESWA 1CWEA 4C92A 3M56A 2BZXA 3WA4A 1AYBA 2DF6A 2MK2A 4A54A 3G1JA 3OA6A 1YJWT 1I5LA 1H3HA 2RVFA 4Z02A 4V2SA 1MMGA 1O4LA 1AEYA 1K1ZA 1YHQA 1U3OA 3BDLA 1LVKA 4JRKA 5J3BA 2MYSA 1UJYA 4KUDK 2LC4A 1M27C 2HUWA 1NLOC 1WYXA 2KK6A 4M78C 1O4GA 2EL8A 2ECZA 3EFOB 2QDLA 3E19A 1VQNQ 5HKYA 1JU5C 3CCRT 2VGNA 4JGHA 1LUNA 3SWNB 4M4ZA 1VYVA 3EG3A 3TEEA 4HKEA 4IUUA 3QDFA 1R1SA 3OYCA 1TUGB 5GANh 2MWOA 4DBQA 4QQGA 2K9GA 4OGEA 3EGDB 2KEAA 2O2OA 2QXFA 4PKCC 4DQ2A 3MAZA 4E7HA 4C0GA 2DK3A 3OYIA 1D4WA 4MZPA 1ZA1B 5HK3A 1AOJA 1Y7XA 4BE0A 3OMGA 3GXXA 4KH1B 4A4BA 4PFOA 4FBNA 2QQAA 2EYQA 3C95A 4RTZA 2R5AA 1PRMC 5GAN6 2GGRA 1Q86C 2RA2A 4A53A 3VRRA 2IPOB 1QVGA 1Q82R 2KYBA 5DM7R 2L2PA 2E3HA 3CXCP 3IMJA 1H8KA 1X2QA 3CC2A 1ZBJA 2KVQG 2J05A 2AHJB 3CPFA 2BE9B 4FYXB 4EMHA 1PICA 5GAN2 4OHIA 1BIAA 2K7AB 1X01A 2AKKA 1NG2A 2BZ8A 2QI2A 2DLZA 2QEXQ 5FU7B 4FT4A 1WHJA 2ABLA 4PK4A 4LDXA 3HRSA 1AHJB 2CS7A 1BFIA 4H1OA 1YJNQ 3MEVA 2E10A 2IG0A 2PLEA 4M75D 3GP8A 4F17A 3OW2A 2DVJA 1E6HA 1JYUA 4CRIA 1XTDA 2O9SA 2GF7A 5IBMA 1VOMA 5KCHA 2O88A 3O8VA 2HAXA 1BHFA 1TZEE 5CK9A 4PJJA 1K76A 2ATCB 5CO7A 2L8DA 1QP3A 2BTTA 2DZCA 2X51A 3LLRA 2C0IA 3CCLQ 2ZPIB 2DXBA 3RIRA 2M1HA 2C06A 2NUPB 5IHKA 2HQHA 1D0ZA 4UC4A 4C8QF 4K11A 3MXYA 2XP1A 5D6XA 1WJSA 3VRNA 3HP9A 4Y92A 4OMPA 4C8QG 3J81E 4C5IA 5CAIA 3JB9H 2M9UA 4E7IA 2PZ1A 4AG2C 1YCSB 1M1KC 3S6WA 4M75A 1FYNA 3VS1A 3X20B 1AYDA 4X34A 3EAEA 1YITA 4D8KA 4BDZA 1K9MC 3HCKA 1S72Q 1O42A 1M2VB 4J6XA 4J6WA 3QPHA 5GJWB 3I55A 3VROA 1QMCA 1QVFP 1X6GA 1VQNT 5HKCA 3TKZA 4NL3A 1WQ7A 2DXTA 1LOJA 1YNZA 3OYJA 5AT1B 4FM4B 2QA4Q 2JJ9A 3QG1A 3M5AA 3M4YA 2ZPBB 3ME9A 2DERA 1M90R 2RHIA 1PKSA 4FYVB 5KH6A 2BBUA 2EQUA 1MMNA 2COZA 4E2FB 5HK0A 1Q81U 2JOYA 5KYNA 4BD3A 3VGOA 1WHMA 3A8MB 5CKDA 2O31A 2X4YA 2Y90A 2DEQA 3L42A 2CZ7B 4AFQC 2DBMA 1VYUA 5LJ3f 1EFNA 2J06A 3JCMW 4HVVA 2DJQA 4M7DE 4ME7A 2OTLT 4TVRA 1HCSB 4EY0A 1FMKA 4XQ3A 3LGLA 1SKUB 2CUBA 4BACA 2Y1NA 1XNIA 3PSJA 4C8QB 1VA7A 4J9FA 3THKA 3OV1A 4JS5A 1M5Q1 2KGYA 2PNBA 4IURA 1ZUYA 3QDRB 1VQ6Q 1KQSP 1BCMA 2ENMA 2KE9A 1JO8A 2YSXA 4BUGA 1RAEB 1HK9A 2E3IA 1A08A 1QVPA 4RG8A 2HBWA 2EVRA 2HEQA 2E4HA 3S3NA 3JB9D 1LUIA 1BHHB 4KT0E 4GWFA 2QEXT 1R1PA 4JDSA 1VQMA 2QQ9A 3EGUA 2RN8A 3EG9A 5CR2A 2HCKA 4LE9A 1D0XA 4J9IA 3CCEQ 2BKDN 3RKYA 1YJNT 1D1AA 2DCRA 1KC8R 1M61A 4EMGA 2LT4A 1XJWB 2NLUA 5I2SA 4EMKB 1OEBA 4KULA 3AHUA 2HQXA 1Q7YC 4K45A 2EAYA 3BY7A 4JJCA 2A08A 2KMTA 4M78D 1MW4A 1WQUA 1SPRA 2NYSA 2K57A 5KE2A 2EGCA 2RK2A 2YLBA 3OYBA 2XG8D 4J7FA 1YIJA 4C0DB 1PKTA 2RHUA 2KNOA 5IN1A 3CCLT 4F5BA 2MRJA 4M7AF 1PWTA 5CQXA 1U1SA 3DB3A 1F1BB 3PNWC 3QBYA 4E7SA 3VYHB 3UPUA 1IJRA 1N6AA 2K3XA 2NUZA 2MF2A 3JAME 2DLPA 1ZSZB 1NJIU 3JB9I 4PJOE 1HYOA 4TZIA 4M7AG 4PJMA 2A0FB 2CP7A 3CQTA 1UJ0A 2WACA 3GF5A 4GLMA 2X3XD 5GJHA 3R6OA 3QWYA 1OZ3A 1IHVA 4II1A 3QYHB 4RTWA 2IUGA 2EKOA 3VS0A 4B9WA 2RJCA 5KYUB 2HKQB 2ZPGB 5GJIA 3M54A 3PIOA 1SPSA 1BI1A 3I56A 1ZUUA 4RCCA 2C0TA 5BO4A 4HCZA 4M78A 3C4SA 2DVEA 3OYYA 3E1SA 3OW2P 2VASA 5L23A 4XZ1A 1GBRA 1TG0A 2XDPA 1JU5A 2HQEA 4C92F 1O4HA 2QA4T 5KYYB 1O4PA 4LN2A 3V8LA 4BDYA 5GAMd 3N8MA 4C92G 1BU1A 1FMWA 3V7RA 1ABQA 2V8KA 2ECDA 3CBMA 3M0RA 1B34B 1BG1A 5CQYA 2CP6A 5LL6S 2EO6A 2ZPEB 3CBPA 3CCJA 3PTAA 1TUDA 1I3ZA 3H0IA 1MMDA 4OMLA 1HD3A 3LYVA 3EG0A 5GMKj 5EELA 2JMAA 2V8IA 3TL0A 1JBMA 2QGFB 1JJ2S 1RLPC 2KYMA 5GANf 2GFAA 4M7AB 4E7ZA 1N8RR 4ZTJA 4ROJA 1IREB 2YUNA 9ATCB 4J83A 1YVLA 1BLJA 1K73R 1X6OA 2KR3A 3M0PA 2X4WA 5GAOm 2FHDA 1YFNA 2KT1A 2CDTA 2XKOC 3EHQA 5FLXE 1VQ6T 1QQJA 2DBKA 1X6CA 2QASA 1RAGB 3CCQQ 2AUGA 3QHSA 2F5KA 2YUOA 8AT1B 4A4KA 2PU9B 1AZEA 3CD6T 2DYBA 3BKBA 4RKUE 4IIOA 3H9NA 1KHIA 1W6XA 2CSQA 2RJDA 1WX6A 1LKLA 2ZZDA 1JYRA 4M75C 4PJNA 4JLIA 2EQKA 2C0OA 2V26A 3CCET 5I6VA 3F70A 4N0AA 1TS9A 1M1KU 4C0ZA 1NPPA 1TCEA 3RMQA 1W2BA 2CZ0B 2RQVA 1UE9A 4C92B 2RM4A 1GCQA 2KRMA 2OJ2A 2OTJQ 2CRHA 3CCVA 3I35A 1KC2A 2EYYA 4A4GA 1EZZB 3V8KA 1Y96A 1OOTA 4IUTA 4Z89A 3T9NA 1R8OB 1SHFA 3ULRB 4PJLA 1VQ4A 1XOVA 3A1PA 4OGCA 2LCSA 2ROLA 5I22A 1O44A 1BCOA 2DO3A 2PVOB 1VQLA 5GMKh 1BYMA 2VIFA 1OPLA 2K79B 2AOBA 2JS2A 2X9HA 3QUIA 1JXMA 1VQ9Q 2OQ1A 5A0LA 3M57A 1KHCA 1BKLA 2EQMA 2EYWA 4QKUA 1X0NA 1N27A 2E65A 1RQQC 3PGGA 1HXDA 1VIFA 2LCTA 1QLYA 2KRSA 5IXBA 1C0MA 1O4KA 1ACMB 4RTUA 1RI0A 2CYZB 1MMAA 3S8LA 1H9OA 2CH4A 4RTXA 4AT1B 2V1QA 1X69A 2QGGA 2B86A 3WXMB 4C8QE 2YXYA 3OYAA 1A1CA 3G6EQ 3MEAA 1YITQ 2CSIA 4N4IA 3VRZA 4XTYA 3CC4A 4MMLA 3UWNA 1A1EA 1N9RA 2DX0A 4K44A 1SRLA 2L3RA 3EFRA 3HRTA 3SFMA 3UA7A 2DLYA 4ZGDB 1OU9A 4M75F 1NBEB 4XAXB 3ZBDA 4BY6B 1GXIE 4M75G 2K2MA 1N9SA 5GANj 1O47A 1D3BA 2DL8A 3E9FA 2RK1A 5DY9A 1Q7YU 2M02A 2DILA 1Q82C 4ZGEB 1G3YA 3RUXA 3DB4A 1TH7A 1KJWA 1MNEA 1OV3A 3C0CA 2CZ1B 4EDUA 5EEQA 3U23A 1R77A 3BFMA 3M0UA 3P8DA 3T04A 1BIBA 1FHSA 2RSYA 4N4HA 1VQ8A 2L3SA 1EIFA 1QCOA 4JZ4A 3BUMB 4CI0C 1BMBA 1FXXA 3OY9A 5CKEA 2CI9A 1NRVA 3CCQT 2CP5A 4LDWA 3OSVA 2FPEA 1ZHIA 3AT1B 4GPLB 5HKZA 2WSFE 2JTMA 1CWDL 3EH1A 2F69A 2VKNA 4F59A 4FL6A 4DA4A 1VQ7A 3US4A 2QAZA 1SEMA 4KGZB 4FSXA 1ARKA 2VXEA 5FU6C 2MQIA 2LRAA 3L2QA 3M0SA 4DBFA 1AYCA 1VUBA 2YUPA 2XDDA 1C1AA 3H8ZA 3KUFA 3RKWA 2OTJT 3IN8A 1K8AC 1SSFA 2CP3A 2A36A 3CMEA 2XIDA 3JCMb 1WJQA 5KYWA 1XQHA 1D09B 3QZ9B 4M75B 3CMAA 4DOWA 3MHXA 4GL9E 4RCBA 3LX7A 4M77E 2K3BA 2OAUA 8ATCB 1YI2Q 1X27A 1VQ5A 1QW1A 2MI6A 4KBMB 1QCFA 3L2RA 1BLKA 3HFNA 3P8BB 2LDMA 1VQ9T 1YIJQ 1Y1UA 2J7IA 4J6YA 3VU3C 3RDVA 2KROA 3PMIA 2DRMA 3OS5A 2FRWA 2O4XA 1QG1E 1LUKA 3OYKA 1MGQA 1MUZA 1IO6A 4X1VA 1O4MA 5D0JA 4NS5A 2M0OA 2KQWA 1Q81R 3PVQA 4FSSA 3M0QA 2RORA 1PSEA 3RMSA 4A4FA 1O4DA 1O4RA
chains in the Genus database with same CATH topology
