4XZ1A

Zap-70-tsh2:compound-b adduct
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
DPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDSLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ZAP-70
publication title Modification by covalent reaction or oxidation of cysteine residues in the tandem-SH2 domains of ZAP-70 and Syk can block phosphopeptide binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 254
sequence length 254
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 4xz1A02
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4xz1A03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4xz1A01
1O43A 3GXWA 2B3OA 1M27A 4P9VA 2YSXA 5HKWA 4QSYA 1RJAA 2DVJA 5I6VA 1D4TA 4K45A 2RVFA 3VS3A 4JGHA 3S9KA 1KA7A 3VRYA 2IUGA 1AYCA 2MRKA 1B47A 3PSKA 1SHAA 2HUWA 1O4QA 2MC1A 1A09A 1O4CA 5EHRA 2EO6A 1Z3KA 3MAZA 1AB2A 1OPKA 1X27A 1FU6A 2IUIA 5AULA 3IN7A 2VIFA 3HIZB 3M7FA 1LUIA 4LUDA 3IN8A 3N84A 1CJ1A 3OVEA 5EG3B 3PQZA 2BBUA 2FCIA 3US4A 3CXLA 1OO3A 3PS5A 5J3XA 1X6CA 1D4WA 1MW4A 2ECDA 1WQUA 1O49A 1A08A 4GWFA 3UF4A 3VS7A 2C0OA 2H8HA 2RORA 3PSJA 3QWXX 5BO4A 1BFJA 2PNBA 1AYDA 3PJPA 4K44A 2DLYA 1BKLA 3MXYA 5IBSA 1QCFA 4A4CA 2C0IA 2EYVA 3IMDA 4FL3A 4F59A 5EELA 2PLDA 1TCEA 4LUEA 3KFJA 3VRPA 2Y3AB 5CDWA 3N8MA 5GJIA 4ROJA 2AOAA 4E68A 5D0JA 1O45A 4TZIA 3VRQA 3BUNB 1A81A 2LQNA 2DLZA 1O44A 4U17A 1FBVA 4JE4A 4P9ZA 1HCTB 4K11A 3PLFB 4GPLB 2HCKA 1OO4A 5HKZA 2L4KA 3VS2A 3NHNA 1FBZA 1QADA 2EYYA 1O4FA 1HCSB 1O46A 2ETZA 2K7AB 5AXIA 1SKJA 3OV1A 4E93A 3BUMB 1CSYA 1R1QA 3CBLA 1P13A 4NWGA 2FO0A 3C7IA 2EKXA 2KNOA 1BHFA 1AOTF 1KSWA 5DC4A 1O4RA 3MXCA 2CI8A 1BFIA 4H1OA 4DGPA 3S8NA 1O4LA 1BLKA 5DF6A 1O4NA 2CI9A 1F1WA 1BG1A 1M61A 3VS6A 3VRRA 1A1CA 1FU5A 3CD3A 1JYQA 4OHIA 2DM0A 1O4GA 2EYZA 4U1PA 3QWYA 2PTKA 1IS0A 1O4EA 3N7YA 2K79B 1FYRA 3PFVA 2CIAA 1CWEA 1O4JA 3HCKA 2HDXA 1O47A 2HDVA 2EO3A 2EOBA 2SRCA 1UUSA 5DC0B 1KA6A 4D8KA 3S8OA 1I3ZA 2JYQA 2CBLA 2C9WA 3GXXA 2LQWA 3VS4A 5EHPA 5EEQA 4XZ0A 2C0TA 3OB2B 2EU0A 1SPRA 1LUKA 1G83A 1UURA 3VRZA 2CS0A 3IMJA 3TKZA 1QG1E 4A4BA 2Y1MA 3EAZA 4H34A 4DGXA 4X6SA 1O4PA 2CRHA 1SPSA 2SHPA 5DC9A 2LCTA 1O4AA 2L3TA 1LKKA 2KK6A 3VRNA 1H9OA 3BUOB 1R1PA 3HHMB 4JEGA 1BF5A 1RQQC 1BKMA 1O4IA 2L6KA 1NZLA 1AYAA 2YU7A 3BKBA 1JU5A 1O41A 2H5KA 3VS5A 1YVLA 4WWQA 1O4HA 3TL0A 2OZOA 1KC2A 3S8LA 1Y1UA 1PICA 1IJRA 1X0NA 1GHUA 2OQ1A 3VS1A 