1R1PA

Structural basis for differential recognition of tyrosine phosphorylated sites in the linker for activation of t cells (lat) by the adaptor protein gads
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
b'IEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2-related adaptor protein 2
publication title Structural basis for differential recognition of tyrosine-phosphorylated sites in the linker for activation of T cells (LAT) by the adaptor Gads.
pubmed doi rcsb
source organism Mus musculus
molecule tags Peptide binding protein
total genus 21
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1r1pA00
1G83A 2K79B 1AYDA 5HKWA 5HKYA 3MAZA 4P9VA 2L3TA 4JE4A 3S8LA 2EO6A 1BKMA 5EG3B 1FYRA 3BKBA 1OO3A 3IMDA 2RORA 4GPLB 3BUMB 1PICA 3N7YA 3VRQA 2C0IA 2LCTA 3ZNIA 5I6VA 1O4EA 2IZVA 2CI8A 5IBMA 3S9KA 2L6KA 2LNWA 1HCTB 1Y57A 4K45A 2RSYA 2ABLA 4XZ0A 4LUDA 2PLEA 1XA6A 1FHSA 1LKLA 1R1PA 2EYVA 1BMBA 4X6SA 1O4QA 2HMHA 1Y1UA 1OPLA 1QG1E 1GHUA 1A09A 4JEGA 4F59A 1FU5A 4A4CA 2LQWA 1LUIA 4NWFA 1ZFPE 2CBLA 1LCJA 2OZOA 1BM2A 3PFVA 1KSWA 1O43A 3VS6A 1A1AA 1SHDA 1FMKA 2EYZA 1AYBA 1K9AA 1RPYA 1FBVA 2IUHA 1SPSA 4GWFA 3TKZA 3BUXB 4WWQA 2HDXA 3VS3A 1P13A 1A07A 2SRCA 1D4TA 2AOBA 2KK6A 1A08A 3OVEA 1MILA 4H1OA 2DVJA 2VIFA 4OHEA 4QSYA 1WQUA 5HKZA 1MW4A 2OQ1A 1JYUA 1LCKA 3K2MA 1O4RA 2BBUA 4TZIA 4OHHA 2DCRA 4JGHA 1D1ZA 5AULA 3VS2A 2DLYA 1UURA 1O45A 2EL8A 1R1QA 2HDVA 1BFJA 2EO3A 2DM0A 3VS7A 3GXWA 4DGPA 1SHAA 2FO0A 3OB1B 4M4ZA 1OPKA 1SKJA 1RQQC 4EY0A 1O4HA 1A1CA 2CRHA 1M61A 1KA6A 1RJAA 4FL3A 4OHDA 4K11A 2GSBA 1AOUF 3M7FA 3TL0A 3US4A 2EU0A 4OHIA 3VGOA 4OHLA 2LNXA 1LUKA 4F5BA 2L4KA 3IMJA 1NZLA 1O4MA 1KA7A 4E68A 3HIZB 5GJIA 4E93A 2HCKA 2H46E 5J3XA 2MQIA 4K2RA 3VS4A 1O4KA 2LQNA 1BHHB 1O4CA 1YVLA 3PJPA 3QWYA 1O4JA 3BUOB 4H34A 3VS1A 1I3ZA 1X6CA 1AD5A 1O4AA 2QMSA 2Y1MA 5EEQA 3UF4A 1SHBA 4EIHA 3T04A 1O49A 1OO4A 2Y3AB 1BHFA 4L1BB 4F5AA 2SHPA 5EHPA 2C0OA 5DC4A 5KAZA 2ETZA 1O4GA 2GE9A 3WA4A 4U1PA 1F2FA 5DF6A 1QADA 3GXXA 1NZVA 1BHHA 2YU7A 1GRIA 2CI9A 1CJ1A 4A4BA 1LUNA 2PLDA 1JYRA 1A81A 4D8KA 3EAZA 1O47A 3PSJA 2EOBA 1SPRA 1O4IA 2AUGA 1Z3KA 1JYQA 2IUGA 1AYAA 2MRKA 2RMXA 1BLJA 1D4WA 2C0TA 2DX0A 4FBNA 4GL9E 3VRRA 3HHMB 1B47A 3GQIB 3PLFB 3PS5A 2XP1A 5BO4A 2ECDA 1FBZA 1X27A 1LUMA 1A1EA 1YVHA 2CS0A 5CDWA 1JWOA 1H9OA 3UYOA 2JYQA 1O4NA 2MK2A 3VROA 1HCSB 3MXCA 1O4OA 5EELA 