4M4ZA

Sh3 and sh2 domains of human src-like adaptor protein 2 (slap2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
152
Chain Sequence
TAVALGSFPLSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Src-like adaptor protein 2 reveals close association of SH3 and SH2 domains through beta-sheet formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Src-like-adapter 2
total genus 36
structure length 152
sequence length 158
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4m4zA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4m4zA02
3PVLA 3K2MA 1SHFA 1RQQC 2K6DA 1O4DA 1IJRA 4OHHA 1FBVA 1YCSB 5FWBA 2DMOA 2DRMA 1A07A 5EEQA 2XMFA 1E7OA 1K4US 1AWWA 1ZBJA 2E5KA 2EL8A 4P9ZA 1NLOC 2JYQA 1OOTA 4NWGA 4WWQA 1AEYA 3CD3A 2X3WD 4F5AA 1WIEA 1K1ZA 2K9GA 2MIOA 1D4WA 1Z3KA 3H0FA 1KJWA 2FCIA 3N8MA 2A08A 1K0XA 3VRZA 1O49A 2L3PA 3TSWA 2CS0A 4AFSC 1AB2A 5ECAA 1UHCA 3VS0A 1PKSA 1W70A 2O9VA 2EPDA 2DL4A 2LJ1A 1A0NB 2ESWA 5CDWA 2YUNA 2PLEA 2IUGA 1O4IA 3CWGA 2JS0A 4X6SA 4RTXA 4K11A 1A1EA 1FYRA 4XZ0A 3TL0A 3EG2A 1W1FA 2F2XA 1BMBA 2J05A 2DLYA 3T04A 3NGPA 2L3SA 1BKLA 4DEXA 1M8MA 1K0SA 2B3OA 2SRCA 2YU7A 5I11A 2MRJA 1KSWA 4F14A 2K79A 1O4OA 1BLJA 2RMXA 2DNUA 1BK2A 2JXBA 2DRKA 2CSIA 5IXFA 2DCRA 2RNAA 3EG0A 3ZNIA 4ZNXA 2FPDA 2KGTA 1JQQA 1SPSA 1BFJA 1I0CA 1VA7A 1ZSGA 2ROLA 1N5ZA 1WYXA 2L2PA 1RLPC 1A1BA 2LJ0A 1YNZA 1SPKA 4P9VA 1Y57A 5IHNA 3S8LA 2XP1A 1QKXA 2KRSA 2AOAA 2FO0A 1I3ZA 1O43A 3GQIB 1NZLA 4CC4B 2K2MA 1UTIA 2LQNA 3HHMB 3O5ZA 2PZ1A 1TCEA 1QWFA 1WFWA 2B86A 1SHAA 3PFVA 2L6KA 1CWEA 4JZ4A 2M0YA 1HSQA 4EIHA 2H46E 2J6FA 4EY0A 1OO3A 1H9OA 4RTTA 3BKBA 1O42A 1HCTB 4J9IA 2C0TA 3QWXX 2ABLA 1CSZA 3MXYA 1TZEE 1WXUA 2MK2A 5IBSA 3U23A 2HEQA 3NMZC 1F2FA 3CXLA 3VRNA 4OMMA 4A4CA 1AYCA 2DL3A 3VRPA 2AZVA 3M0RA 2LJ3A 1O4NA 4D8DA 3WA4A 3VS6A 1P13A 2AKLA 2MC1A 1PRMC 2W0ZA 1ARKA 2EYYA 4OHIA 1FYNA 1PWTA 2EKXA 2CREA 5AULA 2EGAA 1R1PA 1O4JA 2PTKA 1MV3A 4E6RA 3BUNB 1ZLMA 5I6VA 1HJDA 5IXBA 2CIAA 1MILA 2ENMA 5FWCA 2MQIA 1NYGA 3THKA 4GBQA 2Y3AB 1AYBA 2OJ2A 3C0CA 3M0UA 2HSPA 3ULRB 1M27C 1UG1A 4EIKA 1KC2A 1AD5A 3OB1B 1FHSA 3R6NA 1AZEA 4JJDA 1JYQA 1BF5A 5L23A 2JW4A 1WXBA 4DGXA 1CJ1A 2FPFA 2EBPA 1M61A 1LKKA 2AZSA 4E93A 1X0NA 3OB2B 3RBBB 4J9GA 1M30A 1UUEA 1JXOA 3EHRA 3I5SA 1JYUA 3VRRA 4E68A 1X69A 2HUWA 2C0OA 2EYZA 2V1QA 3OVEA 3TVTA 4A63B 1I1JA 1M3CA 3EG1A 3JV3A 2FG0A 2YUOA 3VS5A 2DX0A 1QWEA 4HVWA 2ECZA 5DF6A 1PHTA 4HCKA 1YWPA 2DM1A 1U5SA 2ED0A 1FU6A 1BFIA 2BZYA 3BUMB 2DBMA 3S8OA 4JE4A 1XOVA 2GSBA 1YVHA 2CBLA 3PS5A 4L1BB 1T3LA 1OO4A 3VS1A 2DA9A 5IHKA 1JU5A 1E6GA 2RQTA 3M0SA 2EGCA 2JM8A 2RF0A 4HVUA 1BHHB 3S8NA 1GRIA 2BBUA 1B3QA 1B07A 1NEBA 2K7AB 1NRVA 1R1SA 1X27A 2KT1A 1AOJA 1BKMA 2SEMA 1PNJA 2VWFA 4D8KA 2M51A 1M27A 1I07A 2VVKA 4RTVA 4CC7A 1QADA 1X6CA 5J3XA 2RVFA 4AFQC 3PE0A 4JJCA 1GHUA 3RNJA 2LQWA 3QWYA 1U06A 1AVZC 4JJBA 2AUGA 2IIMA 1PKTA 2CDTA 2A28A 2OQ1A 2YSXA 2Y1NA 2PNAA 2JT4A 1LUNA 2JM9A 4GLMA 1M3BA 4A4BA 1GFDA 2DL8A 3PSJA 2IUHA 4DGPA 3A98A 1O4PA 1NLPC 4LUEA 4F17A 5BO4A 1LKLA 1H3HA 1R1QA 2EVRA 1UJ0A 4AFUC 2GBQA 2L4KA 2SHPA 1CKBA 3EAZA 1BU1A 1NG2A 4HVVA 1O4GA 4TZIA 1O47A 2QMSA 3PSKA 3M0QA 1NEGA 2JS2A 2O88A 1BBZA 2RQUA 2KEAA 3VS2A 1FMKA 5HCKA 3REBB 2DLPA 1WA7A 4J9HA 2LCSA 2PLDA 2GQIA 5KAZA 1AYAA 2J7IA 2CT4A 3VRQA 3S9KA 3VRYA 3IN8A 1RI9A 2LNHB 4RTWA 1TUDA 1WX6A 3H0IA 2FEIA 5DC9A 2JTEA 1TUCA 5GJWB 2HMHA 3NHNA 1QCFA 1UUSA 4X1VA 1CSKA 1O48A 2D0NA 2VKNA 4IIOA 4GWFA 4Z8AA 3PJPA 3VGOA 4H34A 3VS4A 5AXIA 3IQLA 3HIZB 2KNBB 2DYBA 2CH4A 2DJQA 1PICA 2CSQA 2K3BA 1V1CA 2BTTA 2Y1MA 3BUOB 1UDLA 3GXWA 2JMAA 2YSQA 1J3TA 3VROA 2ETZA 5IBMA 3C7IA 1RUWA 2QDLA 1VYTA 1VYVA 1SHDA 1HD3A 1NYFA 2PNBA 4OMNA 1BLKA 4F59A 1ZFPE 2EQIA 1JO8A 1GBQA 4OHEA 3EG3A 1YVLA 4J9BA 3UF4A 1OPLA 2LNWA 2D8JA 2OAWA 1LUKA 1BG1A 1FBZA 1VYUA 4K2RA 2DM0A 1O45A 2D8HA 3N7YA 2G6FX 3CBLA 2BZ8A 5HKYA 2MOXA 1OV3A 4Y92A 1RPYA 2RN8A 3CQTA 4U17A 2DLZA 4CC2A 2KRNA 4AG1C 5GJIA 1A1CA 3H41A 2O31A 1BHFA 2YDLA 1JYRA 1NM7A 2KRMA 2DE0X 2K7AA 4LNPA 1ZUKA 1JEGA 2CUDA 2KE9A 4GPLB 1G2BA 4XZ1A 2ECDA 1IO6A 3M7FA 4FBNA 4RUGA 2CR4A 1Y0MA 2V1RA 3GBQA 4JEGA 2KR3A 1LCJA 1AWJA 1AYDA 1X43A 3LH5A 1O41A 1ZUUA 1EFNA 2EYWA 2KT8A 2C9WA 2CT3A 2I0NA 1YN8A 1U3OA 2F2WA 1WLPB 1SKJA 1X2KA 2NUZA 2EO6A 4F5BA 1KIKA 3OV1A 3IN7A 2L3QA 1UE9A 3SHWA 2KYBA 2HBWA 4RTZA 1GBRA 4FL2A 4Z88A 2GTJA 2FRWA 2ROTA 2YUPA 1S1NA 1KA6A 3BUXB 1UGVA 1D1ZA 2KROA 5IH2A 2KBTA 2F2VA 4LE9A 1X6BA 2AK5A 1LUMA 2CI9A 1YP5A 2ED1A 4RTUA 1O46A 2MCNA 4AG2C 1GCQA 2AOBA 1O4EA 3PQZA 1LUIA 2LP5A 1K9AA 4QT7A 3SEMA 2LNXA 1T0HA 2FPEA 3UA7A 1JWOA 4JGHA 2HDXA 1AZGB 1A81A 1AWOA 2RQRA 5EHPA 1B47A 2VIFA 5DC0B 5EG3B 1ABOA 2DF6A 1BHHA 1O4HA 1BM2A 2JMCA 1X6GA 2GNCA 1AOTF 3MAZA 1K76A 1O4LA 1OPKA 1UJYA 1Z9QA 5D0JA 3M0PA 1ZUYA 1KFZA 1O4CA 5FW9A 4K45A 2DILA 1TG0A 2HCKA 4K44A 3NPFA 2EO3A 1D4TA 3IMDA 2J6OA 1NZVA 2HDAA 4R0KA 1MV0B 1Z9ZA 3FJ5A 2CRHA 1SPRA 2CUBA 4JZ3A 4IIMA 5EC7A 2DBKA 1FU5A 1KA7A 2KK6A 1H8KA 3US4A 2EYVA 4KRTA 1UECA 2IZVA 1RJAA 2EGEA 1ZX6A 4OMOA 2RORA 4CC3A 3OP0A 1GFCA 3EGUA 4ESRA 4ORZA 4J9DA 4JPBW 4NWFA 2H8HA 1O4MA 1O4QA 2AKKA 4AFZC 1QLYA 2LZ6B 1WXTA 2DL5A 2LMJA 1W6XA 2GGRA 1A08A 1SHBA 4J9EA 2BZXA 4J9FA 1MW4A 2RPNA 3KFJA 5IHIA 2W10A 2J6KA 2LX7A 1AWXA 1O44A 2EU0A 4WCIA 1G83A 4FSSA 4OHLA 4H1OA 2RSYA 2GE9A 1BB9A 2DL7A 2X3XD 3N84A 3VS7A 1SEMA 1JXMA 3PLFB 2IUIA 1GCPA 3IMJA 3UYOA 1X2QA 1O4AA 1SRLA 1XA6A 2PNIA 1T3SA 1UHFA 3M0TA 3EACA 1A09A 1IS0A 1MUZA 1Y1UA 2HDVA 2NWMA 2YT6A 3REAB 1SRMA 1QKWA 1ABQA 2KNOA 5I22A 2CI8A 1T0JA 1SSHA 1CSYA 4OMQA 4HXJA 2A37A 2EYXA 2K79B 2MRKA 3I35A 4M4ZA 3VS3A 4J9CA 1OEBA 3H0HA 2FRYA 2KXDA 5DC4A 1RLQC 4GL9E 4LUDA 1E6HA 3ZL7C 4F16A 2EW3A 1LCKA 1SHGA 1UFFA 2KXCA 3TSZA 1A1AA 4RTYA 3UA6A 4OHDA 5GJVB 4QSYA 1CKAA 1O4KA 2H5KA 1UURA 2C0IA 1O4FA 3KFVA 3I9QA 4DEYA 2DX1A 4Z89A 2RQWA 4OMLA 2RMOA 2KYMA 2EOBA 2L0AA 4ROJA 4U1PA 3UATA 1O4RA 2A36A 2O9SA 1HCSB 1GL5A 1PRLC 1H92A 2D1XA 3HCKA 2LCTA 2P4RA 5HKWA 2GTOA 2CH4W 2O2OA 1O4BA 1QG1E 1CWDL 2YUQA 1M3AA 2RQVA 1WQUA 3EHQA 4OMPA 3MXCA 2J06A 1GCQC 5EELA 5GJHA 1AOUF 3BUWB 2OI3A 3GXXA 1F1WA 2EKHA 1JU5C 2DVJA 1WI7A 4FL3A 4LN2A 5HKZA 5EHRA 1WDXA 2OZOA 3TKZA 1YWOA 2L3TA 3PVQA 3I5RA
chains in the Genus database with same CATH superfamily
3PVLA 5I2MA 2EJGA 1WHLA 2YRDA 1RQQC 2HL5C 4EMKC 1IGUA 3J7AF 3SWNB 1YCSB 5FWBA 1FBVA 3CCMQ 2XMFA 1E7OA 1K4US 2DJZA 3L2ZA 1AWWA 2Y90A 4NWGA 1LOJA 3CC7A 2QTVA 4F5AA 3N8MA 2K9GA 1KJWA 3OW2A 2L3PA 2CS0A 5ECAA 3X26B 3SB2A 2M16A 2LJ1A 2PLEA 1O4IA 1OU9A 4X6SA 2E6ZA 4K11A 4LDYA 4XZ0A 2GF7A 1W1FA 3EG2A 1BMBA 2CZ7B 4FW2A 2L3SA 3A8GB 1JJ2A 4L6V5 1WHGA 1K0SA 2B3OA 3PT9A 2SRCA 5I11A 3CCEA 1K9MR 1BLJA 1O4OA 1LNXA 2DNUA 3RKXA 4M7DB 2DCRA 3EG0A 3ZNIA 2LTOA 3CD6Q 1M90C 1BFJA 2LC4A 1UGSB 2DXCA 1PD0A 2LX9A 3PTAA 1YNZA 1OX9A 4P9VA 4NL2A 5IHNA 3S8LA 5GANf 1QKXA 4J7FA 1M5Q1 1Y07A 1I3ZA 3GQIB 1NZLA 2QQRA 3HHMB 1WJRA 3PFVA 3OYMA 1R0CB 4BD3A 3HRUA 2YLCA 2M0YA 1HSQA 4EIHA 2H46E 1OO3A 1PSEA 3KUFA 5GMKe 3GNFB 1Q82U 4J9IA 2C0TA 3OW2S 4C8QF 3M54A 3NMZC 2WACA 3TEEA 4MDXA 4IUUA 4A4CA 1KD1R 1Q86U 5GAN6 2JVVA 3JCMh 3V8KA 1MMGA 4C92G 3M0RA 1WHJA 1IHVA 2LNVA 4M77E 3LW5E 2MC1A 4EDUA 1M8VA 3LWIA 2W0ZA 3CCMT 2DEUA 2D9TA 4QVZA 1YJWA 1B34A 3NFCA 1O4JA 2RJDA 1MV3A 1HJDA 1BI2A 3CMAQ 4M7DE 3THKA 4GBQA 2Y3AB 3ULRB 2HSPA 2YWWA 1KC2A 1OQKA 1FHSA 3JCMQ 4KGZB 4JJDA 2LQKA 1JYQA 5L23A 3LLRA 2IG0A 1WXBA 2JW4A 1VQ9T 4Y91A 4PNOA 2CP7A 4FL6A 1LKKA 1TU0B 3FJPA 3RBBB 4J9GA 1M30A 2V8IA 1UUEA 3S6WA 3GPLA 2DIGA 4XTZA 3ZFJA 4KUDK 2A7YA 3JV3A 1AHJB 3VS5A 2QEXQ 1ZSZB 2DIQA 4HVWA 3EAEA 3LGLA 1X75C 2QAZA 2LT1A 4J8OA 3BFMA 2GSBA 1YVHA 3QYGB 1OO4A 3CCVA 5CKHA 1ACMB 3DKMA 2RQTA 4QW2A 1UGQB 3S8NA 2DO3A 1B07A 1NEBA 1BKMA 4ZGDB 4C8QC 1QADA 2LVMA 2LT4A 1NZ9A 3OYDA 2M1HA 2LQWA 3PMIA 4J6YA 1OI1A 2ATCB 4JJBA 2CDTA 1YJNT 2KSSA 3F70A 1LUNA 2GQVA 2YRVA 2DL8A 1VQ8T 3WVDB 3PSJA 4DGPA 4JDSA 2E3IA 2P84A 4LUEA 1LKLA 3CPWP 1UJ0A 2L4KA 3EAZA 3M53A 2QMSA 3JCMg 3HFNA 1NEGA 1S72T 1M4ZA 3NTIA 4AT1B 4BUGA 1MMDA 1VQMQ 2PLDA 1KQ2A 3S9KA 2LNHB 5LJ5f 1WX6A 3H0IA 1TUDA 2FEIA 1YIJA 4DA4A 2MK5A 2RH2A 2K4YA 1Q86R 3MO8A 2EYQA 2CP5A 2DPPB 2D0NA 4GWFA 4MDWA 3CXCA 2BUDA 3RR6A 2DJQA 