4M4ZA

Sh3 and sh2 domains of human src-like adaptor protein 2 (slap2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
152
Chain Sequence
TAVALGSFPLSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Src-like-adapter 2
publication title Crystal structure of Src-like adaptor protein 2 reveals close association of SH3 and SH2 domains through beta-sheet formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 152
sequence length 158
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4m4zA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4m4zA02
1V1CA 2L6KA 1A1AA 3OP0A 1J3TA 3PJPA 4U1PA 2YUNA 3BUOB 3CD3A 1N5ZA 1T0HA 2AK5A 2PLDA 4IIOA 2LQNA 3IMJA 1SSHA 3PSJA 1NRVA 3IQLA 1G83A 1FYNA 3JV3A 1BBZA 4F59A 1UJYA 2ENMA 2DLYA 1ARKA 4JEGA 2RQWA 1SRLA 1BFIA 2FPFA 4H1OA 2CUBA 1GFDA 3VRRA 2L4KA 2L0AA 2DA9A 4D8DA 4RTUA 1K9AA 1UHFA 1CWEA 1Y1UA 1WA7A 3M0RA 2LJ1A 4CC4B 1X0NA 1JXOA 1WXUA 4J9CA 1YP5A 4Z88A 5I22A 3PSKA 2YUPA 1X6GA 1SKJA 4ROJA 4A4CA 1VYVA 4J9IA 2BZ8A 3EACA 1FHSA 4FBNA 1LCKA 2FPEA 4J9FA 3GBQA 5IHKA 1YVHA 2IUGA 2DRKA 2GNCA 1X2QA 2CSQA 4WCIA 3IMDA 5HKYA 2DILA 2K3BA 2O9VA 2O9SA 1UGVA 2AOBA 3K2MA 2HCKA 3ULRB 2JT4A 2CRHA 4QSYA 1AOUF 4IIMA 5ECAA 1TUCA 2DBKA 2KT8A 4KRTA 4Z8AA 4RTTA 2KROA 1UTIA 1NZVA 2YUOA 1K0XA 4OHIA 2HMHA 1BK2A 1O4FA 1BLJA 1UG1A 2BZYA 3US4A 3REBB 1M61A 1NZLA 3QWXX 3EG2A 5EELA 1CKAA 1UJ0A 3NHNA 3VRQA 1BF5A 1O4CA 1CKBA 1X6BA 3VRPA 4EIKA 1BG1A 2K9GA 3SEMA 1FBVA 1QWEA 2LCSA 1NEGA 2D1XA 3GXWA 3KFVA 1ZFPE 1I1JA 2EKXA 2MIOA 1GCPA 3A98A 1BKMA 1XA6A 2CREA 2KK6A 3CXLA 1FU5A 3HCKA 3M7FA 1Y57A 2LP5A 3OB2B 2M0YA 3T04A 2RPNA 2F2WA 2F2XA 4AG1C 2AZSA 3OB1B 1BKLA 1O4EA 2DX1A 2KEAA 3N7YA 2ED0A 3UATA 1GL5A 4J9HA 2L3SA 5EHRA 2JYQA 2MOXA 1SEMA 1KIKA 2RORA 5IXFA 2VWFA 3GQIB 1AYCA 2C9WA 1YVLA 2CR4A 2DL7A 3PVLA 4RTZA 2YUQA 2QMSA 2HDXA 5I11A 1RLPC 1O4KA 5KAZA 1X6CA 4F5AA 1OOTA 2C0IA 1PICA 5GJVB 4RTVA 1O42A 3VRNA 1O49A 3LH5A 3M0QA 1AWJA 1MV0B 4LUEA 4XZ0A 2EVRA 1PRMC 2MCNA 2CIAA 2JMAA 2CUDA 2XP1A 1CSKA 3SHWA 3M0TA 3M0SA 2A28A 1R1SA 1UUEA 4ZNXA 1OO3A 1OPLA 2FO0A 1AYAA 1UE9A 1D4WA 2OJ2A 2MRKA 3I35A 2B86A 4OMLA 2RQRA 1M3CA 2P4RA 1GFCA 2OAWA 3MAZA 1O4JA 3H41A 2JS0A 1WDXA 3BKBA 3M0UA 1F1WA 3BUMB 5IBSA 2KBTA 2Y3AB 4J9BA 2MK2A 2K7AA 2IUHA 2EKHA 2EU0A 1AB2A 1NYFA 1UDLA 2JMCA 3HIZB 1YNZA 4F17A 3MXYA 4FL3A 3EG3A 2KRSA 1D4TA 1O4MA 3CWGA 4E6RA 2FRWA 5GJIA 1GHUA 4K44A 4X6SA 1E6GA 1YWOA 1SHDA 5DC4A 2LNHB 4JJCA 1A09A 1ABOA 1I0CA 4RTYA 2C0TA 4CC3A 1QKXA 1AZGB 1O44A 1WXTA 1W70A 3U23A 1WI7A 4GBQA 1X27A 4AFQC 2GGRA 2LQWA 3H0IA 2KRNA 1K76A 2DVJA 2RF0A 1R1PA 1LUIA 1A1BA 4AFZC 1O45A 1AVZC 1W6XA 2EYYA 2RQUA 2DYBA 1NM7A 4Y92A 4DEXA 1I3ZA 1O4AA 2LNXA 1CWDL 1YWPA 1RUWA 3EG0A 1AYBA 2SEMA 2JXBA 2EL8A 2DNUA 2JM8A 4K2RA 2V1RA 4EY0A 1RI9A 2YT6A 2DE0X 1MV3A 1YCSB 3C0CA 4JE4A 2A37A 3EGUA 2L3PA 2EYWA 2K7AB 3PVQA 1O48A 5EEQA 1LCJA 1O4NA 2HUWA 3H0HA 3I9QA 1SPSA 3PS5A 2A08A 5FWBA 3TSWA 4HVVA 2RNAA 5I6VA 1BMBA 1B47A 2KXCA 1Y0MA 1HSQA 1ABQA 2ABLA 2PTKA 1OO4A 2YSXA 1A1EA 2XMFA 2G6FX 2MQIA 3UA7A 4DGPA 1QLYA 1MUZA 4K45A 1H8KA 4JJDA 3VGOA 3ZL7C 1ZUYA 2KNBB 4J9DA 5AULA 4GWFA 2D0NA 2W0ZA 4LN2A 2DL8A 2LMJA 1WIEA 1H92A 1JWOA 1GCQC 2SRCA 4GL9E 3H0FA 3M0PA 3TL0A 1VYUA 4JJBA 2IUIA 3CBLA 2RQTA 2J05A 3NGPA 3PE0A 4DEYA 1BHHB 1WFWA 1FYRA 1GCQA 1T0JA 5BO4A 5FW9A 3UA6A 2YSQA 4F14A 1RQQC 1QADA 4AFUC 4OMOA 2MC1A 5AXIA 1A0NB 3N8MA 2CDTA 2RSYA 1SPKA 2FG0A 2ED1A 3EAZA 2H8HA 3C7IA 2KT1A 4L1BB 4D8KA 1MILA 5HCKA 2ECDA 2EPDA 2F2VA 1O4LA 2CT4A 2ROTA 1KA6A 2EQIA 2PNIA 4EIHA 1RJAA 1AOJA 4ORZA 1UURA 2PNBA 1IO6A 1ZSGA 1PWTA 1AWWA 2DMOA 2YDLA 2HDVA 2HEQA 1IJRA 2DBMA 1KSWA 2RN8A 2AUGA 1RLQC 4FSSA 1PKTA 2BBUA 1O4GA 4E68A 1CJ1A 1D1ZA 4GPLB 2GE9A 2SHPA 3BUXB 1NG2A 4E93A 1M27C 2DL3A 4QT7A 2GTJA 4HVUA 2LJ0A 1FMKA 1WX6A 1NLOC 1U3OA 1PKSA 2QDLA 2DL5A 5J3XA 1M27A 1B3QA 1G2BA 4JZ3A 1O43A 1E6HA 1A81A 3VS1A 1O4DA 2LCTA 2VKNA 4RUGA 1K0SA 2FEIA 1O46A 3PLFB 1YN8A 1K4US 2RMXA 1WLPB 2EO6A 2KNOA 1LUMA 1AYDA 2D8JA 3NMZC 2GSBA 1O47A 3GXXA 1PNJA 1HCSB 2LX7A 3I5SA 5HKWA 4DGXA 2L3QA 3TKZA 3S8NA 4J9GA 1WQUA 1E7OA 4J9EA 1AZEA 1UFFA 1JEGA 2CH4A 1AOTF 2O2OA 4K11A 1AWOA 2V1QA 4HCKA 2J7IA 1HCTB 2H5KA 1IS0A 2PNAA 4A4BA 1T3SA 1KC2A 2KE9A 5IH2A 1T3LA 1H9OA 3R6NA 3OV1A 4JZ4A 1JU5C 3I5RA 1LKKA 4LNPA 2L2PA 1VYTA 2D8HA 2X3WD 1O4QA 4JGHA 2NWMA 1SHBA 1JYUA 1ZX6A 2JM9A 2CI8A 5EHPA 3MXCA 2K79B 2Y1MA 1PRLC 1BLKA 4OHDA 1SHGA 2AKLA 1X69A 1TZEE 2AKKA 2ROLA 2ECZA 4P9VA 2Y1NA 1B07A 5DC9A 2AOAA 1JU5A 1WXBA 3VS0A 2O88A 4NWFA 1OV3A 2FPDA 1O41A 2FCIA 1U5SA 4XZ1A 1BB9A 1BHHA 2BZXA 1O4BA 5HKZA 5EG3B 1X43A 1I07A 2RVFA 1XOVA 2OQ1A 3VS4A 1JQQA 1CSZA 1SHAA 5L23A 5DC0B 2W10A 2FRYA 4OHEA 2K6DA 3PQZA 1SHFA 3VROA 1U06A 1BFJA 2GTOA 2J06A 2RQVA 4FL2A 2DX0A 1AWXA 4H34A 3EHQA 1OEBA 3RBBB 1M30A 1JYRA 1QKWA 2CT3A 2HBWA 4OMNA 1OPKA 5CDWA 2LJ3A 5IBMA 4OMPA 1CSYA 3PFVA 2DM1A 2DLZA 4CC2A 1ZUKA 1UECA 1M3AA 5IXBA 2X3XD 4CC7A 3BUWB 1NLPC 1UUSA 2DM0A 1HD3A 2DF6A 1LKLA 1FU6A 1X2KA 1JO8A 5EC7A 2EYVA 1A07A 4HVWA 2YU7A 2J6KA 3EG1A 3N84A 4Z89A 2KR3A 1H3HA 2ESWA 1GBQA 3TVTA 3NPFA 5IHNA 1A1CA 1FBZA 2PZ1A 3OVEA 1HJDA 1MW4A 1RPYA 4ESRA 3VRZA 4RTWA 4P9ZA 5GJHA 4GLMA 3REAB 3EHRA 1TG0A 4LUDA 1AEYA 4OHLA 3S8LA 2NUZA 5GJWB 2I0NA 2IIMA 2JW4A 4HXJA 1F2FA 2CI9A 4OHHA 1QCFA 3FJ5A 3IN7A 2O31A 2B3OA 3BUNB 2RMOA 4WWQA 3S9KA 4F16A 1Z9QA 1QG1E 2JS2A 4X1VA 2DL4A 2A36A 2PLEA 4U17A 1PHTA 2OZOA 1GRIA 3CQTA 2J6FA 1BM2A 3WA4A 2K2MA 3O5ZA 1S1NA 3TSZA 1O4RA 3IN8A 1BHFA 2LNWA 3VS6A 1O4PA 2K79A 1NEBA 4OMMA 3VS2A 4JPBW 3UF4A 5IHIA 3VS3A 1P13A 2VVKA 1Z9ZA 2M51A 3RNJA 1JYQA 2JTEA 2MRJA 5D0JA 1VA7A 1GBRA 2L3TA 2EGEA 1ZLMA 1QWFA 2BTTA 2EYXA 2KRMA 2CH4W 4M4ZA 2DRMA 5DF6A 4AG2C 1AD5A 3VRYA 2KYMA 2E5KA 2KYBA 2LZ6B 2KXDA 4R0KA 2DJQA 2HSPA 1NYGA 2EYZA 4OMQA 2DCRA 1TCEA 2AZVA 5FWCA 1Z3KA 1UHCA 1WYXA 4AFSC 1LUNA 2KGTA 1O4HA 1M8MA 2GQIA 1W1FA 2CS0A 2HDAA 1TUDA 1JXMA 1O4OA 3VS7A 2CBLA 1KJWA 2EBPA 2EGCA 4RTXA 2J6OA 3ZNIA 2C0OA 2ETZA 2EGAA 2CSIA 2EO3A 1R1QA 1LUKA 3THKA 1M3BA 1KFZA 2EW3A 1K1ZA 1A08A 1SRMA 3QWYA 2H46E 2VIFA 3UYOA 4NWGA 3S8OA 2EOBA 1ZUUA 4A63B 1O4IA 4TZIA 2OI3A 3HHMB 2DLPA 2GBQA 3VS5A 1ZBJA 1EFNA 4F5BA 1KA7A 1SPRA 2IZVA 4LE9A 1BU1A 3KFJA
chains in the Genus database with same CATH superfamily
2E10A 3CMET 1R77A 4M75C 3CCSQ 3DLLA 2PLDA 2NUTB 4F7UF 1LJOA 2GFUA 3JV3A 2CP6A 1K73R 1UJYA 2ENMA 4M77A 5GAMe 2AT1B 1BFIA 3P8BB 4M77G 1YI2Q 3OB9A 1KC8U 3CCLA 1YJNT 1ZQ1A 2DK3A 1X0NA 4Z88A 1QQJA 2YUPA 1X6GA 1KG1A 1SKJA 2BZ8A 5CIUA 3CCST 4TVRA 1FX7A 1X2QA 1UGVA 4B9XA 2HCKA 2FZKB 2MK5A 2O01E 4IIMA 5ECAA 3CCVT 3V7CA 4Z8AA 1JJ2P 2KROA 1YFNA 1YI2T 3CC2Q 3GP8A 3CMEA 1NZLA 4M75B 2L89A 1UJ0A 5D6XA 5GAN2 3JB9G 1X6BA 3EGXB 4A4GA 2K9GA 1FBVA 1X01A 2D6FA 3GXWA 2DKGA 5CAIA 3JCMf 2LRAA 1I1JA 1GCPA 3CCQQ 1QCNA 1FU5A 2KGYA 2LP5A 2QA4Q 1YJNA 4M7AF 3J7AF 1O4EA 1Q81C 1GL5A 4J9HA 2L3SA 3CC2T 5GAOp 2MOXA 3CCSA 2E64A 2VWFA 1VQPA 1YVLA 1VQ4Q 3PVLA 2YUQA 3QBYA 4DBQA 2HDXA 2HD0A 1MNEA 1X6CA 2EYQA 3KBGA 4RTVA 3CCVA 1MV0B 2Y4XA 2EVRA 3CCQT 3META 1YI2A 2CIAA 3TU4K 1CSKA 3M0TA 2KVQG 1N9RA 5LJ3j 1EX4A 1UE9A 1VIEA 2C06A 1BI2A 1VQ5Q 4C8QF 3GNFB 4KGVB 1FMVA 1VQ4T 1GFCA 2OAWA 4M7AB 3M0UA 3S3MA 2LTOA 2IUHA 4BACA 2BUDA 2DIQA 4M78F 4FL3A 2KRSA 2XDBA 5KYYA 2X4YA 1S72Q 4QQ6A 1NJIU 1E6GA 1YWOA 1SHDA 2DVEA 1U1SA 1QKXA 3U23A 4GBQA 1VQ5T 2GGRA 4WF2A 2LCCA 1LUIA 1R1PA 2EQKA 2EYYA 2DYBA 4DEXA 1WHGA 1I3ZA 1CWDL 1YWPA 1RUWA 3EG0A 2JTFA 1AYBA 3MPUB 3JSCA 2VXEA 4C8QB 4K2RA 2V1RA 4EY0A 2A37A 4PFPA 2EYWA 1O48A 1VQ4A 3H0HA 3I9QA 3PS5A 2A08A 5LJ3h 1B47A 2QK0A 3UDCA 1M1GA 1HSQA 1ABQA 2XHCA 3R6OA 1A1EA 2G6FX 2HKNA 1VQ9A 2MQIA 1IB8A 3TEEA 3EH2A 5AYFA 4JJDA 1KHIA 1M90R 1AHJB 2KNBB 2EKOA 4LN2A 1JWOA 2LMJA 3M0PA 3CPFA 5CVIA 2CGHA 1VQKT 1VQ5A 1BHHB 4J5YA 5FRMA 5BO4A 1T0JA 1YCYA 3UA6A 3J81E 4F14A 1RQQC 1R0BG 3OW2A 4OMOA 5HKCA 2MC1A 3PFSA 1A0NB 1KQSA 4RMOA 2ED1A 3VUBA 4MMKA 2DXTA 4D8KA 4LD6A 3NFCA 1QVGS 4E7ZA 3CPWA 1KC8R 3CCMA 1ZSZA 1AOJA 2CZ0B 1UURA 3LW5E 3CCJQ 2ATCB 1PWTA 3CD6Q 2DMOA 2HEQA 2DAQA 4Y91A 4FSSA 3CCUA 1CJ1A 1D1ZA 5CQYA 4GPLB 4ZGEB 2DD5A 1UGSB 1B34B 4FL6A 3FC3A 2GF7A 4QQDA 4HVUA 1G3TA 1FMKA 2HL3A 4X9DA 1Q81U 2DL5A 2HSEB 3G4SA 