2KNOA 1F1WA 3EACA 2EKXA 2H8HA 3IN8A 4ROJA 1TZEE 4DGXA 3NHNA 3VS0A 2FCIA 1O46A 1IS0A 3OV1A 2IUIA 3VRYA 1O42A 1O4DA 3S8NA 1NRVA 3PQZA 2C9WA 1QCFA 3KFJA 4FL2A 3MXYA 5AXIA 1IJRA 3HCKA 2PNAA 4LUEA 2HUWA 1CWDL 1O4LA 5EHRA 1CSZA 3VRPA 3IN7A 3CXLA 1M27A 1CSYA 5GJHA 3CD3A 1O44A 1FU6A 1O4FA 1BKLA 2Y1NA 3CWGA 3VS5A 5DC0B 2K7AB 4NWGA 2PTKA 3BUNB 2H5KA 1KC2A 1O4BA 1O4PA 5D0JA 1BFIA 1AB2A 1AYCA 2DLZA 3VRZA 1LKKA 3N8MA 3QWXX 3S8OA 2B3OA 1TCEA 3CBLA 1X0NA 1BLKA 3OB2B 2PNBA 2CR4A 3BUWB 4K44A 5IBSA 1CWEA 1UUSA 3N84A 1R1SA 2RVFA 2CIAA 3C7IA 4U17A 2EYYA 4P9ZA 2YSXA 3VRNA 2AOAA 2MRJA 2MC1A 3PSKA 1A1BA 3OP0A 1O41A 4XZ1A 1BF5A 1AOTF 1JU5A 1O48A 1BG1A 5DC9A
chains in the Genus database with same CATH superfamily
1G83A 2K79B 1AYDA 5HKWA 5HKYA 3MAZA 2KGYA 4P9VA 2L3TA 4JE4A 3S8LA 2EO6A 1BKMA 5EG3B 1FYRA 3BKBA 1OO3A 3IMDA 2RORA 4GPLB 3BUMB 1PICA 3N7YA 3VRQA 2C0IA 2LCTA 3ZNIA 5I6VA 1O4EA 2IZVA 2CI8A 5IBMA 3S9KA 2L6KA 2LNWA 1HCTB 1Y57A 4K45A 2RSYA 2ABLA 4XZ0A 4LUDA 2PLEA 1XA6A 1FHSA 1LKLA 1R1PA 2EYVA 1BMBA 4X6SA 1O4QA 2HMHA 1Y1UA 1OPLA 1QG1E 1GHUA 1A09A 4JEGA 4F59A 1FU5A 4A4CA 2LQWA 1LUIA 4NWFA 1ZFPE 2CBLA 1LCJA 2OZOA 1BM2A 3PFVA 1KSWA 1O43A 3VS6A 1A1AA 1SHDA 1FMKA 2EYZA 1AYBA 1K9AA 1RPYA 1FBVA 2IUHA 1SPSA 4GWFA 3TKZA 3BUXB 4WWQA 2HDXA 3VS3A 1P13A 1A07A 2SRCA 1D4TA 2AOBA 2KK6A 1A08A 3OVEA 1MILA 4H1OA 2DVJA 2VIFA 4OHEA 4QSYA 1WQUA 5HKZA 1MW4A 3LYVA 2OQ1A 1JYUA 1LCKA 3K2MA 1O4RA 2BBUA 4TZIA 4OHHA 2DCRA 4JGHA 1D1ZA 3K2TA 5AULA 3VS2A 2DLYA 1UURA 1O45A 2EL8A 1R1QA 2HDVA 1BFJA 2EO3A 2DM0A 3VS7A 3GXWA 4DGPA 1SHAA 2FO0A 3OB1B 4M4ZA 1OPKA 1SKJA 1RQQC 4EY0A 1O4HA 1A1CA 2CRHA 1M61A 1KA6A 1RJAA 4FL3A 4OHDA 4K11A 2GSBA 1AOUF 3M7FA 3TL0A 3US4A 2EU0A 4OHIA 3VGOA 4OHLA 2LNXA 1LUKA 4F5BA 2L4KA 3IMJA 1NZLA 1O4MA 1KA7A 4E68A 3HIZB 5GJIA 4E93A 2HCKA 2H46E 5J3XA 2MQIA 4K2RA 3VS4A 1O4KA 2LQNA 1BHHB 1O4CA 1YVLA 3PJPA 3QWYA 1O4JA 3BUOB 4H34A 3VS1A 1I3ZA 1X6CA 1AD5A 1O4AA 2QMSA 2Y1MA 5EEQA 3UF4A 1SHBA 4EIHA 3T04A 1O49A 1OO4A 2Y3AB 1BHFA 4L1BB 4F5AA 2SHPA 5EHPA 2C0OA 5DC4A 5KAZA 2ETZA 1O4GA 2GE9A 3WA4A 4U1PA 1F2FA 5DF6A 1QADA 3GXXA 1NZVA 1BHHA 2YU7A 1GRIA 2CI9A 1CJ1A 4A4BA 1LUNA 2PLDA 1JYRA 1A81A 4D8KA 3EAZA 1O47A 3PSJA 2EOBA 1SPRA 1O4IA 2AUGA 1Z3KA 1JYQA 2IUGA 1AYAA 2MRKA 2RMXA 1BLJA 1D4WA 2C0TA 2DX0A 4FBNA 4GL9E 3VRRA 3HHMB 1B47A 3GQIB 3PLFB 3PS5A 2XP1A 5BO4A 2ECDA 1FBZA 1X27A 1LUMA 