2AOBA

Crystal structures of a high-affinity macrocyclic peptide mimetic in complex with the grb2 sh2 domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Growth factor receptor-bound protein 2
publication title Crystal Structures of a High-affinity Macrocyclic Peptide Mimetic in Complex with the Grb2 SH2 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2aobA00
3VGOA 2BBUA 2YSXA 2DVJA 4H34A 1AB2A 3BUNB 3CBLA 3VRYA 1BM2A 1MILA 1O4LA 1JWOA 4A4BA 1KC2A 1QG1E 1O4GA 1RPYA 2Y1NA 5DC9A 1B47A 1AYAA 1LKLA 5DC0B 3PSKA 2ABLA 2H8HA 3OB1B 1P13A 3S9KA 5BO4A 2ETZA 3PS5A 1LCJA 3VROA 1BHFA 3K2MA 4EIHA 5DC4A 4JGHA 3QWXX 3BUMB 1LUKA 3BUWB 1O4AA 5HKZA 1HCTB 4M4ZA 2HCKA 4FL2A 1SPSA 1LCKA 3CD3A 2CR4A 1A08A 1QCFA 3OVEA 1MW4A 2EYZA 1O43A 1OPKA 1M27A 1YVHA 2JYQA 1O4RA 3HHMB 5KAZA 2LQWA 2EYVA 2PNAA 4NWFA 3PFVA 3PJPA 1BG1A 4DGPA 2AOAA 1FBVA 3GXWA 4F5AA 2L4KA 4QSYA 4P9VA 1O4MA 4OHHA 1O4PA 2EO6A 5CDWA 2EL8A 1KA7A 2H5KA 2C0OA 4ROJA 4XZ0A 1SHDA 3VRQA 3IN7A 1X6CA 3TL0A 2EU0A 3GQIB 2IUIA 1UUSA 1M61A 3TKZA 3ZNIA 2EO3A 1AYCA 5EG3B 3BUXB 3VS3A 4GPLB 1FMKA 2FCIA 2HMHA 5EHPA 3VS1A 2DCRA 4OHIA 1UURA 2CI8A 2VIFA 2ECDA 1FBZA 3OV1A 2K7AB 1D4WA 3CXLA 2GE9A 1AYDA 3VRNA 1O4BA 4P9ZA 1RJAA 5HKWA 2EKXA 2RSYA 1FHSA 3GXXA 2IZVA 1AOUF 1AYBA 3US4A 2CIAA 1X27A 2PNBA 2CRHA 2MK2A 1R1QA 1QADA 1LUNA 2OQ1A 4TZIA 1LKKA 1OO3A 1O44A 2MRJA 1JYUA 1LUMA 2IUGA 1LUIA 2EYYA 2EOBA 2SRCA 3C7IA 2DLYA 2MRKA 1CSYA 2PLEA 2QMSA 1O49A 2LCTA 1RQQC 1ZFPE 1O4JA 4K11A 3VS4A 2DX0A 1BFIA 1R1PA 1TCEA 1O4NA 3VS5A 1SPRA 1A1CA 3VS0A 3T04A 1BKMA 1H9OA 3IN8A 3VRRA 3HCKA 4K45A 4U17A 1A1BA 4E93A 1A81A 3EACA 1AOTF 1BKLA 2AOBA 1FYRA 3N8MA 1O4CA 1A09A 1O4DA 1BFJA 1KSWA 2RVFA 3MXYA 1NZLA 1BHHB 1Z3KA 1GRIA 2HDXA 4K44A 2FO0A 2CS0A 3IMJA 1BLJA 2GSBA 1O4OA 2RORA 4OHDA 2LQNA 1I3ZA 3IMDA 4OHLA 1O46A 1O47A 4LUDA 1XA6A 3S8LA 2B3OA 1CSZA 2DLZA 1O45A 4GL9E 2L6KA 5GJIA 4H1OA 1A07A 1TZEE 4FL3A 3WA4A 3OB2B 1CJ1A 5EEQA 1BHHA 2YU7A 1IS0A 2C9WA 1K9AA 3BKBA 5D0JA 1CWDL 2Y3AB 3MAZA 3CWGA 3VS2A 1BF5A 2Y1MA 3EAZA 4L1BB 1Y1UA 4NWGA 5EELA 3HIZB 4JE4A 2K79B 1SHAA 1O4IA 3VS7A 1YVLA 1WQUA 1A1AA 4JEGA 3PLFB 2CI9A 3PSJA 3VRZA 2H46E 1GHUA 1JYRA 1BMBA 