4PKCC 3MJXA 2CSQA 2K3BA 1YI2Q 3JCMW 1YITA 1UDLA 2JMAA 1M1GA 3I55Q 5AT1B 1VYTA 2QQSA 1ZFPE 2P4TA 1GBQA 2GFUA 4OHEA 3EG3A 2D8JA 1QVGP 4C92F 4JS4A 4FSXA 2BZ8A 3HP9A 4R56A 3M55A 1RAEB 4AG1C 1A1CA 5KYWA 1D1BA 1MNDA 3L2UA 3GOXA 3JB9F 1BHFA 4RCCA 2EAYA 4KT0E 4QQDA 3G6EA 2XDBA 3G71T 2OX7A 1Y0MA 5GAOm 3OYIA 3QUIA 1ZBXA 5GAN2 2KK4A 2DTIA 2HQEA 2G3RA 2I0NA 3M59A 3SD4A 2F2WA 1X2KA 1I5LA 4V2SA 4NL3A 3OV1A 2QA4Q 3IN7A 6AT1B 2R5AA 3SHWA 3VUZA 2E3HA 2KYBA 4MZPA 4FL2A 2BE7D 2YUPA 5LL6S 1WHMA 4ELZC 1S1NA 1KA6A 1D1ZA 3UT1A 2KBTA 3MP1A 1YP5A 4BY6B 2ED1A 4AG2C 3HL8A 3OSVA 1YHQQ 1O4EA 2OAUA 4OP0A 4HCBA 3SEMA 1KC8C 3OYHA 3TQ7P 3UA7A 3M57A 2HDXA 4M7AE 4BE1A 2HKNA 1AWOA 1IGQA 5DC0B 2COZA 1OU8A 4HA8A 1VQOT 4PLIA 1B7TA 1BM2A 1X6GA 2K3XA 5A0GA 3JB9J 1K76A 1OPKA 2JTMA 1ZUYA 1KFZA 2K57A 5FW9A 2HCKA 3NPFA 5D6XA 3IMDA 3OSSC 1Z9ZA 2CUBA 1FU5A 1KA7A 2KK6A 2DBKA 3US4A 3MEWA 4C92C 2WSCE 3VV0A 3CBMA 4CC3A 1RAGB 4ORZA 2F1LA 4NWFA 2H8HA 1VQ9A 1O4QA 1QLYA 3VYGA 4J9FA 2BZXA 3KFJA 3RDVA 1OX8A 1O44A 4BI3A 4WCIA 4H1OA 2EQUA 2RSYA 1BB9A 3OYKA 2ZPBB 1NPPA 1D0ZA 2GFAA 2X3XD 4M7AD 4HT9A 3N84A 1WNLA 2PVDB 4RG8A 3IMJA 2DFUA 2AT1B 4DQ2A 1U1TA 2PNIA 5LJ5j 1UHFA 3M0TA 1FX7A 1D1AA 3PIOA 1AT1B 2RHZA 4E7SA 3CCVT 1TXQA 1YBYA 1CSYA 3OYGA 4OMQA 1QVFA 2A37A 4M4ZA 2HZYA 2R58A 4J9CA 1W2BS 3H0HA 1RLQC 1E6HA 1BIBA 1TSFA 3SWNC 2A3LA 1SHGA 2KXCA 3UA6A 4C8QB 1VQLT 2FZGB 4QQ6A 2QG9B 5KE3A 4TVRA 1O4KA 5HK0A 3KFVA 3I9QA 4Y28E 4DEYA 5KYWB 1G5VA 4PJNA 2NUPA 2RQWA 2QGFB 4EPCA 2RHXA 2QEXT 4X9CA 3TCJA 1PRLC 1GL5A 2KMTA 4DBQA 5C0MA 2LCTA 5IAYA 3GLXA 5FU7C 2O2OA 2CGHA 1JJ2P 2KDSA 2YUQA 2XI9A 1WJSA 1WQUA 3EHQA 4OMPA 4NOYA 1YJNA 3MXCA 4KBMB 3BUWB 2OI3A 1G3TA 1JU5C 5FU7B 4J5YA 1Q86C 2NUTB 4FL3A 4LN2A 1Q95G 3RIRA 5HKZA 4M75C 4B6MA 2CP2A 3K2MA 5A0LA 3WVEB 3I56A 4F7UA 4OHHA 2DRMA 2DZ9A 1EX4A 2EL8A 2E5KA 4E47A 3DLLA 1NLOC 2ZAEA 2JYQA 4WWQA 5GMKi 3OS1A 3G71A 1D4WA 2A08A 1O49A 3HRSA 5GMKj 1P92A 4Z02A 2O9VA 3VS0A 2EPDA 5DLQE 1A0NB 1VQ4T 4X34A 1RI0A 3CWGA 2JS0A 2X4YA 4KULA 1A1EA 1YJ9T 3TL0A 4MZTA 2J05A 3NGPA 3CCUA 5D7UA 4DEXA 1M8MA 4C5GA 5GANe 1KSWA 4PFPA 2R5MA 3CD6A 1YI2T 1VQ7T 2FPDA 4WTOB 4M75D 1N5ZA 3FLGA 4M78E 1ZQ1A 2L2PA 2PQWA 3HKSA 4JUVA 4PFOA 1SPKA 3HFOA 1K9MC 2XP1A 2FO0A 2LQNA 1PM3A 3O5ZA 2PZ1A 1TCEA 4XTXA 2HMAA 2DTHA 2DD5A 4DOWA 2L6KA 4JRPA 1CWEA 3JCMc 1ZA1B 4M78A 4JZ4A 3MEVA 2J6FA 4EY0A 4M75F 4RTTA 1K8AR 1H9OA 3CMET 4C92B 4N4HA 3QWXX 2ABLA 1CSZA 3MXYA 1TZEE 1WHKA 4JS5A 2EQJA 5IBSA 2HSEB 3U23A 3JCMe 3DB3A 3VRNA 1I8FA 4O6JA 1WQ7A 5GAOr 3VRPA 1TOVA 4M78D 3CMEA 3WA4A 3VS6A 1P13A 2AKLA 2NYSA 4E7HA 1VQ6Q 1WHHA 3ME9A 2EKXA 3OBWA 2CREA 3L1AA 2PTKA 3BUNB 2CIAA 4BE0A 1MILA 1NYGA 4C8QD 4QVDA 1AYBA 1M2VB 3C0CA 3M0UA 5FU6B 1M27C 3OB1B 1AD5A 4DGXA 1CJ1A 2QDYB 3CXCP 4PJOE 4HCCA 1QCNA 1M61A 4E93A 3CD6T 3OA6A 1MMNA 1VQKQ 1OULA 2EYZA 3OVEA 1I1JA 3EG1A 3CCLT 5CO7A 2FG0A 1QWEA 4HCKA 1YWPA 2ED0A 1BFIA 2H3EB 4JRKA 3BUMB 2XKOC 1IREB 4C92E 1NPRA 2DBMA 4JE4A 1KHIA 4L1BB 3PS5A 1T3LA 5GMKm 3VS1A 1X01A 1VQ9Q 4PJJA 1R8OB 1EIFA 1JU5A 1C0MA 2EGCA 2BKDN 4ZTJA 3E19A 3Q1JA 1NRVA 1R1SA 1X27A 1AOJA 4C5EA 2SEMA 2VWFA 1I07A 5LJ5h 2VVKA 2XDDA 1X6CA 3OQ5A 3PE0A 4JJCA 4PJOA 1OYXA 3QWYA 4BB7A 5CK9A 2IIMA 2A28A 2LRAA 1XTDA 4OB0B 3CC2Q 2ZGWA 3MP8A 2GCXA 1O4PA 4BI8B 4XTYA 3URGA 2F69A 1TWBA 2V8JA 1H3HA 4FIBA 2XU8A 4A4HA 2GBQA 2SHPA 1Y96A 1BU1A 1O4GA 1BCMA 4TZIA 5GAN3 1O47A 5FU6C 2JS2A 1BBZA 2KEAA 4E7KA 1FMKA 3L2WA 2F5KA 2EJFA 3QJ6A 2HMHA 3EGXA 4BDZA 3CEYA 3V8JA 2VKNA 4IIOA 3VGOA 4J6XA 2KNBB 1KK7A 1PICA 2DERA 2BTTA 1Q81C 3CCQA 3G6EQ 3QSUA 1EZZB 2YSQA 3RMSA 3C7IA 2QDLA 1HD3A 3FEOA 2EQIA 2RB6A 4ANJA 2QASA 1YVLA 4PJOC 4J9BA 1OPLA 3CCQT 4FM4B 1NJIR 4K2RA 4C5IA 1H641 2K2VA 1O45A 1QP3A 2D8HA 3JCMd 3N7YA 1G3YA 3CBLA 3EGXB 4XTUA 5GAOp 2RN8A 4U17A 4CC2A 2DD4A 2KRNA 1M1KC 5GJIA 2KRMA 4WF2A 1ZUKA 1VQ5A 2CUDA 1JEGA 4GPLB 1G2BA 2MMPA 4PJOG 1IO6A 2HKQB 4E7JA 1YITQ 3QO3A 4FBNA 3OS5A 4RUGA 3P8HA 2V1RA 2KR3A 1LCJA 2E5QA 1OZ2A 2OTLA 2CT3A 1U3OA 5KCHA 1KIKA 5LJ3h 5HK3A 1ZSZA 1YIJQ 4Z88A 2GTJA 5C6SA 4IUTA 4P5NA 2DEQA 3OYBA 2KROA 1WQWA 5IH2A 1X6BA 2CP3A 5IN1A 2MCNA 3FDRA 1N27A 1VQ7Q 2AOBA 3PQZA 4L5GA 2E1HA 1K9AA 2RI5A 4A4EA 2LNXA 4M77A 2JJ9A 1T0HA 4C8QG 3OS0A 5HY6A 4NS5A 2CZ0B 3CC4A 2WSFE 5EHPA 1ABOA 5GAN4 2A0FB 1FWZA 2MI6A 4M78G 3R6OA 2RK1A 2H3JA 1YJ9Q 3CCRQ 2K5LA 1Z9QA 2MF2A 4K45A 4M75B 2DILA 1JBMA 4MMKA 2ZPEB 2EO3A 1D4TA 1YHQT 3EH1A 3OMCA 2QXFA 3SFMA 4ZGJB 4PJOF 4F7UF 1H8KA 4M7AA 2YRCA 2IZVA 3EFOA 4AMCA 3MHXA 2E10A 3OYYA 2AKKA 3OMGA 3HTRA 2DL5A 2GGRA 1SHBA 3FC3A 1AWXA 1G83A 4FSSA 4PL6A 4OHLA 3CC2A 5I21A 2IPOB 3QDFA 3C12A 1SEMA 1JXMA 4N4GA 4M7AG 3OYNA 1SRLA 4PJLA 4GLKA 8ATCB 2YT6A 2E6NA 3LH0A 3REAB 3OYFA 2OTJA 5I22A 3A8HB 3EH2A 4HXJA 3JAME 3FRNA 2MRKA 1XNIA 3CMAA 2FRYA 2KXDA 4JRIA 5DC4A 3L2QA 4A54A 1Y71A 5DM7R 4LDXA 4M78B 2WSEE 2ZPIB 1TUGB 2M02A 5GAMh 1LJOA 1YIJT 3VJPA 2EOBA 5KYYB 4U1PA 4XU2A 3UATA 2Y4XA 2A36A 1O4RA 3QPHA 4RKUE 3VU3C 5CQXA 4PLLA 4ZN3A 1H92A 1VQNT 2GTOA 1QG1E 4DOVA 1CWDL 1M3AA 9ATCB 1GCQC 1AOUF 5FROA 3AT1B 5L8RE 3GXXA 1JB0E 2MWPA 1F1WA 4DBHA 3X20B 2DVJA 5I2SA 1D3BB 3GIBA 1WDXA 2OZOA 3TKZA 1YWOA 2L3TA 3FIFA 4RG2A 1SHFA 2R57A 1Q7YU 1O9SA 2K6DA 2K5FA 1O4DA 1IJRA 1QVPA 3QZ5B 4C0GA 2DMOA 2ZPFB 5GAMe 5GAOl 3CCJT 4MZMA 1HXDA 1ZBJA 1OOTA 1LPLA 5KYNA 3G4ST 3CXCS 1WIEA 4HT8A 1K1ZA 3EGDA 1V29B 2MIOA 1B34B 3I56T 1KQSA 2CZ1B 1BKBA 1Z3KA 5CVIA 1K0XA 3VRZA 1AB2A 3LX7A 3LGFA 4XAXB 1PKSA 2DL4A 2AIRB 5GMKl 1Y96B 2E65A 2X35A 2K3YA 4RTXA 1XQHA 2PVGB 2F2XA 2DLYA 3T04A 2EQKA 5FRNA 4C0ZA 5GANg 3CC7Q 3PNWC 2YU7A 1Q7YC 2MRJA 1VQMT 3UDCA 3CCMA 1QVFP 2JXBA 2DRKA 3H6ZA 2CSIA 4ZNXA 2KGTA 1VA7A 1WYXA 1A1BA 2LJ0A 1N8RR 2L3RA 4ATOA 2AOAA 2O4XA 2K2MA 2DTOA 2HAXA 1QWFA 2B86A 3CCJA 1SHAA 2HQHA 2E64A 3CBPA 3L42A 2JZ2A 4M78C 4EMGA 4BDYA 3G71Q 1IRXA 3BKBA 1HCTB 2OTLT 1WXUA 3CXLA 1NBEB 4N0AA 4OMMA 1U8RA 3I56Q 1AYCA 2DL3A 1K8AU 3META 2FL7A 4D8DA 3M4YA 3JCMP 3OB9A 5D6YA 2RM4A 1FYNA 4OHIA 1PWTA 4LDWA 5AULA 2EGAA 1KD1C 5I6VA 3E9GA 1ZLMA 2LRQA 5IXBA 2ENMA 5FWCA 2MQIA 4FYYB 2ZPGB 4FYVB 1UG1A 4EIKA 1AZEA 3L2RA 2VUBA 3V7RA 2XK0A 2RO0A 4RMOA 4J83A 1BF5A 1ZA2B 2OTJQ 3CC4T 2DXTA 2PU9B 2RI2A 4FT4A 1FMWA 2EBPA 3CC2T 1C1AA 1X69A 1D3BA 3CCST 2C0OA 2V1QA 1ZSZC 2XD0A 3TVTA 2DYIA 1M3CA 4PJMA 5GAOq 3JB9I 3CPWA 3M9QA 3EFRA 3GNGA 1HYOA 5CKDA 4C92A 2RA2A 2BZYA 3S8OA 2V8KA 3DLMA 1OZ3A 3INZA 1SG5A 3CPFA 3KXTA 3CCLA 1E6GA 4OMFB 3M0SA 4M78F 2JM8A 1B3QA 2ZPHB 2C06A 2KT1A 2DAQA 5KYXB 4MMLA 1JRIA 3LWHA 2CS7A 2IVWA 3ZBDA 1QMCA 4BI4A 2RVFA 5LJ3f 3H9NA 2L8DA 3RNJA 2X4XA 2EIFA 1K73R 1U06A 1FXXA 3I55T 1FMVA 2OQ1A 2YSXA 2Y1NA 3G6ET 2JT4A 4M75E 3X25B 3CCSQ 2LDMA 3CCRA 1N8RU 1VQKT 4GLMA 1GFDA 2YLBA 2IUHA 3X24B 4E7LA 3A98A 1NLPC 1PSFA 3CC4Q 5BO4A 2EJ9A 2OTJT 1R1QA 2EVRA 2CYZB 5CKBA 1VQ7A 3JB9H 2O88A 5IT9E 5HCKA 1BIAA 3OYAA 1QQJA 2GQIA 5KAZA 2J7IA 2CT4A 1VQ4A 2B8AA 3VRYA 5DC9A 3A5ZB 2JTEA 1MGQA 2DXUA 1TUCA 5EG2A 1VQPA 1WZOA 1YITT 5LJ3g 3RERA 4DBRA 1H3ZA 1S72A 2VASA 4X1VA 1O48A 5M9OA 3C4SA 1QCOA 4F7UB 4C5HA 4F04B 4H34A 1UGRB 3HIZB 1K73C 4XU1A 3PIPA 2CH4A 1X6OA 4F7UE 1V1CA 4XTVA 2Y1MA 3BUOB 1N9SA 2QK0A 3VROA 5IBMA 3NTHA 1VYVA 1SHDA 2PNBA 1VQNA 4OMNA 3G4SA 1PC0A 2HD0A 1YHQA 1IHWA 4VUBA 2LNWA 2OAWA 2M0OA 3EGDB 1LUKA 1BG1A 1FBZA 2DM0A 1YCYA 2I2LA 2VXEA 2G6FX 2ZCFB 3T9NA 4B9XA 4B9WA 4HKEA 5CAIA 1OV3A 1RPYA 2DLZA 2QA4A 3CCUT 3H41A 4IURA 2O31A 3E1SA 1JYRA 1NM7A 3QHSA 2DVEA 2DE0X 2K7AA 4ME7A 4XZ1A 5FRMA 1NJIC 3M7FA 1BI1A 4JEGA 1AWJA 1AYDA 1X43A 4IUPA 3LH5A 1O41A 2RJEA 1ZUUA 1EFNA 1SF9A 2KT8A 1D0XA 2C9WA 4KGVB 5D6WA 2CZ6B 2E70A 3OY9A 1SKJA 2FVUA 4F5BA 1UE9A 3VYHB 1N8RC 1KC8R 4RTZA 2ROTA 2VB6A 1D1CA 4LE9A 2AK5A 1LUMA 1IXDA 4RTUA 1O46A 5KYYA 1NE8A 3G4SQ 1LUIA 1VQNQ 4QT7A 5KYXA 3CMAT 1JWOA 4JGHA 4OB1B 1KQ1A 5CIUA 1AZGB 3JB9G 4E7IA 4C0DC 2VIFA 5EG3B 3AHUA 1YI2A 1WGSA 1O4HA 3NTKA 2JMCA 4OB3B 2GNCA 4EMHA 3MAZA 1ZHIA 1VUBA 2X4JA 4LDUA 5LJ5g 3A1PA 4DBFA 4KUIA 3M0PA 3QXEB 3JCMJ 1O4CA 2COYA 3HHTB 1PD1A 3QBYA 4K44A 5CCAA 4R0KA 3FJ5A 1KG1A 2CRHA 1SPRA 4JZ3A 2MYSA 7AT1B 4FYWB 5KH6A 1VQMA 3PGGA 2EGEA 1ZX6A 4OMOA 2RORA 2PUKB 3OP0A 5GAMg 1GFCA 3EGUA 4ESRA 3K2TA 1VQLA 2BE9B 1O4MA 2FZKB 2E4HA 2FZCB 