1A1EA 1YVHA 2CS0A 5CDWA 1JWOA 1H9OA 3UYOA 2LRAA 2JYQA 1O4NA 2MK2A 3VROA 1HCSB 3MXCA 1O4OA 5EELA 2KNOA 1F1WA 3EACA 2EKXA 2H8HA 3IN8A 4ROJA 1TZEE 4DGXA 3NHNA 3VS0A 2FCIA 1O46A 1IS0A 3OV1A 2IUIA 3VRYA 1O42A 1O4DA 3S8NA 1NRVA 3PQZA 2C9WA 1QCFA 3KFJA 4FL2A 3MXYA 5AXIA 1IJRA 3HCKA 2PNAA 4LUEA 2HUWA 1CWDL 1O4LA 5EHRA 1CSZA 3VRPA 3IN7A 3CXLA 1M27A 1CSYA 5GJHA 3CD3A 1O44A 1FU6A 1O4FA 1BKLA 2Y1NA 3CWGA 3VS5A 5DC0B 2K7AB 4NWGA 2PTKA 3BUNB 2H5KA 1KC2A 1O4BA 1O4PA 5D0JA 1BFIA 1AB2A 1AYCA 2DLZA 3VRZA 1LKKA 3N8MA 3QWXX 3S8OA 2B3OA 1TCEA 3CBLA 1X0NA 1BLKA 3OB2B 2PNBA 2CR4A 3BUWB 4K44A 5IBSA 1CWEA 1UUSA 3N84A 1R1SA 2RVFA 2CIAA 3C7IA 4U17A 2EYYA 4P9ZA 2YSXA 3VRNA 2AOAA 2MRJA 2MC1A 3PSKA 1A1BA 3OP0A 1O41A 4XZ1A 1BF5A 1AOTF 1JU5A 1O48A 1BG1A 5DC9A
chains in the Genus database with same CATH topology
1G83A 2K79B 1AYDA 5HKWA 5HKYA 3MAZA 4P9VA 2L3TA 4JE4A 3S8LA 2EO6A 1BKMA 5EG3B 1FYRA 3BKBA 1OO3A 3IMDA 2RORA 4GPLB 3BUMB 1PICA 3N7YA 3VRQA 2C0IA 2LCTA 3ZNIA 5I6VA 1O4EA 2IZVA 2CI8A 5IBMA 3S9KA 2L6KA 2LNWA 1HCTB 1Y57A 4K45A 2RSYA 2ABLA 4XZ0A 4LUDA 2PLEA 1XA6A 1FHSA 1LKLA 1R1PA 2EYVA 1BMBA 4X6SA 1O4QA 2HMHA 1Y1UA 1OPLA 1QG1E 1GHUA 1A09A 4JEGA 4F59A 1FU5A 4A4CA 2LQWA 1LUIA 4NWFA 1ZFPE 2CBLA 1LCJA 2OZOA 1BM2A 3PFVA 1KSWA 1O43A 3VS6A 1A1AA 1SHDA 1FMKA 2EYZA 1AYBA 1K9AA 1RPYA 1FBVA 2IUHA 1SPSA 4GWFA 3TKZA 3BUXB 4WWQA 2HDXA 3VS3A 1P13A 1A07A 2SRCA 1D4TA 2AOBA 2KK6A 1A08A 3OVEA 1MILA 4H1OA 2DVJA 2VIFA 4OHEA 4QSYA 1WQUA 5HKZA 1MW4A 2OQ1A 1JYUA 1LCKA 3K2MA 1O4RA 2BBUA 4TZIA 4OHHA 2DCRA 4JGHA 1D1ZA 5AULA 3VS2A 2DLYA 1UURA 1O45A 2EL8A 1R1QA 2HDVA 1BFJA 2EO3A 2DM0A 3VS7A 3GXWA 4DGPA 1SHAA 2FO0A 3OB1B 4M4ZA 1OPKA 1SKJA 1RQQC 4EY0A 1O4HA 1A1CA 2CRHA 1M61A 1KA6A 1RJAA 4FL3A 4OHDA 4K11A 2GSBA 1AOUF 3M7FA 3TL0A 3US4A 2EU0A 4OHIA 3VGOA 4OHLA 2LNXA 1LUKA 4F5BA 2L4KA 3IMJA 1NZLA 1O4MA 1KA7A 4E68A 3HIZB 5GJIA 4E93A 2HCKA 2H46E 5J3XA 2MQIA 4K2RA 3VS4A 1O4KA 2LQNA 1BHHB 1O4CA 1YVLA 3PJPA 3QWYA 1O4JA 3BUOB 4H34A 3VS1A 1I3ZA 1X6CA 1AD5A 1O4AA 2QMSA 2Y1MA 5EEQA 3UF4A 1SHBA 4EIHA 3T04A 1O49A 1OO4A 2Y3AB 1BHFA 4L1BB 4F5AA 2SHPA 5EHPA 2C0OA 5DC4A 5KAZA 2ETZA 1O4GA 2GE9A 3WA4A 4U1PA 1F2FA 5DF6A 1QADA 3GXXA 1NZVA 1BHHA 2YU7A 1GRIA 2CI9A 1CJ1A 4A4BA 1LUNA 2PLDA 1JYRA 1A81A 4D8KA 3EAZA 1O47A 3PSJA 2EOBA 1SPRA 1O4IA 2AUGA 1Z3KA 1JYQA 2IUGA 1AYAA 2MRKA 2RMXA 1BLJA 1D4WA 2C0TA 2DX0A 4FBNA 