1O4HA 1R1SA 1D4TA 3N7YA 4EY0A 1O4EA 1SHBA 1OPLA 5AULA 2AUGA 1O4FA 4X6SA 5AXIA 1CWEA 4E68A 1HCSB 2SHPA 1O4KA 1F2FA 3PQZA 2L3TA 2OZOA 3KFJA 1KA6A 4D8KA 2KK6A 5EHRA 1O4QA 2MQIA 3NHNA 1IJRA 2DM0A 3UYOA 2HDVA 3S8OA 4LUEA 5IBSA 3OP0A 5GJHA 4A4CA 2MC1A 4GWFA 3VRPA 1BLKA 4K2RA 1A1EA 4F5BA 1F1WA 4DGXA 3BUOB 4FBNA 4XZ1A 5IBMA 2PLDA 3M7FA 1O41A 1FU5A 4WWQA 2LNXA 1JU5A 1X0NA 1PICA 4U1PA 1D1ZA 5J3XA 2LNWA 1O42A 5DF6A 2C0TA 4F59A 3S8NA 3VS6A 1G83A 2KNOA 4OHEA 3UF4A 3QWYA 2IUHA 2PTKA 1NRVA 2HUWA 5HKYA 1JYQA 1OO4A 1Y57A 1FU6A 2C0IA 1NZVA 1AD5A 2CBLA 5I6VA 3N84A 2RMXA 2XP1A 3MXCA 1SKJA 1O48A
chains in the Genus database with same CATH superfamily
3VGOA 2BBUA 2YSXA 2DVJA 4H34A 1AB2A 3BUNB 3CBLA 3VRYA 1BM2A 1MILA 1O4LA 1JWOA 4A4BA 1KC2A 1QG1E 1O4GA 1RPYA 2Y1NA 5DC9A 1B47A 1AYAA 1LKLA 5DC0B 3PSKA 2ABLA 2H8HA 3OB1B 1P13A 3S9KA 5BO4A 2ETZA 3PS5A 1LCJA 3VROA 1BHFA 3K2MA 4EIHA 5DC4A 4JGHA 3QWXX 3BUMB 1LUKA 3BUWB 1O4AA 5HKZA 1HCTB 4M4ZA 2HCKA 4FL2A 1SPSA 1LCKA 3CD3A 2CR4A 1A08A 1QCFA 3OVEA 1MW4A 2EYZA 1O43A 1OPKA 1M27A 1YVHA 2JYQA 1O4RA 3HHMB 5KAZA 2LQWA 2KGYA 2EYVA 2PNAA 4NWFA 3PFVA 3PJPA 1BG1A 4DGPA 2AOAA 1FBVA 3GXWA 4F5AA 2L4KA 4QSYA 4P9VA 1O4MA 4OHHA 1O4PA 2EO6A 5CDWA 2EL8A 1KA7A 2H5KA 2C0OA 4ROJA 4XZ0A 1SHDA 3VRQA 3IN7A 1X6CA 3TL0A 2EU0A 3GQIB 2IUIA 1UUSA 1M61A 3TKZA 3ZNIA 2EO3A 1AYCA 5EG3B 3BUXB 3VS3A 4GPLB 1FMKA 2FCIA 2HMHA 5EHPA 3VS1A 2DCRA 4OHIA 1UURA 2CI8A 2VIFA 2ECDA 1FBZA 3OV1A 2K7AB 1D4WA 3CXLA 2GE9A 1AYDA 3VRNA 1O4BA 4P9ZA 1RJAA 5HKWA 2EKXA 2RSYA 1FHSA 3GXXA 2IZVA 1AOUF 1AYBA 3LYVA 3US4A 2CIAA 1X27A 2PNBA 2CRHA 2MK2A 1R1QA 1QADA 1LUNA 2OQ1A 4TZIA 1LKKA 1OO3A 1O44A 2MRJA 1JYUA 1LUMA 2IUGA 1LUIA 2EYYA 2EOBA 2SRCA 3C7IA 2DLYA 2MRKA 1CSYA 2PLEA 2QMSA 1O49A 2LCTA 1RQQC 1ZFPE 1O4JA 4K11A 3VS4A 2DX0A 1BFIA 1R1PA 1TCEA 1O4NA 3VS5A 1SPRA 1A1CA 3VS0A 3T04A 1BKMA 1H9OA 3IN8A 3VRRA 3HCKA 4K45A 4U17A 1A1BA 4E93A 1A81A 3EACA 1AOTF 1BKLA 2AOBA 1FYRA 3N8MA 1O4CA 1A09A 1O4DA 1BFJA 1KSWA 2RVFA 3MXYA 1NZLA 1BHHB 1Z3KA 1GRIA 2HDXA 4K44A 2FO0A 2CS0A 3IMJA 1BLJA 2GSBA 1O4OA 2RORA 4OHDA 2LQNA 1I3ZA 3IMDA 4OHLA 1O46A 1O47A 4LUDA 1XA6A 3S8LA 2B3OA 1CSZA 2DLZA 1O45A 4GL9E 2L6KA 