2LZ6B 4LD9K 5GANd 3A8OB 4FT2A 2LX7A 2EU0A 1BCOA 1YJWT 1MNEA 2E12A 4LD6A 3CCSA 2X51A 3OYEA 5J3BA 2V26A 3VS7A 2IUIA 1O75A 2DZCA 1NJIU 1M1KU 1VQKA 1O4AA 4JLIA 4O5VA 3BE3A 1V76A 1T3SA 3EACA 1IS0A 1MUZA 5GAN8 4J6WA 1K8AC 1R77A 2EKOA 3EFOB 1SRMA 1I4K1 1ABQA 2QYZA 5CKFA 1YFNA 3D7SB 3ASKA 2CI8A 1DJ7B 3KBGA 2LCLA 2K79B 1OEBA 4E7ZA 1D0YA 4GL9E 4CI0C 3M58A 4LUDA 4FCYA 3ZL7C 4F16A 4FU6A 1LCKA 1M1FA 1UFFA 3N5BB 1A1AA 2O01E 3OYJA 2QEXA 4QSYA 4C0DB 4ZN1A 3JSCA 2Y4YA 4M77D 1M2OA 3RMQA 1QVGS 2H5KA 3CMEQ 2C0IA 4X9DA 1O4FA 4A53A 3HSBA 5GMKh 2LQ8A 4N4IA 2XICA 4XU3A 3S3NA 1W4SA 2DX1A 2QA4T 4Z89A 4OMLA 4XK8E 2RMOA 2HL3A 4IUVA 1HCSB 3ER0A 1N6AA 4ELYC 4XU0A 2D1XA 3HCKA 2P4RA 1W2BA 1D09B 5HKWA 5KYUA 3V7CA 1O4BA 4GY5A 3TREA 4C8QE 2QI2A 2J06A 1I81A 5EELA 3C95A 4A4GA 1C6VX 2FYKA 2EWNA 1YJWQ 2PVOB 1QVGA 5LJ3j 4M7AB 3RKYA 4QVCA 1IB8A 5LJ3d 2BIVA 1RACB 3CC7T 1VQOQ 1PCXA 1A07A 2CKKA 5EEQA 1LVKA 1VQ6T 1TH7A 3MEAA 2RHYA 3VKIA 4P9ZA 4F7UG 1AEYA 3CD3A 2X3WD 3RKWA 3CCUQ 3H0FA 2FCIA 3TSWA 4AFSC 3M5AA 1UHCA 1W70A 4JJNK 2ESWA 5CDWA 2YUNA 2IUGA 3CCJQ 3UPUA 2RD1A 1FYRA 3QYHB 3O8VA 3OS2A 1BKLA 4IUQA 5A0DA 2K5IA 2HBPA 2HQXA 4F14A 2K79A 2DETA 2RMXA 1BK2A 1N9RA 5IXFA 2RNAA 5CR2A 1VQOA 1SPSA 1JQQA 1I0CA 1ZSGA 2ROLA 1UB4A 3CCEQ 3QDRB 1SSFA 1BI0A 1RLPC 3G7ZA 1G8XA 1Y57A 1Q7YR 2KRSA 2QQ9A 1O43A 3EG9B 3QG1A 4CC4B 1UTIA 2VYTA 1WFWA 1F1BB 1KC8U 1YJNQ 4FW1A 2XG8D 2KY9A 2XHCA 3GF5A 3SDZA 1O42A 3PFSA 4ZTFA 4N0AC 2MK2A 2KI7A 4M75G 2HEQA 1F2FA 2KAFA 1K9MU 2QQAA 2JUFA 1M90U 3BY7A 2DXBA 2AZVA 1W2BP 2LJ3A 1WPYA 4XTWA 1O4NA 2VXFA 1GXIE 4KGXB 1PRMC 1ARKA 1R0BG 5GANh 2EYYA 2RI3A 2VV5A 1R1PA 5DY9A 4E6RA 3LYVA 3V8LA 2OJ2A 2RHUA 1UGPB 2QTXA 3JCMV 2AHJB 1TS9A 3R6NA 4KH1B 1Q82C 5KCOA 2FPFA 4XQ3A 5DLOA 2AZSA 3DB4A 3OW2P 3QJYA 1X0NA 3OB2B 1RL2A 1JXOA 3EHRA 3I5SA 1VQPT 1JYUA 3VRRA 1BI3A 4E68A 4LDVA 2HUWA 3CBOA 4A63B 3BDUA 2YUOA 3PMTA 2DX0A 2LCCA 4EMKA 2ECZA 5DF6A 1PHTA 5FLXE 2DM1A 1U5SA 1FU6A 4J7IA 2HNIA 1XOVA 2Z0WA 2CBLA 3M56A 1I5OB 2DA9A 4PJOB 5IHKA 3OBYA 3BW1A 2RK2A 3J80E 4Q5WA 1VQLQ 1MHNA 2NUPB 2RF0A 4HVUA 1BHHB 1GRIA 2BBUA 2K7AB 1JJ2S 5CQYA 2O4XB 1KQSS 1PNJA 4D8KA 2JOYA 2M51A 3BDLA 1M27A 3GP8A 4RTVA 4CC7A 5J3XA 1VQ8A 2D6FA 4AFQC 5KE2A 1GHUA 4A4FA 2P0KA 1AVZC 4BY6C 3X28B 3P8BB 2AUGA 1PKTA 3FB9A 4M7DA 2PNAA 2JM9A 2KQWA 1M3BA 3JCMf 4A4BA 3VUBA 3E9FA 2PUOB 4F17A 2RJFA 2X9HA 3CCET 3MKDA 2ZZDA 4AFUC 1RAAB 1CKBA 3J81E 1NG2A 4HVVA 2X4WA 3PSKA 3M0QA 1G3SA 4M7AF 3ZEHA 3VS2A 2RQUA 5GAMj 3TU4K 3REBB 2DLPA 5GAMd 1WA7A 4J9HA 2LCSA 1AYAA 3JCMb 4OF1A 3VRQA 1M2VA 3S3MA 3IN8A 1RI9A 4RTWA 3P8DA 4RCBA 1KQSP 1QW1A 4M7DG 5GJWB 3NHNA 1QCFA 3WXMB 1RAFB 4M7DF 3JRZA 1UUSA 1CSKA 4D6WA 4QKUA 4Z8AA 3C94A 3PJPA 3VS4A 5AXIA 3QKJA 3IQLA 1YJ9A 4L59A 2DYBA 4OGCA 3EFSA 4KH0B 3GXWA 1J3TA 1Q81U 2ETZA 2P0PA 1RUWA 1WJQA 1NYFA 3L2VA 1BLKA 4CRIA 4F59A 1JO8A 4M7DD 2NLUA 3UF4A 1VYUA 1M9SA 4M77C 5HKYA 3CPWS 2MOXA 3JCMX 3QZ9B 4Y92A 1RAIB 3CQTA 2YDLA 3I55A 2QGGA 8AT1B 2MPXC 1RADB 4LNPA 2OTLQ 2KE9A 4UC4A 2ECDA 4JRQA 2CR4A 3GBQA 5GAMf 2EYWA 1VQ5Q 2EQMA 5J39A 1M1KR 2DK3A 1QP2A 1YN8A 1WLPB 3QIIA 4OB2B 2NUZA 2EO6A 1S72Q 2L3QA 4BACA 1VQPQ 4M7AC 4HCZA 4II1A 2HBWA 1GBRA 4PJOD 5KYUB 2FRWA 3MEUA 4M75A 1VQ4Q 1G3WA 3OYLA 3BUXB 1UGVA 4IKFA 2L5QA 2F2VA 4E2FB 2CI9A 2QQBA 5A2QE 2MAMA 1GCQA 2LP5A 4M7DC 5J26A 2FPEA 2L89A 3E2UA 1A81A 2RQRA 1B47A 3CCQQ 2CP0A 2DF6A 1BHHA 2E41A 1SKUB 5HKCA 1AOTF 4C8QA 5LJ5e 1BYMA 2DKGA 1O4LA 3MPUB 1UJYA 1U1SA 5D0JA 1Y7XA 1TG0A 3MP6A 3RESA 1UEBA 4BE2A 4EMKB 2J6OA 1NZVA 2HDAA 1MV0B 5EC7A 4IIMA 4R55A 2NUTA 4ZGEB 1QVFS 2EYVA 4KRTA 1UECA 3A8MB 1RJAA 1VOMA 4M77F 1Q82R 4J9DA 4JPBW 3CCLQ 2RHIA 2KVQG 2VC8A 1KD1U 3CCVQ 5GANj 4AFZC 2LMJA 1WXTA 2YXYA 3S3OA 1W6XA 1A08A 2F5TX 4J9EA 1MW4A 2RPNA 5IHIA 2W10A 2J6KA 3RUXA 1MMAA 1IZ6A 1RAHB 2GE9A 2DL7A 3SWNA 2D0QB 4PK4A 3M4GA 2CP6A 3PLFB 1GCPA 3UYOA 1X2QA 4M77B 5LJ5d 5AYFA 1VQ8Q 1XA6A 2XIDA 3OYCA 1A09A 1Y1UA 2HDVA 2NWMA 1QKWA 4LXCA 2KNOA 1VIFA 3H8ZA 1TTHB 1T0JA 1SSHA 1Q81R 5GAN5 2EYXA 2JNGA 3I35A 2EFIA 2JN0A 3VS3A 4OGEA 4OVAA 4A4KA 3HRTA 2EW3A 4M77G 2P0QA 3TSZA 4RTYA 4OHDA 3V7SA 5GJVB 2M9UA 2VGNA 1K73U 1CKAA 2XDPA 1UURA 2FHDA 3G1JA 3EG9A 5GAOn 3MCAB 4YTLA 3CCRT 1VIEA 2JTFA 2FB7A 2KYMA 4ROJA 2L0AA 1PG5B 2O9SA 5CKEA 2MWOA 1VQ5T 2VGMA 1RABB 1HK9A 3JB9D 2CH4W 2KGYA 4FYXB 2YHTA 2RJCA 4C0FA 2RQVA 4JLGA 3A8LB 2COWA 5GJHA 4C92D 1XJWB 4QQGA 5GAN7 2EKHA 1KHCA 1WI7A 3LYIA 1VQ6A 3HPWA 5EHRA 4PFZA 3UWNA 5LJ3e 3PVQA 3I5RA 1M90R
chains in the Genus database with same CATH topology
3PVLA 3K2MA 1SHFA 1RQQC 2K6DA 1O4DA 1IJRA 4OHHA 1FBVA 1YCSB 5FWBA 2DMOA 2DRMA 1A07A 5EEQA 2XMFA 1E7OA 1K4US 1AWWA 1ZBJA 2E5KA 2EL8A 4P9ZA 1NLOC 2JYQA 1OOTA 4NWGA 4WWQA 1AEYA 3CD3A 2X3WD 4F5AA 1WIEA 1K1ZA 2K9GA 2MIOA 1D4WA 1Z3KA 3H0FA 1KJWA 2FCIA 3N8MA 2A08A 1K0XA 3VRZA 1O49A 2L3PA 3TSWA 2CS0A 4AFSC 1AB2A 5ECAA 1UHCA 3VS0A 1PKSA 1W70A 2O9VA 2EPDA 2DL4A 2LJ1A 1A0NB 2ESWA 5CDWA 2YUNA 2PLEA 2IUGA 1O4IA 3CWGA 2JS0A 4X6SA 4RTXA 4K11A 1A1EA 1FYRA 4XZ0A 3TL0A 3EG2A 1W1FA 2F2XA 1BMBA 2J05A 2DLYA 3T04A 3NGPA 2L3SA 1BKLA 4DEXA 1M8MA 1K0SA 2B3OA 2SRCA 2YU7A 5I11A 2MRJA 1KSWA 4F14A 2K79A 1O4OA 1BLJA 2RMXA 2DNUA 1BK2A 2JXBA 2DRKA 2CSIA 5IXFA 2DCRA 2RNAA 3EG0A 3ZNIA 4ZNXA 2FPDA 2KGTA 1JQQA 1SPSA 1BFJA 1I0CA 1VA7A 1ZSGA 2ROLA 1N5ZA 1WYXA 2L2PA 1RLPC 1A1BA 2LJ0A 1YNZA 1SPKA 4P9VA 1Y57A 5IHNA 3S8LA 2XP1A 1QKXA 2KRSA 2AOAA 2FO0A 1I3ZA 1O43A 3GQIB 1NZLA 4CC4B 2K2MA 1UTIA 2LQNA 3HHMB 3O5ZA 2PZ1A 1TCEA 1QWFA 1WFWA 2B86A 1SHAA 3PFVA 2L6KA 1CWEA 4JZ4A 2M0YA 1HSQA 4EIHA 2H46E 2J6FA 4EY0A 1OO3A 1H9OA 4RTTA 3BKBA 1O42A 1HCTB 4J9IA 2C0TA 3QWXX 2ABLA 1CSZA 3MXYA 1TZEE 1WXUA 2MK2A 5IBSA 3U23A 2HEQA 3NMZC 1F2FA 3CXLA 3VRNA 4OMMA 4A4CA 1AYCA 2DL3A 3VRPA 2AZVA 3M0RA 2LJ3A 1O4NA 4D8DA 3WA4A 3VS6A 1P13A 2AKLA 2MC1A 1PRMC 2W0ZA 1ARKA 2EYYA 4OHIA 1FYNA 1PWTA 2EKXA 2CREA 5AULA 2EGAA 1R1PA 1O4JA 2PTKA 1MV3A 4E6RA 3BUNB 1ZLMA 5I6VA 1HJDA 5IXBA 2CIAA 1MILA 2ENMA 5FWCA 2MQIA 1NYGA 3THKA 4GBQA 2Y3AB 1AYBA 2OJ2A 3C0CA 3M0UA 2HSPA 3ULRB 1M27C 1UG1A 4EIKA 1KC2A 1AD5A 3OB1B 1FHSA 3R6NA 1AZEA 4JJDA 1JYQA 1BF5A 5L23A 2JW4A 1WXBA 4DGXA 1CJ1A 2FPFA 2EBPA 1M61A 1LKKA 2AZSA 4E93A 1X0NA 3OB2B 3RBBB 4J9GA 1M30A 1UUEA 1JXOA 3EHRA 3I5SA 1JYUA 3VRRA 4E68A 1X69A 2HUWA 2C0OA 2EYZA 2V1QA 3OVEA 3TVTA 4A63B 1I1JA 1M3CA 3EG1A 3JV3A 2FG0A 2YUOA 3VS5A 2DX0A 1QWEA 4HVWA 2ECZA 5DF6A 1PHTA 4HCKA 1YWPA 2DM1A 1U5SA 2ED0A 1FU6A 1BFIA 2BZYA 3BUMB 2DBMA 3S8OA 4JE4A 1XOVA 2GSBA 1YVHA 2CBLA 3PS5A 4L1BB 1T3LA 1OO4A 3VS1A 2DA9A 5IHKA 1JU5A 1E6GA 2RQTA 3M0SA 2EGCA 2JM8A 2RF0A 4HVUA 1BHHB 3S8NA 1GRIA 2BBUA 1B3QA 1B07A 1NEBA 2K7AB 1NRVA 1R1SA 1X27A 2KT1A 1AOJA 1BKMA 2SEMA 1PNJA 2VWFA 4D8KA 2M51A 1M27A 1I07A 2VVKA 4RTVA 4CC7A 1QADA 1X6CA 5J3XA 2RVFA 4AFQC 3PE0A 4JJCA 1GHUA 3RNJA 2LQWA 3QWYA 1U06A 1AVZC 4JJBA 2AUGA 2IIMA 1PKTA 2CDTA 2A28A 2OQ1A 2YSXA 2Y1NA 2PNAA 2JT4A 1LUNA 2JM9A 4GLMA 1M3BA 4A4BA 1GFDA 2DL8A 3PSJA 2IUHA 4DGPA 3A98A 1O4PA 1NLPC 4LUEA 4F17A 5BO4A 1LKLA 1H3HA 1R1QA 2EVRA 1UJ0A 4AFUC 2GBQA 2L4KA 2SHPA 1CKBA 3EAZA 1BU1A 1NG2A 4HVVA 1O4GA 4TZIA 1O47A 2QMSA 3PSKA 3M0QA 1NEGA 2JS2A 2O88A 1BBZA 2RQUA 2KEAA 3VS2A 1FMKA 5HCKA 3REBB 2DLPA 1WA7A 4J9HA 2LCSA 2PLDA 2GQIA 5KAZA 1AYAA 2J7IA 2CT4A 3VRQA 3S9KA 3VRYA 3IN8A 1RI9A 2LNHB 4RTWA 1TUDA 1WX6A 3H0IA 2FEIA 5DC9A 2JTEA 1TUCA 5GJWB 2HMHA 3NHNA 1QCFA 1UUSA 4X1VA 1CSKA 1O48A 2D0NA 2VKNA 4IIOA 4GWFA 4Z8AA 3PJPA 3VGOA 4H34A 3VS4A 5AXIA 3IQLA 3HIZB 2KNBB 2DYBA 2CH4A 2DJQA 1PICA 2CSQA 2K3BA 1V1CA 2BTTA 2Y1MA 3BUOB 1UDLA 3GXWA 2JMAA 2YSQA 1J3TA 3VROA 2ETZA 5IBMA 3C7IA 1RUWA 2QDLA 1VYTA 1VYVA 1SHDA 1HD3A 1NYFA 2PNBA 4OMNA 1BLKA 4F59A 1ZFPE 2EQIA 1JO8A 1GBQA 4OHEA 3EG3A 1YVLA 4J9BA 3UF4A 1OPLA 2LNWA 2D8JA 2OAWA 1LUKA 1BG1A 1FBZA 1VYUA 4K2RA 2DM0A 1O45A 2D8HA 3N7YA 2G6FX 3CBLA 2BZ8A 5HKYA 2MOXA 1OV3A 4Y92A 1RPYA 2RN8A 3CQTA 4U17A 2DLZA 4CC2A 2KRNA 4AG1C 5GJIA 1A1CA 3H41A 2O31A 1BHFA 2YDLA 1JYRA 1NM7A 2KRMA 2DE0X 2K7AA 4LNPA 1ZUKA 1JEGA 2CUDA 2KE9A 4GPLB 1G2BA 4XZ1A 2ECDA 1IO6A 3M7FA 4FBNA 4RUGA 2CR4A 1Y0MA 2V1RA 3GBQA 4JEGA 2KR3A 1LCJA 1AWJA 1AYDA 1X43A 3LH5A 1O41A 1ZUUA 1EFNA 2EYWA 2KT8A 2C9WA 2CT3A 2I0NA 1YN8A 1U3OA 