4GL9E 3VRRA 3HHMB 1B47A 3GQIB 3PLFB 3PS5A 2XP1A 5BO4A 2ECDA 1FBZA 1X27A 1LUMA 1A1EA 1YVHA 2CS0A 5CDWA 1JWOA 1H9OA 3UYOA 2JYQA 1O4NA 2MK2A 3VROA 1HCSB 3MXCA 1O4OA 5EELA 2KNOA 1F1WA 3EACA 2EKXA 2H8HA 3IN8A 4ROJA 1TZEE 4DGXA 3NHNA 3VS0A 2FCIA 1O46A 1IS0A 3OV1A 2IUIA 3VRYA 1O42A 1O4DA 3S8NA 1NRVA 3PQZA 2C9WA 1QCFA 3KFJA 4FL2A 3MXYA 5AXIA 1IJRA 3HCKA 2PNAA 4LUEA 2HUWA 1CWDL 1O4LA 5EHRA 1CSZA 3VRPA 3IN7A 3CXLA 1M27A 1CSYA 5GJHA 3CD3A 1O44A 1FU6A 1O4FA 1BKLA 2Y1NA 3CWGA 3VS5A 5DC0B 2K7AB 4NWGA 2PTKA 3BUNB 2H5KA 1KC2A 1O4BA 1O4PA 5D0JA 1BFIA 1AB2A 1AYCA 2DLZA 3VRZA 1LKKA 3N8MA 3QWXX 3S8OA 2B3OA 1TCEA 3CBLA 1X0NA 1BLKA 3OB2B 2PNBA 2CR4A 3BUWB 4K44A 5IBSA 1CWEA 1UUSA 3N84A 1R1SA 2RVFA 2CIAA 3C7IA 4U17A 2EYYA 4P9ZA 2YSXA 3VRNA 2AOAA 2MRJA 2MC1A 3PSKA 1A1BA 3OP0A 1O41A 4XZ1A 1BF5A 1AOTF 1JU5A 1O48A 1BG1A 5DC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G83 A;  2K79 B;  1AYD A;  5HKW A;  5HKY A;  3MAZ A;  4P9V A;  2L3T A;  4JE4 A;  3S8L A;  2EO6 A;  1BKM A;  5EG3 B;  1FYR A;  3BKB A;  1OO3 A;  3IMD A;  2ROR A;  4GPL B;  3BUM B;  1PIC A;  3N7Y A;  3VRQ A;  2C0I A;  2LCT A;  3ZNI A;  5I6V A;  1O4E A;  2IZV A;  2CI8 A;  5IBM A;  3S9K A;  2L6K A;  2LNW A;  1HCT B;  1Y57 A;  4K45 A;  2RSY A;  2ABL A;  4XZ0 A;  4LUD A;  2PLE A;  1XA6 A;  1FHS A;  1LKL A;  1R1P A;  2EYV A;  1BMB A;  4X6S A;  1O4Q A;  2HMH A;  1Y1U A;  1OPL A;  1QG1 E;  1GHU A;  1A09 A;  4JEG A;  4F59 A;  1FU5 A;  4A4C A;  2LQW A;  1LUI A;  4NWF A;  1ZFP E;  2CBL A;  1LCJ A;  2OZO A;  1BM2 A;  3PFV A;  1KSW A;  1O43 A;  3VS6 A;  1A1A A;  1SHD A;  1FMK A;  2EYZ A;  1AYB A;  1K9A A;  1RPY A;  1FBV A;  2IUH A;  1SPS A;  4GWF A;  3TKZ A;  3BUX B;  4WWQ A;  2HDX A;  3VS3 A;  1P13 A;  1A07 A;  2SRC A;  1D4T A;  2AOB A;  2KK6 A;  1A08 A;  3OVE A;  1MIL A;  4H1O A;  2DVJ A;  2VIF A;  4OHE A;  4QSY A;  1WQU A;  5HKZ A;  1MW4 A;  2OQ1 A;  1JYU A;  1LCK A;  3K2M A;  1O4R A;  2BBU A;  4TZI A;  4OHH A;  2DCR A;  4JGH A;  1D1Z A;  5AUL A;  3VS2 A;  2DLY A;  1UUR A;  1O45 A;  2EL8 A;  1R1Q A;  2HDV A;  1BFJ A;  2EO3 A;  2DM0 A;  3VS7 A;  3GXW A;  4DGP A;  1SHA A;  2FO0 A;  3OB1 B;  4M4Z A;  1OPK A;  1SKJ A;  1RQQ C;  4EY0 A;  1O4H A;  1A1C A;  2CRH A;  1M61 A;  1KA6 A;  1RJA A;  4FL3 A;  4OHD A;  4K11 A;  2GSB A;  1AOU F;  3M7F A;  3TL0 A;  3US4 A;  2EU0 A;  4OHI A;  3VGO A;  4OHL A;  2LNX