5GJIA 4H1OA 1A07A 1TZEE 4FL3A 3WA4A 3OB2B 1CJ1A 5EEQA 1BHHA 2YU7A 1IS0A 3K2TA 2C9WA 1K9AA 3BKBA 5D0JA 1CWDL 2Y3AB 3MAZA 3CWGA 3VS2A 1BF5A 2Y1MA 3EAZA 4L1BB 1Y1UA 4NWGA 5EELA 3HIZB 4JE4A 2K79B 1SHAA 1O4IA 3VS7A 1YVLA 1WQUA 1A1AA 4JEGA 3PLFB 2CI9A 3PSJA 3VRZA 2H46E 1GHUA 1JYRA 1BMBA 1O4HA 1R1SA 1D4TA 3N7YA 4EY0A 1O4EA 1SHBA 1OPLA 5AULA 2AUGA 1O4FA 4X6SA 5AXIA 1CWEA 4E68A 1HCSB 2SHPA 1O4KA 1F2FA 3PQZA 2L3TA 2OZOA 3KFJA 1KA6A 4D8KA 2KK6A 5EHRA 1O4QA 2MQIA 3NHNA 1IJRA 2DM0A 3UYOA 2HDVA 3S8OA 4LUEA 5IBSA 3OP0A 5GJHA 4A4CA 2MC1A 4GWFA 3VRPA 1BLKA 4K2RA 1A1EA 4F5BA 1F1WA 4DGXA 3BUOB 4FBNA 4XZ1A 5IBMA 2PLDA 3M7FA 1O41A 1FU5A 4WWQA 2LNXA 1JU5A 1X0NA 1PICA 4U1PA 2LRAA 1D1ZA 5J3XA 2LNWA 1O42A 5DF6A 2C0TA 4F59A 3S8NA 3VS6A 1G83A 2KNOA 4OHEA 3UF4A 3QWYA 2IUHA 2PTKA 1NRVA 2HUWA 5HKYA 1JYQA 1OO4A 1Y57A 1FU6A 2C0IA 1NZVA 1AD5A 2CBLA 5I6VA 3N84A 2RMXA 2XP1A 3MXCA 1SKJA 1O48A
chains in the Genus database with same CATH topology
3VGOA 2BBUA 2YSXA 2DVJA 4H34A 1AB2A 3BUNB 3CBLA 3VRYA 1BM2A 1MILA 1O4LA 1JWOA 4A4BA 1KC2A 1QG1E 1O4GA 1RPYA 2Y1NA 5DC9A 1B47A 1AYAA 1LKLA 5DC0B 3PSKA 2ABLA 2H8HA 3OB1B 1P13A 3S9KA 5BO4A 2ETZA 3PS5A 1LCJA 3VROA 1BHFA 3K2MA 4EIHA 5DC4A 4JGHA 3QWXX 3BUMB 1LUKA 3BUWB 1O4AA 5HKZA 1HCTB 4M4ZA 2HCKA 4FL2A 1SPSA 1LCKA 3CD3A 2CR4A 1A08A 1QCFA 3OVEA 1MW4A 2EYZA 1O43A 1OPKA 1M27A 1YVHA 2JYQA 1O4RA 3HHMB 5KAZA 2LQWA 2EYVA 2PNAA 4NWFA 3PFVA 3PJPA 1BG1A 4DGPA 2AOAA 1FBVA 3GXWA 4F5AA 2L4KA 4QSYA 4P9VA 1O4MA 4OHHA 1O4PA 2EO6A 5CDWA 2EL8A 1KA7A 2H5KA 2C0OA 4ROJA 4XZ0A 1SHDA 3VRQA 3IN7A 1X6CA 3TL0A 2EU0A 3GQIB 2IUIA 1UUSA 1M61A 3TKZA 3ZNIA 2EO3A 1AYCA 5EG3B 3BUXB 3VS3A 4GPLB 1FMKA 2FCIA 2HMHA 5EHPA 3VS1A 2DCRA 4OHIA 1UURA 2CI8A 2VIFA 2ECDA 1FBZA 3OV1A 2K7AB 1D4WA 3CXLA 2GE9A 1AYDA 3VRNA 1O4BA 4P9ZA 1RJAA 5HKWA 2EKXA 2RSYA 1FHSA 3GXXA 2IZVA 1AOUF 1AYBA 3US4A 2CIAA 1X27A 2PNBA 2CRHA 2MK2A 1R1QA 1QADA 1LUNA 2OQ1A 4TZIA 1LKKA 1OO3A 1O44A 2MRJA 1JYUA 1LUMA 2IUGA 1LUIA 2EYYA 2EOBA 2SRCA 3C7IA 2DLYA 2MRKA 1CSYA 2PLEA 2QMSA 1O49A 2LCTA 1RQQC 1ZFPE 1O4JA 4K11A 3VS4A 2DX0A 1BFIA 1R1PA 1TCEA 1O4NA 3VS5A 1SPRA 1A1CA 3VS0A 3T04A 1BKMA 1H9OA 3IN8A 3VRRA 3HCKA 4K45A 4U17A 