2F2WA 1WLPB 1SKJA 1X2KA 2NUZA 2EO6A 4F5BA 1KIKA 3OV1A 3IN7A 2L3QA 1UE9A 3SHWA 2KYBA 2HBWA 4RTZA 1GBRA 4FL2A 4Z88A 2GTJA 2FRWA 2ROTA 2YUPA 1S1NA 1KA6A 3BUXB 1UGVA 1D1ZA 2KROA 5IH2A 2KBTA 2F2VA 4LE9A 1X6BA 2AK5A 1LUMA 2CI9A 1YP5A 2ED1A 4RTUA 1O46A 2MCNA 4AG2C 1GCQA 2AOBA 1O4EA 3PQZA 1LUIA 2LP5A 1K9AA 4QT7A 3SEMA 2LNXA 1T0HA 2FPEA 3UA7A 1JWOA 4JGHA 2HDXA 1AZGB 1A81A 1AWOA 2RQRA 5EHPA 1B47A 2VIFA 5DC0B 5EG3B 1ABOA 2DF6A 1BHHA 1O4HA 1BM2A 2JMCA 1X6GA 2GNCA 1AOTF 3MAZA 1K76A 1O4LA 1OPKA 1UJYA 1Z9QA 5D0JA 3M0PA 1ZUYA 1KFZA 1O4CA 5FW9A 4K45A 2DILA 1TG0A 2HCKA 4K44A 3NPFA 2EO3A 1D4TA 3IMDA 2J6OA 1NZVA 2HDAA 4R0KA 1MV0B 1Z9ZA 3FJ5A 2CRHA 1SPRA 2CUBA 4JZ3A 4IIMA 5EC7A 2DBKA 1FU5A 1KA7A 2KK6A 1H8KA 3US4A 2EYVA 4KRTA 1UECA 2IZVA 1RJAA 2EGEA 1ZX6A 4OMOA 2RORA 4CC3A 3OP0A 1GFCA 3EGUA 4ESRA 4ORZA 4J9DA 4JPBW 4NWFA 2H8HA 1O4MA 1O4QA 2AKKA 4AFZC 1QLYA 2LZ6B 1WXTA 2DL5A 2LMJA 1W6XA 2GGRA 1A08A 1SHBA 4J9EA 2BZXA 4J9FA 1MW4A 2RPNA 3KFJA 5IHIA 2W10A 2J6KA 2LX7A 1AWXA 1O44A 2EU0A 4WCIA 1G83A 4FSSA 4OHLA 4H1OA 2RSYA 2GE9A 1BB9A 2DL7A 2X3XD 3N84A 3VS7A 1SEMA 1JXMA 3PLFB 2IUIA 1GCPA 3IMJA 3UYOA 1X2QA 1O4AA 1SRLA 1XA6A 2PNIA 1T3SA 1UHFA 3M0TA 3EACA 1A09A 1IS0A 1MUZA 1Y1UA 2HDVA 2NWMA 2YT6A 3REAB 1SRMA 1QKWA 1ABQA 2KNOA 5I22A 2CI8A 1T0JA 1SSHA 1CSYA 4OMQA 4HXJA 2A37A 2EYXA 2K79B 2MRKA 3I35A 4M4ZA 3VS3A 4J9CA 1OEBA 3H0HA 2FRYA 2KXDA 5DC4A 1RLQC 4GL9E 4LUDA 1E6HA 3ZL7C 4F16A 2EW3A 1LCKA 1SHGA 1UFFA 2KXCA 3TSZA 1A1AA 4RTYA 3UA6A 4OHDA 5GJVB 4QSYA 1CKAA 1O4KA 2H5KA 1UURA 2C0IA 1O4FA 3KFVA 3I9QA 4DEYA 2DX1A 4Z89A 2RQWA 4OMLA 2RMOA 2KYMA 2EOBA 2L0AA 4ROJA 4U1PA 3UATA 1O4RA 2A36A 2O9SA 1HCSB 1GL5A 1PRLC 1H92A 2D1XA 3HCKA 2LCTA 2P4RA 5HKWA 2GTOA 2CH4W 2O2OA 1O4BA 1QG1E 1CWDL 2YUQA 1M3AA 2RQVA 1WQUA 3EHQA 4OMPA 3MXCA 2J06A 1GCQC 5EELA 5GJHA 1AOUF 3BUWB 2OI3A 3GXXA 1F1WA 2EKHA 1JU5C 2DVJA 1WI7A 4FL3A 4LN2A 5HKZA 5EHRA 1WDXA 2OZOA 3TKZA 1YWOA 2L3TA 3PVQA 3I5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVL A;  3K2M A;  1SHF A;  1RQQ C;  2K6D A;  1O4D A;  1IJR A;  4OHH A;  1FBV A;  1YCS B;  5FWB A;  2DMO A;  2DRM A;  1A07 A;  5EEQ A;  2XMF A;  1E7O A;  1K4U S;  1AWW A;  1ZBJ A;  2E5K A;  2EL8 A;  4P9Z A;  1NLO C;  2JYQ A;  1OOT A;  4NWG A;  4WWQ A;  1AEY A;  3CD3 A;  2X3W D;  4F5A A;  1WIE A;  1K1Z A;  2K9G A;  2MIO A;  1D4W A;  1Z3K A;  3H0F A;  1KJW A;  2FCI A;  3N8M A;  2A08 A;  1K0X A;  3VRZ A;  1O49 A;  2L3P A;  3TSW A;  2CS0 A;  4AFS C;  1AB2 A;  5ECA A;  1UHC A;  3VS0 A;  1PKS A;  1W70 A;  2O9V A;  2EPD A;  2DL4 A;  2LJ1 A;  1A0N B;  2ESW A;  5CDW A;  2YUN A;  2PLE A;  2IUG A;  1O4I A;  3CWG A;  2JS0 A;  4X6S A;  4RTX A;  4K11 A;  1A1E A;  1FYR A;  4XZ0 A;  3TL0 A;  3EG2 A;  1W1F A;  2F2X A;  1BMB A;  2J05 A;  2DLY A;  3T04 A;  3NGP A;  2L3S A;  1BKL A;  4DEX A;  1M8M A;  1K0S A;  2B3O A;  2SRC A;  2YU7 A;  5I11 A;  2MRJ A;  1KSW A;  4F14 A;  2K79 A;  1O4O A;  1BLJ A;  2RMX A;  2DNU A;  1BK2 A;  2JXB A;  2DRK A;  2CSI A;  5IXF A;  2DCR A;  2RNA A;  3EG0 A;  3ZNI A;  4ZNX A;  2FPD A;  2KGT A;  1JQQ A;  1SPS A;  1BFJ A;  1I0C A;  1VA7 A;  1ZSG A;  2ROL A;  1N5Z A;  1WYX A;  2L2P A;  1RLP C;  1A1B A;  2LJ0 A;  1YNZ A;  1SPK A;  4P9V A;  1Y57 A;  5IHN A;  3S8L A;  2XP1 A;  1QKX A;  2KRS A;  2AOA A;  2FO0 A;  1I3Z A;  1O43 A;  3GQI B;  1NZL A;  4CC4 B;  2K2M A;  1UTI A;  2LQN A;  3HHM B;  3O5Z A;  2PZ1 A;  1TCE A;  1QWF A;  1WFW A;  2B86 A;  1SHA A;  3PFV A;  2L6K A;  1CWE A;  4JZ4 A;  2M0Y A;  1HSQ A;  4EIH A;  2H46 E;  2J6F A;  4EY0 A;  1OO3 A;  1H9O A;  4RTT A;  3BKB A;  1O42 A;  1HCT B;  4J9I A;  2C0T A;  3QWX X;  2ABL A;  1CSZ A;  3MXY A;  1TZE E;  1WXU A;  2MK2 A;  5IBS A;  3U23 A;  2HEQ A;  3NMZ C;  1F2F A;  3CXL A;  3VRN A;  4OMM A;  4A4C A;  1AYC A;  2DL3 A;  3VRP A;  2AZV A;  3M0R A;  2LJ3 A;  1O4N A;  4D8D A;  3WA4 A;  3VS6 A;  1P13 A;  2AKL A;  2MC1 A;  1PRM C;  2W0Z A;  1ARK A;  2EYY A;  4OHI A;  1FYN A;  1PWT A;  2EKX A;  2CRE A;  5AUL A;  2EGA A;  1R1P A;  1O4J A;  2PTK A;  1MV3 A;  4E6R A;  3BUN B;  1ZLM A;  5I6V A;  1HJD A;  5IXB A;  2CIA A;  1MIL A;  2ENM A;  5FWC A;  2MQI A;  1NYG A;  3THK A;  4GBQ A;  2Y3A B;  1AYB A;  2OJ2 A;  3C0C A;  3M0U A;  2HSP A;  3ULR B;  1M27 C;  1UG1 A;  4EIK A;  1KC2 A;  1AD5 A;  3OB1 B;  1FHS A;  3R6N A;  1AZE A;  4JJD A;  1JYQ A;  1BF5 A;  5L23 A;  2JW4 A;  1WXB A;  4DGX A;  1CJ1 A;  2FPF A;  2EBP A;  1M61 A;  1LKK A;  2AZS A;  4E93 A;  1X0N A;  3OB2 B;  3RBB B;  4J9G A;  1M30 A;  1UUE A;  1JXO A;  3EHR A;  3I5S A;  1JYU A;  3VRR A;  4E68 A;  1X69 A;  2HUW A;  2C0O A;  2EYZ A;  2V1Q A;  3OVE A;  3TVT A;  4A63 B;  1I1J A;  1M3C A;  3EG1 A;  3JV3 A;  2FG0 A;  2YUO A;  3VS5 A;  2DX0 A;  1QWE A;  4HVW A;  2ECZ A;  5DF6 A;  1PHT A;  4HCK A;  1YWP A;  2DM1 A;  1U5S A;  2ED0 A;  1FU6 A;  1BFI A;  2BZY A;  3BUM B;  2DBM A;  3S8O A;  4JE4 A;  1XOV A;  2GSB A;  1YVH A;  2CBL A;  3PS5 A;  4L1B B;  1T3L A;  1OO4 A;  3VS1 A;  2DA9 A;  5IHK A;  1JU5 A;  1E6G A;  2RQT A;  3M0S A;  2EGC A;  2JM8 A;  2RF0 A;  4HVU A;  1BHH B;  3S8N A;  1GRI A;  2BBU A;  1B3Q A;  1B07 A;  1NEB A;  2K7A B;  1NRV A;  1R1S A;  1X27 A;  2KT1 A;  1AOJ A;  1BKM A;  2SEM A;  1PNJ A;  2VWF A;  4D8K A;  2M51 A;  1M27 A;  1I07 A;  2VVK A;  4RTV A;  4CC7 A;  1QAD A;  1X6C A;  5J3X A;  2RVF A;  4AFQ C;  3PE0 A;  4JJC A;  1GHU A;  3RNJ A;  2LQW A;  3QWY A;  1U06 A;  1AVZ C;  4JJB A;  2AUG A;  2IIM A;  1PKT A;  2CDT A;  2A28 A;  2OQ1 A;  2YSX A;  2Y1N A;  2PNA A;  2JT4 A;  1LUN A;  2JM9 A;  4GLM A;  1M3B A;  4A4B A;  1GFD A;  2DL8 A;  3PSJ A;  2IUH A;  4DGP A;  3A98 A;  1O4P A;  1NLP C;  4LUE A;  4F17 A;  5BO4 A;  1LKL A;  1H3H A;  1R1Q A;  2EVR A;  1UJ0 A;  4AFU C;  2GBQ A;  2L4K A;  2SHP A;  1CKB A;  3EAZ A;  1BU1 A;  1NG2 A;  4HVV A;  1O4G A;  4TZI A;  1O47 A;  2QMS A;  3PSK A;  3M0Q A;  1NEG A;  2JS2 A;  2O88 A;  1BBZ A;  2RQU A;  2KEA A;  3VS2 A;  1FMK A;  5HCK A;  3REB B;  2DLP A;  1WA7 A;  4J9H A;  2LCS A;  2PLD A;  2GQI A;  5KAZ A;  1AYA A;  2J7I A;  2CT4 A;  3VRQ A;  3S9K A;  3VRY A;  3IN8 A;  1RI9 A;  2LNH B;  4RTW A;  1TUD A;  1WX6 A;  3H0I A;  2FEI A;  5DC9 A;  2JTE A;  1TUC A;  5GJW B;  2HMH A;  3NHN A;  1QCF A;  1UUS A;  4X1V A;  1CSK A;  1O48 A;  2D0N A;  2VKN A;  4IIO A;  4GWF A;  4Z8A A;  3PJP A;  3VGO A;  4H34 A;  3VS4 A;  5AXI A;  3IQL A;  3HIZ B;  2KNB B;  2DYB A;  2CH4 A;  2DJQ A;  1PIC A;  2CSQ A;  2K3B A;  1V1C A;  2BTT A;  2Y1M A;  3BUO B;  1UDL A;  3GXW A;  2JMA A;  2YSQ A;  1J3T A;  3VRO A;  2ETZ A;  5IBM A;  3C7I A;  1RUW A;  2QDL A;  1VYT A;  1VYV A;  1SHD A;  1HD3 A;  1NYF A;  2PNB A;  4OMN A;  1BLK A;  4F59 A;  1ZFP E;  2EQI A;  1JO8 A;  1GBQ A;  4OHE A;  3EG3 A;  1YVL A;  4J9B A;  3UF4 A;  1OPL A;  2LNW A;  2D8J A;  2OAW A;  1LUK A;  1BG1 A;  1FBZ A;  1VYU A;  4K2R A;  2DM0 A;  1O45 A;  2D8H A;  3N7Y A;  2G6F X;  3CBL A;  2BZ8 A;  5HKY A;  2MOX A;  1OV3 A;  4Y92 A;  1RPY A;  2RN8 A;  3CQT A;  4U17 A;  2DLZ A;  4CC2 A;  2KRN A;  4AG1 C;  5GJI A;  1A1C A;  3H41 A;  2O31 A;  1BHF A;  2YDL A;  1JYR A;  1NM7 A;  2KRM A;  2DE0 X;  2K7A A;  4LNP A;  1ZUK A;  1JEG A;  2CUD A;  2KE9 A;  4GPL B;  1G2B A;  4XZ1 A;  2ECD A;  1IO6 A;  3M7F A;  4FBN A;  4RUG A;  2CR4 A;  1Y0M A;  2V1R A;  3GBQ A;  4JEG A;  2KR3 A;  1LCJ A;  1AWJ A;  1AYD A;  1X43 A;  3LH5 A;  1O41 A;  1ZUU A;  1EFN A;  2EYW A;  2KT8 A;  2C9W A;  2CT3 A;  2I0N A;  1YN8 A;  1U3O A;  2F2W A;  1WLP B;  1SKJ A;  1X2K A;  2NUZ A;  2EO6 A;  4F5B A;  1KIK A;  3OV1 A;  3IN7 A;  2L3Q A;  1UE9 A;  3SHW A;  2KYB A;  2HBW A;  4RTZ A;  1GBR A;  4FL2 A;  4Z88 A;  2GTJ A;  2FRW A;  2ROT A;  2YUP A;  1S1N A;  1KA6 A;  3BUX B;  1UGV A;  1D1Z A;  2KRO A;  5IH2 A;  2KBT A;  2F2V A;  4LE9 A;  1X6B A;  2AK5 A;  1LUM A;  2CI9 A;  1YP5 A;  2ED1 A;  4RTU A;  1O46 A;  2MCN A;  4AG2 C;  1GCQ A;  2AOB A;  1O4E A;  3PQZ A;  1LUI A;  2LP5 A;  1K9A A;  4QT7 A;  3SEM A;  2LNX A;  1T0H A;  2FPE A;  3UA7 A;  1JWO A;  4JGH A;  2HDX A;  1AZG B;  1A81 A;  1AWO A;  2RQR A;  5EHP A;  1B47 A;  2VIF A;  5DC0 B;  5EG3 B;  1ABO A;  2DF6 A;  1BHH A;  1O4H A;  