5LJ5j 1O43A 1VQKA 1A81A 1Q7YC 1O4DA 3CCJT 2VKNA 2K3YA 3CD6T 1I8FA 1WLPB 2COWA 4XTVA 3ZFJA 1AYDA 2D8JA 2GSBA 3C12A 1O47A 1HCSB 3OSSC 2RK1A 3FDRA 1M4ZA 1E7OA 3OYGA 1UFFA 4RG2A 4RKUE 2O2OA 1AWOA 1G8XA 2K3XA 2PNAA 2L8DA 5IH2A 1T3LA 2EJ9A 2JVVA 3R6NA 1JU5C 4LDUA 4LNPA 2L2PA 2DPPB 2LNVA 2OTJQ 2WSEE 2CI8A 4F7UA 2Y1MA 1PRLC 4OHDA 2AKLA 1X69A 4OB1B 4JRPA 1B07A 4J6WA 2AOAA 1WXBA 1O41A 1BB9A 2BZXA 5EG3B 1I07A 3CCJA 1LPLA 5DC0B 1OQKA 3CD6A 3L2WA 3LYIA 1SHFA 5LJ5h 2J06A 4M77F 1AWXA 2K57A 3CC7Q 2OTJT 3EHQA 1OEBA 3RBBB 4EDUA 3EG9B 1QKWA 2XDDA 1CSYA 1WHLA 4F04B 4FT2A 3GPLA 2DLZA 5D6WA 1UUSA 4OB3B 1HD3A 1FU6A 1JO8A 2EYVA 1LVKA 3HFNA 3A1PA 3SB2A 1TU0B 4Q5WA 3ZEHA 2J6KA 3N84A 4Z89A 1JRIA 1GBQA 1M1KC 4C5IA 4C5GA 3J80E 2LC4A 4PJOE 1VQ6Q 2HNIA 1FBZA 2OTLQ 2YRDA 1HJDA 1MW4A 1RPYA 3JB9F 4RTWA 4M77B 2P0QA 2YLCA 1TG0A 2NUZA 4PJJA 3LX7A 2CI9A 4KGZB 3FJ5A 1MGQA 2EJGA 3FIFA 4PLIA 2OTJA 2RMOA 3S9KA 4WTOB 3OYDA 1Z9QA 4X1VA 1VQ6T 2JN0A 1MMDA 1S1NA 1RABB 3TSZA 2OTLT 1O4RA 3S3OA 1C0MA 3VS2A 3VU3C 2VVKA 1BYMA 3I55Q 5D0JA 1GBRA 3VYHB 5LJ3d 1M2VB 4ZGJB 2DRMA 4RCBA 2QGGA 5CKEA 1UGQB 1IZ6A 3VRYA 2E5KA 4FW2A 2BIVA 1W2BA 2DJQA 2HSPA 2DIGA 1NYGA 2EYZA 1YITQ 4OMQA 2AZVA 1Z3KA 1UHCA 2AIRB 1O4HA 2MWOA 3EH1A 3OYFA 2GQIA 1WHJA 1KD1U 3I55T 1UEBA 2C0OA 2EO3A 2QAZA 1K1ZA 2H46E 4FYVB 3UYOA 2A0FB 1VQ6A 4HA8A 5AT1B 2GBQA 2OTLA 1YITT 4C92E 2IZVA 4LE9A 4XU0A 1BU1A 3M9QA 1Q81R 2CZ1B 2PVGB 4J83A 1V1CA 2LDMA 1A1AA 3PJPA 1J3TA 2NUPB 3CD3A 2VB6A 2Z0WA 2LQNA 4IIOA 3PSJA 4A4KA 2DLYA 1ARKA 2E41A 2RQWA 5GAN3 1U8RA 3QHSA 3PGGA 2FPFA 2L4KA 4D8DA 4RTUA 4PJOD 1G3SA 3QKJA 4OP0A 1WA7A 4PL6A 1OZ2A 1JXOA 5I22A 3I55A 5GAMj 1FHSA 2FPEA 3H8ZA 3HRSA 4O6JA 3OYHA 4WCIA 4J7IA 1KQSP 2IVWA 2O9SA 5KYYB 5GMKi 1BCOA 4RCCA 4KT0E 2JT4A 4EMGA 1YITA 2E5QA 2EFIA 1QW1A 3CPWP 4OHIA 2YUOA 7AT1B 2JUFA 2LQKA 4PK4A 1UG1A 1O4FA 3E1SA 3REBB 1M61A 1BLJA 3E9FA 3QWXX 3JB9I 1BF5A 3M55A 1QWEA 5C6SA 4HT8A 1NEGA 1IHVA 2WSFE 3KFVA 4KH1B 1XA6A 2CREA 3M7FA 1Y57A 2XIDA 3OB2B 2M0YA 2ZPBB 2AZSA 3ASKA 1BKLA 3NTIA 5FLXE 4A4EA 3OYNA 3G1JA 8AT1B 5A2QE 3CCLQ 5EHRA 1SEMA 2JZ2A 2DTIA 3GQIB 1AYCA 2C9WA 4DOWA 3JCMe 5LJ5d 3OYAA 4XU2A 3WVEB 3CXCA 1RLPC 5GAMh 4F5AA 1WPYA 3LH5A 1AWJA 4D6WA 3V8LA 1PRMC 3HKSA 4M7DC 2CUDA 6AT1B 5KYXA 1R1SA 2MYSA 4C5EA 1OO3A 1OPLA 2YRVA 1AYAA 3CCLT 2MRKA 3C94A 4C92D 3I35A 3RR6A 1PSEA 4OMLA 1OZ3A 1M3CA 4E7IA 4LXCA 3MEUA 2JS0A 3CMAA 4PJOA 3VYGA 1F1WA 3BUMB 1ZSZB 4XAXB 5IBSA 2DXCA 2R5MA 4PJOG 3LH0A 4F17A 3CWGA 3BY7A 2FRWA 2QGFB 3FRNA 1N8RR 4K44A 4X6SA 3MP6A 5DC4A 2LNHB 5HK0A 3QO3A 4JJCA 5LJ3g 1ABOA 2DXUA 1O44A 1LOJA 3PNWC 1AZGB 1WI7A 1VQPQ 3E19A 1VQNT 3ER0A 4BI8B 3MKDA 5GANj 4O5VA 2DVJA 4AFZC 4M7DB 2RQUA 4LDWA 1NM7A 3CCVQ 4PLLA 2DTOA 4B6MA 4BDYA 2SEMA 2JXBA 2EL8A 2DNUA 2RO0A 2JNGA 1FWZA 3RMQA 2DJZA 3MJXA 3OQ5A 2K7AB 1KD1R 2HUWA 1SPSA 4HVVA 3PIOA 1VQPT 5I6VA 2LCLA 3OYEA 2KXCA 4BY6B 2PTKA 1OO4A 1RAEB 2XKOC 2R58A 4FYWB 1QMCA 1QLYA 2KSSA 5GAN5 2FB7A 4IUPA 3VGOA 2A3LA 1WNLA 3SWNA 4F7UB 4GWFA 1GCQC 2F69A 4OMFB 1VYUA 1VQNA 2XU8A 4JJBA 3JRZA 5J26A 3JB9J 2IUIA 2RQTA 2J05A 3NGPA 4DEYA 1WFWA 3OYLA 5A0LA 4A54A 4AFUC 2DFUA 3C95A 4M7AC 1TTHB 2CDTA 5GMKm 3MEWA 2RSYA 3M59A 5FROA 4C92A 5GANh 4L1BB 1MILA 2ECDA 1QP3A 3DB4A 4C92G 2ROTA 4A4FA 2O4XA 2FHDA 4ELZC 1SKUB 2XDPA 4ORZA 4XU3A 1ZSGA 1NBEB 2WSCE 1AWWA 2D0QB 3HFOA 1W2BP 2AUGA 5KCOA 4PNOA 1RLQC 1PKTA 2ZAEA 1M27C 3CBPA 2DL3A 2QQBA 4QT7A 4M75E 3OMCA 3X26B 1VQ9Q 3X28B 1NLOC 1PKSA 1U1TA 2VXFA 4A4HA 2VUBA 4C8QC 4JZ3A 1NPPA 3QPHA 1BI3A 4E7JA 2LCTA 1K0SA 1K4US 2VGNA 3NTKA 4E7SA 3V7SA 3RUXA 1LUMA 4IUTA 4RG8A 4FCYA 1BI0A 3NMZC 2EQUA 2QTVA 4M78C 1TOVA 3GXXA 4L5GA 3I5SA 1IXDA 1PD1A 2L3QA 2DZ9A 3CC4Q 1WQUA 3DB3A 1AZEA 1JEGA 1VQ9T 2KAFA 2YLBA 1Y96A 2V1QA 3QUIA 4HCKA 4OB2B 3G71T 4HCBA 2DYIA 1HCTB 1R8OB 3CCMQ 1YIJQ 1KC2A 5LJ5g 1VYTA 2D8HA 1O4QA 4BE0A 2NWMA 1SHBA 4JGHA 1JYUA 1ZX6A 3E9GA 5EHPA 1VOMA 2KQWA 2XICA 1BLKA 1TZEE 1OULA 2AKKA 2ECZA 3CCUQ 2Y1NA 5M9OA 5DC9A 1EZZB 2V8IA 2PQWA 2KDSA 4OB0B 3VS0A 2EWNA 2FPDA 2FCIA 2JJ9A 1U5SA 3CC4T 4XZ1A 1Q86U 1X43A 2RVFA 1M5Q1 3VS4A 5DM7R 1JQQA 4EMKA 1SHAA 5L23A 1D0XA 3G4SQ 1W4SA 3QZ5B 3WXMB 1VQKQ 3M53A 3CCMT 1YIJT 2DXBA 4GY5A 1RL2A 3PQZA 1I81A 3V8KA 5GAMd 1U06A 2IPOB 4M78B 4P5NA 2LT4A 3FB9A 1JYRA 4Y28E 3CCUT 3QXEB 2CT3A 1OPKA 5IBMA 5A0GA 4QKUA 2DM1A 4MZMA 5I2SA 3G71A 1K9MC 1ACMB 4R55A 1K8AC 2DEQA 5KYWA 3PIPA 2F5KA 2DM0A 4FYXB 3G4ST 1LKLA 1VQ7Q 3EFSA 1WHKA 5EC7A 2FZGB 1B7TA 3L1AA 2G3RA 4HVWA 2YU7A 3EG1A 1RAGB 2KR3A 1H3HA 4KH0B 5IHNA 4NL2A 3CC4A 3JAME 1Q82C 3OBYA 2JTMA 2BE7D 4JRKA 1QVFS 3MO8A 3NTHA 3VRZA 2M1HA 4M75D 4XTUA 2CS7A 4P9ZA 5GJHA 1C1AA 4GLMA 1YIJA 3EHRA 3C4SA 3CXCP 4OHLA 3S8LA 3URGA 2I0NA 1G5VA 5GAOm 1VQ7T 3BUNB 2CZ6B 4WWQA 1BI1A 2EQMA 2DL4A 2DZCA 4L59A 2J6FA 3O5ZA 3IN8A 1BHFA 4C0DC 2LNWA 3VS6A 1O4PA 2K79A 1NEBA 3BW1A 5IHIA 1P13A 2M51A 2JTEA 1Y71A 2MRJA 1VA7A 2RI2A 1M1FA 4R56A 1K73C 2BTTA 1JBMA 2EYXA 2RJDA 5DF6A 4AG2C 2PVDB 4N0AA 1BIBA 4JJNK 2KYMA 2AHJB 2LZ6B 2KXDA 4ZTFA 2DCRA 1TCEA 1G3YA 2NUTA 1LUNA 1M8MA 1VQLQ 4EMHA 1TUDA 4L6V5 3VS7A 5GANf 3QYGB 1VQ7A 2H3EB 1XTDA 3UT1A 4IKFA 3ZNIA 2R5AA 4M7AD 2EGAA 1LUKA 4BE2A 1D3BA 1M3BA 1KFZA 4PJOF 1SRMA 2X4JA 2RH2A 3QWYA 1X6OA 3S8OA 2EOBA 1ZUUA 3HTRA 4QW2A 1O4IA 3L2UA 2E3IA 1ZBXA 5GANd 4JLIA 4C0DB 3OS1A 2ZPFB 3KFJA 1VQLT 3OP0A 4M77C 4ZN1A 1T0HA 2AK5A 1SSHA 2HQXA 3IQLA 1NRVA 5HY6A 3TCJA 3WVDB 4F59A 1OYXA 3M56A 4MDXA 4M75A 2ZPHB 3BDUA 1SRLA 3MEVA 4H1OA 4M75G 4C8QD 1UB4A 2CUBA 3LWHA 3VRRA 3L2VA 2RD1A 2LRQA 1CWEA 3T9NA 1Y1UA 5I21A 1N9SA 4ROJA 1RAIB 4A4CA 1VYVA 4J9IA 3EACA 1LCKA 4J9FA 1NJIR 3GBQA 3AT1B 3RKWA 1YVHA 2IUGA 2DRKA 2CSQA 3IMDA 5HKYA 3EGDB 3JCMW 2AOBA 3K2MA 2X4XA 3QZ9B 2M0OA 3KXTA 1MMAA 2K5FA 1TUCA 2DBKA 2KT8A 4KRTA 4RTTA 3JCMP 1OU8A 1UTIA 1ZA1B 4J6XA 4JRIA 2XG8D 5DY9A 1K0XA 2RHUA 1VQLA 2BZYA 1Q86R 3US4A 1NPRA 4JRQA 1K8AU 4J7FA 5EELA 4N4GA 1CKAA 3NHNA 3BDLA 1CKBA 5GAMg 1BG1A 1RI0A 2IG0A 4IURA 2D1XA 2P84A 2EKXA 3A98A 4C92F 3HCKA 3P8DA 5LJ3f 3T04A 1BKBA 2ZPIB 2QEXA 2MWPA 2RHYA 2JYQA 1KIKA 5IXFA 4C0GA 3QJYA 5GAOr 1I5OB 3SWNB 5I11A 1O4KA 2C0IA 1PICA 1O42A 3GIBA 2MF2A 2QQRA 3OYIA 4FIBA 3RESA 2JMAA 1H641 1C6VX 3M0SA 2HAXA 2A28A 2E1HA 2OJ2A 1PD0A 2E3HA 1Q7YU 1K73U 2RQRA 1JJ2S 3F70A 4JS5A 1OU9A 3H41A 3HHTB 1FMWA 2KBTA 4ELYC 3RERA 2Y3AB 1M90C 2MK2A 3HRUA 1IHWA 4NOYA 4EPCA 2EU0A 1NYFA 1UDLA 3HIZB 1YNZA 4PFOA 3MXYA 1O4MA 4E6RA 5GJIA 1VQ8A 4VUBA 3A8OB 1I0CA 4RTYA 4CC3A 2COYA 3X24B 1X27A 1QVGP 4AFQC 5GAN8 2LQWA 1OI1A 4LD9K 2LVMA 1K76A 5J39A 2LQ8A 1O45A 2MI6A 1W6XA 5D7UA 2LNXA 1KC8C 4KGXB 5FU7B 1Y7XA 4JLGA 1SG5A 2ZPEB 2YT6A 1MV3A 1YCSB 3C0CA 3X20B 5IAYA 3EGUA 1KHCA 3JCMh 1LCJA 3PMIA 1NE8A 2KI7A 1O4NA 2RJFA 2QI2A 3TSWA 4N4IA 3H9NA 1BMBA 2VGMA 3QG1A 2YWWA 1Y96B 2QQAA 3EFRA 2YSXA 3CMAQ 2XMFA 2X51A 3G6EQ 5GANg 3M4YA 4DGPA 1MUZA 3OY9A 4K45A 2XD0A 3ZL7C 5AULA 4A53A 3V7RA 2DO3A 2DL8A 5GMKe 5J3BA 1I4K1 2EJFA 2SRCA 4J6YA 4GL9E 3OS0A 3TL0A 1VIFA 1UGPB 5CK9A 2RA2A 3CBLA 3PE0A 5DLQE 1FYRA 3PT9A 2YSQA 1D1CA 1TH7A 5GAOq 3M58A 2E6ZA 5AXIA 4EMKB 3LYVA 3N8MA 3CMAT 1SPKA 4XK8E 3G6ET 1M1KU 1ZSZC 5LJ5f 2KT1A 2M16A 4M77D 2EPDA 2F2VA 3QYHB 1KA6A 2EQIA 2PNIA 4EIHA 2RJCA 1IO6A 2YDLA 1IJRA 4X9CA 1KSWA 2BBUA 1Q95G 1RADB 5KYNA 2CP5A 5KYWB 1NG2A 4E93A 2ZCFB 2GTJA 2CP3A 2LJ0A 4E7KA 1WX6A 2QDLA 4ATOA 2ZGWA 5J3XA 1ZA2B 3A5ZB 2K2VA 2DERA 1B3QA 1G2BA 1WHHA 3VS1A 5IN1A 3HP9A 4RUGA 1O46A 1YN8A 1VQNQ 2RMXA 2EO6A 2F5TX 2KNOA 5L8RE 4E47A 3HL8A 3G6EA 2FZCB 2LX7A 1PSFA 5HKWA 3DLMA 4BY6C 4DGXA 3INZA 3S8NA 4J9GA 4J9EA 4HT9A 4V2SA 3QJ6A 1TSFA 2L3RA 1WZOA 1AOTF 2H5KA 3EG9A 3JCMQ 5KYUA 1PM3A 2RI3A 3OV1A 1LKKA 4FU6A 3LGLA 2JM9A 3MXCA 2K79B 2LX9A 1SHGA 2FVUA 2ROLA 4J8OA 1JU5A 2PUOB 1OV3A 1O4BA 5IT9E 3CBMA 1XOVA 2HZYA 2OQ1A 2E6NA 2QXFA 2MAMA 1X75C 3DKMA 2P0KA 1HXDA 2HQHA 4HCCA 2DTHA 4OHEA 3VROA 4KBMB 4MDWA 3L2QA 1Q7YR 3RIRA 1HK9A 2RQVA 4M75F 2DX0A 4FL2A 3PMTA 1YJ9Q 3OA6A 2D9TA 2HBWA 1IREB 5CDWA 2LJ3A 4OMPA 1D3BB 5CQXA 4CC2A 1ZUKA 4JDSA 2X3XD 2NYSA 2OX7A 4CC7A 1NLPC 2P0PA 4BUGA 5GAOn 4M7DE 1MMGA 1X2KA 4BE1A 2MMPA 1FXXA 2BKDN 1WQWA 4UC4A 2WACA 4E7HA 1YJ9T 2E12A 4C0ZA 3TVTA 3TREA 3NPFA 3VJPA 1M2VA 2LT1A 1VQOQ 2PZ1A 2PVOB 