1A1BA 4E93A 1A81A 3EACA 1AOTF 1BKLA 2AOBA 1FYRA 3N8MA 1O4CA 1A09A 1O4DA 1BFJA 1KSWA 2RVFA 3MXYA 1NZLA 1BHHB 1Z3KA 1GRIA 2HDXA 4K44A 2FO0A 2CS0A 3IMJA 1BLJA 2GSBA 1O4OA 2RORA 4OHDA 2LQNA 1I3ZA 3IMDA 4OHLA 1O46A 1O47A 4LUDA 1XA6A 3S8LA 2B3OA 1CSZA 2DLZA 1O45A 4GL9E 2L6KA 5GJIA 4H1OA 1A07A 1TZEE 4FL3A 3WA4A 3OB2B 1CJ1A 5EEQA 1BHHA 2YU7A 1IS0A 2C9WA 1K9AA 3BKBA 5D0JA 1CWDL 2Y3AB 3MAZA 3CWGA 3VS2A 1BF5A 2Y1MA 3EAZA 4L1BB 1Y1UA 4NWGA 5EELA 3HIZB 4JE4A 2K79B 1SHAA 1O4IA 3VS7A 1YVLA 1WQUA 1A1AA 4JEGA 3PLFB 2CI9A 3PSJA 3VRZA 2H46E 1GHUA 1JYRA 1BMBA 1O4HA 1R1SA 1D4TA 3N7YA 4EY0A 1O4EA 1SHBA 1OPLA 5AULA 2AUGA 1O4FA 4X6SA 5AXIA 1CWEA 4E68A 1HCSB 2SHPA 1O4KA 1F2FA 3PQZA 2L3TA 2OZOA 3KFJA 1KA6A 4D8KA 2KK6A 5EHRA 1O4QA 2MQIA 3NHNA 1IJRA 2DM0A 3UYOA 2HDVA 3S8OA 4LUEA 5IBSA 3OP0A 5GJHA 4A4CA 2MC1A 4GWFA 3VRPA 1BLKA 4K2RA 1A1EA 4F5BA 1F1WA 4DGXA 3BUOB 4FBNA 4XZ1A 5IBMA 2PLDA 3M7FA 1O41A 1FU5A 4WWQA 2LNXA 1JU5A 1X0NA 1PICA 4U1PA 1D1ZA 5J3XA 2LNWA 1O42A 5DF6A 2C0TA 4F59A 3S8NA 3VS6A 1G83A 2KNOA 4OHEA 3UF4A 3QWYA 2IUHA 2PTKA 1NRVA 2HUWA 5HKYA 1JYQA 1OO4A 1Y57A 1FU6A 2C0IA 1NZVA 1AD5A 2CBLA 5I6VA 3N84A 2RMXA 2XP1A 3MXCA 1SKJA 1O48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGO A;  2BBU A;  2YSX A;  2DVJ A;  4H34 A;  1AB2 A;  3BUN B;  3CBL A;  3VRY A;  1BM2 A;  1MIL A;  1O4L A;  1JWO A;  4A4B A;  1KC2 A;  1QG1 E;  1O4G A;  1RPY A;  2Y1N A;  5DC9 A;  1B47 A;  1AYA A;  1LKL A;  5DC0 B;  3PSK A;  2ABL A;  2H8H A;  3OB1 B;  1P13 A;  3S9K A;  5BO4 A;  2ETZ A;  3PS5 A;  1LCJ A;  3VRO A;  1BHF A;  3K2M A;  4EIH A;  5DC4 A;  4JGH A;  3QWX X;  3BUM B;  1LUK A;  3BUW B;  1O4A A;  5HKZ A;  1HCT B;  4M4Z A;  2HCK A;  4FL2 A;  1SPS A;  1LCK A;  3CD3 A;  2CR4 A;  1A08 A;  1QCF A;  3OVE A;  1MW4 A;  2EYZ A;  1O43 A;  1OPK A;  1M27 A;  1YVH A;  2JYQ A;  1O4R A;  3HHM B;  5KAZ A;  2LQW A;  2EYV A;  2PNA A;  4NWF A;  3PFV A;  3PJP A;  1BG1 A;  4DGP A;  2AOA A;  1FBV A;  3GXW A;  4F5A A;  2L4K A;  4QSY A;  4P9V A;  1O4M A;  4OHH A;  1O4P A;  2EO6 A;  5CDW A;  2EL8 A;  1KA7 A;  2H5K A;  2C0O A;  4ROJ A;  4XZ0 A;  1SHD A;  3VRQ A;  3IN7 A;  1X6C A;  3TL0 A;  2EU0 A;  3GQI