1M3AA 4AFQC 2RF0A 3KFVA 1YVHA 2FRYA 2DBMA 1O41A 2KXDA 1N5ZA 1VYUA 1EFNA 2J06A 2D8JA 1AD5A 5DC9A 2EGEA 1YWPA 4HVVA 2DJQA 1Y57A 1JWOA 4EY0A 1HCSB 1FMKA 1WA7A 5DF6A 2J6FA 4J9HA 2CUBA 1I0CA 1AOUF 2DX1A 2K6DA 1SPKA 2D1XA 2Y1NA 3PSJA 1VA7A 4J9FA 1Z9QA 3THKA 3UA6A 1F1WA 2VWFA 3OV1A 1O49A 2W10A 4J9BA 4AFZC 2PNBA 2VVKA 1ZUYA 4U17A 1OO3A 2ENMA 2KE9A 1JO8A 2I0NA 3NGPA 1O4EA 2B3OA 1GRIA 2YSXA 3REBB 2L3PA 3H0HA 1A08A 3PJPA 2EQIA 1D1ZA 2FEIA 4LUDA 4RTYA 2HBWA 2EVRA 2HEQA 5FWCA 1JQQA 1ZLMA 3VRYA 5IHNA 1LUIA 1I07A 1SRMA 1BHHB 1O4OA 4GWFA 1GCQC 2JT4A 1R1PA 3HHMB 1M3BA 3EGUA 4RTTA 3TVTA 2RN8A 1QWFA 2JM9A 1KA6A 3PSKA 2HCKA 4LE9A 2SEMA 1AWJA 4J9IA 3VS7A 1W70A 1UUEA 5IXFA 2KNBB 1UECA 2DCRA 1M61A 2H8HA 4JJDA 3ZL7C 3PFVA 2IZVA 4CC3A 1OEBA 3UYOA 2LNWA 3VS2A 1O4NA 3H0FA 4K45A 2FCIA 4JJCA 2A08A 1MW4A 1M3CA 1WQUA 1SPRA 1KIKA 1BK2A 2EGCA 2A28A 3JV3A 4OHEA 1PHTA 1AYAA 1ZUKA 4AFSC 3GBQA 2LMJA 2RQRA 2OAWA 3VS4A 2DL5A 2GTOA 4OHHA 5IBSA 1PKTA 2KNOA 4P9VA 4F5BA 1SHAA 2O9VA 2MRJA 1PWTA 1A81A 3QWXX 4ORZA 3REAB 4OMMA 1IJRA 5EC7A 4JPBW 5HKWA 2IIMA 2NUZA 3OB1B 3NHNA 1BBZA 2DLPA 2HDAA 1A1BA 4TZIA 1U5SA 2RQTA 2SRCA 3CQTA 1UJ0A 5DC4A 4GLMA 1HCTB 2X3XD 3LH5A 5GJHA 1WIEA 2X3WD 4HVUA 3QWYA 1UURA 4OHDA 1BF5A 3RBBB 2YT6A 2AOAA 2EYXA 1S1NA 2YUQA 4RTWA 3SEMA 1PRLC 2K79A 3VS0A 2IUGA 3CXLA 2L4KA 4NWGA 3EG1A 1AWWA 4EIHA 1FU6A 1FYRA 2CIAA 2DM0A 2CI8A 2SHPA 2EYVA 1GHUA 1LKKA 2GTJA 1T0HA 1Y0MA 5GJIA 3C7IA 2H5KA 1SPSA 3M0TA 4E93A 3K2MA 2DMOA 4ESRA 1UDLA 2M51A 4HCKA 1HJDA 2D8HA 3IQLA 1UUSA 1ZUUA 2RPNA 2C0TA 1A09A 5BO4A 1NYFA 2CH4W 1M8MA 1B47A 1ABOA 1E7OA 2HDXA 3H41A 2RMXA 4OMQA 1T0JA 4RUGA 5L23A 4XZ1A 1GBRA 3OB2B 2MCNA 1TG0A 1BB9A 4F16A 1JU5A 1AOTF 2J6OA 4J9GA 1O4HA 2OI3A 2YSQA 1O4PA 1OPKA 4LN2A 1UHCA 1CJ1A 2DE0X 4FL2A 1K9AA 3N8MA 3PLFB 4J9DA 1BU1A 1RUWA 1K0SA 4RTVA 2HSPA 4E68A 1ABQA 1O45A 2ECDA 4H34A 2HMHA 4QSYA 2LP5A 3M0RA 1YN8A 2RNAA 1R1QA 1BG1A 2EO6A 1KSWA 2FPDA 1NM7A 2DM1A 1TUDA 1I3ZA 4DGXA 4AG1C 3H0IA 2EYZA 4OMLA 1HD3A 1X43A 3A98A 3EG2A 3EG0A 3KFJA 1GFDA 5EELA 2DA9A 2JMAA 3TL0A 2GQIA 1A0NB 2AKLA 1MILA 3GQIB 2LJ3A 1RLPC 2KYMA 5FW9A 1U06A 1UHFA 3S9KA 2LQNA 3VRQA 3BUNB 1WLPB 2K7AA 4ROJA 2M0YA 2YUNA 1J3TA 1CSZA 1JEGA 1QWEA 3I5RA 5AXIA 1JYQA 2E5KA 1YVLA 3NPFA 3EACA 1BLJA 3PE0A 3GXWA 3I9QA 1Z3KA 3O5ZA 2W0ZA 2V1RA 2KR3A 1JXOA 3M0PA 1YP5A 1WDXA 2KT1A 3EHQA 2CDTA 4CC7A 2Y3AB 3ZNIA 1T3LA 2DBKA 4CC2A 2AZVA 1AWXA 2KGTA 1X6CA 4NWFA 3IMDA 4F5AA 2LJ1A 2G6FX 2MIOA 2AUGA 1E6GA 1X6BA 1XA6A 3PVLA 2DL7A 2KBTA 1GFCA 2YUOA 1AZEA 1IS0A 3EAZA 1NZVA 4Z8AA 5J3XA 2FG0A 2DYBA 3BKBA 2EGAA 4IIOA 4DGPA 2PNIA 1W6XA 2CSQA 2EU0A 1WX6A 1LKLA 3NMZC 1JYRA 4A4CA 5CDWA 2L6KA 2DL4A 3CD3A 4JEGA 2L3TA 1I1JA 2C0OA 5GJVB 2ESWA 1CWEA 5I6VA 4WCIA 2BZXA 3WA4A 1O4CA 1AYBA 2DF6A 1TCEA 2MK2A 1CSKA 2JTEA 2CREA 2RQVA 1H3HA 2RVFA 1UE9A 2ROTA 1BKMA 4J9EA 1GCQA 1M30A 2KRMA 2OJ2A 1O4LA 4XZ0A 1AEYA 1K1ZA 1U3OA 3VS5A 5ECAA 1H92A 2MOXA 2CRHA 3I35A 1UJYA 1NZLA 5DC0B 1KC2A 4P9ZA 1M27C 2EYYA 2HUWA 1NLOC 3MXCA 1WYXA 1OOTA 2KK6A 4Z89A 2EO3A 1O4IA 1SHFA 3ULRB 3N7YA 3PQZA 1O4GA 1XOVA 2LCSA 2ROLA 5I22A 1O44A 2EL8A 4L1BB 2ECZA 4FL3A 2QDLA 1WXBA 2VIFA 5HKYA 3S8OA 1OPLA 1SKJA 1QKWA 2AOBA 2JS2A 2K79B 4U1PA 1JU5C 1JXMA 4KRTA 4JGHA 2OQ1A 1WXUA 1LUNA 1O4JA 1BKLA 1QADA 4M4ZA 2EYWA 1VYVA 3EG3A 4K2RA 1X0NA 1R1SA 1RLQC 4AFUC 3UATA 1AZGB 1RQQC 2EW3A 2LCTA 3M7FA 1QLYA 2KRSA 1K0XA 1KFZA 5IXBA 1Z9ZA 1AVZC 1O4KA 1CSYA 2BZYA 2K9GA 2LQWA 4RTUA 3N84A 3EHRA 2KEAA 2ED0A 2F2VA 1W1FA 2O2OA 3MAZA 3S8LA 4R0KA 2CH4A 1H9OA 4RTXA 1D4WA 2J6KA 1GCPA 5KAZA 2V1QA 1X69A 1G2BA 2H46E 1GBQA 2L3QA 2PNAA 1AWOA 1AOJA 2B86A 3GXXA 4A4BA 4FBNA 1AB2A 2LX7A 1A1CA 2MRKA 5HCKA 4RTZA 1PRMC 1A1AA 2CSIA 2ED1A 5EG3B 2L0AA 2GGRA 4HXJA 3VRZA 5IHIA 2EPDA 2D0NA 3VRRA 1A1EA 2DX0A 1SHDA 2Y1MA 3UF4A 2KYBA 4OHLA 4K44A 3PS5A 2CR4A 1SRLA 2L2PA 3IN7A 1NYGA 2DLYA 3UA7A 1H8KA 1O4QA 1X2QA 2CUDA 3IMJA 2RQWA 1QKXA 1ZBJA 4CC4B 5AULA 1NLPC 2XMFA 2J05A 1UTIA 1LUMA 2KRNA 4LNPA 2MC1A 1SHGA 1PICA 2PTKA 1WXTA 4OMNA 4OHIA 2CT4A 1FBVA 1WI7A 2LJ0A 2K7AB 2AKKA 1NG2A 1ZSGA 1G83A 2BZ8A 2DLZA 2F2XA 1O4FA 2K2MA 3HIZB 2JXBA 3CBLA 4IIMA 2ABLA 1O47A 1O4BA 1OO4A 2DL8A 1B3QA 1O4AA 2YDLA 2EKXA 1BM2A 1BFIA 2GBQA 4H1OA 2LNHB 2LZ6B 3R6NA 3OVEA 2DILA 4DEXA 1BHHA 4HVWA 2PLEA 3TSWA 4F17A 1FBZA 1KJWA 1OV3A 5EEQA 1LCKA 3C0CA 2DNUA 1LCJA 5I11A 2FO0A 3U23A 2CT3A 2DVJA 2ETZA 1E6HA 3M0UA 3S8NA 1A07A 3T04A 1TUCA 4ZNXA 1MV0B 1JYUA 1F2FA 2JYQA 1FHSA 2F2WA 2O9SA 2P4RA 1B07A 5IBMA 2RSYA 2O88A 1VYTA 2AK5A 1O46A 2L3SA 4JZ4A 1RPYA 2IUHA 3BUMB 1BHFA 1BMBA 1TZEE 2CI9A 1NRVA 1K76A 2DL3A 4EIKA 2BTTA 2FPEA 2QMSA 3CWGA 4GPLB 4WWQA 5HKZA 4QT7A 2DRKA 2C9WA 2A37A 2C0IA 1YWOA 2RMOA 1CWDL 1O43A 1GL5A 2OZOA 1V1CA 2VKNA 4F59A 2GE9A 1T3SA 1P13A 5IHKA 3US4A 5IH2A 1UFFA 1MV3A 3BUOB 1SEMA 4K11A 1K4US 2FPFA 3MXYA 1NEGA 4A63B 1ARKA 2XP1A 3TSZA 1NEBA 1RJAA 2MQIA 1SHBA 5FWBA 3VRNA 3BUWB 4Y92A 4OMPA 2GNCA 1SSHA 1RI9A 3M0SA 1AYCA 2YUPA 4DEYA 2PZ1A 2IUIA 4AG2C 1UG1A 1YCSB 2GSBA 1FYNA 4GBQA 3VS1A 1CKBA 3IN8A 1AYDA 5EHPA 2A36A 2JS0A 2KT8A 4JZ3A 4D8KA 3OP0A 4OMOA 2EBPA 4Z88A 3HCKA 1O42A 5EHRA 1CKAA 3VS3A 4F14A 2JM8A 1ZX6A 4LUEA 1PNJA 4GL9E 1X2KA 2RQUA 4J9CA 5GJWB 4E6RA 3VROA 1HSQA 2K3BA 1X27A 1X6GA 2HDVA 2CBLA 1D4TA 2JW4A 3TKZA 1QCFA 1BLKA 2EKHA 3VRPA 1WFWA 1YNZA 2YU7A 2NWMA 1BFJA 3RNJA 1Y1UA 2J7IA 1M27A 2LNXA 3BUXB 1UGVA 1O48A 2KROA 2JMCA 3VS6A 2CS0A 4X6SA 2KXCA 3FJ5A 1PKSA 2DRMA 2BBUA 1FU5A 2FRWA 3I5SA 1QG1E 1LUKA 4D8DA 1KA7A 3SHWA 2AZSA 4X1VA 1MUZA 1IO6A 1O4MA 2EOBA 5D0JA 1ZFPE 3PVQA 3VGOA 4JE4A 4FSSA 3M0QA 4JJBA 2RORA 2PLDA 2O31A 1O4DA 1O4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M3A A;  4AFQ C;  2RF0 A;  3KFV A;  1YVH A;  2FRY A;  2DBM A;  1O41 A;  2KXD A;  1N5Z A;  1VYU A;  1EFN A;  2J06 A;  2D8J A;  1AD5 A;  5DC9 A;  2EGE A;  1YWP A;  4HVV A;  2DJQ A;  1Y57 A;  1JWO A;  4EY0 A;  1HCS B;  1FMK A;  1WA7 A;  5DF6 A;  2J6F A;  4J9H A;  2CUB A;  1I0C A;  1AOU F;  2DX1 A;  2K6D A;  1SPK A;  2D1X A;  2Y1N A;  3PSJ A;  1VA7 A;  4J9F A;  1Z9Q A;  3THK A;  3UA6 A;  1F1W A;  2VWF A;  3OV1 A;  1O49 A;  2W10 A;  4J9B A;  4AFZ C;  2PNB A;  2VVK A;  1ZUY A;  4U17 A;  1OO3 A;  2ENM A;  2KE9 A;  1JO8 A;  2I0N A;  3NGP A;  1O4E A;  2B3O A;  1GRI A;  2YSX A;  3REB B;  2L3P A;  3H0H A;  1A08 A;  3PJP A;  2EQI A;  1D1Z A;  2FEI A;  4LUD A;  4RTY A;  2HBW A;  2EVR A;  2HEQ A;  5FWC A;  1JQQ A;  1ZLM A;  3VRY A;  5IHN A;  1LUI A;  1I07 A;  1SRM A;  1BHH B;  1O4O A;  4GWF A;  1GCQ C;  2JT4 A;  1R1P A;  3HHM B;  1M3B A;  3EGU A;  4RTT A;  3TVT A;  2RN8 A;  1QWF A;  2JM9 A;  1KA6 A;  3PSK A;  2HCK A;  4LE9 A;  2SEM A;  1AWJ A;  4J9I A;  3VS7 A;  1W70 A;  1UUE A;  5IXF A;  2KNB B;  1UEC A;  2DCR A;  1M61 A;  2H8H A;  4JJD A;  3ZL7 C;  3PFV A;  2IZV A;  4CC3 A;  1OEB A;  3UYO A;  2LNW A;  3VS2 A;  1O4N A;  3H0F A;  4K45 A;  2FCI A;  4JJC A;  2A08 A;  1MW4 