A;  1LUK A;  4F5B A;  2L4K A;  3IMJ A;  1NZL A;  1O4M A;  1KA7 A;  4E68 A;  3HIZ B;  5GJI A;  4E93 A;  2HCK A;  2H46 E;  5J3X A;  2MQI A;  4K2R A;  3VS4 A;  1O4K A;  2LQN A;  1BHH B;  1O4C A;  1YVL A;  3PJP A;  3QWY A;  1O4J A;  3BUO B;  4H34 A;  3VS1 A;  1I3Z A;  1X6C A;  1AD5 A;  1O4A A;  2QMS A;  2Y1M A;  5EEQ A;  3UF4 A;  1SHB A;  4EIH A;  3T04 A;  1O49 A;  1OO4 A;  2Y3A B;  1BHF A;  4L1B B;  4F5A A;  2SHP A;  5EHP A;  2C0O A;  5DC4 A;  5KAZ A;  2ETZ A;  1O4G A;  2GE9 A;  3WA4 A;  4U1P A;  1F2F A;  5DF6 A;  1QAD A;  3GXX A;  1NZV A;  1BHH A;  2YU7 A;  1GRI A;  2CI9 A;  1CJ1 A;  4A4B A;  1LUN A;  2PLD A;  1JYR A;  1A81 A;  4D8K A;  3EAZ A;  1O47 A;  3PSJ A;  2EOB A;  1SPR A;  1O4I A;  2AUG A;  1Z3K A;  1JYQ A;  2IUG A;  1AYA A;  2MRK A;  2RMX A;  1BLJ A;  1D4W A;  2C0T A;  2DX0 A;  4FBN A;  4GL9 E;  3VRR A;  3HHM B;  1B47 A;  3GQI B;  3PLF B;  3PS5 A;  2XP1 A;  5BO4 A;  2ECD A;  1FBZ A;  1X27 A;  1LUM A;  1A1E A;  1YVH A;  2CS0 A;  5CDW A;  1JWO A;  1H9O A;  3UYO A;  2JYQ A;  1O4N A;  2MK2 A;  3VRO A;  1HCS B;  3MXC A;  1O4O A;  5EEL A;  2KNO A;  1F1W A;  3EAC A;  2EKX A;  2H8H A;  3IN8 A;  4ROJ A;  1TZE E;  4DGX A;  3NHN A;  3VS0 A;  2FCI A;  1O46 A;  1IS0 A;  3OV1 A;  2IUI A;  3VRY A;  1O42 A;  1O4D A;  3S8N A;  1NRV A;  3PQZ A;  2C9W A;  1QCF A;  3KFJ A;  4FL2 A;  3MXY A;  5AXI A;  1IJR A;  3HCK A;  2PNA A;  4LUE A;  2HUW A;  1CWD L;  1O4L A;  5EHR A;  1CSZ A;  3VRP A;  3IN7 A;  3CXL A;  1M27 A;  1CSY A;  5GJH A;  3CD3 A;  1O44 A;  1FU6 A;  1O4F A;  1BKL A;  2Y1N A;  3CWG A;  3VS5 A;  5DC0 B;  2K7A B;  4NWG A;  2PTK A;  3BUN B;  2H5K A;  1KC2 A;  1O4B A;  1O4P A;  5D0J A;  1BFI A;  1AB2 A;  1AYC A;  2DLZ A;  3VRZ A;  1LKK A;  3N8M A;  3QWX X;  3S8O A;  2B3O A;  1TCE A;  3CBL A;  1X0N A;  1BLK A;  3OB2 B;  2PNB A;  2CR4 A;  3BUW B;  4K44 A;  5IBS A;  1CWE A;  1UUS A;  3N84 A;  1R1S A;  2RVF A;  2CIA A;  3C7I A;  4U17 A;  2EYY A;  4P9Z A;  2YSX A;  3VRN A;  2AOA A;  2MRJ A;  2MC1 A;  3PSK A;  1A1B A;  3OP0 A;  1O41 A;  4XZ1 A;  1BF5 A;  1AOT F;  1JU5 A;  1O48 A;  1BG1 A;  5DC9 A; 
#chains in the Genus database with same CATH topology