B;  2IUI A;  1UUS A;  1M61 A;  3TKZ A;  3ZNI A;  2EO3 A;  1AYC A;  5EG3 B;  3BUX B;  3VS3 A;  4GPL B;  1FMK A;  2FCI A;  2HMH A;  5EHP A;  3VS1 A;  2DCR A;  4OHI A;  1UUR A;  2CI8 A;  2VIF A;  2ECD A;  1FBZ A;  3OV1 A;  2K7A B;  1D4W A;  3CXL A;  2GE9 A;  1AYD A;  3VRN A;  1O4B A;  4P9Z A;  1RJA A;  5HKW A;  2EKX A;  2RSY A;  1FHS A;  3GXX A;  2IZV A;  1AOU F;  1AYB A;  3US4 A;  2CIA A;  1X27 A;  2PNB A;  2CRH A;  2MK2 A;  1R1Q A;  1QAD A;  1LUN A;  2OQ1 A;  4TZI A;  1LKK A;  1OO3 A;  1O44 A;  2MRJ A;  1JYU A;  1LUM A;  2IUG A;  1LUI A;  2EYY A;  2EOB A;  2SRC A;  3C7I A;  2DLY A;  2MRK A;  1CSY A;  2PLE A;  2QMS A;  1O49 A;  2LCT A;  1RQQ C;  1ZFP E;  1O4J A;  4K11 A;  3VS4 A;  2DX0 A;  1BFI A;  1R1P A;  1TCE A;  1O4N A;  3VS5 A;  1SPR A;  1A1C A;  3VS0 A;  3T04 A;  1BKM A;  1H9O A;  3IN8 A;  3VRR A;  3HCK A;  4K45 A;  4U17 A;  1A1B A;  4E93 A;  1A81 A;  3EAC A;  1AOT F;  1BKL A;  2AOB A;  1FYR A;  3N8M A;  1O4C A;  1A09 A;  1O4D A;  1BFJ A;  1KSW A;  2RVF A;  3MXY A;  1NZL A;  1BHH B;  1Z3K A;  1GRI A;  2HDX A;  4K44 A;  2FO0 A;  2CS0 A;  3IMJ A;  1BLJ A;  2GSB A;  1O4O A;  2ROR A;  4OHD A;  2LQN A;  1I3Z A;  3IMD A;  4OHL A;  1O46 A;  1O47 A;  4LUD A;  1XA6 A;  3S8L A;  2B3O A;  1CSZ A;  2DLZ A;  1O45 A;  4GL9 E;  2L6K A;  5GJI A;  4H1O A;  1A07 A;  1TZE E;  4FL3 A;  3WA4 A;  3OB2 B;  1CJ1 A;  5EEQ A;  1BHH A;  2YU7 A;  1IS0 A;  2C9W A;  1K9A A;  3BKB A;  5D0J A;  1CWD L;  2Y3A B;  3MAZ A;  3CWG A;  3VS2 A;  1BF5 A;  2Y1M A;  3EAZ A;  4L1B B;  1Y1U A;  4NWG A;  5EEL A;  3HIZ B;  4JE4 A;  2K79 B;  1SHA A;  1O4I A;  3VS7 A;  1YVL A;  1WQU A;  1A1A A;  4JEG A;  3PLF B;  2CI9 A;  3PSJ A;  3VRZ A;  2H46 E;  1GHU A;  1JYR A;  1BMB A;  1O4H A;  1R1S A;  1D4T A;  3N7Y A;  4EY0 A;  1O4E A;  1SHB A;  1OPL A;  5AUL A;  2AUG A;  1O4F A;  4X6S A;  5AXI A;  1CWE A;  4E68 A;  1HCS B;  2SHP A;  1O4K A;  1F2F A;  3PQZ A;  2L3T A;  2OZO A;  3KFJ A;  1KA6 A;  4D8K A;  2KK6 A;  5EHR A;  1O4Q A;  2MQI A;  3NHN A;  1IJR A;  2DM0 A;  3UYO A;  2HDV A;  3S8O A;  4LUE A;  5IBS A;  3OP0 A;  5GJH A;  4A4C A;  2MC1 A;  4GWF A;  3VRP A;  1BLK A;  4K2R A;  1A1E A;  4F5B