A;  1M3C A;  1WQU A;  1SPR A;  1KIK A;  1BK2 A;  2EGC A;  2A28 A;  3JV3 A;  4OHE A;  1PHT A;  1AYA A;  1ZUK A;  4AFS C;  3GBQ A;  2LMJ A;  2RQR A;  2OAW A;  3VS4 A;  2DL5 A;  2GTO A;  4OHH A;  5IBS A;  1PKT A;  2KNO A;  4P9V A;  4F5B A;  1SHA A;  2O9V A;  2MRJ A;  1PWT A;  1A81 A;  3QWX X;  4ORZ A;  3REA B;  4OMM A;  1IJR A;  5EC7 A;  4JPB W;  5HKW A;  2IIM A;  2NUZ A;  3OB1 B;  3NHN A;  1BBZ A;  2DLP A;  2HDA A;  1A1B A;  4TZI A;  1U5S A;  2RQT A;  2SRC A;  3CQT A;  1UJ0 A;  5DC4 A;  4GLM A;  1HCT B;  2X3X D;  3LH5 A;  5GJH A;  1WIE A;  2X3W D;  4HVU A;  3QWY A;  1UUR A;  4OHD A;  1BF5 A;  3RBB B;  2YT6 A;  2AOA A;  2EYX A;  1S1N A;  2YUQ A;  4RTW A;  3SEM A;  1PRL C;  2K79 A;  3VS0 A;  2IUG A;  3CXL A;  2L4K A;  4NWG A;  3EG1 A;  1AWW A;  4EIH A;  1FU6 A;  1FYR A;  2CIA A;  2DM0 A;  2CI8 A;  2SHP A;  2EYV A;  1GHU A;  1LKK A;  2GTJ A;  1T0H A;  1Y0M A;  5GJI A;  3C7I A;  2H5K A;  1SPS A;  3M0T A;  4E93 A;  3K2M A;  2DMO A;  4ESR A;  1UDL A;  2M51 A;  4HCK A;  1HJD A;  2D8H A;  3IQL A;  1UUS A;  1ZUU A;  2RPN A;  2C0T A;  1A09 A;  5BO4 A;  1NYF A;  2CH4 W;  1M8M A;  1B47 A;  1ABO A;  1E7O A;  2HDX A;  3H41 A;  2RMX A;  4OMQ A;  1T0J A;  4RUG A;  5L23 A;  4XZ1 A;  1GBR A;  3OB2 B;  2MCN A;  1TG0 A;  1BB9 A;  4F16 A;  1JU5 A;  1AOT F;  2J6O A;  4J9G A;  1O4H A;  2OI3 A;  2YSQ A;  1O4P A;  1OPK A;  4LN2 A;  1UHC A;  1CJ1 A;  2DE0 X;  4FL2 A;  1K9A A;  3N8M A;  3PLF B;  4J9D A;  1BU1 A;  1RUW A;  1K0S A;  4RTV A;  2HSP A;  4E68 A;  1ABQ A;  1O45 A;  2ECD A;  4H34 A;  2HMH A;  4QSY A;  2LP5 A;  3M0R A;  1YN8 A;  2RNA A;  1R1Q A;  1BG1 A;  2EO6 A;  1KSW A;  2FPD A;  1NM7 A;  2DM1 A;  1TUD A;  1I3Z A;  4DGX A;  4AG1 C;  3H0I A;  2EYZ A;  4OML A;  1HD3 A;  1X43 A;  3A98 A;  3EG2 A;  3EG0 A;  3KFJ A;  1GFD A;  5EEL A;  2DA9 A;  2JMA A;  3TL0 A;  2GQI A;  1A0N B;  2AKL A;  1MIL A;  3GQI B;  2LJ3 A;  1RLP C;  2KYM A;  5FW9 A;  1U06 A;  1UHF A;  3S9K A;  2LQN A;  3VRQ A;  3BUN B;  1WLP B;  2K7A A;  4ROJ A;  2M0Y A;  2YUN A;  1J3T A;  1CSZ A;  1JEG A;  1QWE A;  3I5R A;  5AXI A;  1JYQ A;  2E5K A;  1YVL A;  3NPF A;  3EAC A;  1BLJ A;  3PE0 A;  3GXW A;  3I9Q A;  1Z3K A;  3O5Z A;  2W0Z A;  2V1R A;  2KR3 A;  1JXO A;  3M0P A;  1YP5 A;  1WDX A;  2KT1 A;  3EHQ A;  2CDT A;  4CC7 A;  2Y3A B;  3ZNI A;  1T3L A;  2DBK A;  4CC2 A;  2AZV A;  1AWX A;  2KGT A;  1X6C A;  4NWF A;  3IMD A;  4F5A A;  2LJ1 A;  2G6F X;  2MIO A;  2AUG A;  1E6G A;  1X6B A;  1XA6 A;  3PVL A;  2DL7 A;  2KBT A;  1GFC A;  2YUO A;  1AZE A;  1IS0 A;  3EAZ A;  1NZV A;  4Z8A A;  5J3X A;  2FG0 A;  2DYB A;  3BKB A;  2EGA A;  4IIO A;  4DGP A;  2PNI A;  1W6X A;  2CSQ A;  2EU0 A;  1WX6 A;  1LKL A;  3NMZ C;  1JYR A;  4A4C A;  5CDW A;  2L6K A;  2DL4 A;  3CD3 A;  4JEG A;  2L3T A;  1I1J A;  2C0O A;  5GJV B;  2ESW A;  1CWE A;  5I6V A;  4WCI A;  2BZX A;  3WA4 A;  1O4C A;  1AYB A;  2DF6 A;  1TCE A;  2MK2 A;  1CSK A;  2JTE A;  2CRE A;  2RQV A;  1H3H A;  2RVF A;  1UE9 A;  2ROT A;  1BKM A;  4J9E A;  1GCQ A;  1M30 A;  2KRM A;  2OJ2 A;  1O4L A;  4XZ0 A;  1AEY A;  1K1Z A;  1U3O A;  3VS5 A;  5ECA A;  1H92 A;  2MOX A;  2CRH A;  3I35 A;  1UJY A;  1NZL A;  5DC0 B;  1KC2 A;  4P9Z A;  1M27 C;  2EYY A;  2HUW A;  1NLO C;  3MXC A;  1WYX A;  1OOT A;  2KK6 A;  4Z89 A;  2EO3 A;  1O4I A;  1SHF A;  3ULR B;  3N7Y A;  3PQZ A;  1O4G A;  1XOV A;  2LCS A;  2ROL A;  5I22 A;  1O44 A;  2EL8 A;  4L1B B;  2ECZ A;  4FL3 A;  2QDL A;  1WXB A;  2VIF A;  5HKY A;  3S8O A;  1OPL A;  1SKJ A;  1QKW A;  2AOB A;  2JS2 A;  2K79 B;  4U1P A;  1JU5 C;  1JXM A;  4KRT A;  4JGH A;  2OQ1 A;  1WXU A;  1LUN A;  1O4J A;  1BKL A;  1QAD A;  4M4Z A;  2EYW A;  1VYV A;  3EG3 A;  4K2R A;  1X0N A;  1R1S A;  1RLQ C;  4AFU C;  3UAT A;  1AZG B;  1RQQ C;  2EW3 A;  2LCT A;  3M7F A;  1QLY A;  2KRS A;  1K0X A;  1KFZ A;  5IXB A;  1Z9Z A;  1AVZ C;  1O4K A;  1CSY A;  2BZY A;  2K9G A;  2LQW A;  4RTU A;  3N84 A;  3EHR A;  2KEA A;  2ED0 A;  2F2V A;  1W1F A;  2O2O A;  3MAZ A;  3S8L A;  4R0K A;  2CH4 A;  1H9O A;  4RTX A;  1D4W A;  2J6K A;  1GCP A;  5KAZ A;  2V1Q A;  1X69 A;  1G2B A;  2H46 E;  1GBQ A;  2L3Q A;  2PNA A;  1AWO A;  1AOJ A;  2B86 A;  3GXX A;  4A4B A;  4FBN A;  1AB2 A;  2LX7 A;  1A1C A;  2MRK A;  5HCK A;  4RTZ A;  1PRM C;  1A1A A;  2CSI A;  2ED1 A;  5EG3 B;  2L0A A;  2GGR A;  4HXJ A;  3VRZ A;  5IHI A;  2EPD A;  2D0N A;  3VRR A;  1A1E A;  2DX0 A;  1SHD A;  2Y1M A;  3UF4 A;  2KYB A;  4OHL A;  4K44 A;  3PS5 A;  2CR4 A;  1SRL A;  2L2P A;  3IN7 A;  1NYG A;  2DLY A;  3UA7 A;  1H8K A;  1O4Q A;  1X2Q A;  2CUD A;  3IMJ A;  2RQW A;  1QKX A;  1ZBJ A;  4CC4 B;  5AUL A;  1NLP C;  2XMF A;  2J05 A;  1UTI A;  1LUM A;  2KRN A;  4LNP A;  2MC1 A;  1SHG A;  1PIC A;  2PTK A;  1WXT A;  4OMN A;  4OHI A;  2CT4 A;  1FBV A;  1WI7 A;  2LJ0 A;  2K7A B;  2AKK A;  1NG2 A;  1ZSG A;  1G83 A;  2BZ8 A;  2DLZ A;  2F2X A;  1O4F A;  2K2M A;  3HIZ B;  2JXB A;  3CBL A;  4IIM A;  2ABL A;  1O47 A;  1O4B A;  1OO4 A;  2DL8 A;  1B3Q A;  1O4A A;  2YDL A;  2EKX A;  1BM2 A;  1BFI A;  2GBQ A;  4H1O A;  2LNH B;  2LZ6 B;  3R6N A;  3OVE A;  2DIL A;  4DEX A;  1BHH A;  4HVW A;  2PLE A;  3TSW A;  4F17 A;  1FBZ A;  1KJW A;  1OV3 A;  5EEQ A;  1LCK A;  3C0C A;  2DNU A;  1LCJ A;  5I11 A;  2FO0 A;  3U23 A;  2CT3 A;  2DVJ A;  2ETZ A;  1E6H A;  3M0U A;  3S8N A;  1A07 A;  3T04 A;  1TUC A;  4ZNX A;  1MV0 B;  1JYU A;  1F2F A;  2JYQ A;  1FHS A;  2F2W A;  2O9S A;  2P4R A;  1B07 A;  5IBM A;  2RSY A;  2O88 A;  1VYT A;  2AK5 A;  1O46 A;  2L3S A;  4JZ4 A;  1RPY A;  2IUH A;  3BUM B;  1BHF A;  1BMB A;  1TZE E;  2CI9 A;  1NRV A;  1K76 A;  2DL3 A;  4EIK A;  2BTT A;  2FPE A;  2QMS A;  3CWG A;  4GPL B;  4WWQ A;  5HKZ A;  4QT7 A;  2DRK A;  2C9W A;  2A37 A;  2C0I A;  1YWO A;  2RMO A;  1CWD L;  1O43 A;  1GL5 A;  2OZO A;  1V1C A;  2VKN A;  4F59 A;  2GE9 A;  1T3S A;  1P13 A;  5IHK A;  3US4 A;  5IH2 A;  1UFF A;  1MV3 A;  3BUO B;  1SEM A;  4K11 A;  1K4U S;  2FPF A;  3MXY A;  1NEG A;  4A63 B;  1ARK A;  2XP1 A;  3TSZ A;  1NEB A;  1RJA A;  2MQI A;  1SHB A;  5FWB A;  3VRN A;  3BUW B;  4Y92 A;  4OMP A;  2GNC A;  1SSH A;  1RI9 A;  3M0S A;  1AYC A;  2YUP A;  4DEY A;  2PZ1 A;  2IUI A;  4AG2 C;  1UG1 A;  1YCS B;  2GSB A;  1FYN A;  4GBQ A;  3VS1 A;  1CKB A;  3IN8 A;  1AYD A;  5EHP A;  2A36 A;  2JS0 A;  2KT8 A;  4JZ3 A;  4D8K A;  3OP0 A;  4OMO A;  2EBP A;  4Z88 A;  3HCK A;  1O42 A;  5EHR A;  1CKA A;  3VS3 A;  4F14 A;  2JM8 A;  1ZX6 A;  4LUE A;  1PNJ A;  4GL9 E;  1X2K A;  2RQU A;  4J9C A;  5GJW B;  4E6R A;  3VRO A;  1HSQ A;  2K3B A;  1X27 A;  1X6G A;  2HDV A;  2CBL A;  1D4T A;  2JW4 A;  3TKZ A;  1QCF A;  1BLK A;  2EKH A;  3VRP A;  1WFW A;  1YNZ A;  2YU7 A;  2NWM A;  1BFJ A;  3RNJ A;  1Y1U A;  2J7I A;  1M27 A;  2LNX A;  3BUX B;  1UGV A;  1O48 A;  2KRO A;  2JMC A;  3VS6 A;  2CS0 A;  4X6S A;  2KXC A;  3FJ5 A;  1PKS A;  2DRM A;  2BBU A;  1FU5 A;  2FRW A;  3I5S A;  1QG1 E;  1LUK A;  4D8D A;  1KA7 A;  3SHW A;  2AZS A;  4X1V A;  1MUZ A;  1IO6 A;  1O4M A;  2EOB A;  5D0J A;  1ZFP E;  3PVQ A;  3VGO A;  4JE4 A;  4FSS A;  3M0Q A;  4JJB A;  2ROR A;  2PLD A;  2O31 A;  1O4D A;  1O4R A; 