3Q1JA 1VUBA 4C5HA 4ESRA 4OF1A 1WJQA 3A8HB 3REAB 4LUDA 1AEYA 4N4HA 5I2MA 2FYKA 5GJWB 1F2FA 4OHHA 3JCMJ 3OS5A 3IN7A 3I56Q 4ANJA 1QG1E 4F7UE 3RKXA 2JS2A 2B8AA 2YRCA 3UPUA 4AT1B 1PHTA 3VKIA 3OYCA 2OZOA 1EIFA 3CQTA 1BM2A 1VQOT 3WA4A 2K2MA 2R57A 2CP7A 4OMMA 1SSFA 3G71Q 4JPBW 3UF4A 3VS3A 3JCMd 3P8HA 2COZA 2EQJA 1Z9ZA 2EGEA 2CH4W 4IUUA 4M4ZA 1YJ9A 3I56T 1V76A 2KYBA 4R0KA 2NUPA 2RM4A 4DBFA 2QASA 1WYXA 4AFSC 2QA4T 1M1KR 1WGSA 1W1FA 2CS0A 1JXMA 1O4OA 4ME7A 2J6OA 2KK4A 2ETZA 5HK3A 2VIFA 1GXIE 1D1AA 4NWGA 5GMKl 4A63B 3CEYA 1M2OA 2OI3A 3M5AA 3HHMB 4FW1A 1VQOA 3VS5A 5GAMf 3CC2A 1EFNA 5GANe 4F5BA 1KA7A 4PJNA 2KMTA 1RAFB 2QQ9A 4M7AE 4NS5A 2PU9B 1N6AA 2L6KA 4U1PA 2YUNA 3BUOB 1N5ZA 1VQMQ 3IMJA 3I56A 1G83A 3MCAB 1FYNA 2QG9B 1BBZA 5CCAA 4M7DD 2K5LA 3CCQA 1QVFA 2RK2A 4JEGA 1TS9A 1IRXA 1TWBA 1XQHA 2QA4A 1UGRB 1QVGA 3GLXA 1GFDA 3OMGA 1D1BA 2L0AA 2DA9A 2Y4YA 1K9AA 1UHFA 3M0RA 2LJ1A 4CC4B 3MHXA 1WXUA 4J9CA 1YP5A 1S72T 5CKDA 3PSKA 3EFOA 4FBNA 5IHKA 3OYMA 3AHUA 2GNCA 3HPWA 1MNDA 1VQMT 2GQVA 1PC0A 3TQ7P 1RAAB 3V8JA 2DILA 2K3BA 2O9VA 3JCMb 3QDFA 3ULRB 3JCMX 4C8QE 2CRHA 4QSYA 4LDXA 1AOUF 3HRTA 2X4WA 3O8VA 1NZVA 2HMHA 1BK2A 2XK0A 5CKBA 4M78E 1KK7A 3EG2A 3VUZA 3VRQA 1O4CA 3VRPA 4EIKA 2K5IA 3SEMA 2LCSA 3OYYA 4NL3A 2Y90A 2ZZDA 3E2UA 1KQ2A 4IUVA 1WJSA 1ZFPE 2MIOA 2VYTA 1BKMA 2P4TA 2KK6A 1G3WA 3CXLA 3RKYA 3M57A 4C0FA 2RPNA 2F2WA 2F2XA 4AG1C 3OYBA 4E7LA 1N8RC 3OB1B 4BB7A 2DX1A 2KEAA 3N7YA 2ED0A 1S72A 3UATA 3BE3A 2RHZA 4CRIA 3LGFA 2RORA 2KY9A 1OX9A 2MPXC 1VQMA 2GFAA 3PTAA 3FEOA 2CR4A 2DL7A 4RTZA 2NLUA 2QMSA 5KAZA 3FLGA 5LJ3e 4IUQA 1OOTA 5GJVB 3GOXA 2E65A 3VRNA 3EAEA 1O49A 3M0QA 4Z02A 4XZ0A 4LUEA 2MCNA 1YHQQ 4BDZA 2XP1A 3SHWA 3OW2S 5KH6A 1KQSS 2VASA 1KD1C 1UUEA 4ZNXA 1BIAA 2FO0A 4M7DA 1D4WA 3OBWA 2B86A 2EIFA 4PJOC 3ZBDA 4M7DG 3CPWS 5FRNA 4XTWA 2P4RA 4YTLA 3MAZA 1O4JA 2EAYA 4GLKA 4JUVA 1I5LA 1WDXA 3JB9H 3BKBA 1WQ7A 3HSBA 2M02A 1O9SA 4J9BA 2K7AA 5C0MA 2CP2A 2EKHA 2E70A 1AB2A 1YHQT 2JMCA 4XTYA 3EG3A 1D4TA 1YBYA 4XTXA 1GHUA 4XQ3A 2X35A 3JCMg 2PUKB 2QEXQ 1M9SA 2GCXA 3BFMA 3L2RA 1A09A 5GAOl 2C0TA 1WXTA 1W70A 5DLOA 3M4GA 1R0CB 5KYXB 2YXYA 3H0IA 2KRNA 4QVZA 2RF0A 1A1BA 4PJMA 4F7UG 1AVZC 4Y92A 3CCEQ 1O4AA 1QVPA 1N27A 3EGXA 2JM8A 1RI9A 2DE0X 1PCXA 4PJOB 4JE4A 2QEXT 2L3PA 4HKEA 3PVQA 5EEQA 3QSUA 2E4HA 4M78D 5FWBA 3MEAA 4MMLA 2RNAA 4DA4A 2CZ7B 1Y0MA 3SWNC 2ABLA 4XU1A 4BD3A 1YHQA 3L2ZA 3UA7A 5KYUB 3G7ZA 3CCET 5GAN4 1D0ZA 1H8KA 3JCMc 4LDYA 1ZUYA 4J9DA 3GNGA 1PG5B 3JCMV 2D0NA 2L5QA 2W0ZA 3OYKA 1H92A 1WIEA 4XTZA 4DBRA 1IGQA 3H0FA 1K9MU 2YHTA 1VQ8Q 3KUFA 4C92C 1GCQA 5FW9A 1QADA 3CC7T 4ZTJA 5GMKj 2HBPA 4AMCA 4BI3A 2FG0A 3EAZA 2H8HA 3C7IA 1D09B 2QDYB 5D6YA 5HCKA 1O4LA 1Q82U 2CT4A 4M7AA 2V26A 1JJ2A 1RJAA 2PNBA 5KCHA 2XI9A 4M7AG 3QIIA 1NZ9A 4OVAA 1VQ8T 2HDVA 4CI0C 2DBMA 2RN8A 3LLRA 1O4GA 4E68A 3CCRQ 5LJ5e 3CCEA 2GE9A 2SHPA 3BUXB 1F1BB 1RACB 1QP2A 3GF5A 4M77E 4HCZA 5CO7A 2RHIA 2HKQB 1U3OA 1N8RU 2OAUA 4LDVA 4DBHA 4PKCC 1IGUA 1XJWB 5FU7C 3RDVA 1M27A 3CBOA 3L42A 3SFMA 1E6HA 3LWIA 2FEIA 3SD4A 4C92B 1MMNA 3PLFB 3CC7A 5KE3A 4FSXA 4C8QA 5GAN6 2O4XB 5LL6S 4MZTA 1PNJA 3CCRT 2H3JA 4C8QG 4DOVA 3TKZA 1TXQA 4QVCA 2K4YA 3OSVA 5GMKh 4M78A 2CH4A 1P92A 2ZPGB 4K11A 2J7IA 2DEUA 4M78G 1IS0A 4A4BA 1T3SA 2KE9A 1H9OA 4JZ4A 4OGEA 3I5RA 8ATCB 1QVFP 2X3WD 2FL7A 2RHXA 2JOYA 4PFZA 1AT1B 4P9VA 1V29B 5FU6C 2HL5C 4NWFA 4EMKC 2O88A 3S6WA 1W2BS 4FM4B 1BHHA 5HKZA 2RI5A 1HYOA 4JS4A 5CR2A 1Y07A 1YJWQ 1CSZA 1O75A 5KE2A 2DD4A 2W10A 2FRYA 2X9HA 2K6DA 4FYYB 3H6ZA 1BFJA 2GTOA 2V8KA 3CCRA 4H34A 3OS2A 4II1A 1M30A 1D0YA 4OMNA 1XNIA 3MP1A 3FJPA 3PFVA 2I2LA 1SF9A 2M9UA 1UECA 1M3AA 5IXBA 4B9WA 3BUWB 1YJWT 2DF6A 1B34A 4MZPA 3OW2P 2CP0A 3VV0A 3X25B 1RAHB 1A07A 2RJEA 2HMAA 2BE9B 2ESWA 5FU6B 2A7YA 2DETA 1A1CA 3OVEA 4PJLA 1QCOA 1ZHIA 3A8GB 1M8VA 5A0DA 9ATCB 2HQEA 2IIMA 2JW4A 4HXJA 2VV5A 2V8JA 1LNXA 1QCFA 4ZN3A 2O31A 2B3OA 5CKFA 1TUGB 4F16A 5CKHA 1H3ZA 4BI4A 4ZGDB 3SDZA 3EFOB 2A36A 2PLEA 4U17A 1GRIA 4KUDK 2QYZA 4E2FB 4KUIA 1YJWA 4QVDA 3QDRB 4N0AC 1BCMA 2VC8A 3RNJA 1JYQA 3A8LB 1KQ1A 1WJRA 2F1LA 1K9MR 2L3TA 1K8AR 1ZLMA 1QWFA 2KRMA 1JB0E 2CYZB 3S3NA 4DQ2A 3JB9D 1AD5A 2RB6A 1DJ7B 3ME9A 1OX8A 3D7SB 5FWCA 4X34A 1WHMA 2KGTA 3N5BB 1MHNA 4M7DF 1NJIC 3CMEQ 1Q82R 2HDAA 2CBLA 1KJWA 2EBPA 2EGCA 4RTXA 4KULA 2CSIA 1R1QA 2QTXA 3THKA 3A8MB 2EW3A 1A08A 3MP8A 3UWNA 3RMSA 2QQSA 4TZIA 5GAN7 2DLPA 5EG2A 3CXCS 1M90U 4FT4A 4OGCA 3OYJA 4QQGA 1ZBJA 1Q86C 3K2TA 2CKKA 1YJNQ 1SPRA 3EGDA 3M54A
chains in the Genus database with same CATH topology
1V1CA 2L6KA 1A1AA 3OP0A 1J3TA 3PJPA 4U1PA 2YUNA 3BUOB 3CD3A 1N5ZA 1T0HA 2AK5A 2PLDA 4IIOA 2LQNA 3IMJA 1SSHA 3PSJA 1NRVA 3IQLA 1G83A 1FYNA 3JV3A 1BBZA 4F59A 1UJYA 2ENMA 2DLYA 1ARKA 4JEGA 2RQWA 1SRLA 1BFIA 2FPFA 4H1OA 2CUBA 1GFDA 3VRRA 2L4KA 2L0AA 2DA9A 4D8DA 4RTUA 1K9AA 1UHFA 1CWEA 1Y1UA 1WA7A 3M0RA 2LJ1A 4CC4B 1X0NA 1JXOA 1WXUA 4J9CA 1YP5A 4Z88A 5I22A 3PSKA 2YUPA 1X6GA 1SKJA 4ROJA 4A4CA 1VYVA 4J9IA 2BZ8A 3EACA 1FHSA 4FBNA 1LCKA 2FPEA 4J9FA 3GBQA 5IHKA 1YVHA 2IUGA 2DRKA 2GNCA 1X2QA 2CSQA 4WCIA 3IMDA 5HKYA 2DILA 2K3BA 2O9VA 2O9SA 1UGVA 2AOBA 3K2MA 2HCKA 3ULRB 2JT4A 2CRHA 4QSYA 1AOUF 4IIMA 5ECAA 1TUCA 2DBKA 2KT8A 4KRTA 4Z8AA 4RTTA 2KROA 1UTIA 1NZVA 2YUOA 1K0XA 4OHIA 2HMHA 1BK2A 1O4FA 1BLJA 1UG1A 2BZYA 3US4A 3REBB 1M61A 1NZLA 3QWXX 3EG2A 5EELA 1CKAA 1UJ0A 3NHNA 3VRQA 1BF5A 1O4CA 1CKBA 1X6BA 3VRPA 4EIKA 1BG1A 2K9GA 3SEMA 1FBVA 1QWEA 2LCSA 1NEGA 2D1XA 3GXWA 3KFVA 1ZFPE 1I1JA 2EKXA 2MIOA 1GCPA 3A98A 1BKMA 1XA6A 2CREA 2KK6A 3CXLA 1FU5A 3HCKA 3M7FA 1Y57A 2LP5A 3OB2B 2M0YA 3T04A 2RPNA 2F2WA 2F2XA 4AG1C 2AZSA 3OB1B 1BKLA 1O4EA 2DX1A 2KEAA 3N7YA 2ED0A 3UATA 1GL5A 4J9HA 2L3SA 5EHRA 2JYQA 2MOXA 1SEMA 1KIKA 2RORA 5IXFA 2VWFA 3GQIB 1AYCA 2C9WA 1YVLA 2CR4A 2DL7A 3PVLA 4RTZA 2YUQA 2QMSA 2HDXA 5I11A 1RLPC 1O4KA 5KAZA 1X6CA 4F5AA 1OOTA 2C0IA 1PICA 5GJVB 4RTVA 1O42A 3VRNA 1O49A 3LH5A 3M0QA 1AWJA 1MV0B 4LUEA 4XZ0A 2EVRA 1PRMC 2MCNA 2CIAA 2JMAA 2CUDA 2XP1A 1CSKA 3SHWA 3M0TA 3M0SA 2A28A 1R1SA 1UUEA 4ZNXA 1OO3A 1OPLA 2FO0A 1AYAA 1UE9A 1D4WA 2OJ2A 2MRKA 3I35A 2B86A 4OMLA 2RQRA 1M3CA 2P4RA 1GFCA 2OAWA 3MAZA 1O4JA 3H41A 2JS0A 1WDXA 3BKBA 3M0UA 1F1WA 3BUMB 5IBSA 2KBTA 2Y3AB 4J9BA 2MK2A 2K7AA 2IUHA 2EKHA 2EU0A 1AB2A 1NYFA 1UDLA 2JMCA 3HIZB 1YNZA 4F17A 3MXYA 4FL3A 3EG3A 2KRSA 1D4TA 1O4MA 3CWGA 4E6RA 2FRWA 5GJIA 1GHUA 4K44A 4X6SA 1E6GA 1YWOA 1SHDA 5DC4A 2LNHB 4JJCA 1A09A 1ABOA 1I0CA 4RTYA 2C0TA 4CC3A 1QKXA 1AZGB 1O44A 1WXTA 1W70A 3U23A 1WI7A 4GBQA 1X27A 4AFQC 2GGRA 2LQWA 3H0IA 2KRNA 1K76A 2DVJA 2RF0A 1R1PA 1LUIA 1A1BA 4AFZC 1O45A 1AVZC 1W6XA 2EYYA 2RQUA 2DYBA 1NM7A 4Y92A 4DEXA 1I3ZA 1O4AA 2LNXA 1CWDL 1YWPA 1RUWA 3EG0A 1AYBA 2SEMA 2JXBA 2EL8A 2DNUA 2JM8A 4K2RA 2V1RA 4EY0A 1RI9A 2YT6A 2DE0X 1MV3A 1YCSB 3C0CA 4JE4A 2A37A 3EGUA 2L3PA 2EYWA 2K7AB 3PVQA 1O48A 5EEQA 1LCJA 1O4NA 2HUWA 3H0HA 3I9QA 1SPSA 3PS5A 2A08A 5FWBA 3TSWA 4HVVA 2RNAA 5I6VA 1BMBA 1B47A 2KXCA 1Y0MA 1HSQA 1ABQA 2ABLA 2PTKA 1OO4A 2YSXA 1A1EA 2XMFA 2G6FX 2MQIA 3UA7A 4DGPA 1QLYA 1MUZA 4K45A 1H8KA 4JJDA 3VGOA 3ZL7C 1ZUYA 2KNBB 4J9DA 5AULA 4GWFA 2D0NA 2W0ZA 4LN2A 2DL8A 2LMJA 1WIEA 1H92A 1JWOA 1GCQC 2SRCA 4GL9E 3H0FA 3M0PA 3TL0A 1VYUA 4JJBA 2IUIA 3CBLA 2RQTA 2J05A 3NGPA 3PE0A 4DEYA 1BHHB 1WFWA 1FYRA 1GCQA 1T0JA 5BO4A 5FW9A 3UA6A 2YSQA 4F14A 1RQQC 1QADA 4AFUC 4OMOA 2MC1A 5AXIA 1A0NB 3N8MA 2CDTA 2RSYA 1SPKA 2FG0A 2ED1A 3EAZA 2H8HA 3C7IA 2KT1A 4L1BB 4D8KA 1MILA 5HCKA 2ECDA 2EPDA 2F2VA 1O4LA 2CT4A 2ROTA 1KA6A 2EQIA 2PNIA 4EIHA 1RJAA 1AOJA 4ORZA 1UURA 2PNBA 1IO6A 1ZSGA 1PWTA 1AWWA 2DMOA 2YDLA 2HDVA 2HEQA 1IJRA 2DBMA 1KSWA 2RN8A 2AUGA 1RLQC 4FSSA 1PKTA 2BBUA 1O4GA 4E68A 1CJ1A 1D1ZA 4GPLB 2GE9A 2SHPA 3BUXB 1NG2A 4E93A 1M27C 2DL3A 4QT7A 2GTJA 4HVUA 2LJ0A 1FMKA 1WX6A 1NLOC 1U3OA 1PKSA 2QDLA 2DL5A 5J3XA 1M27A 1B3QA 1G2BA 4JZ3A 1O43A 1E6HA 1A81A 3VS1A 1O4DA 2LCTA 2VKNA 4RUGA 1K0SA 2FEIA 1O46A 3PLFB 1YN8A 1K4US 2RMXA 1WLPB 2EO6A 2KNOA 1LUMA 1AYDA 2D8JA 3NMZC 2GSBA 1O47A 3GXXA 1PNJA 1HCSB 2LX7A 3I5SA 5HKWA 4DGXA 2L3QA 3TKZA 3S8NA 4J9GA 1WQUA 1E7OA 4J9EA 1AZEA 1UFFA 1JEGA 2CH4A 1AOTF 2O2OA 4K11A 1AWOA 2V1QA 4HCKA 2J7IA 1HCTB 2H5KA 1IS0A 2PNAA 4A4BA 1T3SA 1KC2A 2KE9A 5IH2A 1T3LA 1H9OA 3R6NA 3OV1A 4JZ4A 1JU5C 3I5RA 1LKKA 4LNPA 2L2PA 1VYTA 2D8HA 2X3WD 1O4QA 4JGHA 2NWMA 1SHBA 1JYUA 1ZX6A 2JM9A 2CI8A 5EHPA 3MXCA 2K79B 2Y1MA 1PRLC 1BLKA 4OHDA 1SHGA 2AKLA 1X69A 1TZEE 2AKKA 2ROLA 2ECZA 4P9VA 2Y1NA 1B07A 5DC9A 2AOAA 1JU5A 1WXBA 3VS0A 2O88A 4NWFA 1OV3A 2FPDA 1O41A 2FCIA 1U5SA 4XZ1A 1BB9A 1BHHA 2BZXA 1O4BA 5HKZA 5EG3B 1X43A 1I07A 2RVFA 1XOVA 2OQ1A 3VS4A 1JQQA 1CSZA 1SHAA 5L23A 5DC0B 2W10A 2FRYA 4OHEA 2K6DA 3PQZA 1SHFA 3VROA 1U06A 1BFJA 2GTOA 2J06A 2RQVA 4FL2A 2DX0A 1AWXA 4H34A 3EHQA 1OEBA 3RBBB 1M30A 1JYRA 1QKWA 2CT3A 2HBWA 4OMNA 1OPKA 5CDWA 2LJ3A 5IBMA 4OMPA 1CSYA 3PFVA 2DM1A 2DLZA 4CC2A 1ZUKA 1UECA 1M3AA 5IXBA 2X3XD 4CC7A 3BUWB 1NLPC 1UUSA 2DM0A 1HD3A 2DF6A 1LKLA 1FU6A 1X2KA 1JO8A 5EC7A 2EYVA 1A07A 4HVWA 2YU7A 2J6KA 3EG1A 3N84A 4Z89A 2KR3A 1H3HA 2ESWA 1GBQA 3TVTA 3NPFA 5IHNA 1A1CA 1FBZA 2PZ1A 3OVEA 1HJDA 1MW4A 1RPYA 4ESRA 3VRZA 4RTWA 4P9ZA 5GJHA 4GLMA 3REAB 3EHRA 1TG0A 4LUDA 1AEYA 4OHLA 3S8LA 2NUZA 5GJWB 2I0NA 2IIMA 2JW4A 4HXJA 1F2FA 2CI9A 4OHHA 1QCFA 3FJ5A 3IN7A 2O31A 2B3OA 3BUNB 2RMOA 4WWQA 3S9KA 4F16A 1Z9QA 1QG1E 2JS2A 4X1VA 2DL4A 2A36A 2PLEA 4U17A 1PHTA 2OZOA 1GRIA 3CQTA 2J6FA 1BM2A 3WA4A 2K2MA 3O5ZA 1S1NA 3TSZA 1O4RA 3IN8A 1BHFA 2LNWA 3VS6A 1O4PA 2K79A 1NEBA 4OMMA 3VS2A 4JPBW 3UF4A 5IHIA 3VS3A 1P13A 2VVKA 1Z9ZA 2M51A 3RNJA 1JYQA 2JTEA 2MRJA 5D0JA 1VA7A 1GBRA 2L3TA 2EGEA 1ZLMA 1QWFA 2BTTA 2EYXA 2KRMA 2CH4W 4M4ZA 2DRMA 5DF6A 4AG2C 1AD5A 3VRYA 2KYMA 2E5KA 2KYBA 2LZ6B 2KXDA 4R0KA 2DJQA 2HSPA 1NYGA 2EYZA 4OMQA 2DCRA 1TCEA 2AZVA 5FWCA 1Z3KA 1UHCA 1WYXA 4AFSC 1LUNA 2KGTA 1O4HA 1M8MA 2GQIA 1W1FA 2CS0A 2HDAA 1TUDA 1JXMA 1O4OA 3VS7A 2CBLA 1KJWA 2EBPA 2EGCA 4RTXA 2J6OA 3ZNIA 2C0OA 2ETZA 2EGAA 2CSIA 2EO3A 1R1QA 1LUKA 3THKA 1M3BA 1KFZA 2EW3A 1K1ZA 1A08A 1SRMA 3QWYA 2H46E 2VIFA 3UYOA 4NWGA 3S8OA 2EOBA 1ZUUA 4A63B 1O4IA 4TZIA 2OI3A 3HHMB 2DLPA 2GBQA 3VS5A 1ZBJA 1EFNA 4F5BA 1KA7A 1SPRA 2IZVA 4LE9A 1BU1A 3KFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1C A;  2L6K A;  1A1A A;  3OP0 A;  1J3T A;  3PJP A;  4U1P A;  2YUN A;  3BUO B;  3CD3 A;  1N5Z A;  1T0H A;  2AK5 A;  2PLD A;  4IIO A;  2LQN A;  3IMJ A;  1SSH A;  3PSJ A;  1NRV A;  3IQL A;  1G83 A;  1FYN A;  3JV3 A;  1BBZ A;  4F59 A;  1UJY A;  2ENM A;  2DLY A;  1ARK A;  4JEG A;  2RQW A;  1SRL A;  1BFI A;  2FPF A;  4H1O A;  2CUB A;  1GFD A;  3VRR A;  2L4K A;  2L0A A;  2DA9 A;  4D8D A;  4RTU A;  1K9A A;  1UHF A;  1CWE A;  1Y1U A;  1WA7 A;  3M0R A;  2LJ1 A;  4CC4 B;  1X0N A;  1JXO A;  1WXU A;  4J9C A;  1YP5 A;  4Z88 A;  5I22 A;  3PSK A;  2YUP A;  1X6G A;  1SKJ A;  4ROJ A;  4A4C A;  1VYV A;  4J9I A;  2BZ8 A;  3EAC A;  1FHS A;  4FBN A;  1LCK A;  2FPE A;  4J9F A;  3GBQ A;  5IHK A;  1YVH A;  2IUG A;  2DRK A;  2GNC A;  1X2Q A;  2CSQ A;  4WCI A;  3IMD A;  5HKY A;  2DIL A;  2K3B A;  2O9V A;  2O9S A;  1UGV A;  2AOB A;  3K2M A;  2HCK A;  3ULR B;  2JT4 A;  2CRH A;  4QSY A;  1AOU F;  4IIM A;  5ECA A;  1TUC A;  2DBK A;  2KT8 A;  4KRT A;  4Z8A A;  4RTT A;  2KRO A;  1UTI A;  1NZV A;  2YUO A;  1K0X A;  4OHI A;  2HMH A;  1BK2 A;  1O4F A;  1BLJ A;  1UG1 A;  2BZY A;  3US4 A;  3REB B;  1M61 A;  1NZL A;  3QWX X;  3EG2 A;  5EEL A;  1CKA A;  1UJ0 A;  3NHN A;  3VRQ A;  1BF5 A;  1O4C A;  1CKB A;  1X6B A;  3VRP A;  4EIK A;  1BG1 A;  2K9G A;  3SEM A;  1FBV A;  1QWE A;  2LCS A;  1NEG A;  2D1X A;  3GXW A;  3KFV A;  1ZFP E;  1I1J A;  2EKX A;  2MIO A;  1GCP A;  3A98 A;  1BKM A;  1XA6 A;  2CRE A;  2KK6 A;  3CXL A;  1FU5 A;  3HCK A;  3M7F A;  1Y57 A;  2LP5 A;  3OB2 B;  2M0Y A;  3T04 A;  2RPN A;  2F2W A;  2F2X A;  4AG1 C;  2AZS A;  3OB1 B;  1BKL A;  1O4E A;  2DX1 A;  2KEA A;  3N7Y A;  2ED0 A;  3UAT A;  1GL5 A;  4J9H A;  2L3S A;  5EHR A;  2JYQ A;  2MOX A;  1SEM A;  1KIK A;  2ROR A;  5IXF A;  2VWF A;  3GQI B;  1AYC A;  2C9W A;  1YVL A;  2CR4 A;  2DL7 A;  3PVL A;  4RTZ A;  2YUQ A;  2QMS A;  2HDX A;  5I11 A;  1RLP C;  1O4K A;  5KAZ A;  1X6C A;  4F5A A;  1OOT A;  2C0I A;  1PIC A;  5GJV B;  4RTV A;  1O42 A;  3VRN A;  1O49 A;  3LH5 A;  3M0Q A;  1AWJ A;  1MV0 B;  4LUE A;  4XZ0 A;  2EVR A;  1PRM C;  2MCN A;  2CIA A;  2JMA A;  2CUD A;  2XP1 A;  1CSK A;  3SHW A;  3M0T A;  3M0S A;  2A28 A;  1R1S A;  1UUE A;  4ZNX A;  1OO3 A;  1OPL A;  2FO0 A;  1AYA A;  1UE9 A;  1D4W A;  2OJ2 A;  2MRK A;  3I35 A;  2B86 A;  4OML A;  2RQR A;  1M3C A;  2P4R A;  1GFC A;  2OAW A;  3MAZ A;  1O4J A;  3H41 A;  2JS0 A;  1WDX A;  3BKB A;  3M0U A;  1F1W A;  3BUM B;  5IBS A;  2KBT A;  2Y3A B;  4J9B A;  2MK2 A;  2K7A A;  2IUH A;  2EKH A;  2EU0 A;  1AB2 A;  1NYF A;  1UDL A;  2JMC A;  3HIZ B;  1YNZ A;  4F17 A;  3MXY A;  4FL3 A;  3EG3 A;  2KRS A;  1D4T A;  1O4M A;  3CWG A;  4E6R A;  2FRW A;  5GJI A;  1GHU A;  4K44 A;  4X6S A;  1E6G A;  1YWO A;  1SHD A;  5DC4 A;  2LNH B;  4JJC A;  1A09 A;  1ABO A;  1I0C A;  4RTY A;  2C0T A;  4CC3 A;  1QKX A;  1AZG B;  1O44 A;  1WXT A;  1W70 A;  3U23 A;  1WI7 A;  4GBQ A;  1X27 A;  4AFQ C;  2GGR A;  2LQW A;  3H0I A;  2KRN A;  1K76 A;  2DVJ A;  2RF0 A;  1R1P A;  1LUI A;  1A1B A;  4AFZ C;  1O45 A;  1AVZ C;  1W6X A;  2EYY A;  2RQU A;  2DYB A;  1NM7 A;  4Y92 A;  4DEX A;  1I3Z A;  1O4A A;  2LNX A;  1CWD L;  1YWP A;  1RUW A;  3EG0 A;  1AYB A;  2SEM A;  2JXB A;  2EL8 A;  2DNU A;  2JM8 A;  4K2R A;  2V1R A;  4EY0 A;  1RI9 A;  2YT6 A;  2DE0 X;  1MV3 A;  1YCS B;  3C0C A;  4JE4 A;  2A37 A;  3EGU A;  2L3P A;  2EYW A;  2K7A B;  3PVQ A;  1O48 A;  5EEQ A;  1LCJ A;  1O4N A;  2HUW A;  3H0H A;  3I9Q A;  1SPS A;  3PS5 A;  2A08 A;  5FWB A;  3TSW A;  4HVV A;  2RNA A;  5I6V A;  1BMB A;  1B47 A;  2KXC A;  1Y0M A;  1HSQ A;  1ABQ A;  2ABL A;  2PTK A;  1OO4 A;  2YSX A;  1A1E A;  2XMF A;  2G6F X;  2MQI A;  3UA7 A;  4DGP A;  1QLY A;  1MUZ A;  4K45 A;  1H8K A;  4JJD A;  3VGO A;  3ZL7 C;  1ZUY A;  2KNB B;  4J9D A;  5AUL A;  4GWF A;  2D0N A;  2W0Z A;  4LN2 A;  2DL8 A;  2LMJ A;  1WIE A;  1H92 A;  1JWO A;  1GCQ C;  2SRC A;  4GL9 E;  3H0F A;  3M0P A;  3TL0 A;  1VYU A;  4JJB A;  2IUI A;  3CBL A;  2RQT A;  2J05 A;  3NGP A;  3PE0 A;  4DEY A;  1BHH B;  1WFW A;  1FYR A;  1GCQ A;  1T0J A;  5BO4 A;  5FW9 A;  3UA6 A;  2YSQ A;  4F14 A;  1RQQ C;  1QAD A;  4AFU C;  4OMO A;  2MC1 A;  5AXI A;  1A0N B;  3N8M A;  2CDT A;  2RSY A;  1SPK A;  2FG0 A;  2ED1 A;  3EAZ A;  2H8H A;  3C7I A;  2KT1 A;  4L1B B;  4D8K A;  1MIL A;  5HCK A;  2ECD A;  2EPD A;  2F2V A;  1O4L A;  2CT4 A;  2ROT A;  1KA6 A;  2EQI A;  2PNI A;  4EIH A;  1RJA A;  1AOJ A;  4ORZ A;  1UUR A;  2PNB A;  1IO6 A;  1ZSG A;  1PWT A;  1AWW A;  2DMO A;  2YDL A;  2HDV A;  2HEQ A;  1IJR A;  2DBM A;  1KSW A;  2RN8 A;  2AUG A;  1RLQ C;  4FSS A;  1PKT A;  2BBU A;  1O4G A;  4E68 A;  1CJ1 A;  1D1Z A;  4GPL B;  2GE9 A;  2SHP A;  3BUX B;  1NG2 A;  4E93 A;  1M27 C;  2DL3 A;  4QT7 A;  2GTJ A;  4HVU A;  2LJ0 A;  1FMK A;  1WX6 A;  1NLO C;  1U3O A;  1PKS A;  2QDL A;  2DL5 A;  5J3X A;  1M27 A;  1B3Q A;  1G2B A;  4JZ3 A;  1O43 A;  1E6H A;  1A81 A;  3VS1 A;  1O4D A;  2LCT A;  2VKN A;  4RUG A;  1K0S A;  2FEI A;  1O46 A;  3PLF B;  1YN8 A;  1K4U S;  2RMX A;  1WLP B;  2EO6 A;  2KNO A;  1LUM A;  1AYD A;  2D8J A;  3NMZ C;  2GSB A;  1O47 A;  3GXX A;  1PNJ A;  1HCS B;  2LX7 A;  3I5S A;  5HKW A;  4DGX A;  2L3Q A;  3TKZ A;  3S8N A;  4J9G A;  1WQU A;  1E7O A;  4J9E A;  1AZE A;  1UFF A;  1JEG A;  2CH4 A;  1AOT F;  2O2O A;  4K11 A;  1AWO A;  2V1Q A;  4HCK A;  2J7I A;  1HCT B;  2H5K A;  1IS0 A;  2PNA A;  4A4B A;  1T3S A;  1KC2 A;  2KE9 A;  5IH2 A;  1T3L A;  1H9O A;  3R6N A;  3OV1 A;  4JZ4 A;  1JU5 C;  3I5R A;  1LKK A;  4LNP A;  2L2P A;  1VYT A;  2D8H A;  2X3W D;  1O4Q A;  4JGH A;  2NWM A;  1SHB A;  1JYU A;  1ZX6 A;  2JM9 A;  2CI8 A;  5EHP A;  3MXC A;  2K79 B;  2Y1M A;  1PRL C;  1BLK A;  4OHD A;  1SHG A;  2AKL A;  1X69 A;  1TZE E;  2AKK A;  2ROL A;  2ECZ A;  4P9V A;  2Y1N A;  1B07 A;  5DC9 A;  2AOA A;  1JU5 A;  1WXB A;  3VS0 A;  2O88 A;  4NWF A;  1OV3 A;  2FPD A;  1O41 A;  2FCI A;  1U5S A;  4XZ1 A;  1BB9 A;  1BHH A;  2BZX A;  1O4B A;  5HKZ A;  5EG3 B;  1X43 A;  1I07 A;  2RVF A;  1XOV A;  2OQ1 A;  3VS4 A;  1JQQ A;  1CSZ A;  1SHA A;  5L23 A;  5DC0 B;  2W10 A;  2FRY A;  4OHE A;  2K6D