2XP1A 3VROA 1BLJA 2MRJA 4F5AA 4K2RA 2IUHA 1AOUF 2GE9A 4M4ZA 2MQIA 2LNWA 1R1SA 1GRIA 4EIHA 1JYUA 3VS0A 5IBMA 4OHLA 4XZ1A 1BMBA 1RPYA 2EL8A 2Y1NA 2PNAA 1SHBA 1AYBA 4OHDA 3WA4A 3CWGA 1A07A 1Y57A 1D1ZA 2HMHA 1LCKA 4FL2A 1O4DA 2PLEA 1K9AA 1LUNA 1O4KA 2RMXA 1FHSA 1NRVA 3K2MA 2GSBA 2AOBA 1A1EA 5GJHA 1YVHA 3UYOA 1AD5A 3T04A 1O4OA 1LKLA 1TZEE 2IZVA 2H46E 5HKYA 2DX0A 1A1AA 1O42A 2QMSA 4GL9E 1OPLA 1A1BA 1JYRA 4F5BA 3BUWB 1BHHA 1JWOA 2ABLA 1F2FA 1BHHB 3OB1B 2DCRA 1CSZA 3VGOA 4OHHA 1NZVA 1MILA 5KAZA 3GQIB 2RSYA 1FMKA 1O48A 1BM2A 4OHEA 4L1BB 1SHDA 2AUGA 2CR4A 1CWDL 3EACA 3ZNIA 1O4MA 1O4BA 2MK2A 1ZFPE 4FBNA 4NWFA 3OP0A 2LNXA 3BUXB 4EY0A 1XA6A 1LUMA 1LCJA
chains in the Genus database with same CATH superfamily
1O43A 3GXWA 2B3OA 1M27A 4P9VA 2YSXA 5HKWA 4QSYA 1RJAA 2DVJA 5I6VA 1D4TA 4K45A 2RVFA 3VS3A 4JGHA 3S9KA 1KA7A 3VRYA 2IUGA 1AYCA 2MRKA 1B47A 3PSKA 1SHAA 2HUWA 1O4QA 2MC1A 1A09A 1O4CA 5EHRA 2EO6A 1Z3KA 3MAZA 1AB2A 1OPKA 1X27A 1FU6A 2IUIA 5AULA 3LYVA 3IN7A 2VIFA 3HIZB 3M7FA 1LUIA 4LUDA 2LRAA 3IN8A 3N84A 1CJ1A 3OVEA 5EG3B 3PQZA 2BBUA 2FCIA 3US4A 3CXLA 1OO3A 3PS5A 5J3XA 1X6CA 1D4WA 1MW4A 2ECDA 1WQUA 1O49A 1A08A 4GWFA 3UF4A 3VS7A 2C0OA 2H8HA 2RORA 3PSJA 3QWXX 5BO4A 1BFJA 2PNBA 1AYDA 3PJPA 4K44A 2DLYA 1BKLA 3MXYA 5IBSA 1QCFA 4A4CA 2C0IA 2EYVA 3IMDA 4FL3A 4F59A 5EELA 2PLDA 1TCEA 4LUEA 3KFJA 3VRPA 2Y3AB 5CDWA 3N8MA 5GJIA 4ROJA 2AOAA 4E68A 5D0JA 2KGYA 1O45A 4TZIA 3VRQA 3BUNB 1A81A 2LQNA 2DLZA 1O44A 4U17A 1FBVA 4JE4A 4P9ZA 1HCTB 4K11A 3PLFB 4GPLB 2HCKA 1OO4A 5HKZA 2L4KA 3VS2A 3NHNA 1FBZA 1QADA 2EYYA 1O4FA 1HCSB 1O46A 2ETZA 2K7AB 5AXIA 1SKJA 3OV1A 4E93A 3BUMB 1CSYA 1R1QA 3CBLA 1P13A 4NWGA 2FO0A 3C7IA 2EKXA 2KNOA 1BHFA 1AOTF 1KSWA 5DC4A 1O4RA 3MXCA 2CI8A 1BFIA 4H1OA 4DGPA 3S8NA 1O4LA 1BLKA 5DF6A 1O4NA 2CI9A 1F1WA 1BG1A 1M61A 3VS6A 3VRRA 1A1CA 1FU5A 3CD3A 1JYQA 4OHIA 2DM0A 1O4GA 2EYZA 4U1PA 3QWYA 2PTKA 1IS0A 1O4EA 3N7YA 2K79B 1FYRA 3PFVA 2CIAA 1CWEA 1O4JA 3HCKA 2HDXA 1O47A 2HDVA 2EO3A 2EOBA 2SRCA 1UUSA 5DC0B 1KA6A 4D8KA 3S8OA 1I3ZA 2JYQA 2CBLA 2C9WA 3GXXA 2LQWA 3VS4A 5EHPA 5EEQA 4XZ0A 2C0TA 3OB2B 2EU0A 1SPRA 1LUKA 1G83A 1UURA 3VRZA 2CS0A 3IMJA 3TKZA 1QG1E 4A4BA 3K2TA 2Y1MA 3EAZA 4H34A 4DGXA 4X6SA 1O4PA 2CRHA 1SPSA 2SHPA 5DC9A 2LCTA 1O4AA 2L3TA 1LKKA 2KK6A 3VRNA 1H9OA 3BUOB 1R1PA 3HHMB 4JEGA 1BF5A 1RQQC 1BKMA 1O4IA 2L6KA 1NZLA 1AYAA 2YU7A 3BKBA 1JU5A 1O41A 