#chains in the Genus database with same CATH topology
 1M3A A;  3VUB A;  2FRY A;  4J8O A;  1W2B P;  2KXD A;  5I2M A;  5DC9 A;  1YWP A;  2AIR B;  4FW2 A;  1JWO A;  2XHC A;  2J6F A;  4J9H A;  5GAN 8;  2DX1 A;  3HL8 A;  3G6E T;  1YIT T;  2D1X A;  1TWB A;  3JB9 F;  1YJW A;  2VWF A;  2BIV A;  2W10 A;  3JCM d;  1VIE A;  1TTH B;  3JB9 G;  1YJ9 Q;  2I0N A;  4L5G A;  2G3R A;  2L3P A;  3H0H A;  3MO8 A;  4N0A C;  3OYL A;  3OS1 A;  2FEI A;  2HZY A;  4LUD A;  4RTY A;  5FWC A;  4HCC A;  1JQQ A;  1ZLM A;  3VRY A;  5A2Q E;  2DD4 A;  1GCQ C;  4M78 F;  1AT1 B;  1DJ7 B;  2RI2 A;  4RTT A;  3TVT A;  3PSK A;  1QWF A;  2SEM A;  3VS7 A;  3K2T A;  3CCR A;  4GY5 A;  4M78 G;  1UUE A;  1UEC A;  3EG9 B;  4PJO D;  2H8H A;  1LNX A;  2VV5 A;  3ZL7 C;  4JS4 A;  3CCJ Q;  3PIP A;  2E12 A;  3H0F A;  1M3C A;  2QG9 B;  2BUD A;  3JCM J;  5GMK l;  1BK2 A;  5GAN 7;  5KYX A;  4B6M A;  1PHT A;  1ZUK A;  4AFS C;  2DD5 A;  1NZ9 A;  2LMJ A;  3VS4 A;  2GTO A;  1WZO A;  1KD1 U;  2O9V A;  1A81 A;  4ORZ A;  1KC8 C;  1VQP Q;  4BB7 A;  2ZGW A;  4JRP A;  4JPB W;  1O75 A;  1LJO A;  1U5S A;  2SRC A;  1EX4 A;  1NJI R;  3OYN A;  3LH5 A;  4HVU A;  3EFO A;  2FZG B;  4F7U E;  2FZK B;  3G71 Q;  5GAO q;  2AOA A;  1PRL C;  4NWG A;  1I5O B;  3TCJ A;  3VV0 A;  1FYR A;  2CIA A;  2DM0 A;  2CI8 A;  2SHP A;  2K5I A;  1LKK A;  2GTJ A;  1Y0M A;  1RAB B;  3SWN A;  3C7I A;  4ZTF A;  4PJO A;  3QZ5 B;  4OP0 A;  4E93 A;  2DMO A;  3QO3 A;  1NE8 A;  2KSS A;  3LYI A;  4HCK A;  1HJD A;  3HFO A;  5HY6 A;  2RPN A;  1A09 A;  1OQK A;  1M8M A;  1ABO A;  1V29 B;  1BI0 A;  1E7O A;  3EGD A;  1MND A;  2JNG A;  1YI2 T;  2ZCF B;  4OMQ A;  4M78 B;  2PUK B;  3CCV Q;  2A3L A;  4F16 A;  5C6S A;  1AOT F;  2J6O A;  2JUF A;  1YIJ T;  3JRZ A;  1K9A A;  4J9D A;  3CBO A;  1IXD A;  1K0S A;  2VXF A;  4E68 A;  4QSY A;  1YN8 A;  2RNA A;  3MEU A;  3OYE A;  4LD6 A;  2E1H A;  4ZN3 A;  1Q82 U;  4AG1 C;  2E6Z A;  2RI5 A;  2EYZ A;  3L2W A;  1X43 A;  4ZGJ B;  2DA9 A;  2LVM A;  2AKL A;  3GQI B;  3CXC S;  2LJ3 A;  4O6J A;  4L59 A;  1U06 A;  3S9K A;  2LQN A;  3CCU A;  2K7A A;  2M0Y A;  1J3T A;  3FEO A;  1QWE A;  3I5R A;  1G8X A;  5GAN 3;  1I81 A;  2DTO A;  3PE0 A;  3I9Q A;  1Z3K A;  2W0Z A;  2MPX C;  1JXO A;  1YP5 A;  1WDX A;  5CKF A;  2FZC B;  2Y3A B;  4CC2 A;  1M1F A;  1AWX A;  2KGT A;  1YJ9 T;  2BE7 D;  4R55 A;  3IMD A;  3OYF A;  1W4S A;  2JTF A;  3OBW A;  1E6G A;  1XA6 A;  3PVL A;  4JUV A;  1VQO Q;  2DL7 A;  2KBT A;  3CC4 Q;  1OX8 A;  1UGQ B;  4BI3 A;  4Z8A A;  2E64 A;  1N8R C;  4XTV A;  4DGP A;  3EGX A;  2EU0 A;  3NMZ C;  4KGX B;  5CDW A;  3OSS C;  1VQN A;  4J5Y A;  1K73 C;  2L3T A;  3OS0 A;  5FRO A;  4WCI A;  3GOX A;  1O4C A;  5CVI A;  2X4X A;  1K8A U;  1M1K R;  1CSK A;  2CRE A;  2LCL A;  1BKM A;  1QVG P;  2CGH A;  2JVV A;  3OYM A;  4XZ0 A;  3CPW S;  3VS5 A;  2MOX A;  4XTZ A;  1NZL A;  5DC0 B;  4P9Z A;  2HL3 A;  1O4I A;  3NTK A;  1Y96 B;  1VQP T;  1WXB A;  3FRN A;  2OTL A;  1SKJ A;  1WHH A;  4OB1 B;  4P5N A;  4KRT A;  4QVZ A;  1S72 T;  4JRI A;  4MDW A;  3M9Q A;  3G71 T;  5D6W A;  3GIB A;  1Q86 U;  3X24 B;  3UDC A;  1AZG B;  2EW3 A;  1WHK A;  3M7F A;  1U1T A;  1YHQ Q;  1TOV A;  1QVF S;  1KFZ A;  1Z9Z A;  1AVZ C;  3D7S B;  1KK7 A;  1CSY A;  3VYG A;  2X35 A;  3EHR A;  2F2V A;  2QQB A;  3MKD A;  2D6F A;  2MAM A;  4R0K A;  5LJ5 d;  2QEX A;  2J6K A;  1GCP A;  5KAZ A;  5A0D A;  1IHW A;  1G2B A;  1GBQ A;  1AWO A;  4M7D C;  4ZN1 A;  1G3S A;  1ZA2 B;  3V7C A;  4E7J A;  2Y4X A;  2LX7 A;  1YJN A;  2MRK A;  5HCK A;  3CME Q;  3CCV T;  3INZ A;  2ED1 A;  2YHT A;  1A1A A;  4DBH A;  2L0A A;  1WGS A;  1PSF A;  2D0N A;  2RJF A;  3FB9 A;  3A8G B;  3M4G A;  3JCM V;  1B7T A;  3UF4 A;  2CR4 A;  2HMA A;  3IN7 A;  4C0F A;  2Z0W A;  1NYG A;  3C12 A;  2HBP A;  2CUD A;  5AYF A;  4C8Q A;  1QKX A;  4D6W A;  3ASK A;  1UTI A;  2KRN A;  2MC1 A;  1FX7 A;  4KH0 B;  1SHG A;  1WXT A;  4OMN A;  4FU6 A;  1BKB A;  1X75 C;  1FBV A;  2MK5 A;  3HIZ B;  3CBL A;  4IIM A;  3OMC A;  1OO4 A;  1B3Q A;  1KQS S;  3G4S A;  2K5L A;  2P0P A;  1BM2 A;  3P8H A;  3R6N A;  3OVE A;  3G7Z A;  2EJF A;  4DEX A;  1BHH A;  3H6Z A;  1D3B B;  3SDZ A;  1M2O A;  1LCK A;  2DNU A;  1LCJ A;  3URG A;  2CT3 A;  4EPC A;  3S8N A;  1A07 A;  3VKI A;  1TUC A;  4ZNX A;  2JYQ A;  2F2W A;  2P4R A;  1B07 A;  3CC2 Q;  1VYT A;  2AK5 A;  1O46 A;  3BW1 A;  4EMK A;  4XU2 A;  2RO0 A;  2QMS A;  5LJ5 e;  3CWG A;  2EFI A;  4QT7 A;  2DRK A;  5GAM e;  1VQO T;  2EQJ A;  4RMO A;  2C9W A;  1YWO A;  2RMO A;  1YJW Q;  1O43 A;  2OZO A;  1K9M U;  3CCS A;  3MPU B;  2GE9 A;  3JCM g;  3SWN C;  5IH2 A;  1MV3 A;  4PJO C;  4M77 D;  3BUO B;  1K4U S;  4A63 B;  2VB6 A;  1RJA A;  1TSF A;  5FWB A;  3BUW B;  2R5M A;  1KG1 A;  5L8R E;  4DEY A;  1UG1 A;  3E2U A;  4GBQ A;  3HRU A;  2JS0 A;  2KT8 A;  4AMC A;  1M8V A;  4JZ3 A;  3OP0 A;  1Q95 G;  5KYU A;  4OMO A;  4OMF B;  1ZQ1 A;  3SD4 A;  3VS3 A;  3L2V A;  1ZX6 A;  2QTV A;  4LUE A;  4M78 E;  2P0Q A;  4E6R A;  4N4G A;  1HSQ A;  2HDV A;  2DPP B;  5KCO A;  3FLG A;  3OYD A;  2EKH A;  1WFW A;  3VUZ A;  1YCY A;  4ATO A;  2YU7 A;  2NWM A;  4WTO B;  3LWI A;  3RNJ A;  3M55 A;  2LNX A;  1UGV A;  1O48 A;  2JMC A;  3VS6 A;  4PFZ A;  2E5Q A;  1VQ6 A;  4M77 A;  3OW2 S;  1RAF B;  3A8O B;  1KA7 A;  3SHW A;  2AZS A;  1YHQ T;  2EOB A;  2F5T X;  5FU7 C;  2QYZ A;  3NTI A;  1ZFP E;  1Y71 A;  3ER0 A;  4JE4 A;  3MEW A;  4JJB A;  4X9D A;  3CC7 A;  3RR6 A;  3CD6 A;  1YVH A;  3CPW A;  3I55 Q;  2LTO A;  3CCE A;  5DF6 A;  4C5H A;  3S3O A;  1I0C A;  1VQK A;  3CME T;  1P92 A;  1Z9Q A;  3CEY A;  3DLL A;  2DFU A;  2ZAE A;  4XTW A;  4AFZ C;  3QII A;  2VYT A;  3MP1 A;  2VVK A;  4U17 A;  5GMK i;  3NGP A;  1O4E A;  1GRI A;  4PL6 A;  2QTX A;  4XU3 A;  1PD1 A;  4PJO F;  3QXE B;  1RL2 A;  3RES A;  2FB7 A;  2GQV A;  5IHN A;  4HCB A;  1I07 A;  1SRM A;  1O4O A;  4PJO G;  2L89 A;  1BI3 A;  4J7I A;  2PQW A;  4FYW B;  7AT1 B;  4GLK A;  1AWJ A;  2PVD B;  5GAN 4;  2CZ6 B;  4C5E A;  2LT1 A;  4JJD A;  2GCX A;  2IZV A;  3UYO A;  3CCM A;  3GPL A;  4O5V A;  1O4N A;  2XK0 A;  3LW5 E;  4HA8 A;  1QCN A;  1KIK A;  3CC2 T;  3GNG A;  3CCU Q;  4OHE A;  1OI1 A;  3GBQ A;  2RQR A;  1M1G A;  1OU8 A;  3PMT A;  2XD0 A;  3LWH A;  4P9V A;  1JJ2 A;  2QQS A;  5KYX B;  1SHA A;  2DIG A;  3QWX X;  3REA B;  1KD1 R;  2NUT A;  1VQM Q;  2L5Q A;  5EC7 A;  1BBZ A;  2HDA A;  4MZM A;  3HHT B;  2EWN A;  5DC4 A;  5J39 A;  4BI4 A;  1C6V X;  1G3W A;  3OS2 A;  1BF5 A;  2EJG A;  3TU4 K;  2EYX A;  1S1N A;  2YUQ A;  1KQS A;  3N5B B;  2K79 A;  3SEM A;  3CXL A;  3EG1 A;  1AWW A;  4EIH A;  1GHU A;  2RI3 A;  4R56 A;  1IGQ A;  3L2Z A;  1RAI B;  4FIB A;  5CKB A;  4FW1 A;  4PFP A;  1PD0 A;  2H5K A;  4BE1 A;  2YRD A;  4M7D D;  3K2M A;  1UDL A;  2M51 A;  5LJ3 d;  2D8H A;  3JCM X;  1UUS A;  4F7U A;  4PJO B;  2CH4 W;  1NJI C;  3X28 B;  2JN0 A;  4C8Q C;  5DLQ E;  2HDX A;  2COY A;  3H41 A;  5D7U A;  3OB2 B;  2MCN A;  4FYY B;  1BB9 A;  3RKX A;  4QVD A;  3L1A A;  3M59 A;  5A0G A;  4M7A E;  1M4Z A;  3QJY A;  4FL2 A;  1ZBX A;  3C94 A;  1RUW A;  4RTV A;  2HSP A;  2OTL Q;  1IGU A;  2V8J A;  2HMH A;  4OB0 B;  3JSC A;  3LH0 A;  3CCQ A;  1M90 C;  5DLO A;  2X4J A;  4YTL A;  3I56 Q;  1KSW A;  1M9S A;  1NPR A;  3A98 A;  3EG2 A;  4PLL A;  4WF2 A;  3I55 T;  1GFD A;  3J7A F;  2GQI A;  4M7D A;  5FW9 A;  3VJP A;  4EMK C;  2LQ8 A;  4ELY C;  4BI8 B;  5AXI A;  2E5K A;  1SF9 A;  3EAC A;  3SB2 A;  3GXW A;  3O5Z A;  2JZ2 A;  2KK4 A;  4OVA A;  5LJ5 g;  5GAM g;  4Y91 A;  1T3L A;  5LJ5 j;  5GAM j;  2OTJ A;  4C0D C;  1FWZ A;  2FL7 A;  5LJ3 e;  2LJ1 A;  4ELZ C;  4C92 E;  2G6F X;  3GNF B;  4LDV A;  1RAA B;  5GMK e;  3HKS A;  2R57 A;  1IS0 A;  1ZSZ C;  3EAZ A;  1NZV A;  5J3X A;  2FG0 A;  2EGA A;  2PNI A;  2XDB A;  1OYX A;  4A4C A;  4B9X A;  3FC3 A;  4DOV A;  3CD3 A;  1I1J A;  2DZ9 A;  4BE2 A;  3EGX B;  2DIQ A;  1VQ9 A;  2RB6 A;  2JTE A;  2RHZ A;  2EJ9 A;  1K8A R;  2DYI A;  1WPY A;  2ROT A;  4J9E A;  2D0Q B;  1M30 A;  1D1C A;  3CPW P;  3G4S Q;  5ECA A;  1H92 A;  4E7K A;  2K5F A;  3CCU T;  1IZ6 A;  6AT1 B;  4Y28 E;  4QQD A;  4E47 A;  2B8A A;  2PUO B;  3JCM e;  3MXC A;  2KAF A;  3GLX A;  2DJZ A;  2EO3 A;  1WQW A;  2DKG A;  2K3Y A;  3N7Y A;  3PQZ A;  4M77 C;  5M9O A;  4L1B B;  4FL3 A;  1VQM T;  1RAH B;  2VUB A;  4IUV A;  1V76 A;  2F1L A;  3UT1 A;  3S8O A;  1QKW A;  4U1P A;  3G6E A;  1WXU A;  1O4J A;  1QAD A;  3E9G A;  2H3J A;  3J80 E;  5KE3 A;  4K2R A;  1PC0 A;  3CCS Q;  1RLQ C;  1IB8 A;  4AFU C;  5FU6 B;  3UAT A;  1Q86 R;  5LJ5 h;  1K0X A;  5GAM h;  3L2U A;  2BZY A;  2LQW A;  5CCA A;  3N84 A;  3HSB A;  2ED0 A;  1W1F A;  3MP6 A;  1BI2 A;  3BE3 A;  5GAO l;  4QW2 A;  5GAN d;  4M7A C;  2GFU A;  3OYH A;  2MMP A;  1VQ4 Q;  5IAY A;  4A4H A;  2RJE A;  2H46 E;  2L3Q A;  2PNA A;  1VQL Q;  1AB2 A;  2COW A;  4HT8 A;  4XU0 A;  3OYG A;  4E7L A;  2HNI A;  5EG3 B;  4HXJ A;  5IHI A;  3MJX A;  1Y07 A;  2EPD A;  2CP0 A;  2KDS A;  3A8H B;  4FCY A;  1SHD A;  4XU1 A;  2Y1M A;  4OHL A;  3PS5 A;  4Q5W A;  1JJ2 P;  2QK0 A;  2Y4Y A;  1W2B S;  3QKJ A;  1O4Q A;  2CKK A;  2RQW A;  1KQ2 A;  4CC4 B;  3TRE A;  5AUL A;  1NLP C;  2ZPH B;  2XMF A;  4VUB A;  3X26 B;  1LUM A;  3MCA B;  4LNP A;  1WNL A;  2PTK A;  4L6V 5;  4LD9 K;  2CT4 A;  2R58 A;  2HD0 A;  3I56 T;  2P84 A;  1WI7 A;  2LJ0 A;  1ZSG A;  1G83 A;  2F2X A;  1O4F A;  2JXB A;  1O4B A;  1YBY A;  1O4A A;  2YDL A;  2EKX A;  1WJR A;  3NTH A;  4MZT A;  2GBQ A;  2LNH B;  2LZ6 B;  4C92 C;  2RHY A;  4XK8 E;  4HVW A;  3TSW A;  4C5G A;  1FBZ A;  4LXC A;  4QVC A;  3FJP A;  2OX7 A;  3CC7 Q;  3OQ5 A;  5I11 A;  1UB4 A;  2FO0 A;  1R0B G;  2ETZ A;  3CD6 Q;  1MV0 B;  1F2F A;  4XTX A;  4RG2 A;  4M77 F;  1RPY A;  2IUH A;  3JCM f;  4MDX A;  5FRM A;  3OB9 A;  2DL3 A;  5GAN e;  1VQK Q;  4M77 G;  4EIK A;  2NUP A;  2A37 A;  3CCJ T;  1GL5 A;  3KXT A;  3NFC A;  1V1C A;  3V8J A;  2DTI A;  1T3S A;  4JLG A;  1P13 A;  1K9M R;  2ZPF B;  1YI2 A;  4HT9 A;  3LGF A;  1UFF A;  3QYG B;  4M75 E;  2RHX A;  2FPF A;  2XU8 A;  1NEG A;  1G5V A;  3TSZ A;  1NEB A;  1SHB A;  2A7Y A;  2K4Y A;  1KQ1 A;  2FVU A;  2GNC A;  1SSH A;  1RI9 A;  2HSE B;  4JJN K;  1UGP B;  2IUI A;  2O01 E;  1OUL A;  2GSB A;  3MET A;  3JCM P;  1M2V A;  1CKB A;  1I4K 1;  3G4S T;  1VQ8 Q;  5EHP A;  5EG2 A;  4C8Q D;  2EBP A;  4Z88 A;  1JRI A;  4IKF A;  5EHR A;  2RD1 A;  1CKA A;  1R0C B;  4F14 A;  2JM8 A;  2VGM A;  1PNJ A;  3QJ6 A;  1X2K A;  2RQU A;  4J9C A;  3CCM Q;  1RAC B;  1VQ7 Q;  3JCM c;  2HL5 C;  2QQR A;  2CBL A;  4LDY A;  2JW4 A;  1D4T A;  3EH2 A;  3DLM A;  1WHL A;  3VRP A;  3QSU A;  5GMK m;  1BFJ A;  3M53 A;  1M27 A;  3FDR A;  2FYK A;  3BUX B;  1M90 U;  5I21 A;  1QP2 A;  2CS0 A;  4X6S A;  2KXC A;  3FJ5 A;  3CCS T;  1FU5 A;  1O9S A;  4MMK A;  1YJ9 A;  3I5S A;  4D8D A;  4BY6 C;  3EFS A;  1IRX A;  2P4T A;  2DXU A;  3A5Z B;  4M77 B;  1D0Y A;  2WSE E;  3JB9 J;  2PLD A;  3X25 B;  3CMA Q;  3RER A;  4WWQ A;  2RF0 A;  2P0K A;  1SG5 A;  3KFV A;  3HTR A;  1O41 A;  1VQ4 T;  1N5Z A;  1D1B A;  2D8J A;  1AD5 A;  2EGE A;  1VQL T;  1VQ5 Q;  1Y57 A;  2XI9 A;  1WA7 A;  1AOU F;  2K2V A;  2K6D A;  3OBY A;  3MP8 A;  1SPK A;  2CP2 A;  3UA6 A;  1F1W A;  4IUP A;  5GAN 5;  3CCL A;  5LJ3 g;  1O49 A;  4J9B A;  5LJ3 j;  2DTH A;  1OO3 A;  4X9C A;  2B3O A;  5FRN A;  3REB B;  3HPW A;  1Q7Y R;  3PJP A;  2EQI A;  4F04 B;  1D1Z A;  4KGV B;  1U8R A;  4ANJ A;  4PLI A;  4F7U F;  2JT4 A;  5GAO n;  3ZFJ A;  3HHM B;  1VQP A;  1M3B A;  2I2L A;  2JM9 A;  1KA6 A;  2YRC A;  1W70 A;  3WVD B;  4F7U G;  1KC8 U;  5IXF A;  2KNB B;  1S72 A;  4NL2 A;  3KBG A;  3PT9 A;  