A;  3PQZ A;  1SHF A;  3VRO A;  1U06 A;  1BFJ A;  2GTO A;  2J06 A;  2RQV A;  4FL2 A;  2DX0 A;  1AWX A;  4H34 A;  3EHQ A;  1OEB A;  3RBB B;  1M30 A;  1JYR A;  1QKW A;  2CT3 A;  2HBW A;  4OMN A;  1OPK A;  5CDW A;  2LJ3 A;  5IBM A;  4OMP A;  1CSY A;  3PFV A;  2DM1 A;  2DLZ A;  4CC2 A;  1ZUK A;  1UEC A;  1M3A A;  5IXB A;  2X3X D;  4CC7 A;  3BUW B;  1NLP C;  1UUS A;  2DM0 A;  1HD3 A;  2DF6 A;  1LKL A;  1FU6 A;  1X2K A;  1JO8 A;  5EC7 A;  2EYV A;  1A07 A;  4HVW A;  2YU7 A;  2J6K A;  3EG1 A;  3N84 A;  4Z89 A;  2KR3 A;  1H3H A;  2ESW A;  1GBQ A;  3TVT A;  3NPF A;  5IHN A;  1A1C A;  1FBZ A;  2PZ1 A;  3OVE A;  1HJD A;  1MW4 A;  1RPY A;  4ESR A;  3VRZ A;  4RTW A;  4P9Z A;  5GJH A;  4GLM A;  3REA B;  3EHR A;  1TG0 A;  4LUD A;  1AEY A;  4OHL A;  3S8L A;  2NUZ A;  5GJW B;  2I0N A;  2IIM A;  2JW4 A;  4HXJ A;  1F2F A;  2CI9 A;  4OHH A;  1QCF A;  3FJ5 A;  3IN7 A;  2O31 A;  2B3O A;  3BUN B;  2RMO A;  4WWQ A;  3S9K A;  4F16 A;  1Z9Q A;  1QG1 E;  2JS2 A;  4X1V A;  2DL4 A;  2A36 A;  2PLE A;  4U17 A;  1PHT A;  2OZO A;  1GRI A;  3CQT A;  2J6F A;  1BM2 A;  3WA4 A;  2K2M A;  3O5Z A;  1S1N A;  3TSZ A;  1O4R A;  3IN8 A;  1BHF A;  2LNW A;  3VS6 A;  1O4P A;  2K79 A;  1NEB A;  4OMM A;  3VS2 A;  4JPB W;  3UF4 A;  5IHI A;  3VS3 A;  1P13 A;  2VVK A;  1Z9Z A;  2M51 A;  3RNJ A;  1JYQ A;  2JTE A;  2MRJ A;  5D0J A;  1VA7 A;  1GBR A;  2L3T A;  2EGE A;  1ZLM A;  1QWF A;  2BTT A;  2EYX A;  2KRM A;  2CH4 W;  4M4Z A;  2DRM A;  5DF6 A;  4AG2 C;  1AD5 A;  3VRY A;  2KYM A;  2E5K A;  2KYB A;  2LZ6 B;  2KXD A;  4R0K A;  2DJQ A;  2HSP A;  1NYG A;  2EYZ A;  4OMQ A;  2DCR A;  1TCE A;  2AZV A;  5FWC A;  1Z3K A;  1UHC A;  1WYX A;  4AFS C;  1LUN A;  2KGT A;  1O4H A;  1M8M A;  2GQI A;  1W1F A;  2CS0 A;  2HDA A;  1TUD A;  1JXM A;  1O4O A;  3VS7 A;  2CBL A;  1KJW A;  2EBP A;  2EGC A;  4RTX A;  2J6O A;  3ZNI A;  2C0O A;  2ETZ A;  2EGA A;  2CSI A;  2EO3 A;  1R1Q A;  1LUK A;  3THK A;  1M3B A;  1KFZ A;  2EW3 A;  1K1Z A;  1A08 A;  1SRM A;  3QWY A;  2H46 E;  2VIF A;  3UYO A;  4NWG A;  3S8O A;  2EOB A;  1ZUU A;  4A63 B;  1O4I A;  4TZI A;  2OI3 A;  3HHM B;  2DLP A;  2GBQ A;  3VS5 A;  1ZBJ A;  1EFN A;  4F5B A;  1KA7 A;  1SPR A;  2IZV A;  4LE9 A;  1BU1 A;  3KFJ A; 
#chains in the Genus database with same CATH topology
 2E10 A;  3CME T;  1R77 A;  4M75 C;  3CCS Q;  3DLL A;  2PLD A;  2NUT B;  4F7U F;  1LJO A;  2GFU A;  3JV3 A;  2CP6 A;  1K73 R;  1UJY A;  2ENM A;  4M77 A;  5GAM e;  2AT1 B;  1BFI A;  3P8B B;  4M77 G;  1YI2 Q;  3OB9 A;  1KC8 U;  3CCL A;  1YJN T;  1ZQ1 A;  2DK3 A;  1X0N A;  4Z88 A;  1QQJ A;  2YUP A;  1X6G A;  1KG1 A;  1SKJ A;  2BZ8 A;  5CIU A;  3CCS T;  4TVR A;  1FX7 A;  1X2Q A;  1UGV A;  4B9X A;  2HCK A;  2FZK B;  2MK5 A;  2O01 E;  4IIM A;  5ECA A;  3CCV T;  3V7C A;  4Z8A A;  1JJ2 P;  2KRO A;  1YFN A;  1YI2 T;  3CC2 Q;  3GP8 A;  3CME A;  1NZL A;  4M75 B;  2L89 A;  1UJ0 A;  5D6X A;  5GAN 2;  3JB9 G;  1X6B A;  3EGX B;  4A4G A;  2K9G A;  1FBV A;  1X01 A;  2D6F A;  3GXW A;  2DKG A;  5CAI A;  3JCM f;  2LRA A;  1I1J A;  1GCP A;  3CCQ Q;  1QCN A;  1FU5 A;  2KGY A;  2LP5 A;  2QA4 Q;  1YJN A;  4M7A F;  3J7A F;  1O4E A;  1Q81 C;  1GL5 A;  4J9H A;  2L3S A;  3CC2 T;  5GAO p;  2MOX A;  3CCS A;  2E64 A;  2VWF A;  1VQP A;  1YVL A;  1VQ4 Q;  3PVL A;  2YUQ A;  3QBY A;  4DBQ A;  2HDX A;  2HD0 A;  1MNE A;  1X6C A;  2EYQ A;  3KBG A;  4RTV A;  3CCV A;  1MV0 B;  2Y4X A;  2EVR A;  3CCQ T;  3MET A;  1YI2 A;  2CIA A;  3TU4 K;  1CSK A;  3M0T A;  2KVQ G;  1N9R A;  5LJ3 j;  1EX4 A;  1UE9 A;  1VIE A;  2C06 A;  1BI2 A;  1VQ5 Q;  4C8Q F;  3GNF B;  4KGV B;  1FMV A;  1VQ4 T;  1GFC A;  2OAW A;  4M7A B;  3M0U A;  3S3M A;  2LTO A;  2IUH A;  4BAC A;  2BUD A;  2DIQ A;  4M78 F;  4FL3 A;  2KRS A;  2XDB A;  5KYY A;  2X4Y A;  1S72 Q;  4QQ6 A;  1NJI U;  1E6G A;  1YWO A;  1SHD A;  2DVE A;  1U1S A;  1QKX A;  3U23 A;  4GBQ A;  1VQ5 T;  2GGR A;  4WF2 A;  2LCC A;  1LUI A;  1R1P A;  2EQK A;  2EYY A;  2DYB A;  4DEX A;  1WHG A;  1I3Z A;  1CWD L;  1YWP A;  1RUW A;  3EG0 A;  2JTF A;  1AYB A;  3MPU B;  3JSC A;  2VXE A;  4C8Q B;  4K2R A;  2V1R A;  4EY0 A;  2A37 A;  4PFP A;  2EYW A;  1O48 A;  1VQ4 A;  3H0H A;  3I9Q A;  3PS5 A;  2A08 A;  5LJ3 h;  1B47 A;  2QK0 A;  3UDC A;  1M1G A;  1HSQ A;  1ABQ A;  2XHC A;  3R6O A;  1A1E A;  2G6F X;  2HKN A;  1VQ9 A;  2MQI A;  1IB8 A;  3TEE A;  3EH2 A;  5AYF A;  4JJD A;  1KHI A;  1M90 R;  1AHJ B;  2KNB B;  2EKO A;  4LN2 A;  1JWO A;  2LMJ A;  3M0P A;  3CPF A;  5CVI A;  2CGH A;  1VQK T;  1VQ5 A;  1BHH B;  4J5Y A;  5FRM A;  5BO4 A;  1T0J A;  1YCY A;  3UA6 A;  3J81 E;  4F14 A;  1RQQ C;  1R0B G;  3OW2 A;  4OMO A;  5HKC A;  2MC1 A;  3PFS A;  1A0N B;  1KQS A;  4RMO A;  2ED1 A;  3VUB A;  4MMK A;  2DXT A;  4D8K A;  4LD6 A;  3NFC A;  1QVG S;  4E7Z A;  3CPW A;  1KC8 R;  3CCM A;  1ZSZ A;  1AOJ A;  2CZ0 B;  1UUR A;  3LW5 E;  3CCJ Q;  2ATC B;  1PWT A;  3CD6 Q;  2DMO A;  2HEQ A;  2DAQ A;  4Y91 A;  4FSS A;  3CCU A;  1CJ1 A;  1D1Z A;  5CQY A;  4GPL B;  4ZGE B;  2DD5 A;  1UGS B;  1B34 B;  4FL6 A;  3FC3 A;  2GF7 A;  4QQD A;  4HVU A;  1G3T A;  1FMK A;  2HL3 A;  4X9D A;  1Q81 U;  2DL5 A;  2HSE B;  3G4S A;  5LJ5 j;  1O43 A;  1VQK A;  1A81 A;  1Q7Y C;  1O4D A;  3CCJ T;  2VKN A;  2K3Y A;  3CD6 T;  1I8F A;  1WLP B;  2COW A;  4XTV A;  3ZFJ A;  1AYD A;  2D8J A;  2GSB A;  3C12 A;  1O47 A;  1HCS B;  3OSS C;  2RK1 A;  3FDR A;  1M4Z A;  1E7O A;  3OYG A;  1UFF A;  4RG2 A;  4RKU E;  2O2O A;  1AWO A;  1G8X A;  2K3X A;  2PNA A;  2L8D A;  5IH2 A;  1T3L A;  2EJ9 A;  2JVV A;  3R6N A;  1JU5 C;  4LDU A;  4LNP A;  2L2P A;  2DPP B;  2LNV A;  2OTJ Q;  2WSE E;  2CI8 A;  4F7U A;  2Y1M A;  1PRL C;  4OHD A;  2AKL A;  1X69 A;  4OB1 B;  4JRP A;  1B07 A;  4J6W A;  2AOA A;  1WXB A;  1O41 A;  1BB9 A;  2BZX A;  5EG3 B;  1I07 A;  3CCJ A;  1LPL A;  5DC0 B;  1OQK A;  3CD6 A;  3L2W A;  3LYI A;  1SHF A;  5LJ5 h;  2J06 A;  4M77 F;  1AWX A;  2K57 A;  3CC7 Q;  2OTJ T;  3EHQ A;  1OEB A;  3RBB B;  4EDU A;  3EG9 B;  1QKW A;  2XDD A;  1CSY A;  1WHL A;  4F04 B;  4FT2 A;  3GPL A;  2DLZ A;  5D6W A;  1UUS A;  4OB3 B;  1HD3 A;  1FU6 A;  1JO8 A;  2EYV A;  1LVK A;  3HFN A;  3A1P A;  3SB2 A;  1TU0 B;  4Q5W A;  3ZEH A;  2J6K A;  3N84 A;  4Z89 A;  1JRI A;  1GBQ A;  1M1K C;  4C5I A;  4C5G A;  3J80 E;  2LC4 A;  4PJO E;  1VQ6 Q;  2HNI A;  1FBZ A;  2OTL Q;  2YRD A;  1HJD A;  1MW4 A;  1RPY A;  3JB9 F;  4RTW A;  4M77 B;  2P0Q A;  2YLC A;  1TG0 A;  2NUZ A;  4PJJ A;  3LX7 A;  2CI9 A;  4KGZ B;  3FJ5 A;  1MGQ A;  2EJG A;  3FIF A;  4PLI A;  2OTJ A;  2RMO A;  3S9K A;  4WTO B;  3OYD A;  1Z9Q A;  4X1V A;  1VQ6 T;  2JN0 A;  1MMD A;  1S1N A;  1RAB B;  3TSZ A;  2OTL T;  1O4R A;  3S3O A;  1C0M A;  3VS2 A;  3VU3 C;  2VVK A;  1BYM A;  3I55 Q;  5D0J A;  1GBR A;  3VYH B;  5LJ3 d;  1M2V B;  4ZGJ B;  2DRM A;  4RCB A;  2QGG A;  5CKE A;  1UGQ B;  1IZ6 A;  3VRY A;  2E5K A;  4FW2 A;  2BIV A;  1W2B A;  2DJQ A;  2HSP A;  2DIG A;  1NYG A;  2EYZ A;  1YIT Q;  4OMQ A;  2AZV A;  1Z3K A;  1UHC A;  2AIR B;  1O4H A;  2MWO A;  3EH1 A;  3OYF A;  2GQI A;  1WHJ A;  1KD1 U;  3I55 T;  1UEB A;  2C0O A;  2EO3 A;  2QAZ A;  1K1Z A;  2H46 E;  4FYV B;  3UYO A;  2A0F B;  1VQ6 A;  4HA8 A;  5AT1 B;  2GBQ A;  2OTL A;  1YIT T;  4C92 E;  2IZV A;  4LE9 A;  4XU0 A;  1BU1 A;  3M9Q A;  1Q81 R;  2CZ1 B;  2PVG B;  4J83 A;  1V1C A;  2LDM A;  1A1A A;  3PJP A;  1J3T A;  2NUP B;  3CD3 A;  2VB6 A;  2Z0W A;  2LQN A;  4IIO A;  3PSJ A;  4A4K A;  2DLY A;  1ARK A;  2E41 A;  2RQW A;  5GAN 3;  1U8R A;  3QHS A;  3PGG A;  2FPF A;  2L4K A;  4D8D A;  4RTU A;  4PJO D;  1G3S A;  3QKJ A;  4OP0 A;  1WA7 A;  4PL6 A;  1OZ2 A;  1JXO A;  5I22 A;  3I55 A;  5GAM j;  1FHS A;  2FPE A;  3H8Z A;  3HRS A;  4O6J A;  3OYH A;  4WCI A;  4J7I A;  1KQS P;  2IVW A;  2O9S A;  5KYY B;  5GMK i;  1BCO A;  4RCC A;  4KT0 E;  2JT4 A;  4EMG A;  1YIT A;  2E5Q A;  2EFI A;  1QW1 A;  3CPW P;  4OHI A;  2YUO A;  7AT1 B;  2JUF A;  2LQK A;  4PK4 A;  1UG1 A;  1O4F A;  3E1S A;  3REB B;  1M61 A;  1BLJ A;  3E9F A;  3QWX X;  3JB9 I;  1BF5 A;  3M55 A;  1QWE A;  5C6S A;  4HT8 A;  1NEG A;  1IHV A;  2WSF E;  3KFV A;  4KH1 B;  1XA6 A;  2CRE A;  