A;  1F1W A;  4DGX A;  3BUO B;  4FBN A;  4XZ1 A;  5IBM A;  2PLD A;  3M7F A;  1O41 A;  1FU5 A;  4WWQ A;  2LNX A;  1JU5 A;  1X0N A;  1PIC A;  4U1P A;  1D1Z A;  5J3X A;  2LNW A;  1O42 A;  5DF6 A;  2C0T A;  4F59 A;  3S8N A;  3VS6 A;  1G83 A;  2KNO A;  4OHE A;  3UF4 A;  3QWY A;  2IUH A;  2PTK A;  1NRV A;  2HUW A;  5HKY A;  1JYQ A;  1OO4 A;  1Y57 A;  1FU6 A;  2C0I A;  1NZV A;  1AD5 A;  2CBL A;  5I6V A;  3N84 A;  2RMX A;  2XP1 A;  3MXC A;  1SKJ A;  1O48 A; 
#chains in the Genus database with same CATH topology
 3VGO A;  2BBU A;  2YSX A;  2DVJ A;  4H34 A;  1AB2 A;  3BUN B;  3CBL A;  3VRY A;  1BM2 A;  1MIL A;  1O4L A;  1JWO A;  4A4B A;  1KC2 A;  1QG1 E;  1O4G A;  1RPY A;  2Y1N A;  5DC9 A;  1B47 A;  1AYA A;  1LKL A;  5DC0 B;  3PSK A;  2ABL A;  2H8H A;  3OB1 B;  1P13 A;  3S9K A;  5BO4 A;  2ETZ A;  3PS5 A;  1LCJ A;  3VRO A;  1BHF A;  3K2M A;  4EIH A;  5DC4 A;  4JGH A;  3QWX X;  3BUM B;  1LUK A;  3BUW B;  1O4A A;  5HKZ A;  1HCT B;  4M4Z A;  2HCK A;  4FL2 A;  1SPS A;  1LCK A;  3CD3 A;  2CR4 A;  1A08 A;  1QCF A;  3OVE A;  1MW4 A;  2EYZ A;  1O43 A;  1OPK A;  1M27 A;  1YVH A;  2JYQ A;  1O4R A;  3HHM B;  5KAZ A;  2LQW A;  2KGY A;  2EYV A;  2PNA A;  4NWF A;  3PFV A;  3PJP A;  1BG1 A;  4DGP A;  2AOA A;  1FBV A;  3GXW A;  4F5A A;  2L4K A;  4QSY A;  4P9V A;  1O4M A;  4OHH A;  1O4P A;  2EO6 A;  5CDW A;  2EL8 A;  1KA7 A;  2H5K A;  2C0O A;  4ROJ A;  4XZ0 A;  1SHD A;  3VRQ A;  3IN7 A;  1X6C A;  3TL0 A;  2EU0 A;  3GQI B;  2IUI A;  1UUS A;  1M61 A;  3TKZ A;  3ZNI A;  2EO3 A;  1AYC A;  5EG3 B;  3BUX B;  3VS3 A;  4GPL B;  1FMK A;  2FCI A;  2HMH A;  5EHP A;  3VS1 A;  2DCR A;  4OHI A;  1UUR A;  2CI8 A;  2VIF A;  2ECD A;  1FBZ A;  3OV1 A;  2K7A B;  1D4W A;  3CXL A;  2GE9 A;  1AYD A;  3VRN A;  1O4B A;  4P9Z A;  1RJA A;  5HKW A;  2EKX A;  2RSY A;  1FHS A;  3GXX A;  2IZV A;  1AOU F;  1AYB A;  3LYV A;  3US4 A;  2CIA A;  1X27 A;  2PNB A;  2CRH A;  2MK2 A;  1R1Q A;  1QAD A;  1LUN A;  2OQ1 A;  4TZI A;  1LKK A;  1OO3 A;  1O44 A;  2MRJ A;  1JYU A;  1LUM A;  2IUG A;  1LUI A;  2EYY A;  2EOB A;  2SRC A;  3C7I A;  2DLY A;  2MRK A;  1CSY A;  2PLE A;  2QMS A;  1O49 A;  2LCT A;  1RQQ C;  