2H5KA 3VS5A 1YVLA 4WWQA 1O4HA 3TL0A 2OZOA 1KC2A 3S8LA 1Y1UA 1PICA 1IJRA 1X0NA 1GHUA 2OQ1A 3VS1A 2XP1A 3VROA 1BLJA 2MRJA 4F5AA 4K2RA 2IUHA 1AOUF 2GE9A 4M4ZA 2MQIA 2LNWA 1R1SA 1GRIA 4EIHA 1JYUA 3VS0A 5IBMA 4OHLA 4XZ1A 1BMBA 1RPYA 2EL8A 2Y1NA 2PNAA 1SHBA 1AYBA 4OHDA 3WA4A 3CWGA 1A07A 1Y57A 1D1ZA 2HMHA 1LCKA 4FL2A 1O4DA 2PLEA 1K9AA 1LUNA 1O4KA 2RMXA 1FHSA 1NRVA 3K2MA 2GSBA 2AOBA 1A1EA 5GJHA 1YVHA 3UYOA 1AD5A 3T04A 1O4OA 1LKLA 1TZEE 2IZVA 2H46E 5HKYA 2DX0A 1A1AA 1O42A 2QMSA 4GL9E 1OPLA 1A1BA 1JYRA 4F5BA 3BUWB 1BHHA 1JWOA 2ABLA 1F2FA 1BHHB 3OB1B 2DCRA 1CSZA 3VGOA 4OHHA 1NZVA 1MILA 5KAZA 3GQIB 2RSYA 1FMKA 1O48A 1BM2A 4OHEA 4L1BB 1SHDA 2AUGA 2CR4A 1CWDL 3EACA 3ZNIA 1O4MA 1O4BA 2MK2A 1ZFPE 4FBNA 4NWFA 3OP0A 2LNXA 3BUXB 4EY0A 1XA6A 1LUMA 1LCJA
chains in the Genus database with same CATH topology
1O43A 3GXWA 2B3OA 1M27A 4P9VA 2YSXA 5HKWA 4QSYA 1RJAA 2DVJA 5I6VA 1D4TA 4K45A 2RVFA 3VS3A 4JGHA 3S9KA 1KA7A 3VRYA 2IUGA 1AYCA 2MRKA 1B47A 3PSKA 1SHAA 2HUWA 1O4QA 2MC1A 1A09A 1O4CA 5EHRA 2EO6A 1Z3KA 3MAZA 1AB2A 1OPKA 1X27A 1FU6A 2IUIA 5AULA 3IN7A 2VIFA 3HIZB 3M7FA 1LUIA 4LUDA 3IN8A 3N84A 1CJ1A 3OVEA 5EG3B 3PQZA 2BBUA 2FCIA 3US4A 3CXLA 1OO3A 3PS5A 5J3XA 1X6CA 1D4WA 1MW4A 2ECDA 1WQUA 1O49A 1A08A 4GWFA 3UF4A 3VS7A 2C0OA 2H8HA 2RORA 3PSJA 3QWXX 5BO4A 1BFJA 2PNBA 1AYDA 3PJPA 4K44A 2DLYA 1BKLA 3MXYA 5IBSA 1QCFA 4A4CA 2C0IA 2EYVA 3IMDA 4FL3A 4F59A 5EELA 2PLDA 1TCEA 4LUEA 3KFJA 3VRPA 2Y3AB 5CDWA 3N8MA 5GJIA 4ROJA 2AOAA 4E68A 5D0JA 1O45A 4TZIA 3VRQA 3BUNB 1A81A 2LQNA 2DLZA 1O44A 4U17A 1FBVA 4JE4A 4P9ZA 1HCTB 4K11A 3PLFB 4GPLB 2HCKA 1OO4A 5HKZA 2L4KA 3VS2A 3NHNA 1FBZA 1QADA 2EYYA 1O4FA 1HCSB 1O46A 2ETZA 2K7AB 5AXIA 1SKJA 3OV1A 4E93A 3BUMB 1CSYA 1R1QA 3CBLA 1P13A 4NWGA 2FO0A 3C7IA 2EKXA 2KNOA 1BHFA 1AOTF 1KSWA 5DC4A 1O4RA 3MXCA 2CI8A 1BFIA 4H1OA 4DGPA 3S8NA 1O4LA 1BLKA 5DF6A 1O4NA 2CI9A 1F1WA 1BG1A 1M61A 3VS6A 3VRRA 1A1CA 1FU5A 3CD3A 1JYQA 4OHIA 2DM0A 1O4GA 2EYZA 4U1PA 3QWYA 2PTKA 1IS0A 1O4EA 3N7YA 2K79B 1FYRA 3PFVA 2CIAA 1CWEA 1O4JA 3HCKA 2HDXA 1O47A 2HDVA 2EO3A 2EOBA 2SRCA 1UUSA 5DC0B 1KA6A 4D8KA 3S8OA 1I3ZA 2JYQA 2CBLA 2C9WA 3GXXA 2LQWA 3VS4A 5EHPA 5EEQA 4XZ0A 2C0TA 3OB2B 2EU0A 1SPRA 1LUKA 1G83A 1UURA 3VRZA 2CS0A 3IMJA 3TKZA 1QG1E 4A4BA 2Y1MA 3EAZA 4H34A 4DGXA 4X6SA 1O4PA 2CRHA 1SPSA 2SHPA 5DC9A 2LCTA 1O4AA 2L3TA 1LKKA 2KK6A 3VRNA 1H9OA 3BUOB 1R1PA 3HHMB 4JEGA 