3CC7 T;  3PFV A;  3G71 A;  3CC4 T;  1TU0 B;  4CC3 A;  2LNW A;  4FT2 A;  3VS2 A;  3TQ7 P;  2FCI A;  1MHN A;  3JCM Q;  4XTU A;  4NOY A;  2A28 A;  3DKM A;  2E6N A;  3JV3 A;  1AYA A;  2QA4 A;  1I8F A;  2OAW A;  1VQK T;  2DL5 A;  5CIU A;  5IBS A;  4OHH A;  1UGR B;  1ZSZ A;  3CXC A;  2YLC A;  4OB3 B;  4OMM A;  1QVG S;  5HKW A;  2VC8 A;  2IIM A;  3OB1 B;  3NHN A;  3FIF A;  4M7D F;  1A1B A;  2RQT A;  5C0M A;  3CCR Q;  1HCT B;  2NUT B;  3Q1J A;  1JB0 E;  1PM3 A;  1WIE A;  2X3W D;  4OHD A;  1UUR A;  3RBB B;  5D6Y A;  4M7D G;  2LQK A;  2YT6 A;  2M16 A;  5LJ3 h;  2L4K A;  5KYW B;  1FU6 A;  5GAO r;  4M7A D;  1UEB A;  2EYV A;  2KI7 A;  2XIC A;  2LRQ A;  1T0H A;  2E70 A;  5J26 A;  1VQ8 T;  3M0T A;  4ESR A;  1KD1 C;  4IUQ A;  3IQL A;  2H3E B;  4KUI A;  1NYF A;  1B47 A;  3CCM T;  2AT1 B;  1PG5 B;  1RAD B;  1VQ7 T;  1LPL A;  4F7U B;  5KYY A;  2RMX A;  1T0J A;  4RUG A;  2DAQ A;  2O4X B;  4J9G A;  2KY9 A;  2OI3 A;  2YSQ A;  4JRQ A;  3A8L B;  1H64 1;  1OPK A;  2LX9 A;  5CKH A;  1UHC A;  1CJ1 A;  2D9T A;  2DE0 X;  2HKN A;  5IT9 E;  4OF1 A;  3PLF B;  3ZEH A;  1OX9 A;  1B34 A;  1OZ2 A;  3V7S A;  2LNV A;  2QDY B;  3JCM h;  1O45 A;  1WHG A;  4H34 A;  2LP5 A;  3PFS A;  4DBR A;  5GAO p;  1R1Q A;  3BDU A;  4OB2 B;  2LCC A;  1VQO A;  4C92 D;  2FPD A;  1NM7 A;  2DM1 A;  4DGX A;  4M7A A;  3CMA T;  2DXC A;  1UGS B;  3WVE B;  1Q81 C;  3KFJ A;  2RH2 A;  1H3Z A;  1PCX A;  1A0N B;  1MIL A;  2MWP A;  1N8R U;  1VQ5 T;  1UHF A;  5LJ5 f;  3VRQ A;  3BUN B;  1WLP B;  5GAM f;  1CSZ A;  1JEG A;  1K73 U;  4PNO A;  1JYQ A;  3NPF A;  4M7D B;  4QQ6 A;  2V1R A;  2YWW A;  1G3T A;  5GAN g;  1QVF A;  4CC7 A;  3ZNI A;  2AZV A;  4NWF A;  4F5A A;  1FMV A;  2MIO A;  2DET A;  1X6B A;  3S3M A;  2E41 A;  2YRV A;  1GFC A;  2DEU A;  2WSC E;  4LDU A;  2EIF A;  2L6K A;  4A4E A;  2DL4 A;  2IVW A;  4JEG A;  1TXQ A;  3M58 A;  2PVG B;  5GJV B;  2ESW A;  1CWE A;  4C92 A;  3M56 A;  2BZX A;  3WA4 A;  1AYB A;  2DF6 A;  2MK2 A;  4A54 A;  3G1J A;  3OA6 A;  1YJW T;  1I5L A;  1H3H A;  2RVF A;  4Z02 A;  4V2S A;  1MMG A;  1O4L A;  1AEY A;  1K1Z A;  1YHQ A;  1U3O A;  3BDL A;  1LVK A;  4JRK A;  5J3B A;  2MYS A;  1UJY A;  4KUD K;  2LC4 A;  1M27 C;  2HUW A;  1NLO C;  1WYX A;  2KK6 A;  4M78 C;  1O4G A;  2EL8 A;  2ECZ A;  3EFO B;  2QDL A;  3E19 A;  1VQN Q;  5HKY A;  1JU5 C;  3CCR T;  2VGN A;  4JGH A;  1LUN A;  3SWN B;  4M4Z A;  1VYV A;  3EG3 A;  3TEE A;  4HKE A;  4IUU A;  3QDF A;  1R1S A;  3OYC A;  1TUG B;  5GAN h;  2MWO A;  4DBQ A;  4QQG A;  2K9G A;  4OGE A;  3EGD B;  2KEA A;  2O2O A;  2QXF A;  4PKC C;  4DQ2 A;  3MAZ A;  4E7H A;  4C0G A;  2DK3 A;  3OYI A;  1D4W A;  4MZP A;  1ZA1 B;  5HK3 A;  1AOJ A;  1Y7X A;  4BE0 A;  3OMG A;  3GXX A;  4KH1 B;  4A4B A;  4PFO A;  4FBN A;  2QQA A;  2EYQ A;  3C95 A;  4RTZ A;  2R5A A;  1PRM C;  5GAN 6;  2GGR A;  1Q86 C;  2RA2 A;  4A53 A;  3VRR A;  2IPO B;  1QVG A;  1Q82 R;  2KYB A;  5DM7 R;  2L2P A;  2E3H A;  3CXC P;  3IMJ A;  1H8K A;  1X2Q A;  3CC2 A;  1ZBJ A;  2KVQ G;  2J05 A;  2AHJ B;  3CPF A;  2BE9 B;  4FYX B;  4EMH A;  1PIC A;  5GAN 2;  4OHI A;  1BIA A;  2K7A B;  1X01 A;  2AKK A;  1NG2 A;  2BZ8 A;  2QI2 A;  2DLZ A;  2QEX Q;  5FU7 B;  4FT4 A;  1WHJ A;  2ABL A;  4PK4 A;  4LDX A;  3HRS A;  1AHJ B;  2CS7 A;  1BFI A;  4H1O A;  1YJN Q;  3MEV A;  2E10 A;  2IG0 A;  2PLE A;  4M75 D;  3GP8 A;  4F17 A;  3OW2 A;  2DVJ A;  1E6H A;  1JYU A;  4CRI A;  1XTD A;  2O9S A;  2GF7 A;  5IBM A;  1VOM A;  5KCH A;  2O88 A;  3O8V A;  2HAX A;  1BHF A;  1TZE E;  5CK9 A;  4PJJ A;  1K76 A;  2ATC B;  5CO7 A;  2L8D A;  1QP3 A;  2BTT A;  2DZC A;  2X51 A;  3LLR A;  2C0I A;  3CCL Q;  2ZPI B;  2DXB A;  3RIR A;  2M1H A;  2C06 A;  2NUP B;  5IHK A;  2HQH A;  1D0Z A;  4UC4 A;  4C8Q F;  4K11 A;  3MXY A;  2XP1 A;  5D6X A;  1WJS A;  3VRN A;  3HP9 A;  4Y92 A;  4OMP A;  4C8Q G;  3J81 E;  4C5I A;  5CAI A;  3JB9 H;  2M9U A;  4E7I A;  2PZ1 A;  4AG2 C;  1YCS B;  1M1K C;  3S6W A;  4M75 A;  1FYN A;  3VS1 A;  3X20 B;  1AYD A;  4X34 A;  3EAE A;  1YIT A;  4D8K A;  4BDZ A;  1K9M C;  3HCK A;  1S72 Q;  1O42 A;  1M2V B;  4J6X A;  4J6W A;  3QPH A;  5GJW B;  3I55 A;  3VRO A;  1QMC A;  1QVF P;  1X6G A;  1VQN T;  5HKC A;  3TKZ A;  4NL3 A;  1WQ7 A;  2DXT A;  1LOJ A;  1YNZ A;  3OYJ A;  5AT1 B;  4FM4 B;  2QA4 Q;  2JJ9 A;  3QG1 A;  3M5A A;  3M4Y A;  2ZPB B;  3ME9 A;  2DER A;  1M90 R;  2RHI A;  1PKS A;  4FYV B;  5KH6 A;  2BBU A;  2EQU A;  1MMN A;  2COZ A;  4E2F B;  5HK0 A;  1Q81 U;  2JOY A;  5KYN A;  4BD3 A;  3VGO A;  1WHM A;  3A8M B;  5CKD A;  2O31 A;  2X4Y A;  2Y90 A;  2DEQ A;  3L42 A;  2CZ7 B;  4AFQ C;  2DBM A;  1VYU A;  5LJ3 f;  1EFN A;  2J06 A;  3JCM W;  4HVV A;  2DJQ A;  4M7D E;  4ME7 A;  2OTL T;  4TVR A;  1HCS B;  4EY0 A;  1FMK A;  4XQ3 A;  3LGL A;  1SKU B;  2CUB A;  4BAC A;  2Y1N A;  1XNI A;  3PSJ A;  4C8Q B;  1VA7 A;  4J9F A;  3THK A;  3OV1 A;  4JS5 A;  1M5Q 1;  2KGY A;  2PNB A;  4IUR A;  1ZUY A;  3QDR B;  1VQ6 Q;  1KQS P;  1BCM A;  2ENM A;  2KE9 A;  1JO8 A;  2YSX A;  4BUG A;  1RAE B;  1HK9 A;  2E3I A;  1A08 A;  1QVP A;  4RG8 A;  2HBW A;  2EVR A;  2HEQ A;  2E4H A;  3S3N A;  3JB9 D;  1LUI A;  1BHH B;  4KT0 E;  4GWF A;  2QEX T;  1R1P A;  4JDS A;  1VQM A;  2QQ9 A;  3EGU A;  2RN8 A;  3EG9 A;  5CR2 A;  2HCK A;  4LE9 A;  1D0X A;  4J9I A;  3CCE Q;  2BKD N;  3RKY A;  1YJN T;  1D1A A;  2DCR A;  1KC8 R;  1M61 A;  4EMG A;  2LT4 A;  1XJW B;  2NLU A;  5I2S A;  4EMK B;  1OEB A;  4KUL A;  3AHU A;  2HQX A;  1Q7Y C;  4K45 A;  2EAY A;  3BY7 A;  4JJC A;  2A08 A;  2KMT A;  4M78 D;  1MW4 A;  1WQU A;  1SPR A;  2NYS A;  2K57 A;  5KE2 A;  2EGC A;  2RK2 A;  2YLB A;  3OYB A;  2XG8 D;  4J7F A;  1YIJ A;  4C0D B;  1PKT A;  2RHU A;  2KNO A;  5IN1 A;  3CCL T;  4F5B A;  2MRJ A;  4M7A F;  1PWT A;  5CQX A;  1U1S A;  3DB3 A;  1F1B B;  3PNW C;  3QBY A;  4E7S A;  3VYH B;  3UPU A;  1IJR A;  1N6A A;  2K3X A;  2NUZ A;  2MF2 A;  3JAM E;  2DLP A;  1ZSZ B;  1NJI U;  3JB9 I;  4PJO E;  1HYO A;  4TZI A;  4M7A G;  4PJM A;  2A0F B;  2CP7 A;  3CQT A;  1UJ0 A;  2WAC A;  3GF5 A;  4GLM A;  2X3X D;  5GJH A;  3R6O A;  3QWY A;  1OZ3 A;  1IHV A;  4II1 A;  3QYH B;  4RTW A;  2IUG A;  2EKO A;  3VS0 A;  4B9W A;  2RJC A;  5KYU B;  2HKQ B;  2ZPG B;  5GJI A;  3M54 A;  3PIO