3M7F A;  1Y57 A;  2XID A;  3OB2 B;  2M0Y A;  2ZPB B;  2AZS A;  3ASK A;  1BKL A;  3NTI A;  5FLX E;  4A4E A;  3OYN A;  3G1J A;  8AT1 B;  5A2Q E;  3CCL Q;  5EHR A;  1SEM A;  2JZ2 A;  2DTI A;  3GQI B;  1AYC A;  2C9W A;  4DOW A;  3JCM e;  5LJ5 d;  3OYA A;  4XU2 A;  3WVE B;  3CXC A;  1RLP C;  5GAM h;  4F5A A;  1WPY A;  3LH5 A;  1AWJ A;  4D6W A;  3V8L A;  1PRM C;  3HKS A;  4M7D C;  2CUD A;  6AT1 B;  5KYX A;  1R1S A;  2MYS A;  4C5E A;  1OO3 A;  1OPL A;  2YRV A;  1AYA A;  3CCL T;  2MRK A;  3C94 A;  4C92 D;  3I35 A;  3RR6 A;  1PSE A;  4OML A;  1OZ3 A;  1M3C A;  4E7I A;  4LXC A;  3MEU A;  2JS0 A;  3CMA A;  4PJO A;  3VYG A;  1F1W A;  3BUM B;  1ZSZ B;  4XAX B;  5IBS A;  2DXC A;  2R5M A;  4PJO G;  3LH0 A;  4F17 A;  3CWG A;  3BY7 A;  2FRW A;  2QGF B;  3FRN A;  1N8R R;  4K44 A;  4X6S A;  3MP6 A;  5DC4 A;  2LNH B;  5HK0 A;  3QO3 A;  4JJC A;  5LJ3 g;  1ABO A;  2DXU A;  1O44 A;  1LOJ A;  3PNW C;  1AZG B;  1WI7 A;  1VQP Q;  3E19 A;  1VQN T;  3ER0 A;  4BI8 B;  3MKD A;  5GAN j;  4O5V A;  2DVJ A;  4AFZ C;  4M7D B;  2RQU A;  4LDW A;  1NM7 A;  3CCV Q;  4PLL A;  2DTO A;  4B6M A;  4BDY A;  2SEM A;  2JXB A;  2EL8 A;  2DNU A;  2RO0 A;  2JNG A;  1FWZ A;  3RMQ A;  2DJZ A;  3MJX A;  3OQ5 A;  2K7A B;  1KD1 R;  2HUW A;  1SPS A;  4HVV A;  3PIO A;  1VQP T;  5I6V A;  2LCL A;  3OYE A;  2KXC A;  4BY6 B;  2PTK A;  1OO4 A;  1RAE B;  2XKO C;  2R58 A;  4FYW B;  1QMC A;  1QLY A;  2KSS A;  5GAN 5;  2FB7 A;  4IUP A;  3VGO A;  2A3L A;  1WNL A;  3SWN A;  4F7U B;  4GWF A;  1GCQ C;  2F69 A;  4OMF B;  1VYU A;  1VQN A;  2XU8 A;  4JJB A;  3JRZ A;  5J26 A;  3JB9 J;  2IUI A;  2RQT A;  2J05 A;  3NGP A;  4DEY A;  1WFW A;  3OYL A;  5A0L A;  4A54 A;  4AFU C;  2DFU A;  3C95 A;  4M7A C;  1TTH B;  2CDT A;  5GMK m;  3MEW A;  2RSY A;  3M59 A;  5FRO A;  4C92 A;  5GAN h;  4L1B B;  1MIL A;  2ECD A;  1QP3 A;  3DB4 A;  4C92 G;  2ROT A;  4A4F A;  2O4X A;  2FHD A;  4ELZ C;  1SKU B;  2XDP A;  4ORZ A;  4XU3 A;  1ZSG A;  1NBE B;  2WSC E;  1AWW A;  2D0Q B;  3HFO A;  1W2B P;  2AUG A;  5KCO A;  4PNO A;  1RLQ C;  1PKT A;  2ZAE A;  1M27 C;  3CBP A;  2DL3 A;  2QQB A;  4QT7 A;  4M75 E;  3OMC A;  3X26 B;  1VQ9 Q;  3X28 B;  1NLO C;  1PKS A;  1U1T A;  2VXF A;  4A4H A;  2VUB A;  4C8Q C;  4JZ3 A;  1NPP A;  3QPH A;  1BI3 A;  4E7J A;  2LCT A;  1K0S A;  1K4U S;  2VGN A;  3NTK A;  4E7S A;  3V7S A;  3RUX A;  1LUM A;  4IUT A;  4RG8 A;  4FCY A;  1BI0 A;  3NMZ C;  2EQU A;  2QTV A;  4M78 C;  1TOV A;  3GXX A;  4L5G A;  3I5S A;  1IXD A;  1PD1 A;  2L3Q A;  2DZ9 A;  3CC4 Q;  1WQU A;  3DB3 A;  1AZE A;  1JEG A;  1VQ9 T;  2KAF A;  2YLB A;  1Y96 A;  2V1Q A;  3QUI A;  4HCK A;  4OB2 B;  3G71 T;  4HCB A;  2DYI A;  1HCT B;  1R8O B;  3CCM Q;  1YIJ Q;  1KC2 A;  5LJ5 g;  1VYT A;  2D8H A;  1O4Q A;  4BE0 A;  2NWM A;  1SHB A;  4JGH A;  1JYU A;  1ZX6 A;  3E9G A;  5EHP A;  1VOM A;  2KQW A;  2XIC A;  1BLK A;  1TZE E;  1OUL A;  2AKK A;  2ECZ A;  3CCU Q;  2Y1N A;  5M9O A;  5DC9 A;  1EZZ B;  2V8I A;  2PQW A;  2KDS A;  4OB0 B;  3VS0 A;  2EWN A;  2FPD A;  2FCI A;  2JJ9 A;  1U5S A;  3CC4 T;  4XZ1 A;  1Q86 U;  1X43 A;  2RVF A;  1M5Q 1;  3VS4 A;  5DM7 R;  1JQQ A;  4EMK A;  1SHA A;  5L23 A;  1D0X A;  3G4S Q;  1W4S A;  3QZ5 B;  3WXM B;  1VQK Q;  3M53 A;  3CCM T;  1YIJ T;  2DXB A;  4GY5 A;  1RL2 A;  3PQZ A;  1I81 A;  3V8K A;  5GAM d;  1U06 A;  2IPO B;  4M78 B;  4P5N A;  2LT4 A;  3FB9 A;  1JYR A;  4Y28 E;  3CCU T;  3QXE B;  2CT3 A;  1OPK A;  5IBM A;  5A0G A;  4QKU A;  2DM1 A;  4MZM A;  5I2S A;  3G71 A;  1K9M C;  1ACM B;  4R55 A;  1K8A C;  2DEQ A;  5KYW A;  3PIP A;  2F5K A;  2DM0 A;  4FYX B;  3G4S T;  1LKL A;  1VQ7 Q;  3EFS A;  1WHK A;  5EC7 A;  2FZG B;  1B7T A;  3L1A A;  2G3R A;  4HVW A;  2YU7 A;  3EG1 A;  1RAG B;  2KR3 A;  1H3H A;  4KH0 B;  5IHN A;  4NL2 A;  3CC4 A;  3JAM E;  1Q82 C;  3OBY A;  2JTM A;  2BE7 D;  4JRK A;  1QVF S;  3MO8 A;  3NTH A;  3VRZ A;  2M1H A;  4M75 D;  4XTU A;  2CS7 A;  4P9Z A;  5GJH A;  1C1A A;  4GLM A;  1YIJ A;  3EHR A;  3C4S A;  3CXC P;  4OHL A;  3S8L A;  3URG A;  2I0N A;  1G5V A;  5GAO m;  1VQ7 T;  3BUN B;  2CZ6 B;  4WWQ A;  1BI1 A;  2EQM A;  2DL4 A;  2DZC A;  4L59 A;  2J6F A;  3O5Z A;  3IN8 A;  1BHF A;  4C0D C;  2LNW A;  3VS6 A;  1O4P A;  2K79 A;  1NEB A;  3BW1 A;  5IHI A;  1P13 A;  2M51 A;  2JTE A;  1Y71 A;  2MRJ A;  1VA7 A;  2RI2 A;  1M1F A;  4R56 A;  1K73 C;  2BTT A;  1JBM A;  2EYX A;  2RJD A;  5DF6 A;  4AG2 C;  2PVD B;  4N0A A;  1BIB A;  4JJN K;  2KYM A;  2AHJ B;  2LZ6 B;  2KXD A;  4ZTF A;  2DCR A;  1TCE A;  1G3Y A;  2NUT A;  1LUN A;  1M8M A;  1VQL Q;  4EMH A;  1TUD A;  4L6V 5;  3VS7 A;  5GAN f;  3QYG B;  1VQ7 A;  2H3E B;  1XTD A;  3UT1 A;  4IKF A;  3ZNI A;  2R5A A;  4M7A D;  2EGA A;  1LUK A;  4BE2 A;  1D3B A;  1M3B A;  1KFZ A;  4PJO F;  1SRM A;  2X4J A;  2RH2 A;  3QWY A;  1X6O A;  3S8O A;  2EOB A;  1ZUU A;  3HTR A;  4QW2 A;  1O4I A;  3L2U A;  2E3I A;  1ZBX A;  5GAN d;  4JLI A;  4C0D B;  3OS1 A;  2ZPF B;  3KFJ A;  1VQL T;  3OP0 A;  4M77 C;  4ZN1 A;  1T0H A;  2AK5 A;  1SSH A;  2HQX A;  3IQL A;  1NRV A;  5HY6 A;  3TCJ A;  3WVD B;  4F59 A;  1OYX A;  3M56 A;  4MDX A;  4M75 A;  2ZPH B;  3BDU A;  1SRL A;  3MEV A;  4H1O A;  4M75 G;  4C8Q D;  1UB4 A;  2CUB A;  3LWH A;  3VRR A;  3L2V A;  2RD1 A;  2LRQ A;  1CWE A;  3T9N A;  1Y1U A;  5I21 A;  1N9S A;  4ROJ A;  1RAI B;  4A4C A;  1VYV A;  4J9I A;  3EAC A;  1LCK A;  4J9F A;  1NJI R;  3GBQ A;  3AT1 B;  3RKW A;  1YVH A;  2IUG A;  2DRK A;  2CSQ A;  3IMD A;  5HKY A;  3EGD B;  3JCM W;  2AOB A;  3K2M A;  2X4X A;  3QZ9 B;  2M0O A;  3KXT A;  1MMA A;  2K5F A;  1TUC A;  2DBK A;  2KT8 A;  4KRT A;  4RTT A;  3JCM P;  1OU8 A;  1UTI A;  1ZA1 B;  4J6X A;  4JRI A;  2XG8 D;  5DY9 A;  1K0X A;  2RHU A;  1VQL A;  2BZY A;  1Q86 R;  3US4 A;  1NPR A;  4JRQ A;  1K8A U;  4J7F A;  5EEL A;  4N4G A;  1CKA A;  3NHN A;  3BDL A;  1CKB A;  5GAM g;  1BG1 A;  1RI0 A;  2IG0 A;  4IUR A;  2D1X A;  2P84 A;  2EKX A;  3A98 A;  4C92 F;  3HCK A;  3P8D A;  5LJ3 f;  3T04 A;  1BKB A;  2ZPI B;  2QEX A;  2MWP A;  2RHY A;  2JYQ A;  1KIK A;  5IXF A;  4C0G A;  3QJY A;  5GAO r;  1I5O B;  3SWN B;  5I11 A;  1O4K A;  2C0I A;  1PIC A;  1O42 A;  3GIB A;  2MF2 A;  2QQR A;  3OYI A;  4FIB A;  3RES A;  2JMA A;  1H64 1;  1C6V X;  3M0S A;  2HAX A;  2A28 A;  2E1H A;  2OJ2 A;  1PD0 A;  2E3H A;  1Q7Y U;  1K73 U;  2RQR A;  1JJ2 S;  3F70 A;  4JS5 A;  1OU9 A;  3H41 A;  3HHT B;  1FMW A;  2KBT A;  4ELY C;  3RER A;  2Y3A B;  1M90 C;  2MK2 A;  3HRU A;  1IHW A;  4NOY A;  4EPC A;  2EU0 A;  1NYF A;  1UDL A;  3HIZ B;  1YNZ A;  4PFO A;  3MXY A;  1O4M A;  4E6R A;  5GJI A;  1VQ8 A;  4VUB A;  3A8O B;  1I0C A;  4RTY A;  4CC3 A;  2COY A;  3X24 B;  1X27 A;  1QVG P;  4AFQ C;  5GAN 8;  2LQW A;  1OI1 A;  4LD9 K;  2LVM A;  1K76 A;  5J39 A;  2LQ8 A;  1O45 A;  2MI6 A;  1W6X A;  5D7U A;  2LNX A;  1KC8 C;  4KGX B;  5FU7 B;  1Y7X A;  4JLG A;  1SG5 A;  2ZPE B;  2YT6 A;  1MV3 A;  1YCS B;  3C0C A;  3X20 B;  5IAY A;  3EGU A;  1KHC A;  3JCM h;  1LCJ A;  3PMI A;  1NE8 A;  2KI7 A;  1O4N A;  2RJF A;  2QI2 A;  3TSW A;  4N4I A;  3H9N A;  1BMB A;  2VGM A;  3QG1 A;  2YWW A;  1Y96 B;  2QQA A;  3EFR A;  2YSX A;  3CMA Q;  2XMF A;  2X51 A;  3G6E Q;  5GAN g;  3M4Y A;  4DGP A;  1MUZ A;  3OY9 A;  4K45 A;  2XD0 A;  3ZL7 C;  5AUL A;  4A53 A;  3V7R A;  2DO3 A;  2DL8 A;  5GMK e;  5J3B A;  1I4K 1;  2EJF A;  2SRC A;  4J6Y A;  4GL9 E;  3OS0 A;  3TL0 A;  1VIF A;  1UGP B;  5CK9 A;  2RA2 A;  3CBL A;  3PE0 A;  5DLQ E;  1FYR A;  3PT9 A;  2YSQ A;  1D1C A;  1TH7 A;  5GAO q;  3M58 A;  2E6Z A;  5AXI A;  4EMK B;  3LYV A;  3N8M A;  3CMA T;  1SPK A;  4XK8 E;  3G6E T;  1M1K U;  1ZSZ C;  5LJ5 f;  2KT1 A;  2M16 A;  4M77 D;  2EPD A;  2F2V A;  3QYH B;  1KA6 A;  2EQI A;  2PNI A;  4EIH A;  2RJC A;  1IO6 A;  2YDL A;  1IJR A;  4X9C A;  1KSW A;  2BBU A;  1Q95 G;  1RAD B;  5KYN A;  2CP5 A;  5KYW B;  1NG2 A;  4E93 A;  2ZCF B;  2GTJ A;  2CP3 A;  2LJ0 A;  4E7K A;  1WX6 A;  2QDL A;  4ATO A;  2ZGW A;  5J3X A;  1ZA2 B;  3A5Z B;  2K2V A;  2DER A;  1B3Q A;  1G2B A;  1WHH A;  3VS1 A;  5IN1 A;  3HP9 A;  4RUG A;  1O46 A;  1YN8 A;  1VQN Q;  2RMX A;  2EO6 A;  2F5T X;  2KNO A;  5L8R