1BF5A 1RQQC 1BKMA 1O4IA 2L6KA 1NZLA 1AYAA 2YU7A 3BKBA 1JU5A 1O41A 2H5KA 3VS5A 1YVLA 4WWQA 1O4HA 3TL0A 2OZOA 1KC2A 3S8LA 1Y1UA 1PICA 1IJRA 1X0NA 1GHUA 2OQ1A 3VS1A 2XP1A 3VROA 1BLJA 2MRJA 4F5AA 4K2RA 2IUHA 1AOUF 2GE9A 4M4ZA 2MQIA 2LNWA 1R1SA 1GRIA 4EIHA 1JYUA 3VS0A 5IBMA 4OHLA 4XZ1A 1BMBA 1RPYA 2EL8A 2Y1NA 2PNAA 1SHBA 1AYBA 4OHDA 3WA4A 3CWGA 1A07A 1Y57A 1D1ZA 2HMHA 1LCKA 4FL2A 1O4DA 2PLEA 1K9AA 1LUNA 1O4KA 2RMXA 1FHSA 1NRVA 3K2MA 2GSBA 2AOBA 1A1EA 5GJHA 1YVHA 3UYOA 1AD5A 3T04A 1O4OA 1LKLA 1TZEE 2IZVA 2H46E 5HKYA 2DX0A 1A1AA 1O42A 2QMSA 4GL9E 1OPLA 1A1BA 1JYRA 4F5BA 3BUWB 1BHHA 1JWOA 2ABLA 1F2FA 1BHHB 3OB1B 2DCRA 1CSZA 3VGOA 4OHHA 1NZVA 1MILA 5KAZA 3GQIB 2RSYA 1FMKA 1O48A 1BM2A 4OHEA 4L1BB 1SHDA 2AUGA 2CR4A 1CWDL 3EACA 3ZNIA 1O4MA 1O4BA 2MK2A 1ZFPE 4FBNA 4NWFA 3OP0A 2LNXA 3BUXB 4EY0A 1XA6A 1LUMA 1LCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O43 A;  3GXW A;  2B3O A;  1M27 A;  4P9V A;  2YSX A;  5HKW A;  4QSY A;  1RJA A;  2DVJ A;  5I6V A;  1D4T A;  4K45 A;  2RVF A;  3VS3 A;  4JGH A;  3S9K A;  1KA7 A;  3VRY A;  2IUG A;  1AYC A;  2MRK A;  1B47 A;  3PSK A;  1SHA A;  2HUW A;  1O4Q A;  2MC1 A;  1A09 A;  1O4C A;  5EHR A;  2EO6 A;  1Z3K A;  3MAZ A;  1AB2 A;  1OPK A;  1X27 A;  1FU6 A;  2IUI A;  5AUL A;  3IN7 A;  2VIF A;  3HIZ B;  3M7F A;  1LUI A;  4LUD A;  3IN8 A;  3N84 A;  1CJ1 A;  3OVE A;  5EG3 B;  3PQZ A;  2BBU A;  2FCI A;  3US4 A;  3CXL A;  1OO3 A;  3PS5 A;  5J3X A;  1X6C A;  1D4W A;  1MW4 A;  2ECD A;  1WQU A;  1O49 A;  1A08 A;  4GWF A;  3UF4 A;  3VS7 A;  2C0O A;  2H8H A;  2ROR A;  3PSJ A;  3QWX X;  5BO4 A;  1BFJ A;  2PNB A;  1AYD A;  3PJP A;  4K44 A;  2DLY A;  1BKL A;  3MXY A;  5IBS A;  1QCF A;  4A4C A;  2C0I A;  2EYV A;  3IMD A;  4FL3 A;  4F59 A;  5EEL A;  2PLD A;  1TCE A;  4LUE A;  3KFJ A;  3VRP A;  2Y3A B;  5CDW A;  3N8M A;  5GJI A;  4ROJ A;  2AOA A;  4E68 A;  5D0J A;  1O45 A;  4TZI A;  3VRQ A;  3BUN B;  1A81 A;  2LQN A;  2DLZ A;  1O44 A;  4U17 A;  1FBV A;  4JE4 A;  4P9Z A;  1HCT B;  4K11 A;  3PLF B;  4GPL B;  2HCK A;  1OO4 A;  5HKZ A;  2L4K A;  3VS2 A;  3NHN A;  1FBZ A;  1QAD A;  2EYY A;  1O4F A;  1HCS B;  1O46 A;  2ETZ A;  2K7A B;  5AXI A;  1SKJ A;  3OV1 A;  4E93 A;  3BUM B;  1CSY A;  1R1Q A;  3CBL A;  1P13 A;  4NWG A;  2FO0 A;  3C7I A;  2EKX A;  2KNO A;  1BHF A;  1AOT F;  1KSW A;  5DC4 A;  1O4R A;  3MXC A;  2CI8 A;  1BFI