1BM2 A;  2JMC A;  1X6G A;  2GNC A;  1AOT F;  3MAZ A;  1K76 A;  1O4L A;  1OPK A;  1UJY A;  1Z9Q A;  5D0J A;  3M0P A;  1ZUY A;  1KFZ A;  1O4C A;  5FW9 A;  4K45 A;  2DIL A;  1TG0 A;  2HCK A;  4K44 A;  3NPF A;  2EO3 A;  1D4T A;  3IMD A;  2J6O A;  1NZV A;  2HDA A;  4R0K A;  1MV0 B;  1Z9Z A;  3FJ5 A;  2CRH A;  1SPR A;  2CUB A;  4JZ3 A;  4IIM A;  5EC7 A;  2DBK A;  1FU5 A;  1KA7 A;  2KK6 A;  1H8K A;  3US4 A;  2EYV A;  4KRT A;  1UEC A;  2IZV A;  1RJA A;  2EGE A;  1ZX6 A;  4OMO A;  2ROR A;  4CC3 A;  3OP0 A;  1GFC A;  3EGU A;  4ESR A;  4ORZ A;  4J9D A;  4JPB W;  4NWF A;  2H8H A;  1O4M A;  1O4Q A;  2AKK A;  4AFZ C;  1QLY A;  2LZ6 B;  1WXT A;  2DL5 A;  2LMJ A;  1W6X A;  2GGR A;  1A08 A;  1SHB A;  4J9E A;  2BZX A;  4J9F A;  1MW4 A;  2RPN A;  3KFJ A;  5IHI A;  2W10 A;  2J6K A;  2LX7 A;  1AWX A;  1O44 A;  2EU0 A;  4WCI A;  1G83 A;  4FSS A;  4OHL A;  4H1O A;  2RSY A;  2GE9 A;  1BB9 A;  2DL7 A;  2X3X D;  3N84 A;  3VS7 A;  1SEM A;  1JXM A;  3PLF B;  2IUI A;  1GCP A;  3IMJ A;  3UYO A;  1X2Q A;  1O4A A;  1SRL A;  1XA6 A;  2PNI A;  1T3S A;  1UHF A;  3M0T A;  3EAC A;  1A09 A;  1IS0 A;  1MUZ A;  1Y1U A;  2HDV A;  2NWM A;  2YT6 A;  3REA B;  1SRM A;  1QKW A;  1ABQ A;  2KNO A;  5I22 A;  2CI8 A;  1T0J A;  1SSH A;  1CSY A;  4OMQ A;  4HXJ A;  2A37 A;  2EYX A;  2K79 B;  2MRK A;  3I35 A;  4M4Z A;  3VS3 A;  4J9C A;  1OEB A;  3H0H A;  2FRY A;  2KXD A;  5DC4 A;  1RLQ C;  4GL9 E;  4LUD A;  1E6H A;  3ZL7 C;  4F16 A;  2EW3 A;  1LCK A;  1SHG A;  1UFF A;  2KXC A;  3TSZ A;  1A1A A;  4RTY A;  3UA6 A;  4OHD A;  5GJV B;  4QSY A;  1CKA A;  1O4K A;  2H5K A;  1UUR A;  2C0I A;  1O4F A;  3KFV A;  3I9Q A;  4DEY A;  2DX1 A;  4Z89 A;  2RQW A;  4OML A;  2RMO A;  2KYM A;  2EOB A;  2L0A A;  4ROJ A;  4U1P A;  3UAT A;  1O4R A;  2A36 A;  2O9S A;  1HCS B;  1GL5 A;  1PRL C;  1H92 A;  2D1X A;  3HCK A;  2LCT A;  2P4R A;  5HKW A;  2GTO A;  2CH4 W;  2O2O A;  1O4B A;  1QG1 E;  1CWD L;  2YUQ A;  1M3A A;  2RQV A;  1WQU A;  3EHQ A;  4OMP A;  3MXC A;  2J06 A;  1GCQ C;  5EEL A;  5GJH A;  1AOU F;  3BUW B;  2OI3 A;  3GXX A;  1F1W A;  2EKH A;  1JU5 C;  2DVJ A;  1WI7 A;  4FL3 A;  4LN2 A;  5HKZ A;  5EHR A;  1WDX A;  2OZO A;  3TKZ A;  1YWO A;  2L3T A;  3PVQ A;  3I5R A; 
#chains in the Genus database with same CATH topology
 3PVL A;  5I2M A;  2EJG A;  1WHL A;  2YRD A;  1RQQ C;  2HL5 C;  4EMK C;  1IGU A;  3J7A F;  3SWN B;  1YCS B;  5FWB A;  1FBV A;  3CCM Q;  2XMF A;  1E7O A;  1K4U S;  2DJZ A;  3L2Z A;  1AWW A;  2Y90 A;  4NWG A;  1LOJ A;  3CC7 A;  2QTV A;  4F5A A;  3N8M A;  2K9G A;  1KJW A;  3OW2 A;  2L3P A;  2CS0 A;  5ECA A;  3X26 B;  3SB2 A;  2M16 A;  2LJ1 A;  2PLE A;  1O4I A;  1OU9 A;  4X6S A;  2E6Z A;  4K11 A;  4LDY A;  4XZ0 A;  2GF7 A;  1W1F A;  3EG2 A;  1BMB A;  2CZ7 B;  4FW2 A;  2L3S A;  3A8G B;  1JJ2 A;  4L6V 5;  1WHG A;  1K0S A;  2B3O A;  3PT9 A;  2SRC A;  5I11 A;  3CCE A;  1K9M R;  1BLJ A;  1O4O A;  1LNX A;  2DNU A;  3RKX A;  4M7D B;  2DCR A;  3EG0 A;  3ZNI A;  2LTO A;  3CD6 Q;  1M90 C;  1BFJ A;  2LC4 A;  1UGS B;  2DXC A;  1PD0 A;  2LX9 A;  3PTA A;  1YNZ A;  1OX9 A;  4P9V A;  4NL2 A;  5IHN A;  3S8L A;  5GAN f;  1QKX A;  4J7F A;  1M5Q 1;  1Y07 A;  1I3Z A;  3GQI B;  1NZL A;  2QQR A;  3HHM B;  1WJR A;  3PFV A;  3OYM A;  1R0C B;  4BD3 A;  3HRU A;  2YLC A;  2M0Y A;  1HSQ A;  4EIH A;  2H46 E;  1OO3 A;  1PSE A;  3KUF A;  5GMK e;  3GNF B;  1Q82 U;  4J9I A;  2C0T A;  3OW2 S;  4C8Q F;  3M54 A;  3NMZ C;  2WAC A;  3TEE A;  4MDX A;  4IUU A;  4A4C A;  1KD1 R;  1Q86 U;  5GAN 6;  2JVV A;  3JCM h;  3V8K A;  1MMG A;  4C92 G;  3M0R A;  1WHJ A;  1IHV A;  2LNV A;  4M77 E;  3LW5 E;  2MC1 A;  4EDU A;  1M8V A;  3LWI A;  2W0Z A;  3CCM T;  2DEU A;  2D9T A;  4QVZ A;  1YJW A;  1B34 A;  3NFC A;  1O4J A;  2RJD A;  1MV3 A;  1HJD A;  1BI2 A;  3CMA Q;  4M7D E;  3THK A;  4GBQ A;  2Y3A B;  3ULR B;  2HSP A;  2YWW A;  1KC2 A;  1OQK A;  1FHS A;  3JCM Q;  4KGZ B;  4JJD A;  2LQK A;  1JYQ A;  5L23 A;  3LLR A;  2IG0 A;  1WXB A;  2JW4 A;  1VQ9 T;  4Y91 A;  4PNO A;  2CP7 A;  4FL6 A;  1LKK A;  1TU0 B;  3FJP A;  3RBB B;  4J9G A;  1M30 A;  2V8I A;  1UUE A;  3S6W A;  3GPL A;  2DIG A;  4XTZ A;  3ZFJ A;  4KUD K;  2A7Y A;  3JV3 A;  1AHJ B;  3VS5 A;  2QEX Q;  1ZSZ B;  2DIQ A;  4HVW A;  3EAE A;  3LGL A;  1X75 C;  2QAZ A;  2LT1 A;  4J8O A;  3BFM A;  2GSB A;  1YVH A;  3QYG B;  1OO4 A;  3CCV A;  5CKH A;  1ACM B;  3DKM A;  2RQT A;  4QW2 A;  1UGQ B;  3S8N A;  2DO3 A;  1B07 A;  1NEB A;  1BKM A;  4ZGD B;  4C8Q C;  1QAD A;  2LVM A;  2LT4 A;  1NZ9 A;  3OYD A;  2M1H A;  2LQW A;  3PMI A;  4J6Y A;  1OI1 A;  2ATC B;  4JJB A;  2CDT A;  1YJN T;  2KSS A;  3F70 A;  1LUN A;  2GQV A;  2YRV A;  2DL8 A;  1VQ8 T;  3WVD B;  3PSJ A;  4DGP A;  4JDS A;  2E3I A;  2P84 A;  4LUE A;  1LKL A;  3CPW P;  1UJ0 A;  2L4K A;  3EAZ A;  3M53 A;  2QMS A;  3JCM g;  3HFN A;  1NEG A;  1S72 T;  1M4Z A;  3NTI A;  4AT1 B;  4BUG A;  1MMD A;  1VQM Q;  2PLD A;  1KQ2 A;  3S9K A;  2LNH B;  5LJ5 f;  1WX6 A;  3H0I A;  1TUD A;  2FEI A;  1YIJ A;  4DA4 A;  2MK5 A;  2RH2 A;  2K4Y A;  1Q86 R;  3MO8 A;  2EYQ A;  2CP5 A;  2DPP B;  2D0N A;  4GWF A;  4MDW A;  3CXC A;  2BUD A;  3RR6 A;  2DJQ A;  4PKC C;  3MJX A;  2CSQ A;  2K3B A;  1YI2 Q;  3JCM W;  1YIT A;  1UDL A;  2JMA A;  1M1G A;  3I55 Q;  5AT1 B;  1VYT A;  2QQS A;  1ZFP E;  2P4T A;  1GBQ A;  2GFU A;  4OHE A;  3EG3 A;  2D8J A;  1QVG P;  4C92 F;  4JS4 A;  4FSX A;  2BZ8 A;  3HP9 A;  4R56 A;  3M55 A;  1RAE B;  4AG1 C;  1A1C A;  5KYW A;  1D1B A;  1MND A;  3L2U A;  3GOX A;  3JB9 F;  1BHF A;  4RCC A;  2EAY A;  4KT0 E;  4QQD A;  3G6E A;  2XDB A;  3G71 T;  2OX7 A;  1Y0M A;  5GAO m;  3OYI A;  3QUI A;  1ZBX A;  5GAN 2;  2KK4 A;  2DTI A;  2HQE A;  2G3R A;  2I0N A;  3M59 A;  3SD4 A;  2F2W A;  1X2K A;  1I5L A;  4V2S A;  4NL3 A;  3OV1 A;  2QA4 Q;  3IN7 A;  6AT1 B;  2R5A A;  3SHW A;  3VUZ A;  2E3H A;  2KYB A;  4MZP A;  4FL2 A;  2BE7 D;  2YUP A;  5LL6 S;  1WHM A;  4ELZ C;  1S1N A;  1KA6 A;  1D1Z A;  3UT1 A;  2KBT A;  3MP1 A;  1YP5 A;  4BY6 B;  2ED1 A;  4AG2 C;  3HL8 A;  3OSV A;  1YHQ Q;  1O4E A;  2OAU A;  4OP0 A;  4HCB A;  3SEM A;  1KC8 C;  3OYH A;  3TQ7 P;  3UA7 A;  3M57 A;  2HDX A;  4M7A E;  4BE1 A;  2HKN A;  1AWO A;  1IGQ A;  5DC0 B;  2COZ A;  1OU8 A;  4HA8 A;  1VQO T;  4PLI A;  1B7T A;  1BM2 A;  1X6G A;  2K3X A;  5A0G A;  3JB9 J;  1K76 A;  1OPK A;  2JTM A;  1ZUY A;  1KFZ A;  2K57 A;  5FW9 A;  2HCK A;  3NPF A;  5D6X A;  3IMD A;  3OSS C;  1Z9Z A;  2CUB A;  1FU5 A;  1KA7 A;  2KK6 A;  2DBK A;  3US4 A;  3MEW A;  4C92 C;  2WSC E;  3VV0 A;  3CBM A;  4CC3 A;  1RAG B;  4ORZ A;  2F1L A;  4NWF A;  2H8H A;  1VQ9 A;  1O4Q A;  1QLY A;  3VYG A;  4J9F A;  2BZX A;  3KFJ A;  3RDV A;  1OX8 A;  1O44 A;  4BI3 A;  4WCI A;  4H1O A;  2EQU A;  2RSY A;  1BB9 A;  3OYK A;  2ZPB B;  1NPP A;  1D0Z A;  2GFA A;  2X3X D;  4M7A D;  4HT9 A;  3N84 A;  1WNL A;  2PVD B;  4RG8 A;  3IMJ A;  2DFU A;  2AT1 B;  4DQ2 A;  1U1T A;  2PNI A;  5LJ5 j;  1UHF A;  3M0T A;  1FX7 A;  1D1A A;  3PIO A;  1AT1 B;  2RHZ A;  4E7S A;  3CCV T;  1TXQ A;  1YBY A;  1CSY A;  3OYG A;  4OMQ A;  1QVF A;  2A37 A;  4M4Z A;  2HZY A;  2R58 A;  4J9C A;  1W2B S;  3H0H A;  1RLQ C;  1E6H A;  1BIB A;  1TSF A;  3SWN C;  2A3L A;  1SHG A;  2KXC A;  3UA6 A;  4C8Q B;  1VQL T;  2FZG B;  4QQ6 A;  2QG9 B;  5KE3 A;  4TVR A;  1O4K A;  5HK0 A;  3KFV A;  3I9Q A;  4Y28 E;  4DEY A;  5KYW B;  1G5V A;  4PJN A;  2NUP A;  2RQW A;  2QGF B;  4EPC A;  2RHX A;  2QEX T;  4X9C A;  3TCJ A;  1PRL C;  1GL5 A;  2KMT A;  4DBQ A;  5C0M A;  2LCT A;  5IAY A;  3GLX A;  5FU7 C;  2O2O A;  2CGH A;  1JJ2 P;  2KDS A;  2YUQ A;  2XI9 A;  1WJS A;  1WQU A;  3EHQ A;  4OMP A;  4NOY A;  1YJN A;  3MXC A;  4KBM B;  3BUW B;  2OI3 A;  1G3T A;  1JU5 C;  5FU7 B;  4J5Y A;  1Q86 C;  2NUT B;  4FL3 A;  4LN2 A;  1Q95 G;  3RIR A;  5HKZ A;  4M75 C;  4B6M A;  2CP2 A;  3K2M A;  5A0L A;  3WVE B;  3I56 A;  4F7U A;  4OHH A;  2DRM A;  2DZ9 A;  1EX4 A;  2EL8 A;  2E5K A;  4E47 A;  3DLL A;  1NLO C;  2ZAE A;  2JYQ A;  4WWQ A;  5GMK i;  3OS1 A;  3G71 A;  1D4W A;  2A08 A;  1O49 A;  3HRS A;  5GMK j;  1P92 A;  4Z02 A;  2O9V A;  3VS0 A;  2EPD A;  5DLQ E;  