E;  4E47 A;  3HL8 A;  3G6E A;  2FZC B;  2LX7 A;  1PSF A;  5HKW A;  3DLM A;  4BY6 C;  4DGX A;  3INZ A;  3S8N A;  4J9G A;  4J9E A;  4HT9 A;  4V2S A;  3QJ6 A;  1TSF A;  2L3R A;  1WZO A;  1AOT F;  2H5K A;  3EG9 A;  3JCM Q;  5KYU A;  1PM3 A;  2RI3 A;  3OV1 A;  1LKK A;  4FU6 A;  3LGL A;  2JM9 A;  3MXC A;  2K79 B;  2LX9 A;  1SHG A;  2FVU A;  2ROL A;  4J8O A;  1JU5 A;  2PUO B;  1OV3 A;  1O4B A;  5IT9 E;  3CBM A;  1XOV A;  2HZY A;  2OQ1 A;  2E6N A;  2QXF A;  2MAM A;  1X75 C;  3DKM A;  2P0K A;  1HXD A;  2HQH A;  4HCC A;  2DTH A;  4OHE A;  3VRO A;  4KBM B;  4MDW A;  3L2Q A;  1Q7Y R;  3RIR A;  1HK9 A;  2RQV A;  4M75 F;  2DX0 A;  4FL2 A;  3PMT A;  1YJ9 Q;  3OA6 A;  2D9T A;  2HBW A;  1IRE B;  5CDW A;  2LJ3 A;  4OMP A;  1D3B B;  5CQX A;  4CC2 A;  1ZUK A;  4JDS A;  2X3X D;  2NYS A;  2OX7 A;  4CC7 A;  1NLP C;  2P0P A;  4BUG A;  5GAO n;  4M7D E;  1MMG A;  1X2K A;  4BE1 A;  2MMP A;  1FXX A;  2BKD N;  1WQW A;  4UC4 A;  2WAC A;  4E7H A;  1YJ9 T;  2E12 A;  4C0Z A;  3TVT A;  3TRE A;  3NPF A;  3VJP A;  1M2V A;  2LT1 A;  1VQO Q;  2PZ1 A;  2PVO B;  3Q1J A;  1VUB A;  4C5H A;  4ESR A;  4OF1 A;  1WJQ A;  3A8H B;  3REA B;  4LUD A;  1AEY A;  4N4H A;  5I2M A;  2FYK A;  5GJW B;  1F2F A;  4OHH A;  3JCM J;  3OS5 A;  3IN7 A;  3I56 Q;  4ANJ A;  1QG1 E;  4F7U E;  3RKX A;  2JS2 A;  2B8A A;  2YRC A;  3UPU A;  4AT1 B;  1PHT A;  3VKI A;  3OYC A;  2OZO A;  1EIF A;  3CQT A;  1BM2 A;  1VQO T;  3WA4 A;  2K2M A;  2R57 A;  2CP7 A;  4OMM A;  1SSF A;  3G71 Q;  4JPB W;  3UF4 A;  3VS3 A;  3JCM d;  3P8H A;  2COZ A;  2EQJ A;  1Z9Z A;  2EGE A;  2CH4 W;  4IUU A;  4M4Z A;  1YJ9 A;  3I56 T;  1V76 A;  2KYB A;  4R0K A;  2NUP A;  2RM4 A;  4DBF A;  2QAS A;  1WYX A;  4AFS C;  2QA4 T;  1M1K R;  1WGS A;  1W1F A;  2CS0 A;  1JXM A;  1O4O A;  4ME7 A;  2J6O A;  2KK4 A;  2ETZ A;  5HK3 A;  2VIF A;  1GXI E;  1D1A A;  4NWG A;  5GMK l;  4A63 B;  3CEY A;  1M2O A;  2OI3 A;  3M5A A;  3HHM B;  4FW1 A;  1VQO A;  3VS5 A;  5GAM f;  3CC2 A;  1EFN A;  5GAN e;  4F5B A;  1KA7 A;  4PJN A;  2KMT A;  1RAF B;  2QQ9 A;  4M7A E;  4NS5 A;  2PU9 B;  1N6A A;  2L6K A;  4U1P A;  2YUN A;  3BUO B;  1N5Z A;  1VQM Q;  3IMJ A;  3I56 A;  1G83 A;  3MCA B;  1FYN A;  2QG9 B;  1BBZ A;  5CCA A;  4M7D D;  2K5L A;  3CCQ A;  1QVF A;  2RK2 A;  4JEG A;  1TS9 A;  1IRX A;  1TWB A;  1XQH A;  2QA4 A;  1UGR B;  1QVG A;  3GLX A;  1GFD A;  3OMG A;  1D1B A;  2L0A A;  2DA9 A;  2Y4Y A;  1K9A A;  1UHF A;  3M0R A;  2LJ1 A;  4CC4 B;  3MHX A;  1WXU A;  4J9C A;  1YP5 A;  1S72 T;  5CKD A;  3PSK A;  3EFO A;  4FBN A;  5IHK A;  3OYM A;  3AHU A;  2GNC A;  3HPW A;  1MND A;  1VQM T;  2GQV A;  1PC0 A;  3TQ7 P;  1RAA B;  3V8J A;  2DIL A;  2K3B A;  2O9V A;  3JCM b;  3QDF A;  3ULR B;  3JCM X;  4C8Q E;  2CRH A;  4QSY A;  4LDX A;  1AOU F;  3HRT A;  2X4W A;  3O8V A;  1NZV A;  2HMH A;  1BK2 A;  2XK0 A;  5CKB A;  4M78 E;  1KK7 A;  3EG2 A;  3VUZ A;  3VRQ A;  1O4C A;  3VRP A;  4EIK A;  2K5I A;  3SEM A;  2LCS A;  3OYY A;  4NL3 A;  2Y90 A;  2ZZD A;  3E2U A;  1KQ2 A;  4IUV A;  1WJS A;  1ZFP E;  2MIO A;  2VYT A;  1BKM A;  2P4T A;  2KK6 A;  1G3W A;  3CXL A;  3RKY A;  3M57 A;  4C0F A;  2RPN A;  2F2W A;  2F2X A;  4AG1 C;  3OYB A;  4E7L A;  1N8R C;  3OB1 B;  4BB7 A;  2DX1 A;  2KEA A;  3N7Y A;  2ED0 A;  1S72 A;  3UAT A;  3BE3 A;  2RHZ A;  4CRI A;  3LGF A;  2ROR A;  2KY9 A;  1OX9 A;  2MPX C;  1VQM A;  2GFA A;  3PTA A;  3FEO A;  2CR4 A;  2DL7 A;  4RTZ A;  2NLU A;  2QMS A;  5KAZ A;  3FLG A;  5LJ3 e;  4IUQ A;  1OOT A;  5GJV B;  3GOX A;  2E65 A;  3VRN A;  3EAE A;  1O49 A;  3M0Q A;  4Z02 A;  4XZ0 A;  4LUE A;  2MCN A;  1YHQ Q;  4BDZ A;  2XP1 A;  3SHW A;  3OW2 S;  5KH6 A;  1KQS S;  2VAS A;  1KD1 C;  1UUE A;  4ZNX A;  1BIA A;  2FO0 A;  4M7D A;  1D4W A;  3OBW A;  2B86 A;  2EIF A;  4PJO C;  3ZBD A;  4M7D G;  3CPW S;  5FRN A;  4XTW A;  2P4R A;  4YTL A;  3MAZ A;  1O4J A;  2EAY A;  4GLK A;  4JUV A;  1I5L A;  1WDX A;  3JB9 H;  3BKB A;  1WQ7 A;  3HSB A;  2M02 A;  1O9S A;  4J9B A;  2K7A A;  5C0M A;  2CP2 A;  2EKH A;  2E70 A;  1AB2 A;  1YHQ T;  2JMC A;  4XTY A;  3EG3 A;  1D4T A;  1YBY A;  4XTX A;  1GHU A;  4XQ3 A;  2X35 A;  3JCM g;  2PUK B;  2QEX Q;  1M9S A;  2GCX A;  3BFM A;  3L2R A;  1A09 A;  5GAO l;  2C0T A;  1WXT A;  1W70 A;  5DLO A;  3M4G A;  1R0C B;  5KYX B;  2YXY A;  3H0I A;  2KRN A;  4QVZ A;  2RF0 A;  1A1B A;  4PJM A;  4F7U G;  1AVZ C;  4Y92 A;  3CCE Q;  1O4A A;  1QVP A;  1N27 A;  3EGX A;  2JM8 A;  1RI9 A;  2DE0 X;  1PCX A;  4PJO B;  4JE4 A;  2QEX T;  2L3P A;  4HKE A;  3PVQ A;  5EEQ A;  3QSU A;  2E4H A;  4M78 D;  5FWB A;  3MEA A;  4MML A;  2RNA A;  4DA4 A;  2CZ7 B;  1Y0M A;  3SWN C;  2ABL A;  4XU1 A;  4BD3 A;  1YHQ A;  3L2Z A;  3UA7 A;  5KYU B;  3G7Z A;  3CCE T;  5GAN 4;  1D0Z A;  1H8K A;  3JCM c;  4LDY A;  1ZUY A;  4J9D A;  3GNG A;  1PG5 B;  3JCM V;  2D0N A;  2L5Q A;  2W0Z A;  3OYK A;  1H92 A;  1WIE A;  4XTZ A;  4DBR A;  1IGQ A;  3H0F A;  1K9M U;  2YHT A;  1VQ8 Q;  3KUF A;  4C92 C;  1GCQ A;  5FW9 A;  1QAD A;  3CC7 T;  4ZTJ A;  5GMK j;  2HBP A;  4AMC A;  4BI3 A;  2FG0 A;  3EAZ A;  2H8H A;  3C7I A;  1D09 B;  2QDY B;  5D6Y A;  5HCK A;  1O4L A;  1Q82 U;  2CT4 A;  4M7A A;  2V26 A;  1JJ2 A;  1RJA A;  2PNB A;  5KCH A;  2XI9 A;  4M7A G;  3QII A;  1NZ9 A;  4OVA A;  1VQ8 T;  2HDV A;  4CI0 C;  2DBM A;  2RN8 A;  3LLR A;  1O4G A;  4E68 A;  3CCR Q;  5LJ5 e;  3CCE A;  2GE9 A;  2SHP A;  3BUX B;  1F1B B;  1RAC B;  1QP2 A;  3GF5 A;  4M77 E;  4HCZ A;  5CO7 A;  2RHI A;  2HKQ B;  1U3O A;  1N8R U;  2OAU A;  4LDV A;  4DBH A;  4PKC C;  1IGU A;  1XJW B;  5FU7 C;  3RDV A;  1M27 A;  3CBO A;  3L42 A;  3SFM A;  1E6H A;  3LWI A;  2FEI A;  3SD4 A;  4C92 B;  1MMN A;  3PLF B;  3CC7 A;  5KE3 A;  4FSX A;  4C8Q A;  5GAN 6;  2O4X B;  5LL6 S;  4MZT A;  1PNJ A;  3CCR T;  2H3J A;  4C8Q G;  4DOV A;  3TKZ A;  1TXQ A;  4QVC A;  2K4Y A;  3OSV A;  5GMK h;  4M78 A;  2CH4 A;  1P92 A;  2ZPG B;  4K11 A;  2J7I A;  2DEU A;  4M78 G;  1IS0 A;  4A4B A;  1T3S A;  2KE9 A;  1H9O A;  4JZ4 A;  4OGE A;  3I5R A;  8ATC B;  1QVF P;  2X3W D;  2FL7 A;  2RHX A;  2JOY A;  4PFZ A;  1AT1 B;  4P9V A;  1V29 B;  5FU6 C;  2HL5 C;  4NWF A;  4EMK C;  2O88 A;  3S6W A;  1W2B S;  4FM4 B;  1BHH A;  5HKZ A;  2RI5 A;  1HYO A;  4JS4 A;  5CR2 A;  1Y07 A;  1YJW Q;  1CSZ A;  1O75 A;  5KE2 A;  2DD4 A;  2W10 A;  2FRY A;  2X9H A;  2K6D A;  4FYY B;  3H6Z A;  1BFJ A;  2GTO A;  2V8K A;  3CCR A;  4H34 A;  3OS2 A;  4II1 A;  1M30 A;  1D0Y A;  4OMN A;  1XNI A;  3MP1 A;  3FJP A;  3PFV A;  2I2L A;  1SF9 A;  2M9U A;  1UEC A;  1M3A A;  5IXB A;  4B9W A;  3BUW B;  1YJW T;  2DF6 A;  1B34 A;  4MZP A;  3OW2 P;  2CP0 A;  3VV0 A;  3X25 B;  1RAH B;  1A07 A;  2RJE A;  2HMA A;  2BE9 B;  2ESW A;  5FU6 B;  2A7Y A;  2DET A;  1A1C A;  3OVE A;  4PJL A;  1QCO A;  1ZHI A;  3A8G B;  1M8V A;  5A0D A;  9ATC B;  2HQE A;  2IIM A;  2JW4 A;  4HXJ A;  2VV5 A;  2V8J A;  1LNX A;  1QCF A;  4ZN3 A;  2O31 A;  2B3O A;  5CKF A;  1TUG B;  4F16 A;  5CKH A;  1H3Z A;  4BI4 A;  4ZGD B;  3SDZ A;  3EFO B;  2A36 A;  2PLE A;  4U17 A;  1GRI A;  4KUD K;  2QYZ A;  4E2F B;  4KUI A;  1YJW A;  4QVD A;  3QDR B;  4N0A C;  1BCM A;  2VC8 A;  3RNJ A;  1JYQ A;  3A8L B;  1KQ1 A;  1WJR A;  2F1L A;  1K9M R;  2L3T A;  1K8A R;  1ZLM A;  1QWF A;  2KRM A;  1JB0 E;  2CYZ B;  3S3N A;  4DQ2 A;  3JB9 D;  1AD5 A;  2RB6 A;  1DJ7 B;  3ME9 A;  1OX8 A;  3D7S B;  5FWC A;  4X34 A;  1WHM A;  2KGT A;  3N5B B;  1MHN A;  4M7D F;  1NJI C;  3CME Q;  1Q82 R;  2HDA A;  2CBL A;  1KJW A;  2EBP A;  2EGC A;  4RTX A;  4KUL A;  2CSI A;  1R1Q A;  2QTX A;  3THK A;  3A8M B;  2EW3 A;  1A08 A;  3MP8 A;  3UWN A;  3RMS A;  2QQS A;  4TZI A;  5GAN 7;  2DLP A;  5EG2 A;  3CXC S;  1M90 U;  4FT4 A;  4OGC A;  3OYJ A;  4QQG A;  1ZBJ A;  1Q86 C;  3K2T A;  2CKK A;  1YJN Q;  1SPR A;  3EGD A;  3M54 A; 
#chains in the Genus database with same CATH homology