1ZFP E;  1O4J A;  4K11 A;  3VS4 A;  2DX0 A;  1BFI A;  1R1P A;  1TCE A;  1O4N A;  3VS5 A;  1SPR A;  1A1C A;  3VS0 A;  3T04 A;  1BKM A;  1H9O A;  3IN8 A;  3VRR A;  3HCK A;  4K45 A;  4U17 A;  1A1B A;  4E93 A;  1A81 A;  3EAC A;  1AOT F;  1BKL A;  2AOB A;  1FYR A;  3N8M A;  1O4C A;  1A09 A;  1O4D A;  1BFJ A;  1KSW A;  2RVF A;  3MXY A;  1NZL A;  1BHH B;  1Z3K A;  1GRI A;  2HDX A;  4K44 A;  2FO0 A;  2CS0 A;  3IMJ A;  1BLJ A;  2GSB A;  1O4O A;  2ROR A;  4OHD A;  2LQN A;  1I3Z A;  3IMD A;  4OHL A;  1O46 A;  1O47 A;  4LUD A;  1XA6 A;  3S8L A;  2B3O A;  1CSZ A;  2DLZ A;  1O45 A;  4GL9 E;  2L6K A;  5GJI A;  4H1O A;  1A07 A;  1TZE E;  4FL3 A;  3WA4 A;  3OB2 B;  1CJ1 A;  5EEQ A;  1BHH A;  2YU7 A;  1IS0 A;  3K2T A;  2C9W A;  1K9A A;  3BKB A;  5D0J A;  1CWD L;  2Y3A B;  3MAZ A;  3CWG A;  3VS2 A;  1BF5 A;  2Y1M A;  3EAZ A;  4L1B B;  1Y1U A;  4NWG A;  5EEL A;  3HIZ B;  4JE4 A;  2K79 B;  1SHA A;  1O4I A;  3VS7 A;  1YVL A;  1WQU A;  1A1A A;  4JEG A;  3PLF B;  2CI9 A;  3PSJ A;  3VRZ A;  2H46 E;  1GHU A;  1JYR A;  1BMB A;  1O4H A;  1R1S A;  1D4T A;  3N7Y A;  4EY0 A;  1O4E A;  1SHB A;  1OPL A;  5AUL A;  2AUG A;  1O4F A;  4X6S A;  5AXI A;  1CWE A;  4E68 A;  1HCS B;  2SHP A;  1O4K A;  1F2F A;  3PQZ A;  2L3T A;  2OZO A;  3KFJ A;  1KA6 A;  4D8K A;  2KK6 A;  5EHR A;  1O4Q A;  2MQI A;  3NHN A;  1IJR A;  2DM0 A;  3UYO A;  2HDV A;  3S8O A;  4LUE A;  5IBS A;  3OP0 A;  5GJH A;  4A4C A;  2MC1 A;  4GWF A;  3VRP A;  1BLK A;  4K2R A;  1A1E A;  4F5B A;  1F1W A;  4DGX A;  3BUO B;  4FBN A;  4XZ1 A;  5IBM A;  2PLD A;  3M7F A;  1O41 A;  1FU5 A;  4WWQ A;  2LNX A;  1JU5 A;  1X0N A;  1PIC A;  4U1P A;  2LRA A;  1D1Z A;  5J3X A;  2LNW A;  1O42 A;  5DF6 A;  2C0T A;  4F59 A;  3S8N A;  3VS6 A;  1G83 A;  2KNO A;  4OHE A;  3UF4 A;  3QWY A;  2IUH A;  2PTK A;  1NRV A;  2HUW A;  5HKY A;  1JYQ A;  1OO4 A;  1Y57 A;  1FU6 A;  2C0I A;  1NZV A;  1AD5 A;  2CBL A;  5I6V A;  3N84 A;  2RMX A;  2XP1 A;  3MXC A;  1SKJ A;  1O48 A; 
#chains in the Genus database with same CATH homology