 1G83 A;  2K79 B;  1AYD A;  5HKW A;  5HKY A;  3MAZ A;  2KGY A;  4P9V A;  2L3T A;  4JE4 A;  3S8L A;  2EO6 A;  1BKM A;  5EG3 B;  1FYR A;  3BKB A;  1OO3 A;  3IMD A;  2ROR A;  4GPL B;  3BUM B;  1PIC A;  3N7Y A;  3VRQ A;  2C0I A;  2LCT A;  3ZNI A;  5I6V A;  1O4E A;  2IZV A;  2CI8 A;  5IBM A;  3S9K A;  2L6K A;  2LNW A;  1HCT B;  1Y57 A;  4K45 A;  2RSY A;  2ABL A;  4XZ0 A;  4LUD A;  2PLE A;  1XA6 A;  1FHS A;  1LKL A;  1R1P A;  2EYV A;  1BMB A;  4X6S A;  1O4Q A;  2HMH A;  1Y1U A;  1OPL A;  1QG1 E;  1GHU A;  1A09 A;  4JEG A;  4F59 A;  1FU5 A;  4A4C A;  2LQW A;  1LUI A;  4NWF A;  1ZFP E;  2CBL A;  1LCJ A;  2OZO A;  1BM2 A;  3PFV A;  1KSW A;  1O43 A;  3VS6 A;  1A1A A;  1SHD A;  1FMK A;  2EYZ A;  1AYB A;  1K9A A;  1RPY A;  1FBV A;  2IUH A;  1SPS A;  4GWF A;  3TKZ A;  3BUX B;  4WWQ A;  2HDX A;  3VS3 A;  1P13 A;  1A07 A;  2SRC A;  1D4T A;  2AOB A;  2KK6 A;  1A08 A;  3OVE A;  1MIL A;  4H1O A;  2DVJ A;  2VIF A;  4OHE A;  4QSY A;  1WQU A;  5HKZ A;  1MW4 A;  3LYV A;  2OQ1 A;  1JYU A;  1LCK A;  3K2M A;  1O4R A;  2BBU A;  4TZI A;  4OHH A;  2DCR A;  4JGH A;  1D1Z A;  3K2T A;  5AUL A;  3VS2 A;  2DLY A;  1UUR A;  1O45 A;  2EL8 A;  1R1Q A;  2HDV A;  1BFJ A;  2EO3 A;  2DM0 A;  3VS7 A;  3GXW A;  4DGP A;  1SHA A;  2FO0 A;  3OB1 B;  4M4Z A;  1OPK A;  1SKJ A;  1RQQ C;  4EY0 A;  1O4H A;  1A1C A;  2CRH A;  1M61 A;  1KA6 A;  1RJA A;  4FL3 A;  4OHD A;  4K11 A;  2GSB A;  1AOU F;  3M7F A;  3TL0 A;  3US4 A;  2EU0 A;  4OHI A;  3VGO A;  4OHL A;  2LNX A;  1LUK A;  4F5B A;  2L4K A;  3IMJ A;  1NZL A;  1O4M A;  1KA7 A;  4E68 A;  3HIZ B;  5GJI A;  4E93 A;  2HCK A;  2H46 E;  5J3X A;  2MQI A;  4K2R A;  3VS4 A;  1O4K A;  2LQN A;  1BHH B;  1O4C A;  1YVL A;  3PJP A;  3QWY A;  1O4J A;  3BUO B;  4H34 A;  3VS1 A;  1I3Z A;  1X6C A;  1AD5 A;  1O4A A;  2QMS A;  2Y1M A;  5EEQ A;  3UF4 A;  1SHB A;  4EIH A;  3T04 A;  1O49 A;  1OO4 A;  2Y3A B;  1BHF A;  4L1B B;  4F5A A;  2SHP A;  5EHP A;  2C0O A;  5DC4 A;  5KAZ A;  2ETZ A;  1O4G A;  2GE9 A;  3WA4 A;  4U1P A;  1F2F A;  5DF6 A;  1QAD A;  3GXX A;  1NZV A;  1BHH A;  2YU7 A;  1GRI A;  2CI9 A;  1CJ1 A;  4A4B A;  1LUN A;  2PLD A;  1JYR A;  1A81 A;  4D8K A;  3EAZ A;  1O47 A;  3PSJ A;  2EOB A;  1SPR A;  1O4I A;  2AUG A;  1Z3K A;  1JYQ A;  2IUG A;  1AYA A;  2MRK A;  2RMX A;  1BLJ A;  1D4W A;  2C0T A;  2DX0 A;  4FBN A;  4GL9 E;  3VRR A;  3HHM B;  1B47 A;  3GQI B;  3PLF B;  3PS5 A;  2XP1 A;  5BO4 A;  2ECD A;  1FBZ A;  1X27 A;  1LUM A;  1A1E A;  1YVH A;  2CS0 A;  5CDW A;  1JWO A;  1H9O A;  3UYO A;  2LRA A;  2JYQ A;  1O4N A;  2MK2 A;  3VRO