1A0N B;  1VQ4 T;  4X34 A;  1RI0 A;  3CWG A;  2JS0 A;  2X4Y A;  4KUL A;  1A1E A;  1YJ9 T;  3TL0 A;  4MZT A;  2J05 A;  3NGP A;  3CCU A;  5D7U A;  4DEX A;  1M8M A;  4C5G A;  5GAN e;  1KSW A;  4PFP A;  2R5M A;  3CD6 A;  1YI2 T;  1VQ7 T;  2FPD A;  4WTO B;  4M75 D;  1N5Z A;  3FLG A;  4M78 E;  1ZQ1 A;  2L2P A;  2PQW A;  3HKS A;  4JUV A;  4PFO A;  1SPK A;  3HFO A;  1K9M C;  2XP1 A;  2FO0 A;  2LQN A;  1PM3 A;  3O5Z A;  2PZ1 A;  1TCE A;  4XTX A;  2HMA A;  2DTH A;  2DD5 A;  4DOW A;  2L6K A;  4JRP A;  1CWE A;  3JCM c;  1ZA1 B;  4M78 A;  4JZ4 A;  3MEV A;  2J6F A;  4EY0 A;  4M75 F;  4RTT A;  1K8A R;  1H9O A;  3CME T;  4C92 B;  4N4H A;  3QWX X;  2ABL A;  1CSZ A;  3MXY A;  1TZE E;  1WHK A;  4JS5 A;  2EQJ A;  5IBS A;  2HSE B;  3U23 A;  3JCM e;  3DB3 A;  3VRN A;  1I8F A;  4O6J A;  1WQ7 A;  5GAO r;  3VRP A;  1TOV A;  4M78 D;  3CME A;  3WA4 A;  3VS6 A;  1P13 A;  2AKL A;  2NYS A;  4E7H A;  1VQ6 Q;  1WHH A;  3ME9 A;  2EKX A;  3OBW A;  2CRE A;  3L1A A;  2PTK A;  3BUN B;  2CIA A;  4BE0 A;  1MIL A;  1NYG A;  4C8Q D;  4QVD A;  1AYB A;  1M2V B;  3C0C A;  3M0U A;  5FU6 B;  1M27 C;  3OB1 B;  1AD5 A;  4DGX A;  1CJ1 A;  2QDY B;  3CXC P;  4PJO E;  4HCC A;  1QCN A;  1M61 A;  4E93 A;  3CD6 T;  3OA6 A;  1MMN A;  1VQK Q;  1OUL A;  2EYZ A;  3OVE A;  1I1J A;  3EG1 A;  3CCL T;  5CO7 A;  2FG0 A;  1QWE A;  4HCK A;  1YWP A;  2ED0 A;  1BFI A;  2H3E B;  4JRK A;  3BUM B;  2XKO C;  1IRE B;  4C92 E;  1NPR A;  2DBM A;  4JE4 A;  1KHI A;  4L1B B;  3PS5 A;  1T3L A;  5GMK m;  3VS1 A;  1X01 A;  1VQ9 Q;  4PJJ A;  1R8O B;  1EIF A;  1JU5 A;  1C0M A;  2EGC A;  2BKD N;  4ZTJ A;  3E19 A;  3Q1J A;  1NRV A;  1R1S A;  1X27 A;  1AOJ A;  4C5E A;  2SEM A;  2VWF A;  1I07 A;  5LJ5 h;  2VVK A;  2XDD A;  1X6C A;  3OQ5 A;  3PE0 A;  4JJC A;  4PJO A;  1OYX A;  3QWY A;  4BB7 A;  5CK9 A;  2IIM A;  2A28 A;  2LRA A;  1XTD A;  4OB0 B;  3CC2 Q;  2ZGW A;  3MP8 A;  2GCX A;  1O4P A;  4BI8 B;  4XTY A;  3URG A;  2F69 A;  1TWB A;  2V8J A;  1H3H A;  4FIB A;  2XU8 A;  4A4H A;  2GBQ A;  2SHP A;  1Y96 A;  1BU1 A;  1O4G A;  1BCM A;  4TZI A;  5GAN 3;  1O47 A;  5FU6 C;  2JS2 A;  1BBZ A;  2KEA A;  4E7K A;  1FMK A;  3L2W A;  2F5K A;  2EJF A;  3QJ6 A;  2HMH A;  3EGX A;  4BDZ A;  3CEY A;  3V8J A;  2VKN A;  4IIO A;  3VGO A;  4J6X A;  2KNB B;  1KK7 A;  1PIC A;  2DER A;  2BTT A;  1Q81 C;  3CCQ A;  3G6E Q;  3QSU A;  1EZZ B;  2YSQ A;  3RMS A;  3C7I A;  2QDL A;  1HD3 A;  3FEO A;  2EQI A;  2RB6 A;  4ANJ A;  2QAS A;  1YVL A;  4PJO C;  4J9B A;  1OPL A;  3CCQ T;  4FM4 B;  1NJI R;  4K2R A;  4C5I A;  1H64 1;  2K2V A;  1O45 A;  1QP3 A;  2D8H A;  3JCM d;  3N7Y A;  1G3Y A;  3CBL A;  3EGX B;  4XTU A;  5GAO p;  2RN8 A;  4U17 A;  4CC2 A;  2DD4 A;  2KRN A;  1M1K C;  5GJI A;  2KRM A;  4WF2 A;  1ZUK A;  1VQ5 A;  2CUD A;  1JEG A;  4GPL B;  1G2B A;  2MMP A;  4PJO G;  1IO6 A;  2HKQ B;  4E7J A;  1YIT Q;  3QO3 A;  4FBN A;  3OS5 A;  4RUG A;  3P8H A;  2V1R A;  2KR3 A;  1LCJ A;  2E5Q A;  1OZ2 A;  2OTL A;  2CT3 A;  1U3O A;  5KCH A;  1KIK A;  5LJ3 h;  5HK3 A;  1ZSZ A;  1YIJ Q;  4Z88 A;  2GTJ A;  5C6S A;  4IUT A;  4P5N A;  2DEQ A;  3OYB A;  2KRO A;  1WQW A;  5IH2 A;  1X6B A;  2CP3 A;  5IN1 A;  2MCN A;  3FDR A;  1N27 A;  1VQ7 Q;  2AOB A;  3PQZ A;  4L5G A;  2E1H A;  1K9A A;  2RI5 A;  4A4E A;  2LNX A;  4M77 A;  2JJ9 A;  1T0H A;  4C8Q G;  3OS0 A;  5HY6 A;  4NS5 A;  2CZ0 B;  3CC4 A;  2WSF E;  5EHP A;  1ABO A;  5GAN 4;  2A0F B;  1FWZ A;  2MI6 A;  4M78 G;  3R6O A;  2RK1 A;  2H3J A;  1YJ9 Q;  3CCR Q;  2K5L A;  1Z9Q A;  2MF2 A;  4K45 A;  4M75 B;  2DIL A;  1JBM A;  4MMK A;  2ZPE B;  2EO3 A;  1D4T A;  1YHQ T;  3EH1 A;  3OMC A;  2QXF A;  3SFM A;  4ZGJ B;  4PJO F;  4F7U F;  1H8K A;  4M7A A;  2YRC A;  2IZV A;  3EFO A;  4AMC A;  3MHX A;  2E10 A;  3OYY A;  2AKK A;  3OMG A;  3HTR A;  2DL5 A;  2GGR A;  1SHB A;  3FC3 A;  1AWX A;  1G83 A;  4FSS A;  4PL6 A;  4OHL A;  3CC2 A;  5I21 A;  2IPO B;  3QDF A;  3C12 A;  1SEM A;  1JXM A;  4N4G A;  4M7A G;  3OYN A;  1SRL A;  4PJL A;  4GLK A;  8ATC B;  2YT6 A;  2E6N A;  3LH0 A;  3REA B;  3OYF A;  2OTJ A;  5I22 A;  3A8H B;  3EH2 A;  4HXJ A;  3JAM E;  3FRN A;  2MRK A;  1XNI A;  3CMA A;  2FRY A;  2KXD A;  4JRI A;  5DC4 A;  3L2Q A;  4A54 A;  1Y71 A;  5DM7 R;  4LDX A;  4M78 B;  2WSE E;  2ZPI B;  1TUG B;  2M02 A;  5GAM h;  1LJO A;  1YIJ T;  3VJP A;  2EOB A;  5KYY B;  4U1P A;  4XU2 A;  3UAT A;  2Y4X A;  2A36 A;  1O4R A;  3QPH A;  4RKU E;  3VU3 C;  5CQX A;  4PLL A;  4ZN3 A;  1H92 A;  1VQN T;  2GTO A;  1QG1 E;  4DOV A;  1CWD L;  1M3A A;  9ATC B;  1GCQ C;  1AOU F;  5FRO A;  3AT1 B;  5L8R E;  3GXX A;  1JB0 E;  2MWP A;  1F1W A;  4DBH A;  3X20 B;  2DVJ A;  5I2S A;  1D3B B;  3GIB A;  1WDX A;  2OZO A;  3TKZ A;  1YWO A;  2L3T A;  3FIF A;  4RG2 A;  1SHF A;  2R57 A;  1Q7Y U;  1O9S A;  2K6D A;  2K5F A;  1O4D A;  1IJR A;  1QVP A;  3QZ5 B;  4C0G A;  2DMO A;  2ZPF B;  5GAM e;  5GAO l;  3CCJ T;  4MZM A;  1HXD A;  1ZBJ A;  1OOT A;  1LPL A;  5KYN A;  3G4S T;  3CXC S;  1WIE A;  4HT8 A;  1K1Z A;  3EGD A;  1V29 B;  2MIO A;  1B34 B;  3I56 T;  1KQS A;  2CZ1 B;  1BKB A;  1Z3K A;  5CVI A;  1K0X A;  3VRZ A;  1AB2 A;  3LX7 A;  3LGF A;  4XAX B;  1PKS A;  2DL4 A;  2AIR B;  5GMK l;  1Y96 B;  2E65 A;  2X35 A;  2K3Y A;  4RTX A;  1XQH A;  2PVG B;  2F2X A;  2DLY A;  3T04 A;  2EQK A;  5FRN A;  4C0Z A;  5GAN g;  3CC7 Q;  3PNW C;  2YU7 A;  1Q7Y C;  2MRJ A;  1VQM T;  3UDC A;  3CCM A;  1QVF P;  2JXB A;  2DRK A;  3H6Z A;  2CSI A;  4ZNX A;  2KGT A;  1VA7 A;  1WYX A;  1A1B A;  2LJ0 A;  1N8R R;  2L3R A;  4ATO A;  2AOA A;  2O4X A;  2K2M A;  2DTO A;  2HAX A;  1QWF A;  2B86 A;  3CCJ A;  1SHA A;  2HQH A;  2E64 A;  3CBP A;  3L42 A;  2JZ2 A;  4M78 C;  4EMG A;  4BDY A;  3G71 Q;  1IRX A;  3BKB A;  1HCT B;  2OTL T;  1WXU A;  3CXL A;  1NBE B;  4N0A A;  4OMM A;  1U8R A;  3I56 Q;  1AYC A;  2DL3 A;  1K8A U;  3MET A;  2FL7 A;  4D8D A;  3M4Y A;  3JCM P;  3OB9 A;  5D6Y A;  2RM4 A;  1FYN A;  4OHI A;  1PWT A;  4LDW A;  5AUL A;  2EGA A;  1KD1 C;  5I6V A;  3E9G A;  1ZLM A;  2LRQ A;  5IXB A;  2ENM A;  5FWC A;  2MQI A;  4FYY B;  2ZPG B;  4FYV B;  1UG1 A;  4EIK A;  1AZE A;  3L2R A;  2VUB A;  3V7R A;  2XK0 A;  2RO0 A;  4RMO A;  4J83 A;  1BF5 A;  1ZA2 B;  2OTJ Q;  3CC4 T;  2DXT A;  2PU9 B;  2RI2 A;  4FT4 A;  1FMW A;  2EBP A;  3CC2 T;  1C1A A;  1X69 A;  1D3B A;  3CCS T;  2C0O A;  2V1Q A;  1ZSZ C;  2XD0 A;  3TVT A;  2DYI A;  1M3C A;  4PJM A;  5GAO q;  3JB9 I;  3CPW A;  3M9Q A;  3EFR A;  3GNG A;  1HYO A;  5CKD A;  4C92 A;  2RA2 A;  2BZY A;  3S8O A;  2V8K A;  3DLM A;  1OZ3 A;  3INZ A;  1SG5 A;  3CPF A;  3KXT A;  3CCL A;  1E6G A;  4OMF B;  3M0S A;  4M78 F;  2JM8 A;  1B3Q A;  2ZPH B;  2C06 A;  2KT1 A;  2DAQ A;  5KYX B;  4MML A;  1JRI A;  3LWH A;  2CS7 A;  2IVW A;  3ZBD A;  1QMC A;  4BI4 A;  2RVF A;  5LJ3 f;  3H9N A;  2L8D A;  3RNJ A;  2X4X A;  2EIF A;  1K73 R;  1U06 A;  1FXX A;  3I55 T;  1FMV A;  2OQ1 A;  2YSX A;  2Y1N A;  3G6E T;  2JT4 A;  4M75 E;  3X25 B;  3CCS Q;  2LDM A;  3CCR A;  1N8R U;  1VQK T;  4GLM A;  1GFD A;  2YLB A;  2IUH A;  3X24 B;  4E7L A;  3A98 A;  1NLP C;  1PSF A;  3CC4 Q;  5BO4 A;  2EJ9 A;  2OTJ T;  1R1Q A;  2EVR A;  2CYZ B;  5CKB A;  1VQ7 A;  3JB9 H;  2O88 A;  5IT9 E;  5HCK A;  1BIA A;  3OYA A;  1QQJ A;  2GQI A;  5KAZ A;  2J7I A;  2CT4 A;  1VQ4 A;  2B8A A;  3VRY A;  5DC9 A;  3A5Z B;  2JTE A;  1MGQ A;  2DXU A;  1TUC A;  5EG2 A;  1VQP A;  1WZO A;  1YIT T;  5LJ3 g;  3RER A;  4DBR A;  1H3Z A;  1S72 A;  2VAS A;  4X1V A;  1O48 A;  5M9O A;  3C4S A;  1QCO A;  4F7U B;  4C5H A;  4F04 B;  4H34 A;  1UGR B;  3HIZ B;  1K73 C;  4XU1 A;  3PIP A;  2CH4 A;  1X6O A;  4F7U E;  1V1C A;  4XTV A;  2Y1M A;  3BUO B;  1N9S A;  2QK0 A;  3VRO A;  5IBM A;  3NTH A;  1VYV A;  1SHD A;  2PNB A;  1VQN A;  4OMN A;  3G4S A;  1PC0 A;  2HD0 A;  1YHQ A;  1IHW A;  4VUB A;  2LNW A;  2OAW A;  2M0O A;  3EGD B;  1LUK A;  1BG1 A;  1FBZ A;  2DM0 A;  1YCY A;  2I2L A;  2VXE A;  2G6F X;  2ZCF B;  3T9N A;  4B9X A;  4B9W A;  4HKE A;  5CAI A;  1OV3 A;  1RPY A;  2DLZ A;  2QA4 A;  3CCU T;  3H41 A;  4IUR A;  2O31 A;  3E1S A;  1JYR A;  1NM7 A;  3QHS A;  2DVE A;  2DE0 X;  2K7A A;  4ME7 A;  4XZ1 