A;  1SPS A;  1BI1 A;  3I56 A;  1ZUU A;  4RCC A;  2C0T A;  5BO4 A;  4HCZ A;  4M78 A;  3C4S A;  2DVE A;  3OYY A;  3E1S A;  3OW2 P;  2VAS A;  5L23 A;  4XZ1 A;  1GBR A;  1TG0 A;  2XDP A;  1JU5 A;  2HQE A;  4C92 F;  1O4H A;  2QA4 T;  5KYY B;  1O4P A;  4LN2 A;  3V8L A;  4BDY A;  5GAM d;  3N8M A;  4C92 G;  1BU1 A;  1FMW A;  3V7R A;  1ABQ A;  2V8K A;  2ECD A;  3CBM A;  3M0R A;  1B34 B;  1BG1 A;  5CQY A;  2CP6 A;  5LL6 S;  2EO6 A;  2ZPE B;  3CBP A;  3CCJ A;  3PTA A;  1TUD A;  1I3Z A;  3H0I A;  1MMD A;  4OML A;  1HD3 A;  3LYV A;  3EG0 A;  5GMK j;  5EEL A;  2JMA A;  2V8I A;  3TL0 A;  1JBM A;  2QGF B;  1JJ2 S;  1RLP C;  2KYM A;  5GAN f;  2GFA A;  4M7A B;  4E7Z A;  1N8R R;  4ZTJ A;  4ROJ A;  1IRE B;  2YUN A;  9ATC B;  4J83 A;  1YVL A;  1BLJ A;  1K73 R;  1X6O A;  2KR3 A;  3M0P A;  2X4W A;  5GAO m;  2FHD A;  1YFN A;  2KT1 A;  2CDT A;  2XKO C;  3EHQ A;  5FLX E;  1VQ6 T;  1QQJ A;  2DBK A;  1X6C A;  2QAS A;  1RAG B;  3CCQ Q;  2AUG A;  3QHS A;  2F5K A;  2YUO A;  8AT1 B;  4A4K A;  2PU9 B;  1AZE A;  3CD6 T;  2DYB A;  3BKB A;  4RKU E;  4IIO A;  3H9N A;  1KHI A;  1W6X A;  2CSQ A;  2RJD A;  1WX6 A;  1LKL A;  2ZZD A;  1JYR A;  4M75 C;  4PJN A;  4JLI A;  2EQK A;  2C0O A;  2V26 A;  3CCE T;  5I6V A;  3F70 A;  4N0A A;  1TS9 A;  1M1K U;  4C0Z A;  1NPP A;  1TCE A;  3RMQ A;  1W2B A;  2CZ0 B;  2RQV A;  1UE9 A;  4C92 B;  2RM4 A;  1GCQ A;  2KRM A;  2OJ2 A;  2OTJ Q;  2CRH A;  3CCV A;  3I35 A;  1KC2 A;  2EYY A;  4A4G A;  1EZZ B;  3V8K A;  1Y96 A;  1OOT A;  4IUT A;  4Z89 A;  3T9N A;  1R8O B;  1SHF A;  3ULR B;  4PJL A;  1VQ4 A;  1XOV A;  3A1P A;  4OGC A;  2LCS A;  2ROL A;  5I22 A;  1O44 A;  1BCO A;  2DO3 A;  2PVO B;  1VQL A;  5GMK h;  1BYM A;  2VIF A;  1OPL A;  2K79 B;  2AOB A;  2JS2 A;  2X9H A;  3QUI A;  1JXM A;  1VQ9 Q;  2OQ1 A;  5A0L A;  3M57 A;  1KHC A;  1BKL A;  2EQM A;  2EYW A;  4QKU A;  1X0N A;  1N27 A;  2E65 A;  1RQQ C;  3PGG A;  1HXD A;  1VIF A;  2LCT A;  1QLY A;  2KRS A;  5IXB A;  1C0M A;  1O4K A;  1ACM B;  4RTU A;  1RI0 A;  2CYZ B;  1MMA A;  3S8L A;  1H9O A;  2CH4 A;  4RTX A;  4AT1 B;  2V1Q A;  1X69 A;  2QGG A;  2B86 A;  3WXM B;  4C8Q E;  2YXY A;  3OYA A;  1A1C A;  3G6E Q;  3MEA A;  1YIT Q;  2CSI A;  4N4I A;  3VRZ A;  4XTY A;  3CC4 A;  4MML A;  3UWN A;  1A1E A;  1N9R A;  2DX0 A;  4K44 A;  1SRL A;  2L3R A;  3EFR A;  3HRT A;  3SFM A;  3UA7 A;  2DLY A;  4ZGD B;  1OU9 A;  4M75 F;  1NBE B;  4XAX B;  3ZBD A;  4BY6 B;  1GXI E;  4M75 G;  2K2M A;  1N9S A;  5GAN j;  1O47 A;  1D3B A;  2DL8 A;  3E9F A;  2RK1 A;  5DY9 A;  1Q7Y U;  2M02 A;  2DIL A;  1Q82 C;  4ZGE B;  1G3Y A;  3RUX A;  3DB4 A;  1TH7 A;  1KJW A;  1MNE A;  1OV3 A;  3C0C A;  2CZ1 B;  4EDU A;  5EEQ A;  3U23 A;  1R77 A;  3BFM A;  3M0U A;  3P8D A;  3T04 A;  1BIB A;  1FHS A;  2RSY A;  4N4H A;  1VQ8 A;  2L3S A;  1EIF A;  1QCO A;  4JZ4 A;  3BUM B;  4CI0 C;  1BMB A;  1FXX A;  3OY9 A;  5CKE A;  2CI9 A;  1NRV A;  3CCQ T;  2CP5 A;  4LDW A;  3OSV A;  2FPE A;  1ZHI A;  3AT1 B;  4GPL B;  5HKZ A;  2WSF E;  2JTM A;  1CWD L;  3EH1 A;  2F69 A;  2VKN A;  4F59 A;  4FL6 A;  4DA4 A;  1VQ7 A;  3US4 A;  2QAZ A;  1SEM A;  4KGZ B;  4FSX A;  1ARK A;  2VXE A;  5FU6 C;  2MQI A;  2LRA A;  3L2Q A;  3M0S A;  4DBF A;  1AYC A;  1VUB A;  2YUP A;  2XDD A;  1C1A A;  3H8Z A;  3KUF A;  3RKW A;  2OTJ T;  3IN8 A;  1K8A C;  1SSF A;  2CP3 A;  2A36 A;  3CME A;  2XID A;  3JCM b;  1WJQ A;  5KYW A;  1XQH A;  1D09 B;  3QZ9 B;  4M75 B;  3CMA A;  4DOW A;  3MHX A;  4GL9 E;  4RCB A;  3LX7 A;  4M77 E;  2K3B A;  2OAU A;  8ATC B;  1YI2 Q;  1X27 A;  1VQ5 A;  1QW1 A;  2MI6 A;  4KBM B;  1QCF A;  3L2R A;  1BLK A;  3HFN A;  3P8B B;  2LDM A;  1VQ9 T;  1YIJ Q;  1Y1U A;  2J7I A;  4J6Y A;  3VU3 C;  3RDV A;  2KRO A;  3PMI A;  2DRM A;  3OS5 A;  2FRW A;  2O4X A;  1QG1 E;  1LUK A;  3OYK A;  1MGQ A;  1MUZ A;  1IO6 A;  4X1V A;  1O4M A;  5D0J A;  4NS5 A;  2M0O A;  2KQW A;  1Q81 R;  3PVQ A;  4FSS A;  3M0Q A;  2ROR A;  1PSE A;  3RMS A;  4A4F A;  1O4D A;  1O4R A; 
#chains in the Genus database with same CATH homology
 1M3A A;  4AFQ C;  2RF0 A;  3KFV A;  1YVH A;  2FRY A;  2DBM A;  1O41 A;  2KXD A;  1N5Z A;  1VYU A;  1EFN A;  2J06 A;  2D8J A;  1AD5 A;  5DC9 A;  2EGE A;  1YWP A;  4HVV A;  2DJQ A;  1Y57 A;  1JWO A;  4EY0 A;  1HCS B;  1FMK A;  1WA7 A;  5DF6 A;  2J6F A;  4J9H A;  2CUB A;  1I0C A;  1AOU F;  2DX1 A;  2K6D A;  1SPK A;  2D1X A;  2Y1N A;  3PSJ A;  1VA7 A;  4J9F A;  1Z9Q A;  3THK A;  3UA6 A;  1F1W A;  2VWF A;  3OV1 A;  1O49 A;  2W10 A;  4J9B A;  4AFZ C;  2PNB A;  2VVK A;  1ZUY A;  4U17 A;  1OO3 A;  2ENM A;  2KE9 A;  1JO8 A;  2I0N A;  3NGP A;  1O4E A;  2B3O A;  1GRI A;  2YSX A;  3REB B;  2L3P A;  3H0H A;  1A08 A;  3PJP A;  2EQI A;  1D1Z A;  2FEI A;  4LUD A;  4RTY A;  2HBW A;  2EVR A;  2HEQ A;  5FWC A;  1JQQ A;  1ZLM A;  3VRY A;  5IHN A;  1LUI A;  1I07 A;  1SRM A;  1BHH B;  1O4O A;  4GWF A;  1GCQ C;  2JT4 A;  1R1P A;  3HHM B;  1M3B A;  3EGU A;  4RTT A;  3TVT A;  2RN8 A;  1QWF A;  2JM9 A;  1KA6 A;  3PSK A;  2HCK A;  4LE9 A;  2SEM A;  1AWJ A;  4J9I A;  3VS7 A;  1W70 A;  1UUE A;  5IXF A;  2KNB B;  1UEC A;  2DCR A;  1M61 A;  2H8H A;  4JJD A;  3ZL7 C;  3PFV A;  2IZV A;  4CC3 A;  1OEB A;  3UYO A;  2LNW A;  3VS2 A;  1O4N A;  3H0F A;  4K45 A;  2FCI A;  4JJC A;  2A08 A;  1MW4 A;  1M3C A;  1WQU A;  1SPR A;  1KIK A;  1BK2 A;  2EGC A;  2A28 A;  3JV3 A;  4OHE A;  1PHT A;  1AYA A;  1ZUK A;  4AFS C;  3GBQ A;  2LMJ A;  2RQR A;  2OAW A;  3VS4 A;  2DL5 A;  2GTO A;  4OHH A;  5IBS A;  1PKT A;  2KNO A;  4P9V A;  4F5B A;  1SHA A;  2O9V A;  2MRJ A;  1PWT A;  1A81 A;  3QWX X;  4ORZ A;  3REA B;  4OMM A;  1IJR A;  5EC7 A;  4JPB W;  5HKW A;  2IIM A;  2NUZ A;  3OB1 B;  3NHN A;  1BBZ A;  2DLP A;  2HDA A;  1A1B A;  4TZI A;  1U5S A;  2RQT A;  2SRC A;  3CQT A;  1UJ0 A;  5DC4 A;  4GLM A;  1HCT B;  2X3X D;  3LH5 A;  5GJH A;  1WIE A;  2X3W D;  4HVU A;  3QWY A;  1UUR A;  4OHD A;  1BF5 A;  3RBB B;  2YT6 A;  2AOA A;  2EYX A;  1S1N A;  2YUQ A;  4RTW A;  3SEM A;  1PRL C;  2K79 A;  3VS0 A;  2IUG A;  3CXL A;  2L4K A;  4NWG A;  3EG1 A;  1AWW A;  4EIH A;  1FU6 A;  1FYR A;  2CIA A;  2DM0 A;  2CI8 A;  2SHP A;  2EYV A;  1GHU A;  1LKK A;  2GTJ A;  1T0H A;  1Y0M A;  5GJI A;  3C7I A;  2H5K A;  1SPS A;  