A;  4H1O A;  4DGP A;  3S8N A;  1O4L A;  1BLK A;  5DF6 A;  1O4N A;  2CI9 A;  1F1W A;  1BG1 A;  1M61 A;  3VS6 A;  3VRR A;  1A1C A;  1FU5 A;  3CD3 A;  1JYQ A;  4OHI A;  2DM0 A;  1O4G A;  2EYZ A;  4U1P A;  3QWY A;  2PTK A;  1IS0 A;  1O4E A;  3N7Y A;  2K79 B;  1FYR A;  3PFV A;  2CIA A;  1CWE A;  1O4J A;  3HCK A;  2HDX A;  1O47 A;  2HDV A;  2EO3 A;  2EOB A;  2SRC A;  1UUS A;  5DC0 B;  1KA6 A;  4D8K A;  3S8O A;  1I3Z A;  2JYQ A;  2CBL A;  2C9W A;  3GXX A;  2LQW A;  3VS4 A;  5EHP A;  5EEQ A;  4XZ0 A;  2C0T A;  3OB2 B;  2EU0 A;  1SPR A;  1LUK A;  1G83 A;  1UUR A;  3VRZ A;  2CS0 A;  3IMJ A;  3TKZ A;  1QG1 E;  4A4B A;  2Y1M A;  3EAZ A;  4H34 A;  4DGX A;  4X6S A;  1O4P A;  2CRH A;  1SPS A;  2SHP A;  5DC9 A;  2LCT A;  1O4A A;  2L3T A;  1LKK A;  2KK6 A;  3VRN A;  1H9O A;  3BUO B;  1R1P A;  3HHM B;  4JEG A;  1BF5 A;  1RQQ C;  1BKM A;  1O4I A;  2L6K A;  1NZL A;  1AYA A;  2YU7 A;  3BKB A;  1JU5 A;  1O41 A;  2H5K A;  3VS5 A;  1YVL A;  4WWQ A;  1O4H A;  3TL0 A;  2OZO A;  1KC2 A;  3S8L A;  1Y1U A;  1PIC A;  1IJR A;  1X0N A;  1GHU A;  2OQ1 A;  3VS1 A;  2XP1 A;  3VRO A;  1BLJ A;  2MRJ A;  4F5A A;  4K2R A;  2IUH A;  1AOU F;  2GE9 A;  4M4Z A;  2MQI A;  2LNW A;  1R1S A;  1GRI A;  4EIH A;  1JYU A;  3VS0 A;  5IBM A;  4OHL A;  4XZ1 A;  1BMB A;  1RPY A;  2EL8 A;  2Y1N A;  2PNA A;  1SHB A;  1AYB A;  4OHD A;  3WA4 A;  3CWG A;  1A07 A;  1Y57 A;  1D1Z A;  2HMH A;  1LCK A;  4FL2 A;  1O4D A;  2PLE A;  1K9A A;  1LUN A;  1O4K A;  2RMX A;  1FHS A;  1NRV A;  3K2M A;  2GSB A;  2AOB A;  1A1E A;  5GJH A;  1YVH A;  3UYO A;  1AD5 A;  3T04 A;  1O4O A;  1LKL A;  1TZE E;  2IZV A;  2H46 E;  5HKY A;  2DX0 A;  1A1A A;  1O42 A;  2QMS A;  4GL9 E;  1OPL A;  1A1B A;  1JYR A;  4F5B A;  3BUW B;  1BHH A;  1JWO A;  2ABL A;  1F2F A;  1BHH B;  3OB1 B;  2DCR A;  1CSZ A;  3VGO A;  4OHH A;  1NZV A;  1MIL A;  5KAZ A;  3GQI B;  2RSY A;  1FMK A;  1O48 A;  1BM2 A;  4OHE A;  4L1B B;  1SHD A;  2AUG A;  2CR4 A;  1CWD L;  3EAC A;  3ZNI A;  1O4M A;  1O4B A;  2MK2 A;  1ZFP E;  4FBN A;  4NWF A;  3OP0 A;  2LNX A;  3BUX B;  4EY0 A;  1XA6 A;  1LUM A;  1LCJ A; 
#chains in the Genus database with same CATH topology