A;  1HCS B;  3MXC A;  1O4O A;  5EEL A;  2KNO A;  1F1W A;  3EAC A;  2EKX A;  2H8H A;  3IN8 A;  4ROJ A;  1TZE E;  4DGX A;  3NHN A;  3VS0 A;  2FCI A;  1O46 A;  1IS0 A;  3OV1 A;  2IUI A;  3VRY A;  1O42 A;  1O4D A;  3S8N A;  1NRV A;  3PQZ A;  2C9W A;  1QCF A;  3KFJ A;  4FL2 A;  3MXY A;  5AXI A;  1IJR A;  3HCK A;  2PNA A;  4LUE A;  2HUW A;  1CWD L;  1O4L A;  5EHR A;  1CSZ A;  3VRP A;  3IN7 A;  3CXL A;  1M27 A;  1CSY A;  5GJH A;  3CD3 A;  1O44 A;  1FU6 A;  1O4F A;  1BKL A;  2Y1N A;  3CWG A;  3VS5 A;  5DC0 B;  2K7A B;  4NWG A;  2PTK A;  3BUN B;  2H5K A;  1KC2 A;  1O4B A;  1O4P A;  5D0J A;  1BFI A;  1AB2 A;  1AYC A;  2DLZ A;  3VRZ A;  1LKK A;  3N8M A;  3QWX X;  3S8O A;  2B3O A;  1TCE A;  3CBL A;  1X0N A;  1BLK A;  3OB2 B;  2PNB A;  2CR4 A;  3BUW B;  4K44 A;  5IBS A;  1CWE A;  1UUS A;  3N84 A;  1R1S A;  2RVF A;  2CIA A;  3C7I A;  4U17 A;  2EYY A;  4P9Z A;  2YSX A;  3VRN A;  2AOA A;  2MRJ A;  2MC1 A;  3PSK A;  1A1B A;  3OP0 A;  1O41 A;  4XZ1 A;  1BF5 A;  1AOT F;  1JU5 A;  1O48 A;  1BG1 A;  5DC9 A; 
#chains in the Genus database with same CATH homology
 1G83 A;  2K79 B;  1AYD A;  5HKW A;  5HKY A;  3MAZ A;  4P9V A;  2L3T A;  4JE4 A;  3S8L A;  2EO6 A;  1BKM A;  5EG3 B;  1FYR A;  3BKB A;  1OO3 A;  3IMD A;  2ROR A;  4GPL B;  3BUM B;  1PIC A;  3N7Y A;  3VRQ A;  2C0I A;  2LCT A;  3ZNI A;  5I6V A;  1O4E A;  2IZV A;  2CI8 A;  5IBM A;  3S9K A;  2L6K A;  2LNW A;  1HCT B;  1Y57 A;  4K45 A;  2RSY A;  2ABL A;  4XZ0 A;  4LUD A;  2PLE A;  1XA6 A;  1FHS A;  1LKL A;  1R1P A;  2EYV A;  1BMB A;  4X6S A;  1O4Q A;  2HMH A;  1Y1U A;  1OPL A;  1QG1 E;  1GHU A;  1A09 A;  4JEG A;  4F59 A;  1FU5 A;  4A4C A;  2LQW A;  1LUI A;  4NWF A;  1ZFP E;  2CBL A;  1LCJ A;  2OZO A;  1BM2 A;  3PFV A;  1KSW A;  1O43 A;  3VS6 A;  1A1A A;  1SHD A;  1FMK A;  2EYZ A;  1AYB A;  1K9A A;  1RPY A;  1FBV A;  2IUH A;  1SPS A;  4GWF A;  3TKZ A;  3BUX B;  4WWQ A;  2HDX A;  3VS3 A;  1P13 A;  1A07 A;  2SRC A;  1D4T A;  2AOB A;  2KK6 A;  1A08 A;  3OVE A;  1MIL A;  4H1O A;  2DVJ A;  2VIF A;  4OHE A;  4QSY A;  1WQU A;  5HKZ A;  1MW4 A;  2OQ1 A;  1JYU A;  1LCK A;  3K2M A;  1O4R A;  2BBU A;  4TZI A;  4OHH A;  2DCR A;  4JGH A;  1D1Z A;  5AUL A;  3VS2 A;  2DLY A;  1UUR A;  1O45 A;  2EL8 A;  1R1Q A;  2HDV A;  1BFJ A;  2EO3 A;  2DM0 A;  3VS7 A;  3GXW A;  4DGP A;  1SHA A;  2FO0 A;  3OB1 B;  4M4Z A;  1OPK