 1V1C A;  2L6K A;  1A1A A;  3OP0 A;  1J3T A;  3PJP A;  4U1P A;  2YUN A;  3BUO B;  3CD3 A;  1N5Z A;  1T0H A;  2AK5 A;  2PLD A;  4IIO A;  2LQN A;  3IMJ A;  1SSH A;  3PSJ A;  1NRV A;  3IQL A;  1G83 A;  1FYN A;  3JV3 A;  1BBZ A;  4F59 A;  1UJY A;  2ENM A;  2DLY A;  1ARK A;  4JEG A;  2RQW A;  1SRL A;  1BFI A;  2FPF A;  4H1O A;  2CUB A;  1GFD A;  3VRR A;  2L4K A;  2L0A A;  2DA9 A;  4D8D A;  4RTU A;  1K9A A;  1UHF A;  1CWE A;  1Y1U A;  1WA7 A;  3M0R A;  2LJ1 A;  4CC4 B;  1X0N A;  1JXO A;  1WXU A;  4J9C A;  1YP5 A;  4Z88 A;  5I22 A;  3PSK A;  2YUP A;  1X6G A;  1SKJ A;  4ROJ A;  4A4C A;  1VYV A;  4J9I A;  2BZ8 A;  3EAC A;  1FHS A;  4FBN A;  1LCK A;  2FPE A;  4J9F A;  3GBQ A;  5IHK A;  1YVH A;  2IUG A;  2DRK A;  2GNC A;  1X2Q A;  2CSQ A;  4WCI A;  3IMD A;  5HKY A;  2DIL A;  2K3B A;  2O9V A;  2O9S A;  1UGV A;  2AOB A;  3K2M A;  2HCK A;  3ULR B;  2JT4 A;  2CRH A;  4QSY A;  1AOU F;  4IIM A;  5ECA A;  1TUC A;  2DBK A;  2KT8 A;  4KRT A;  4Z8A A;  4RTT A;  2KRO A;  1UTI A;  1NZV A;  2YUO A;  1K0X A;  4OHI A;  2HMH A;  1BK2 A;  1O4F A;  1BLJ A;  1UG1 A;  2BZY A;  3US4 A;  3REB B;  1M61 A;  1NZL A;  3QWX X;  3EG2 A;  5EEL A;  1CKA A;  1UJ0 A;  3NHN A;  3VRQ A;  1BF5 A;  1O4C A;  1CKB A;  1X6B A;  3VRP A;  4EIK A;  1BG1 A;  2K9G A;  3SEM A;  1FBV A;  1QWE A;  2LCS A;  1NEG A;  2D1X A;  3GXW A;  3KFV A;  1ZFP E;  1I1J A;  2EKX A;  2MIO A;  1GCP A;  3A98 A;  1BKM A;  1XA6 A;  2CRE A;  2KK6 A;  3CXL A;  1FU5 A;  3HCK A;  3M7F A;  1Y57 A;  2LP5 A;  3OB2 B;  2M0Y A;  3T04 A;  2RPN A;  2F2W A;  2F2X A;  4AG1 C;  2AZS A;  3OB1 B;  1BKL A;  1O4E A;  2DX1 A;  2KEA A;  3N7Y A;  2ED0 A;  3UAT A;  1GL5 A;  4J9H A;  2L3S A;  5EHR A;  2JYQ A;  2MOX A;  1SEM A;  1KIK A;  2ROR A;  5IXF A;  2VWF A;  3GQI B;  1AYC A;  2C9W A;  1YVL A;  2CR4 A;  2DL7 A;  3PVL A;  4RTZ A;  2YUQ A;  2QMS A;  2HDX A;  5I11 A;  1RLP C;  1O4K A;  5KAZ A;  1X6C A;  4F5A A;  1OOT A;  2C0I A;  1PIC A;  5GJV B;  4RTV A;  1O42 A;  3VRN A;  1O49 A;  3LH5 A;  3M0Q A;  1AWJ A;  1MV0 B;  4LUE A;  4XZ0 A;  2EVR A;  1PRM C;  2MCN A;  2CIA A;  2JMA A;  2CUD A;  2XP1 A;  1CSK A;  3SHW A;  3M0T A;  3M0S A;  2A28 A;  1R1S A;  1UUE A;  4ZNX A;  1OO3 A;  1OPL A;  2FO0 A;  1AYA A;  1UE9 A;  1D4W A;  2OJ2 A;  2MRK A;  3I35 A;  2B86 A;  4OML A;  2RQR A;  1M3C A;  2P4R A;  1GFC A;  2OAW A;  3MAZ A;  1O4J A;  3H41 A;  2JS0 A;  1WDX A;  3BKB A;  3M0U A;  1F1W A;  3BUM B;  5IBS A;  2KBT A;  2Y3A B;  4J9B A;  2MK2 A;  2K7A A;  2IUH A;  2EKH A;  2EU0 A;  1AB2 A;  1NYF A;  1UDL A;  2JMC A;  3HIZ B;  1YNZ A;  4F17 A;  3MXY A;  4FL3 A;  3EG3 A;  2KRS A;  1D4T A;  1O4M A;  3CWG A;  4E6R A;  2FRW A;  5GJI A;  1GHU A;  4K44 A;  4X6S A;  1E6G A;  1YWO A;  1SHD A;  5DC4 A;  2LNH B;  4JJC A;  1A09 A;  1ABO A;  1I0C A;  4RTY A;  2C0T A;  4CC3 A;  1QKX A;  1AZG B;  1O44 A;  1WXT A;  1W70 A;  3U23 A;  1WI7 A;  4GBQ A;  1X27 A;  4AFQ C;  2GGR A;  2LQW A;  3H0I A;  2KRN A;  1K76 A;  2DVJ A;  2RF0 A;  1R1P A;  1LUI A;  1A1B A;  4AFZ C;  1O45 A;  1AVZ C;  1W6X A;  2EYY A;  2RQU A;  2DYB A;  1NM7 A;  4Y92 A;  4DEX A;  1I3Z A;  1O4A A;  2LNX A;  1CWD L;  1YWP A;  1RUW A;  3EG0 A;  1AYB A;  2SEM A;  2JXB A;  2EL8 A;  2DNU A;  2JM8 A;  4K2R A;  2V1R A;  4EY0 A;  1RI9 A;  2YT6 A;  2DE0 X;  1MV3 A;  1YCS B;  3C0C A;  4JE4 A;  2A37 A;  3EGU A;  2L3P A;  2EYW A;  2K7A B;  3PVQ A;  1O48 A;  5EEQ A;  1LCJ A;  1O4N A;  2HUW A;  3H0H A;  3I9Q A;  1SPS A;  3PS5 A;  2A08 A;  5FWB A;  3TSW A;  4HVV A;  2RNA A;  5I6V A;  1BMB A;  1B47 A;  2KXC A;  1Y0M A;  1HSQ A;  1ABQ A;  2ABL A;  2PTK A;  1OO4 A;  2YSX A;  1A1E A;  2XMF A;  2G6F X;  2MQI A;  3UA7 A;  4DGP A;  1QLY A;  1MUZ A;  4K45 A;  1H8K A;  4JJD A;  3VGO A;  3ZL7 C;  1ZUY A;  2KNB B;  4J9D A;  5AUL A;  4GWF A;  2D0N A;  2W0Z A;  4LN2 A;  2DL8 A;  2LMJ A;  1WIE A;  1H92 A;  1JWO A;  1GCQ C;  2SRC A;  4GL9 E;  3H0F A;  3M0P A;  3TL0 A;  1VYU A;  4JJB A;  2IUI A;  3CBL A;  2RQT A;  2J05 A;  3NGP A;  3PE0 A;  4DEY A;  1BHH B;  1WFW A;  1FYR A;  1GCQ A;  1T0J A;  5BO4 A;  5FW9 A;  3UA6 A;  2YSQ A;  4F14 A;  1RQQ C;  1QAD A;  4AFU C;  4OMO A;  2MC1 A;  5AXI A;  1A0N B;  3N8M A;  2CDT A;  2RSY A;  1SPK A;  2FG0 A;  2ED1 A;  3EAZ A;  2H8H A;  3C7I A;  2KT1 A;  4L1B B;  4D8K A;  1MIL A;  5HCK A;  2ECD A;  2EPD A;  2F2V A;  1O4L A;  2CT4 A;  2ROT A;  1KA6 A;  2EQI A;  2PNI A;  4EIH A;  1RJA A;  1AOJ A;  4ORZ A;  1UUR A;  2PNB A;  1IO6 A;  1ZSG A;  1PWT A;  1AWW A;  2DMO A;  2YDL A;  2HDV A;  2HEQ A;  1IJR A;  2DBM A;  1KSW A;  2RN8 A;  2AUG A;  1RLQ C;  4FSS A;  1PKT A;  2BBU A;  1O4G A;  4E68 A;  1CJ1 A;  1D1Z A;  4GPL B;  2GE9 A;  2SHP A;  3BUX B;  1NG2 A;  4E93 A;  1M27 C;  2DL3 A;  4QT7 A;  2GTJ A;  4HVU A;  2LJ0 A;  1FMK A;  1WX6 A;  1NLO C;  1U3O A;  1PKS A;  2QDL A;  2DL5 A;  5J3X A;  1M27 A;  1B3Q A;  1G2B A;  4JZ3 A;  1O43 A;  1E6H A;  1A81 A;  3VS1 A;  1O4D A;  2LCT A;  2VKN A;  4RUG A;  1K0S A;  2FEI A;  1O46 A;  3PLF B;  1YN8 A;  1K4U S;  2RMX A;  1WLP B;  2EO6 A;  2KNO A;  1LUM A;  1AYD A;  2D8J A;  3NMZ C;  2GSB A;  1O47 A;  3GXX A;  1PNJ A;  1HCS B;  2LX7 A;  3I5S A;  5HKW A;  4DGX A;  2L3Q A;  3TKZ A;  3S8N A;  4J9G A;  1WQU A;  1E7O A;  4J9E A;  1AZE A;  1UFF A;  1JEG A;  2CH4 A;  1AOT F;  2O2O A;  4K11 A;  1AWO A;  2V1Q A;  4HCK A;  2J7I A;  1HCT B;  2H5K A;  1IS0 A;  2PNA A;  4A4B A;  1T3S A;  1KC2 A;  2KE9 A;  5IH2 A;  1T3L A;  1H9O A;  3R6N A;  3OV1 A;  4JZ4 A;  1JU5 C;  3I5R A;  1LKK A;  4LNP A;  2L2P A;  1VYT A;  2D8H A;  2X3W D;  1O4Q A;  4JGH A;  2NWM A;  1SHB A;  1JYU A;  1ZX6 A;  2JM9 A;  2CI8 A;  5EHP A;  3MXC A;  2K79 B;  2Y1M A;  1PRL C;  1BLK A;  4OHD A;  1SHG A;  2AKL A;  1X69 A;  1TZE E;  2AKK A;  2ROL A;  2ECZ A;  4P9V A;  2Y1N A;  1B07 A;  5DC9 A;  2AOA A;  1JU5 A;  1WXB A;  3VS0 A;  2O88 A;  4NWF A;  1OV3 A;  2FPD A;  1O41 A;  2FCI A;  1U5S A;  4XZ1 A;  1BB9 A;  1BHH A;  2BZX A;  1O4B A;  5HKZ A;  5EG3 B;  1X43 A;  1I07 A;  2RVF A;  1XOV A;  2OQ1 A;  3VS4 A;  1JQQ A;  1CSZ A;  1SHA A;  5L23 A;  5DC0 B;  2W10 A;  2FRY A;  4OHE A;  2K6D A;  3PQZ A;  1SHF A;  3VRO A;  1U06 A;  1BFJ A;  2GTO A;  2J06 A;  2RQV A;  4FL2 A;  2DX0 A;  1AWX A;  4H34 A;  3EHQ A;  1OEB A;  3RBB B;  1M30 A;  1JYR A;  1QKW A;  2CT3 A;  2HBW A;  4OMN A;  1OPK A;  5CDW A;  2LJ3 A;  5IBM A;  4OMP A;  1CSY A;  3PFV A;  2DM1 A;  2DLZ A;  4CC2 A;  1ZUK A;  1UEC A;  1M3A A;  5IXB A;  2X3X D;  4CC7 A;  3BUW B;  1NLP C;  1UUS A;  2DM0 A;  1HD3 A;  2DF6 A;  1LKL A;  1FU6 A;  1X2K A;  1JO8 A;  5EC7 A;  2EYV A;  1A07 A;  4HVW A;  2YU7 A;  2J6K A;  3EG1 A;  3N84 A;  4Z89 A;  2KR3 A;  1H3H A;  2ESW A;  1GBQ A;  3TVT A;  3NPF A;  5IHN A;  1A1C A;  1FBZ A;  2PZ1 A;  3OVE A;  1HJD A;  1MW4 A;  1RPY A;  4ESR A;  3VRZ A;  4RTW A;  4P9Z A;  5GJH A;  4GLM A;  3REA B;  3EHR A;  1TG0 A;  4LUD A;  1AEY A;  4OHL A;  3S8L A;  2NUZ A;  5GJW B;  2I0N A;  2IIM A;  2JW4 A;  4HXJ A;  1F2F A;  2CI9 A;  4OHH A;  1QCF A;  3FJ5 A;  3IN7 A;  2O31 A;  2B3O A;  3BUN B;  2RMO A;  4WWQ A;  3S9K A;  4F16 A;  1Z9Q A;  1QG1 E;  2JS2 A;  4X1V A;  2DL4 A;  2A36 A;  2PLE A;  4U17 A;  1PHT A;  2OZO A;  1GRI A;  3CQT A;  2J6F A;  1BM2 A;  3WA4 A;  2K2M A;  3O5Z A;  1S1N A;  3TSZ A;  1O4R A;  3IN8 A;  1BHF A;  2LNW A;  3VS6 A;  1O4P A;  2K79 A;  1NEB A;  4OMM A;  3VS2 A;  4JPB W;  3UF4 A;  5IHI A;  3VS3 A;  1P13 A;  2VVK A;  1Z9Z A;  2M51 A;  3RNJ A;  1JYQ A;  2JTE A;  2MRJ A;  5D0J A;  1VA7 A;  1GBR A;  2L3T A;  2EGE A;  1ZLM A;  1QWF A;  2BTT A;  2EYX A;  2KRM A;  2CH4 W;  4M4Z A;  2DRM A;  5DF6 A;  4AG2 C;  1AD5 A;  3VRY A;  2KYM A;  2E5K A;  2KYB A;  2LZ6 B;  2KXD A;  4R0K A;  2DJQ A;  2HSP A;  1NYG A;  2EYZ A;  4OMQ A;  2DCR A;  1TCE A;  2AZV A;  5FWC A;  1Z3K A;  1UHC A;  1WYX A;  4AFS C;  1LUN A;  2KGT A;  1O4H A;  1M8M A;  2GQI A;  1W1F A;  2CS0 A;  2HDA A;  1TUD A;  1JXM A;  1O4O A;  3VS7 A;  2CBL A;  1KJW A;  2EBP A;  2EGC A;  4RTX A;  2J6O A;  3ZNI A;  2C0O A;  2ETZ A;  2EGA A;  2CSI A;  2EO3 A;  1R1Q A;  1LUK A;  3THK A;  1M3B A;  1KFZ A;  2EW3 A;  1K1Z A;  1A08 A;  1SRM A;  3QWY A;  2H46 E;  2VIF A;  3UYO A;  4NWG A;  3S8O A;  2EOB A;  1ZUU A;  4A63 B;  1O4I A;  4TZI A;  2OI3 A;  3HHM B;  2DLP A;  2GBQ A;  3VS5 A;  1ZBJ A;  1EFN A;  4F5B A;  1KA7 A;  1SPR A;  2IZV A;  4LE9 A;  1BU1 A;  3KFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...