3M0T A;  4E93 A;  3K2M A;  2DMO A;  4ESR A;  1UDL A;  2M51 A;  4HCK A;  1HJD A;  2D8H A;  3IQL A;  1UUS A;  1ZUU A;  2RPN A;  2C0T A;  1A09 A;  5BO4 A;  1NYF A;  2CH4 W;  1M8M A;  1B47 A;  1ABO A;  1E7O A;  2HDX A;  3H41 A;  2RMX A;  4OMQ A;  1T0J A;  4RUG A;  5L23 A;  4XZ1 A;  1GBR A;  3OB2 B;  2MCN A;  1TG0 A;  1BB9 A;  4F16 A;  1JU5 A;  1AOT F;  2J6O A;  4J9G A;  1O4H A;  2OI3 A;  2YSQ A;  1O4P A;  1OPK A;  4LN2 A;  1UHC A;  1CJ1 A;  2DE0 X;  4FL2 A;  1K9A A;  3N8M A;  3PLF B;  4J9D A;  1BU1 A;  1RUW A;  1K0S A;  4RTV A;  2HSP A;  4E68 A;  1ABQ A;  1O45 A;  2ECD A;  4H34 A;  2HMH A;  4QSY A;  2LP5 A;  3M0R A;  1YN8 A;  2RNA A;  1R1Q A;  1BG1 A;  2EO6 A;  1KSW A;  2FPD A;  1NM7 A;  2DM1 A;  1TUD A;  1I3Z A;  4DGX A;  4AG1 C;  3H0I A;  2EYZ A;  4OML A;  1HD3 A;  1X43 A;  3A98 A;  3EG2 A;  3EG0 A;  3KFJ A;  1GFD A;  5EEL A;  2DA9 A;  2JMA A;  3TL0 A;  2GQI A;  1A0N B;  2AKL A;  1MIL A;  3GQI B;  2LJ3 A;  1RLP C;  2KYM A;  5FW9 A;  1U06 A;  1UHF A;  3S9K A;  2LQN A;  3VRQ A;  3BUN B;  1WLP B;  2K7A A;  4ROJ A;  2M0Y A;  2YUN A;  1J3T A;  1CSZ A;  1JEG A;  1QWE A;  3I5R A;  5AXI A;  1JYQ A;  2E5K A;  1YVL A;  3NPF A;  3EAC A;  1BLJ A;  3PE0 A;  3GXW A;  3I9Q A;  1Z3K A;  3O5Z A;  2W0Z A;  2V1R A;  2KR3 A;  1JXO A;  3M0P A;  1YP5 A;  1WDX A;  2KT1 A;  3EHQ A;  2CDT A;  4CC7 A;  2Y3A B;  3ZNI A;  1T3L A;  2DBK A;  4CC2 A;  2AZV A;  1AWX A;  2KGT A;  1X6C A;  4NWF A;  3IMD A;  4F5A A;  2LJ1 A;  2G6F X;  2MIO A;  2AUG A;  1E6G A;  1X6B A;  1XA6 A;  3PVL A;  2DL7 A;  2KBT A;  1GFC A;  2YUO A;  1AZE A;  1IS0 A;  3EAZ A;  1NZV A;  4Z8A A;  5J3X A;  2FG0 A;  2DYB A;  3BKB A;  2EGA A;  4IIO A;  4DGP A;  2PNI A;  1W6X A;  2CSQ A;  2EU0 A;  1WX6 A;  1LKL A;  3NMZ C;  1JYR A;  4A4C A;  5CDW A;  2L6K A;  2DL4 A;  3CD3 A;  4JEG A;  2L3T A;  1I1J A;  2C0O A;  5GJV B;  2ESW A;  1CWE A;  5I6V A;  4WCI A;  2BZX A;  3WA4 A;  1O4C A;  1AYB A;  2DF6 A;  1TCE A;  2MK2 A;  1CSK A;  2JTE A;  2CRE A;  2RQV A;  1H3H A;  2RVF A;  1UE9 A;  2ROT A;  1BKM A;  4J9E A;  1GCQ A;  1M30 A;  2KRM A;  2OJ2 A;  1O4L A;  4XZ0 A;  1AEY A;  1K1Z A;  1U3O A;  3VS5 A;  5ECA A;  1H92 A;  2MOX A;  2CRH A;  3I35 A;  1UJY A;  1NZL A;  5DC0 B;  1KC2 A;  4P9Z A;  1M27 C;  2EYY A;  2HUW A;  1NLO C;  3MXC A;  1WYX A;  1OOT A;  2KK6 A;  4Z89 A;  2EO3 A;  1O4I A;  1SHF A;  3ULR B;  3N7Y A;  3PQZ A;  1O4G A;  1XOV A;  2LCS A;  2ROL A;  5I22 A;  1O44 A;  2EL8 A;  4L1B B;  2ECZ A;  4FL3 A;  2QDL A;  1WXB A;  2VIF A;  5HKY A;  3S8O A;  1OPL A;  1SKJ A;  1QKW A;  2AOB A;  2JS2 A;  2K79 B;  4U1P A;  1JU5 C;  1JXM A;  4KRT A;  4JGH A;  2OQ1 A;  1WXU A;  1LUN A;  1O4J A;  1BKL A;  1QAD A;  4M4Z A;  2EYW A;  1VYV A;  3EG3 A;  4K2R A;  1X0N A;  1R1S A;  1RLQ C;  4AFU C;  3UAT A;  1AZG B;  1RQQ C;  2EW3 A;  2LCT A;  3M7F A;  1QLY A;  2KRS A;  1K0X A;  1KFZ A;  5IXB A;  1Z9Z A;  1AVZ C;  1O4K A;  1CSY A;  2BZY A;  2K9G A;  2LQW A;  4RTU A;  3N84 A;  3EHR A;  2KEA A;  2ED0 A;  2F2V A;  1W1F A;  2O2O A;  3MAZ A;  3S8L A;  4R0K A;  2CH4 A;  1H9O A;  4RTX A;  1D4W A;  2J6K A;  1GCP A;  5KAZ A;  2V1Q A;  1X69 A;  1G2B A;  2H46 E;  1GBQ A;  2L3Q A;  2PNA A;  1AWO A;  1AOJ A;  2B86 A;  3GXX A;  4A4B A;  4FBN A;  1AB2 A;  2LX7 A;  1A1C A;  2MRK A;  5HCK A;  4RTZ A;  1PRM C;  1A1A A;  2CSI A;  2ED1 A;  5EG3 B;  2L0A A;  2GGR A;  4HXJ A;  3VRZ A;  5IHI A;  2EPD A;  2D0N A;  3VRR A;  1A1E A;  2DX0 A;  1SHD A;  2Y1M A;  3UF4 A;  2KYB A;  4OHL A;  4K44 A;  3PS5 A;  2CR4 A;  1SRL A;  2L2P A;  3IN7 A;  1NYG A;  2DLY A;  3UA7 A;  1H8K A;  1O4Q A;  1X2Q A;  2CUD A;  3IMJ A;  2RQW A;  1QKX A;  1ZBJ A;  4CC4 B;  5AUL A;  1NLP C;  2XMF A;  2J05 A;  1UTI A;  1LUM A;  2KRN A;  4LNP A;  2MC1 A;  1SHG A;  1PIC A;  2PTK A;  1WXT A;  4OMN A;  4OHI A;  2CT4 A;  1FBV A;  1WI7 A;  2LJ0 A;  2K7A B;  2AKK A;  1NG2 A;  1ZSG A;  1G83 A;  2BZ8 A;  2DLZ A;  2F2X A;  1O4F A;  2K2M A;  3HIZ B;  2JXB A;  3CBL A;  4IIM A;  2ABL A;  1O47 A;  1O4B A;  1OO4 A;  2DL8 A;  1B3Q A;  1O4A A;  2YDL A;  2EKX A;  1BM2 A;  1BFI A;  2GBQ A;  4H1O A;  2LNH B;  2LZ6 B;  3R6N A;  3OVE A;  2DIL A;  4DEX A;  1BHH A;  4HVW A;  2PLE A;  3TSW A;  4F17 A;  1FBZ A;  1KJW A;  1OV3 A;  5EEQ A;  1LCK A;  3C0C A;  2DNU A;  1LCJ A;  5I11 A;  2FO0 A;  3U23 A;  2CT3 A;  2DVJ A;  2ETZ A;  1E6H A;  3M0U A;  3S8N A;  1A07 A;  3T04 A;  1TUC A;  4ZNX A;  1MV0 B;  1JYU A;  1F2F A;  2JYQ A;  1FHS A;  2F2W A;  2O9S A;  2P4R A;  1B07 A;  5IBM A;  2RSY A;  2O88 A;  1VYT A;  2AK5 A;  1O46 A;  2L3S A;  4JZ4 A;  1RPY A;  2IUH A;  3BUM B;  1BHF A;  1BMB A;  1TZE E;  2CI9 A;  1NRV A;  1K76 A;  2DL3 A;  4EIK A;  2BTT A;  2FPE A;  2QMS A;  3CWG A;  4GPL B;  4WWQ A;  5HKZ A;  4QT7 A;  2DRK A;  2C9W A;  2A37 A;  2C0I A;  1YWO A;  2RMO A;  1CWD L;  1O43 A;  1GL5 A;  2OZO A;  1V1C A;  2VKN A;  4F59 A;  2GE9 A;  1T3S A;  1P13 A;  5IHK A;  3US4 A;  5IH2 A;  1UFF A;  1MV3 A;  3BUO B;  1SEM A;  4K11 A;  1K4U S;  2FPF A;  3MXY A;  1NEG A;  4A63 B;  1ARK A;  2XP1 A;  3TSZ A;  1NEB A;  1RJA A;  2MQI A;  1SHB A;  5FWB A;  3VRN A;  3BUW B;  4Y92 A;  4OMP A;  2GNC A;  1SSH A;  1RI9 A;  3M0S A;  1AYC A;  2YUP A;  4DEY A;  2PZ1 A;  2IUI A;  4AG2 C;  1UG1 A;  1YCS B;  2GSB A;  1FYN A;  4GBQ A;  3VS1 A;  1CKB A;  3IN8 A;  1AYD A;  5EHP A;  2A36 A;  2JS0 A;  2KT8 A;  4JZ3 A;  4D8K A;  3OP0 A;  4OMO A;  2EBP A;  4Z88 A;  3HCK A;  1O42 A;  5EHR A;  1CKA A;  3VS3 A;  4F14 A;  2JM8 A;  1ZX6 A;  4LUE A;  1PNJ A;  4GL9 E;  1X2K A;  2RQU A;  4J9C A;  5GJW B;  4E6R A;  3VRO A;  1HSQ A;  2K3B A;  1X27 A;  1X6G A;  2HDV A;  2CBL A;  1D4T A;  2JW4 A;  3TKZ A;  1QCF A;  1BLK A;  2EKH A;  3VRP A;  1WFW A;  1YNZ A;  2YU7 A;  2NWM A;  1BFJ A;  3RNJ A;  1Y1U A;  2J7I A;  1M27 A;  2LNX A;  3BUX B;  1UGV A;  1O48 A;  2KRO A;  2JMC A;  3VS6 A;  2CS0 A;  4X6S A;  2KXC A;  3FJ5 A;  1PKS A;  2DRM A;  2BBU A;  1FU5 A;  2FRW A;  3I5S A;  1QG1 E;  1LUK A;  4D8D A;  1KA7 A;  3SHW A;  2AZS A;  4X1V A;  1MUZ A;  1IO6 A;  1O4M A;  2EOB A;  5D0J A;  1ZFP E;  3PVQ A;  3VGO A;  4JE4 A;  4FSS A;  3M0Q A;  4JJB A;  2ROR A;  2PLD A;  2O31 A;  1O4D A;  1O4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...