 1O43 A;  3GXW A;  2B3O A;  1M27 A;  4P9V A;  2YSX A;  5HKW A;  4QSY A;  1RJA A;  2DVJ A;  5I6V A;  1D4T A;  4K45 A;  2RVF A;  3VS3 A;  4JGH A;  3S9K A;  1KA7 A;  3VRY A;  2IUG A;  1AYC A;  2MRK A;  1B47 A;  3PSK A;  1SHA A;  2HUW A;  1O4Q A;  2MC1 A;  1A09 A;  1O4C A;  5EHR A;  2EO6 A;  1Z3K A;  3MAZ A;  1AB2 A;  1OPK A;  1X27 A;  1FU6 A;  2IUI A;  5AUL A;  3LYV A;  3IN7 A;  2VIF A;  3HIZ B;  3M7F A;  1LUI A;  4LUD A;  2LRA A;  3IN8 A;  3N84 A;  1CJ1 A;  3OVE A;  5EG3 B;  3PQZ A;  2BBU A;  2FCI A;  3US4 A;  3CXL A;  1OO3 A;  3PS5 A;  5J3X A;  1X6C A;  1D4W A;  1MW4 A;  2ECD A;  1WQU A;  1O49 A;  1A08 A;  4GWF A;  3UF4 A;  3VS7 A;  2C0O A;  2H8H A;  2ROR A;  3PSJ A;  3QWX X;  5BO4 A;  1BFJ A;  2PNB A;  1AYD A;  3PJP A;  4K44 A;  2DLY A;  1BKL A;  3MXY A;  5IBS A;  1QCF A;  4A4C A;  2C0I A;  2EYV A;  3IMD A;  4FL3 A;  4F59 A;  5EEL A;  2PLD A;  1TCE A;  4LUE A;  3KFJ A;  3VRP A;  2Y3A B;  5CDW A;  3N8M A;  5GJI A;  4ROJ A;  2AOA A;  4E68 A;  5D0J A;  2KGY A;  1O45 A;  4TZI A;  3VRQ A;  3BUN B;  1A81 A;  2LQN A;  2DLZ A;  1O44 A;  4U17 A;  1FBV A;  4JE4 A;  4P9Z A;  1HCT B;  4K11 A;  3PLF B;  4GPL B;  2HCK A;  1OO4 A;  5HKZ A;  2L4K A;  3VS2 A;  3NHN A;  1FBZ A;  1QAD A;  2EYY A;  1O4F A;  1HCS B;  1O46 A;  2ETZ A;  2K7A B;  5AXI A;  1SKJ A;  3OV1 A;  4E93 A;  3BUM B;  1CSY A;  1R1Q A;  3CBL A;  1P13 A;  4NWG A;  2FO0 A;  3C7I A;  2EKX A;  2KNO A;  1BHF A;  1AOT F;  1KSW A;  5DC4 A;  1O4R A;  3MXC A;  2CI8 A;  1BFI A;  4H1O A;  4DGP A;  3S8N A;  1O4L A;  1BLK A;  5DF6 A;  1O4N A;  2CI9 A;  1F1W A;  1BG1 A;  1M61 A;  3VS6 A;  3VRR A;  1A1C A;  1FU5 A;  3CD3 A;  1JYQ A;  4OHI A;  2DM0 A;  1O4G A;  2EYZ A;  4U1P A;  3QWY A;  2PTK A;  1IS0 A;  1O4E A;  3N7Y A;  2K79 B;  1FYR A;  3PFV A;  2CIA A;  1CWE A;  1O4J A;  3HCK A;  2HDX A;  1O47 A;  2HDV A;  2EO3 A;  2EOB A;  2SRC A;  1UUS A;  5DC0 B;  1KA6 A;  4D8K A;  3S8O A;  1I3Z A;  2JYQ A;  2CBL A;  2C9W A;  3GXX A;  2LQW A;  3VS4 A;  5EHP A;  5EEQ A;  4XZ0 A;  2C0T A;  3OB2 B;  2EU0 A;  1SPR A;  1LUK A;  1G83 A;  1UUR A;  3VRZ A;  2CS0 A;  3IMJ A;  3TKZ A;  1QG1 E;  4A4B A;  3K2T A;  2Y1M A;  3EAZ A;  4H34 A;  4DGX A;  4X6S A;  1O4P A;  2CRH A;  1SPS A;  2SHP A;  5DC9 A;  2LCT A;  1O4A A;  2L3T A;  1LKK A;  2KK6 A;  3VRN A;  1H9O A;  3BUO B;  1R1P A;  3HHM B;  4JEG A;  1BF5 A;  1RQQ C;  1BKM A;  1O4I A;  2L6K A;  1NZL A;  1AYA A;  2YU7 A;  3BKB A;  1JU5 A;  1O41 A;  2H5K A;  3VS5 A;  1YVL A;  4WWQ A;  1O4H A;  3TL0 A;  2OZO A;  1KC2 A;  3S8L A;  1Y1U A;  1PIC A;  1IJR A;  1X0N