A;  5FRM A;  1NJI C;  3M7F A;  1BI1 A;  4JEG A;  1AWJ A;  1AYD A;  1X43 A;  4IUP A;  3LH5 A;  1O41 A;  2RJE A;  1ZUU A;  1EFN A;  1SF9 A;  2KT8 A;  1D0X A;  2C9W A;  4KGV B;  5D6W A;  2CZ6 B;  2E70 A;  3OY9 A;  1SKJ A;  2FVU A;  4F5B A;  1UE9 A;  3VYH B;  1N8R C;  1KC8 R;  4RTZ A;  2ROT A;  2VB6 A;  1D1C A;  4LE9 A;  2AK5 A;  1LUM A;  1IXD A;  4RTU A;  1O46 A;  5KYY A;  1NE8 A;  3G4S Q;  1LUI A;  1VQN Q;  4QT7 A;  5KYX A;  3CMA T;  1JWO A;  4JGH A;  4OB1 B;  1KQ1 A;  5CIU A;  1AZG B;  3JB9 G;  4E7I A;  4C0D C;  2VIF A;  5EG3 B;  3AHU A;  1YI2 A;  1WGS A;  1O4H A;  3NTK A;  2JMC A;  4OB3 B;  2GNC A;  4EMH A;  3MAZ A;  1ZHI A;  1VUB A;  2X4J A;  4LDU A;  5LJ5 g;  3A1P A;  4DBF A;  4KUI A;  3M0P A;  3QXE B;  3JCM J;  1O4C A;  2COY A;  3HHT B;  1PD1 A;  3QBY A;  4K44 A;  5CCA A;  4R0K A;  3FJ5 A;  1KG1 A;  2CRH A;  1SPR A;  4JZ3 A;  2MYS A;  7AT1 B;  4FYW B;  5KH6 A;  1VQM A;  3PGG A;  2EGE A;  1ZX6 A;  4OMO A;  2ROR A;  2PUK B;  3OP0 A;  5GAM g;  1GFC A;  3EGU A;  4ESR A;  3K2T A;  1VQL A;  2BE9 B;  1O4M A;  2FZK B;  2E4H A;  2FZC B;  2LZ6 B;  4LD9 K;  5GAN d;  3A8O B;  4FT2 A;  2LX7 A;  2EU0 A;  1BCO A;  1YJW T;  1MNE A;  2E12 A;  4LD6 A;  3CCS A;  2X51 A;  3OYE A;  5J3B A;  2V26 A;  3VS7 A;  2IUI A;  1O75 A;  2DZC A;  1NJI U;  1M1K U;  1VQK A;  1O4A A;  4JLI A;  4O5V A;  3BE3 A;  1V76 A;  1T3S A;  3EAC A;  1IS0 A;  1MUZ A;  5GAN 8;  4J6W A;  1K8A C;  1R77 A;  2EKO A;  3EFO B;  1SRM A;  1I4K 1;  1ABQ A;  2QYZ A;  5CKF A;  1YFN A;  3D7S B;  3ASK A;  2CI8 A;  1DJ7 B;  3KBG A;  2LCL A;  2K79 B;  1OEB A;  4E7Z A;  1D0Y A;  4GL9 E;  4CI0 C;  3M58 A;  4LUD A;  4FCY A;  3ZL7 C;  4F16 A;  4FU6 A;  1LCK A;  1M1F A;  1UFF A;  3N5B B;  1A1A A;  2O01 E;  3OYJ A;  2QEX A;  4QSY A;  4C0D B;  4ZN1 A;  3JSC A;  2Y4Y A;  4M77 D;  1M2O A;  3RMQ A;  1QVG S;  2H5K A;  3CME Q;  2C0I A;  4X9D A;  1O4F A;  4A53 A;  3HSB A;  5GMK h;  2LQ8 A;  4N4I A;  2XIC A;  4XU3 A;  3S3N A;  1W4S A;  2DX1 A;  2QA4 T;  4Z89 A;  4OML A;  4XK8 E;  2RMO A;  2HL3 A;  4IUV A;  1HCS B;  3ER0 A;  1N6A A;  4ELY C;  4XU0 A;  2D1X A;  3HCK A;  2P4R A;  1W2B A;  1D09 B;  5HKW A;  5KYU A;  3V7C A;  1O4B A;  4GY5 A;  3TRE A;  4C8Q E;  2QI2 A;  2J06 A;  1I81 A;  5EEL A;  3C95 A;  4A4G A;  1C6V X;  2FYK A;  2EWN A;  1YJW Q;  2PVO B;  1QVG A;  5LJ3 j;  4M7A B;  3RKY A;  4QVC A;  1IB8 A;  5LJ3 d;  2BIV A;  1RAC B;  3CC7 T;  1VQO Q;  1PCX A;  1A07 A;  2CKK A;  5EEQ A;  1LVK A;  1VQ6 T;  1TH7 A;  3MEA A;  2RHY A;  3VKI A;  4P9Z A;  4F7U G;  1AEY A;  3CD3 A;  2X3W D;  3RKW A;  3CCU Q;  3H0F A;  2FCI A;  3TSW A;  4AFS C;  3M5A A;  1UHC A;  1W70 A;  4JJN K;  2ESW A;  5CDW A;  2YUN A;  2IUG A;  3CCJ Q;  3UPU A;  2RD1 A;  1FYR A;  3QYH B;  3O8V A;  3OS2 A;  1BKL A;  4IUQ A;  5A0D A;  2K5I A;  2HBP A;  2HQX A;  4F14 A;  2K79 A;  2DET A;  2RMX A;  1BK2 A;  1N9R A;  5IXF A;  2RNA A;  5CR2 A;  1VQO A;  1SPS A;  1JQQ A;  1I0C A;  1ZSG A;  2ROL A;  1UB4 A;  3CCE Q;  3QDR B;  1SSF A;  1BI0 A;  1RLP C;  3G7Z A;  1G8X A;  1Y57 A;  1Q7Y R;  2KRS A;  2QQ9 A;  1O43 A;  3EG9 B;  3QG1 A;  4CC4 B;  1UTI A;  2VYT A;  1WFW A;  1F1B B;  1KC8 U;  1YJN Q;  4FW1 A;  2XG8 D;  2KY9 A;  2XHC A;  3GF5 A;  3SDZ A;  1O42 A;  3PFS A;  4ZTF A;  4N0A C;  2MK2 A;  2KI7 A;  4M75 G;  2HEQ A;  1F2F A;  2KAF A;  1K9M U;  2QQA A;  2JUF A;  1M90 U;  3BY7 A;  2DXB A;  2AZV A;  1W2B P;  2LJ3 A;  1WPY A;  4XTW A;  1O4N A;  2VXF A;  1GXI E;  4KGX B;  1PRM C;  1ARK A;  1R0B G;  5GAN h;  2EYY A;  2RI3 A;  2VV5 A;  1R1P A;  5DY9 A;  4E6R A;  3LYV A;  3V8L A;  2OJ2 A;  2RHU A;  1UGP B;  2QTX A;  3JCM V;  2AHJ B;  1TS9 A;  3R6N A;  4KH1 B;  1Q82 C;  5KCO A;  2FPF A;  4XQ3 A;  5DLO A;  2AZS A;  3DB4 A;  3OW2 P;  3QJY A;  1X0N A;  3OB2 B;  1RL2 A;  1JXO A;  3EHR A;  3I5S A;  1VQP T;  1JYU A;  3VRR A;  1BI3 A;  4E68 A;  4LDV A;  2HUW A;  3CBO A;  4A63 B;  3BDU A;  2YUO A;  3PMT A;  2DX0 A;  2LCC A;  4EMK A;  2ECZ A;  5DF6 A;  1PHT A;  5FLX E;  2DM1 A;  1U5S A;  1FU6 A;  4J7I A;  2HNI A;  1XOV A;  2Z0W A;  2CBL A;  3M56 A;  1I5O B;  2DA9 A;  4PJO B;  5IHK A;  3OBY A;  3BW1 A;  2RK2 A;  3J80 E;  4Q5W A;  1VQL Q;  1MHN A;  2NUP B;  2RF0 A;  4HVU A;  1BHH B;  1GRI A;  2BBU A;  2K7A B;  1JJ2 S;  5CQY A;  2O4X B;  1KQS S;  1PNJ A;  4D8K A;  2JOY A;  2M51 A;  3BDL A;  1M27 A;  3GP8 A;  4RTV A;  4CC7 A;  5J3X A;  1VQ8 A;  2D6F A;  4AFQ C;  5KE2 A;  1GHU A;  4A4F A;  2P0K A;  1AVZ C;  4BY6 C;  3X28 B;  3P8B B;  2AUG A;  1PKT A;  3FB9 A;  4M7D A;  2PNA A;  2JM9 A;  2KQW A;  1M3B A;  3JCM f;  4A4B A;  3VUB A;  3E9F A;  2PUO B;  4F17 A;  2RJF A;  2X9H A;  3CCE T;  3MKD A;  2ZZD A;  4AFU C;  1RAA B;  1CKB A;  3J81 E;  1NG2 A;  4HVV A;  2X4W A;  3PSK A;  3M0Q A;  1G3S A;  4M7A F;  3ZEH A;  3VS2 A;  2RQU A;  5GAM j;  3TU4 K;  3REB B;  2DLP A;  5GAM d;  1WA7 A;  4J9H A;  2LCS A;  1AYA A;  3JCM b;  4OF1 A;  3VRQ A;  1M2V A;  3S3M A;  3IN8 A;  1RI9 A;  4RTW A;  3P8D A;  4RCB A;  1KQS P;  1QW1 A;  4M7D G;  5GJW B;  3NHN A;  1QCF A;  3WXM B;  1RAF B;  4M7D F;  3JRZ A;  1UUS A;  1CSK A;  4D6W A;  4QKU A;  4Z8A A;  3C94 A;  3PJP A;  3VS4 A;  5AXI A;  3QKJ A;  3IQL A;  1YJ9 A;  4L59 A;  2DYB A;  4OGC A;  3EFS A;  4KH0 B;  3GXW A;  1J3T A;  1Q81 U;  2ETZ A;  2P0P A;  1RUW A;  1WJQ A;  1NYF A;  3L2V A;  1BLK A;  4CRI A;  4F59 A;  1JO8 A;  4M7D D;  2NLU A;  3UF4 A;  1VYU A;  1M9S A;  4M77 C;  5HKY A;  3CPW S;  2MOX A;  3JCM X;  3QZ9 B;  4Y92 A;  1RAI B;  3CQT A;  2YDL A;  3I55 A;  2QGG A;  8AT1 B;  2MPX C;  1RAD B;  4LNP A;  2OTL Q;  2KE9 A;  4UC4 A;  2ECD A;  4JRQ A;  2CR4 A;  3GBQ A;  5GAM f;  2EYW A;  1VQ5 Q;  2EQM A;  5J39 A;  1M1K R;  2DK3 A;  1QP2 A;  1YN8 A;  1WLP B;  3QII A;  4OB2 B;  2NUZ A;  2EO6 A;  1S72 Q;  2L3Q A;  4BAC A;  1VQP Q;  4M7A C;  4HCZ A;  4II1 A;  2HBW A;  1GBR A;  4PJO D;  5KYU B;  2FRW A;  3MEU A;  4M75 A;  1VQ4 Q;  1G3W A;  3OYL A;  3BUX B;  1UGV A;  4IKF A;  2L5Q A;  2F2V A;  4E2F B;  2CI9 A;  2QQB A;  5A2Q E;  2MAM A;  1GCQ A;  2LP5 A;  4M7D C;  5J26 A;  2FPE A;  2L89 A;  3E2U A;  1A81 A;  2RQR A;  1B47 A;  3CCQ Q;  2CP0 A;  2DF6 A;  1BHH A;  2E41 A;  1SKU B;  5HKC A;  1AOT F;  4C8Q A;  5LJ5 e;  1BYM A;  2DKG A;  1O4L A;  3MPU B;  1UJY A;  1U1S A;  5D0J A;  1Y7X A;  1TG0 A;  3MP6 A;  3RES A;  1UEB A;  4BE2 A;  4EMK B;  2J6O A;  1NZV A;  2HDA A;  1MV0 B;  5EC7 A;  4IIM A;  4R55 A;  2NUT A;  4ZGE B;  1QVF S;  2EYV A;  4KRT A;  1UEC A;  3A8M B;  1RJA A;  1VOM A;  4M77 F;  1Q82 R;  4J9D A;  4JPB W;  3CCL Q;  2RHI A;  2KVQ G;  2VC8 A;  1KD1 U;  3CCV Q;  5GAN j;  4AFZ C;  2LMJ A;  1WXT A;  2YXY A;  3S3O A;  1W6X A;  1A08 A;  2F5T X;  4J9E A;  1MW4 A;  2RPN A;  5IHI A;  2W10 A;  2J6K A;  3RUX A;  1MMA A;  1IZ6 A;  1RAH B;  2GE9 A;  2DL7 A;  3SWN A;  2D0Q B;  4PK4 A;  3M4G A;  2CP6 A;  3PLF B;  1GCP A;  3UYO A;  1X2Q A;  4M77 B;  5LJ5 d;  5AYF A;  1VQ8 Q;  1XA6 A;  2XID A;  3OYC A;  1A09 A;  1Y1U A;  2HDV A;  2NWM A;  1QKW A;  4LXC A;  2KNO A;  1VIF A;  3H8Z A;  1TTH B;  1T0J A;  1SSH A;  1Q81 R;  5GAN 5;  2EYX A;  2JNG A;  3I35 A;  2EFI A;  2JN0 A;  3VS3 A;  4OGE A;  4OVA A;  4A4K A;  3HRT A;  2EW3 A;  4M77 G;  2P0Q A;  3TSZ A;  4RTY A;  4OHD A;  3V7S A;  5GJV B;  2M9U A;  2VGN A;  1K73 U;  1CKA A;  2XDP A;  1UUR A;  2FHD A;  3G1J A;  3EG9 A;  5GAO n;  3MCA B;  4YTL A;  3CCR T;  1VIE A;  2JTF A;  2FB7 A;  2KYM A;  4ROJ A;  2L0A A;  1PG5 B;  2O9S A;  5CKE A;  2MWO A;  1VQ5 T;  2VGM A;  1RAB B;  1HK9 A;  3JB9 D;  2CH4 W;  2KGY A;  4FYX B;  2YHT A;  2RJC A;  4C0F A;  2RQV A;  4JLG A;  3A8L B;  2COW A;  5GJH A;  4C92 D;  1XJW B;  4QQG A;  5GAN 7;  2EKH A;  1KHC A;  1WI7 A;  3LYI A;  1VQ6 A;  3HPW A;  5EHR A;  4PFZ A;  3UWN A;  5LJ3 e;  3PVQ A;  3I5R A;  1M90 R; 
#chains in the Genus database with same CATH homology