A;  1SKJ A;  1RQQ C;  4EY0 A;  1O4H A;  1A1C A;  2CRH A;  1M61 A;  1KA6 A;  1RJA A;  4FL3 A;  4OHD A;  4K11 A;  2GSB A;  1AOU F;  3M7F A;  3TL0 A;  3US4 A;  2EU0 A;  4OHI A;  3VGO A;  4OHL A;  2LNX A;  1LUK A;  4F5B A;  2L4K A;  3IMJ A;  1NZL A;  1O4M A;  1KA7 A;  4E68 A;  3HIZ B;  5GJI A;  4E93 A;  2HCK A;  2H46 E;  5J3X A;  2MQI A;  4K2R A;  3VS4 A;  1O4K A;  2LQN A;  1BHH B;  1O4C A;  1YVL A;  3PJP A;  3QWY A;  1O4J A;  3BUO B;  4H34 A;  3VS1 A;  1I3Z A;  1X6C A;  1AD5 A;  1O4A A;  2QMS A;  2Y1M A;  5EEQ A;  3UF4 A;  1SHB A;  4EIH A;  3T04 A;  1O49 A;  1OO4 A;  2Y3A B;  1BHF A;  4L1B B;  4F5A A;  2SHP A;  5EHP A;  2C0O A;  5DC4 A;  5KAZ A;  2ETZ A;  1O4G A;  2GE9 A;  3WA4 A;  4U1P A;  1F2F A;  5DF6 A;  1QAD A;  3GXX A;  1NZV A;  1BHH A;  2YU7 A;  1GRI A;  2CI9 A;  1CJ1 A;  4A4B A;  1LUN A;  2PLD A;  1JYR A;  1A81 A;  4D8K A;  3EAZ A;  1O47 A;  3PSJ A;  2EOB A;  1SPR A;  1O4I A;  2AUG A;  1Z3K A;  1JYQ A;  2IUG A;  1AYA A;  2MRK A;  2RMX A;  1BLJ A;  1D4W A;  2C0T A;  2DX0 A;  4FBN A;  4GL9 E;  3VRR A;  3HHM B;  1B47 A;  3GQI B;  3PLF B;  3PS5 A;  2XP1 A;  5BO4 A;  2ECD A;  1FBZ A;  1X27 A;  1LUM A;  1A1E A;  1YVH A;  2CS0 A;  5CDW A;  1JWO A;  1H9O A;  3UYO A;  2JYQ A;  1O4N A;  2MK2 A;  3VRO A;  1HCS B;  3MXC A;  1O4O A;  5EEL A;  2KNO A;  1F1W A;  3EAC A;  2EKX A;  2H8H A;  3IN8 A;  4ROJ A;  1TZE E;  4DGX A;  3NHN A;  3VS0 A;  2FCI A;  1O46 A;  1IS0 A;  3OV1 A;  2IUI A;  3VRY A;  1O42 A;  1O4D A;  3S8N A;  1NRV A;  3PQZ A;  2C9W A;  1QCF A;  3KFJ A;  4FL2 A;  3MXY A;  5AXI A;  1IJR A;  3HCK A;  2PNA A;  4LUE A;  2HUW A;  1CWD L;  1O4L A;  5EHR A;  1CSZ A;  3VRP A;  3IN7 A;  3CXL A;  1M27 A;  1CSY A;  5GJH A;  3CD3 A;  1O44 A;  1FU6 A;  1O4F A;  1BKL A;  2Y1N A;  3CWG A;  3VS5 A;  5DC0 B;  2K7A B;  4NWG A;  2PTK A;  3BUN B;  2H5K A;  1KC2 A;  1O4B A;  1O4P A;  5D0J A;  1BFI A;  1AB2 A;  1AYC A;  2DLZ A;  3VRZ A;  1LKK A;  3N8M A;  3QWX X;  3S8O A;  2B3O A;  1TCE A;  3CBL A;  1X0N A;  1BLK A;  3OB2 B;  2PNB A;  2CR4 A;  3BUW B;  4K44 A;  5IBS A;  1CWE A;  1UUS A;  3N84 A;  1R1S A;  2RVF A;  2CIA A;  3C7I A;  4U17 A;  2EYY A;  4P9Z A;  2YSX A;  3VRN A;  2AOA A;  2MRJ A;  2MC1 A;  3PSK A;  1A1B A;  3OP0 A;  1O41 A;  4XZ1 A;  1BF5 A;  1AOT F;  1JU5 A;  1O48 A;  1BG1 A;  5DC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...