A;  1GHU A;  2OQ1 A;  3VS1 A;  2XP1 A;  3VRO A;  1BLJ A;  2MRJ A;  4F5A A;  4K2R A;  2IUH A;  1AOU F;  2GE9 A;  4M4Z A;  2MQI A;  2LNW A;  1R1S A;  1GRI A;  4EIH A;  1JYU A;  3VS0 A;  5IBM A;  4OHL A;  4XZ1 A;  1BMB A;  1RPY A;  2EL8 A;  2Y1N A;  2PNA A;  1SHB A;  1AYB A;  4OHD A;  3WA4 A;  3CWG A;  1A07 A;  1Y57 A;  1D1Z A;  2HMH A;  1LCK A;  4FL2 A;  1O4D A;  2PLE A;  1K9A A;  1LUN A;  1O4K A;  2RMX A;  1FHS A;  1NRV A;  3K2M A;  2GSB A;  2AOB A;  1A1E A;  5GJH A;  1YVH A;  3UYO A;  1AD5 A;  3T04 A;  1O4O A;  1LKL A;  1TZE E;  2IZV A;  2H46 E;  5HKY A;  2DX0 A;  1A1A A;  1O42 A;  2QMS A;  4GL9 E;  1OPL A;  1A1B A;  1JYR A;  4F5B A;  3BUW B;  1BHH A;  1JWO A;  2ABL A;  1F2F A;  1BHH B;  3OB1 B;  2DCR A;  1CSZ A;  3VGO A;  4OHH A;  1NZV A;  1MIL A;  5KAZ A;  3GQI B;  2RSY A;  1FMK A;  1O48 A;  1BM2 A;  4OHE A;  4L1B B;  1SHD A;  2AUG A;  2CR4 A;  1CWD L;  3EAC A;  3ZNI A;  1O4M A;  1O4B A;  2MK2 A;  1ZFP E;  4FBN A;  4NWF A;  3OP0 A;  2LNX A;  3BUX B;  4EY0 A;  1XA6 A;  1LUM A;  1LCJ A; 
#chains in the Genus database with same CATH homology
 1O43 A;  3GXW A;  2B3O A;  1M27 A;  4P9V A;  2YSX A;  5HKW A;  4QSY A;  1RJA A;  2DVJ A;  5I6V A;  1D4T A;  4K45 A;  2RVF A;  3VS3 A;  4JGH A;  3S9K A;  1KA7 A;  3VRY A;  2IUG A;  1AYC A;  2MRK A;  1B47 A;  3PSK A;  1SHA A;  2HUW A;  1O4Q A;  2MC1 A;  1A09 A;  1O4C A;  5EHR A;  2EO6 A;  1Z3K A;  3MAZ A;  1AB2 A;  1OPK A;  1X27 A;  1FU6 A;  2IUI A;  5AUL A;  3IN7 A;  2VIF A;  3HIZ B;  3M7F A;  1LUI A;  4LUD A;  3IN8 A;  3N84 A;  1CJ1 A;  3OVE A;  5EG3 B;  3PQZ A;  2BBU A;  2FCI A;  3US4 A;  3CXL A;  1OO3 A;  3PS5 A;  5J3X A;  1X6C A;  1D4W A;  1MW4 A;  2ECD A;  1WQU A;  1O49 A;  1A08 A;  4GWF A;  3UF4 A;  3VS7 A;  2C0O A;  2H8H A;  2ROR A;  3PSJ A;  3QWX X;  5BO4 A;  1BFJ A;  2PNB A;  1AYD A;  3PJP A;  4K44 A;  2DLY A;  1BKL A;  3MXY A;  5IBS A;  1QCF A;  4A4C A;  2C0I A;  2EYV A;  3IMD A;  4FL3 A;  4F59 A;  5EEL A;  2PLD A;  1TCE A;  4LUE A;  3KFJ A;  3VRP A;  2Y3A B;  5CDW A;  3N8M A;  5GJI A;  4ROJ A;  2AOA A;  4E68 A;  5D0J A;  1O45 A;  4TZI A;  3VRQ A;  3BUN B;  1A81 A;  2LQN A;  2DLZ A;  1O44 A;  4U17 A;  1FBV A;  4JE4 A;  4P9Z A;  1HCT B;  4K11 A;  3PLF B;  4GPL B;  2HCK A;  1OO4 A;  5HKZ A;  2L4K A;  3VS2 A;  3NHN A;  1FBZ A;  1QAD A;  2EYY A;  1O4F A;  1HCS B;  1O46 A;  2ETZ A;  2K7A