 3PVL A;  3K2M A;  1SHF A;  1RQQ C;  2K6D A;  1O4D A;  1IJR A;  4OHH A;  1FBV A;  1YCS B;  5FWB A;  2DMO A;  2DRM A;  1A07 A;  5EEQ A;  2XMF A;  1E7O A;  1K4U S;  1AWW A;  1ZBJ A;  2E5K A;  2EL8 A;  4P9Z A;  1NLO C;  2JYQ A;  1OOT A;  4NWG A;  4WWQ A;  1AEY A;  3CD3 A;  2X3W D;  4F5A A;  1WIE A;  1K1Z A;  2K9G A;  2MIO A;  1D4W A;  1Z3K A;  3H0F A;  1KJW A;  2FCI A;  3N8M A;  2A08 A;  1K0X A;  3VRZ A;  1O49 A;  2L3P A;  3TSW A;  2CS0 A;  4AFS C;  1AB2 A;  5ECA A;  1UHC A;  3VS0 A;  1PKS A;  1W70 A;  2O9V A;  2EPD A;  2DL4 A;  2LJ1 A;  1A0N B;  2ESW A;  5CDW A;  2YUN A;  2PLE A;  2IUG A;  1O4I A;  3CWG A;  2JS0 A;  4X6S A;  4RTX A;  4K11 A;  1A1E A;  1FYR A;  4XZ0 A;  3TL0 A;  3EG2 A;  1W1F A;  2F2X A;  1BMB A;  2J05 A;  2DLY A;  3T04 A;  3NGP A;  2L3S A;  1BKL A;  4DEX A;  1M8M A;  1K0S A;  2B3O A;  2SRC A;  2YU7 A;  5I11 A;  2MRJ A;  1KSW A;  4F14 A;  2K79 A;  1O4O A;  1BLJ A;  2RMX A;  2DNU A;  1BK2 A;  2JXB A;  2DRK A;  2CSI A;  5IXF A;  2DCR A;  2RNA A;  3EG0 A;  3ZNI A;  4ZNX A;  2FPD A;  2KGT A;  1JQQ A;  1SPS A;  1BFJ A;  1I0C A;  1VA7 A;  1ZSG A;  2ROL A;  1N5Z A;  1WYX A;  2L2P A;  1RLP C;  1A1B A;  2LJ0 A;  1YNZ A;  1SPK A;  4P9V A;  1Y57 A;  5IHN A;  3S8L A;  2XP1 A;  1QKX A;  2KRS A;  2AOA A;  2FO0 A;  1I3Z A;  1O43 A;  3GQI B;  1NZL A;  4CC4 B;  2K2M A;  1UTI A;  2LQN A;  3HHM B;  3O5Z A;  2PZ1 A;  1TCE A;  1QWF A;  1WFW A;  2B86 A;  1SHA A;  3PFV A;  2L6K A;  1CWE A;  4JZ4 A;  2M0Y A;  1HSQ A;  4EIH A;  2H46 E;  2J6F A;  4EY0 A;  1OO3 A;  1H9O A;  4RTT A;  3BKB A;  1O42 A;  1HCT B;  4J9I A;  2C0T A;  3QWX X;  2ABL A;  1CSZ A;  3MXY A;  1TZE E;  1WXU A;  2MK2 A;  5IBS A;  3U23 A;  2HEQ A;  3NMZ C;  1F2F A;  3CXL A;  3VRN A;  4OMM A;  4A4C A;  1AYC A;  2DL3 A;  3VRP A;  2AZV A;  3M0R A;  2LJ3 A;  1O4N A;  4D8D A;  3WA4 A;  3VS6 A;  1P13 A;  2AKL A;  2MC1 A;  1PRM C;  2W0Z A;  1ARK A;  2EYY A;  4OHI A;  1FYN A;  1PWT A;  2EKX A;  2CRE A;  5AUL A;  2EGA A;  1R1P A;  1O4J A;  2PTK A;  1MV3 A;  4E6R A;  3BUN B;  1ZLM A;  5I6V A;  1HJD A;  5IXB A;  2CIA A;  1MIL A;  2ENM A;  5FWC A;  2MQI A;  1NYG A;  3THK A;  4GBQ A;  2Y3A B;  1AYB A;  2OJ2 A;  3C0C A;  3M0U A;  2HSP A;  3ULR B;  1M27 C;  1UG1 A;  4EIK A;  1KC2 A;  1AD5 A;  3OB1 B;  1FHS A;  3R6N A;  1AZE A;  4JJD A;  1JYQ A;  1BF5 A;  5L23 A;  2JW4 A;  1WXB A;  4DGX A;  1CJ1 A;  2FPF A;  2EBP A;  1M61 A;  1LKK A;  2AZS A;  4E93 A;  1X0N A;  3OB2 B;  3RBB B;  4J9G A;  1M30 A;  1UUE A;  1JXO A;  3EHR A;  3I5S A;  1JYU A;  3VRR A;  4E68 A;  1X69 A;  2HUW A;  2C0O A;  2EYZ A;  2V1Q A;  3OVE A;  3TVT A;  4A63 B;  1I1J A;  1M3C A;  3EG1 A;  3JV3 A;  2FG0 A;  2YUO A;  3VS5 A;  2DX0 A;  1QWE A;  4HVW A;  2ECZ A;  5DF6 A;  1PHT A;  4HCK A;  1YWP A;  2DM1 A;  1U5S A;  2ED0 A;  1FU6 A;  1BFI A;  2BZY A;  3BUM B;  2DBM A;  3S8O A;  4JE4 A;  1XOV A;  2GSB A;  1YVH A;  2CBL A;  3PS5 A;  4L1B B;  1T3L A;  1OO4 A;  3VS1 A;  2DA9 A;  5IHK A;  1JU5 A;  1E6G A;  2RQT A;  3M0S A;  2EGC A;  2JM8 A;  2RF0 A;  4HVU A;  1BHH B;  3S8N A;  1GRI A;  2BBU A;  1B3Q A;  1B07 A;  1NEB A;  2K7A B;  1NRV A;  1R1S A;  1X27 A;  2KT1 A;  1AOJ A;  1BKM A;  2SEM A;  1PNJ A;  2VWF A;  4D8K A;  2M51 A;  1M27 A;  1I07 A;  2VVK A;  4RTV A;  4CC7 A;  1QAD A;  1X6C A;  5J3X A;  2RVF A;  4AFQ C;  3PE0 A;  4JJC A;  1GHU A;  3RNJ A;  2LQW A;  3QWY A;  1U06 A;  1AVZ C;  4JJB A;  2AUG A;  2IIM A;  1PKT A;  2CDT A;  2A28 A;  2OQ1 A;  2YSX A;  2Y1N A;  2PNA A;  2JT4 A;  1LUN A;  2JM9 A;  4GLM A;  1M3B A;  4A4B A;  1GFD A;  2DL8 A;  3PSJ A;  2IUH A;  4DGP A;  3A98 A;  1O4P A;  1NLP C;  4LUE A;  4F17 A;  5BO4 A;  1LKL A;  1H3H A;  1R1Q A;  2EVR A;  1UJ0 A;  4AFU C;  2GBQ A;  2L4K A;  2SHP A;  1CKB A;  3EAZ A;  1BU1 A;  1NG2 A;  4HVV A;  1O4G A;  4TZI A;  1O47 A;  2QMS A;  3PSK A;  3M0Q A;  1NEG A;  2JS2 A;  2O88 A;  1BBZ A;  2RQU A;  2KEA A;  3VS2 A;  1FMK A;  5HCK A;  3REB B;  2DLP A;  1WA7 A;  4J9H A;  2LCS A;  2PLD A;  2GQI A;  5KAZ A;  1AYA A;  2J7I A;  2CT4 A;  3VRQ A;  3S9K A;  3VRY A;  3IN8 A;  1RI9 A;  2LNH B;  4RTW A;  1TUD A;  1WX6 A;  3H0I A;  2FEI A;  5DC9 A;  2JTE A;  1TUC A;  5GJW B;  2HMH A;  3NHN A;  1QCF A;  1UUS A;  4X1V A;  1CSK A;  1O48 A;  2D0N A;  2VKN A;  4IIO A;  4GWF A;  4Z8A A;  3PJP A;  3VGO A;  4H34 A;  3VS4 A;  5AXI A;  3IQL A;  3HIZ B;  2KNB B;  2DYB A;  2CH4 A;  2DJQ A;  1PIC A;  2CSQ A;  2K3B A;  1V1C A;  2BTT A;  2Y1M A;  3BUO B;  1UDL A;  3GXW A;  2JMA A;  2YSQ A;  1J3T A;  3VRO A;  2ETZ A;  5IBM A;  3C7I A;  1RUW A;  2QDL A;  1VYT A;  1VYV A;  1SHD A;  1HD3 A;  1NYF A;  2PNB A;  4OMN A;  1BLK A;  4F59 A;  1ZFP E;  2EQI A;  1JO8 A;  1GBQ A;  4OHE A;  3EG3 A;  1YVL A;  4J9B A;  3UF4 A;  1OPL A;  2LNW A;  2D8J A;  2OAW A;  1LUK A;  1BG1 A;  1FBZ A;  1VYU A;  4K2R A;  2DM0 A;  1O45 A;  2D8H A;  3N7Y A;  2G6F X;  3CBL A;  2BZ8 A;  5HKY A;  2MOX A;  1OV3 A;  4Y92 A;  1RPY A;  2RN8 A;  3CQT A;  4U17 A;  2DLZ A;  4CC2 A;  2KRN A;  4AG1 C;  5GJI A;  1A1C A;  3H41 A;  2O31 A;  1BHF A;  2YDL A;  1JYR A;  1NM7 A;  2KRM A;  2DE0 X;  2K7A A;  4LNP A;  1ZUK A;  1JEG A;  2CUD A;  2KE9 A;  4GPL B;  1G2B A;  4XZ1 A;  2ECD A;  1IO6 A;  3M7F A;  4FBN A;  4RUG A;  2CR4 A;  1Y0M A;  2V1R A;  3GBQ A;  4JEG A;  2KR3 A;  1LCJ A;  1AWJ A;  1AYD A;  1X43 A;  3LH5 A;  1O41 A;  1ZUU A;  1EFN A;  2EYW A;  2KT8 A;  2C9W A;  2CT3 A;  2I0N A;  1YN8 A;  1U3O A;  2F2W A;  1WLP B;  1SKJ A;  1X2K A;  2NUZ A;  2EO6 A;  4F5B A;  1KIK A;  3OV1 A;  3IN7 A;  2L3Q A;  1UE9 A;  3SHW A;  2KYB A;  2HBW A;  4RTZ A;  1GBR A;  4FL2 A;  4Z88 A;  2GTJ A;  2FRW A;  2ROT A;  2YUP A;  1S1N A;  1KA6 A;  3BUX B;  1UGV A;  1D1Z A;  2KRO A;  5IH2 A;  2KBT A;  2F2V A;  4LE9 A;  1X6B A;  2AK5 A;  1LUM A;  2CI9 A;  1YP5 A;  2ED1 A;  4RTU A;  1O46 A;  2MCN A;  4AG2 C;  1GCQ A;  2AOB A;  1O4E A;  3PQZ A;  1LUI A;  2LP5 A;  1K9A A;  4QT7 A;  3SEM A;  2LNX A;  1T0H A;  2FPE A;  3UA7 A;  1JWO A;  4JGH A;  2HDX A;  1AZG B;  1A81 A;  1AWO A;  2RQR A;  5EHP A;  1B47 A;  2VIF A;  5DC0 B;  5EG3 B;  1ABO A;  2DF6 A;  1BHH A;  1O4H A;  1BM2 A;  2JMC A;  1X6G A;  2GNC A;  1AOT F;  3MAZ A;  1K76 A;  1O4L A;  1OPK A;  1UJY A;  1Z9Q A;  5D0J A;  3M0P A;  1ZUY A;  1KFZ A;  1O4C A;  5FW9 A;  4K45 A;  2DIL A;  1TG0 A;  2HCK A;  4K44 A;  3NPF A;  2EO3 A;  1D4T A;  3IMD A;  2J6O A;  1NZV A;  2HDA A;  4R0K A;  1MV0 B;  1Z9Z A;  3FJ5 A;  2CRH A;  1SPR A;  2CUB A;  4JZ3 A;  4IIM A;  5EC7 A;  2DBK A;  1FU5 A;  1KA7 A;  2KK6 A;  1H8K A;  3US4 A;  2EYV A;  4KRT A;  1UEC A;  2IZV A;  1RJA A;  2EGE A;  1ZX6 A;  4OMO A;  2ROR A;  4CC3 A;  3OP0 A;  1GFC A;  3EGU A;  4ESR A;  4ORZ A;  4J9D A;  4JPB W;  4NWF A;  2H8H A;  1O4M A;  1O4Q A;  2AKK A;  4AFZ C;  1QLY A;  2LZ6 B;  1WXT A;  2DL5 A;  2LMJ A;  1W6X A;  2GGR A;  1A08 A;  1SHB A;  4J9E A;  2BZX A;  4J9F A;  1MW4 A;  2RPN A;  3KFJ A;  5IHI A;  2W10 A;  2J6K A;  2LX7 A;  1AWX A;  1O44 A;  2EU0 A;  4WCI A;  1G83 A;  4FSS A;  4OHL A;  4H1O A;  2RSY A;  2GE9 A;  1BB9 A;  2DL7 A;  2X3X D;  3N84 A;  3VS7 A;  1SEM A;  1JXM A;  3PLF B;  2IUI A;  1GCP A;  3IMJ A;  3UYO A;  1X2Q A;  1O4A A;  1SRL A;  1XA6 A;  2PNI A;  1T3S A;  1UHF A;  3M0T A;  3EAC A;  1A09 A;  1IS0 A;  1MUZ A;  1Y1U A;  2HDV A;  2NWM A;  2YT6 A;  3REA B;  1SRM A;  1QKW A;  1ABQ A;  2KNO A;  5I22 A;  2CI8 A;  1T0J A;  1SSH A;  1CSY A;  4OMQ A;  4HXJ A;  2A37 A;  2EYX A;  2K79 B;  2MRK A;  3I35 A;  4M4Z A;  3VS3 A;  4J9C A;  1OEB A;  3H0H A;  2FRY A;  2KXD A;  5DC4 A;  1RLQ C;  4GL9 E;  4LUD A;  1E6H A;  3ZL7 C;  4F16 A;  2EW3 A;  1LCK A;  1SHG A;  1UFF A;  2KXC A;  3TSZ A;  1A1A A;  4RTY A;  3UA6 A;  4OHD A;  5GJV B;  4QSY A;  1CKA A;  1O4K A;  2H5K A;  1UUR A;  2C0I A;  1O4F A;  3KFV A;  3I9Q A;  4DEY A;  2DX1 A;  4Z89 A;  2RQW A;  4OML A;  2RMO A;  2KYM A;  2EOB A;  2L0A A;  4ROJ A;  4U1P A;  3UAT A;  1O4R A;  2A36 A;  2O9S A;  1HCS B;  1GL5 A;  1PRL C;  1H92 A;  2D1X A;  3HCK A;  2LCT A;  2P4R A;  5HKW A;  2GTO A;  2CH4 W;  2O2O A;  1O4B A;  1QG1 E;  1CWD L;  2YUQ A;  1M3A A;  2RQV A;  1WQU A;  3EHQ A;  4OMP A;  3MXC A;  2J06 A;  1GCQ C;  5EEL A;  5GJH A;  1AOU F;  3BUW B;  2OI3 A;  3GXX A;  1F1W A;  2EKH A;  1JU5 C;  2DVJ A;  1WI7 A;  4FL3 A;  4LN2 A;  5HKZ A;  5EHR A;  1WDX A;  2OZO A;  3TKZ A;  1YWO A;  2L3T A;  3PVQ A;  3I5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...