B;  5AXI A;  1SKJ A;  3OV1 A;  4E93 A;  3BUM B;  1CSY A;  1R1Q A;  3CBL A;  1P13 A;  4NWG A;  2FO0 A;  3C7I A;  2EKX A;  2KNO A;  1BHF A;  1AOT F;  1KSW A;  5DC4 A;  1O4R A;  3MXC A;  2CI8 A;  1BFI A;  4H1O A;  4DGP A;  3S8N A;  1O4L A;  1BLK A;  5DF6 A;  1O4N A;  2CI9 A;  1F1W A;  1BG1 A;  1M61 A;  3VS6 A;  3VRR A;  1A1C A;  1FU5 A;  3CD3 A;  1JYQ A;  4OHI A;  2DM0 A;  1O4G A;  2EYZ A;  4U1P A;  3QWY A;  2PTK A;  1IS0 A;  1O4E A;  3N7Y A;  2K79 B;  1FYR A;  3PFV A;  2CIA A;  1CWE A;  1O4J A;  3HCK A;  2HDX A;  1O47 A;  2HDV A;  2EO3 A;  2EOB A;  2SRC A;  1UUS A;  5DC0 B;  1KA6 A;  4D8K A;  3S8O A;  1I3Z A;  2JYQ A;  2CBL A;  2C9W A;  3GXX A;  2LQW A;  3VS4 A;  5EHP A;  5EEQ A;  4XZ0 A;  2C0T A;  3OB2 B;  2EU0 A;  1SPR A;  1LUK A;  1G83 A;  1UUR A;  3VRZ A;  2CS0 A;  3IMJ A;  3TKZ A;  1QG1 E;  4A4B A;  2Y1M A;  3EAZ A;  4H34 A;  4DGX A;  4X6S A;  1O4P A;  2CRH A;  1SPS A;  2SHP A;  5DC9 A;  2LCT A;  1O4A A;  2L3T A;  1LKK A;  2KK6 A;  3VRN A;  1H9O A;  3BUO B;  1R1P A;  3HHM B;  4JEG A;  1BF5 A;  1RQQ C;  1BKM A;  1O4I A;  2L6K A;  1NZL A;  1AYA A;  2YU7 A;  3BKB A;  1JU5 A;  1O41 A;  2H5K A;  3VS5 A;  1YVL A;  4WWQ A;  1O4H A;  3TL0 A;  2OZO A;  1KC2 A;  3S8L A;  1Y1U A;  1PIC A;  1IJR A;  1X0N A;  1GHU A;  2OQ1 A;  3VS1 A;  2XP1 A;  3VRO A;  1BLJ A;  2MRJ A;  4F5A A;  4K2R A;  2IUH A;  1AOU F;  2GE9 A;  4M4Z A;  2MQI A;  2LNW A;  1R1S A;  1GRI A;  4EIH A;  1JYU A;  3VS0 A;  5IBM A;  4OHL A;  4XZ1 A;  1BMB A;  1RPY A;  2EL8 A;  2Y1N A;  2PNA A;  1SHB A;  1AYB A;  4OHD A;  3WA4 A;  3CWG A;  1A07 A;  1Y57 A;  1D1Z A;  2HMH A;  1LCK A;  4FL2 A;  1O4D A;  2PLE A;  1K9A A;  1LUN A;  1O4K A;  2RMX A;  1FHS A;  1NRV A;  3K2M A;  2GSB A;  2AOB A;  1A1E A;  5GJH A;  1YVH A;  3UYO A;  1AD5 A;  3T04 A;  1O4O A;  1LKL A;  1TZE E;  2IZV A;  2H46 E;  5HKY A;  2DX0 A;  1A1A A;  1O42 A;  2QMS A;  4GL9 E;  1OPL A;  1A1B A;  1JYR A;  4F5B A;  3BUW B;  1BHH A;  1JWO A;  2ABL A;  1F2F A;  1BHH B;  3OB1 B;  2DCR A;  1CSZ A;  3VGO A;  4OHH A;  1NZV A;  1MIL A;  5KAZ A;  3GQI B;  2RSY A;  1FMK A;  1O48 A;  1BM2 A;  4OHE A;  4L1B B;  1SHD A;  2AUG A;  2CR4 A;  1CWD L;  3EAC A;  3ZNI A;  1O4M A;  1O4B A;  2MK2 A;  1ZFP E;  4FBN A;  4NWF A;  3OP0 A;  2LNX A;  3BUX B;  4EY0 A;  1XA6 A;  1LUM A;  1LCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...