 3VGO A;  2BBU A;  2YSX A;  2DVJ A;  4H34 A;  1AB2 A;  3BUN B;  3CBL A;  3VRY A;  1BM2 A;  1MIL A;  1O4L A;  1JWO A;  4A4B A;  1KC2 A;  1QG1 E;  1O4G A;  1RPY A;  2Y1N A;  5DC9 A;  1B47 A;  1AYA A;  1LKL A;  5DC0 B;  3PSK A;  2ABL A;  2H8H A;  3OB1 B;  1P13 A;  3S9K A;  5BO4 A;  2ETZ A;  3PS5 A;  1LCJ A;  3VRO A;  1BHF A;  3K2M A;  4EIH A;  5DC4 A;  4JGH A;  3QWX X;  3BUM B;  1LUK A;  3BUW B;  1O4A A;  5HKZ A;  1HCT B;  4M4Z A;  2HCK A;  4FL2 A;  1SPS A;  1LCK A;  3CD3 A;  2CR4 A;  1A08 A;  1QCF A;  3OVE A;  1MW4 A;  2EYZ A;  1O43 A;  1OPK A;  1M27 A;  1YVH A;  2JYQ A;  1O4R A;  3HHM B;  5KAZ A;  2LQW A;  2EYV A;  2PNA A;  4NWF A;  3PFV A;  3PJP A;  1BG1 A;  4DGP A;  2AOA A;  1FBV A;  3GXW A;  4F5A A;  2L4K A;  4QSY A;  4P9V A;  1O4M A;  4OHH A;  1O4P A;  2EO6 A;  5CDW A;  2EL8 A;  1KA7 A;  2H5K A;  2C0O A;  4ROJ A;  4XZ0 A;  1SHD A;  3VRQ A;  3IN7 A;  1X6C A;  3TL0 A;  2EU0 A;  3GQI B;  2IUI A;  1UUS A;  1M61 A;  3TKZ A;  3ZNI A;  2EO3 A;  1AYC A;  5EG3 B;  3BUX B;  3VS3 A;  4GPL B;  1FMK A;  2FCI A;  2HMH A;  5EHP A;  3VS1 A;  2DCR A;  4OHI A;  1UUR A;  2CI8 A;  2VIF A;  2ECD A;  1FBZ A;  3OV1 A;  2K7A B;  1D4W A;  3CXL A;  2GE9 A;  1AYD A;  3VRN A;  1O4B A;  4P9Z A;  1RJA A;  5HKW A;  2EKX A;  2RSY A;  1FHS A;  3GXX A;  2IZV A;  1AOU F;  1AYB A;  3US4 A;  2CIA A;  1X27 A;  2PNB A;  2CRH A;  2MK2 A;  1R1Q A;  1QAD A;  1LUN A;  2OQ1 A;  4TZI A;  1LKK A;  1OO3 A;  1O44 A;  2MRJ A;  1JYU A;  1LUM A;  2IUG A;  1LUI A;  2EYY A;  2EOB A;  2SRC A;  3C7I A;  2DLY A;  2MRK A;  1CSY A;  2PLE A;  2QMS A;  1O49 A;  2LCT A;  1RQQ C;  1ZFP E;  1O4J A;  4K11 A;  3VS4 A;  2DX0 A;  1BFI A;  1R1P A;  1TCE A;  1O4N A;  3VS5 A;  1SPR A;  1A1C A;  3VS0 A;  3T04 A;  1BKM A;  1H9O A;  3IN8 A;  3VRR A;  3HCK A;  4K45 A;  4U17 A;  1A1B A;  4E93 A;  1A81 A;  3EAC A;  1AOT F;  1BKL A;  2AOB A;  1FYR A;  3N8M A;  1O4C A;  1A09 A;  1O4D A;  1BFJ A;  1KSW A;  2RVF A;  3MXY A;  1NZL A;  1BHH B;  1Z3K A;  1GRI A;  2HDX A;  4K44 A;  2FO0 A;  2CS0 A;  3IMJ A;  1BLJ A;  2GSB A;  1O4O A;  2ROR A;  4OHD A;  2LQN A;  1I3Z A;  3IMD A;  4OHL A;  1O46 A;  1O47 A;  4LUD A;  1XA6 A;  3S8L A;  2B3O A;  1CSZ A;  2DLZ A;  1O45 A;  4GL9 E;  2L6K A;  5GJI A;  4H1O A;  1A07 A;  1TZE E;  4FL3 A;  3WA4 A;  3OB2 B;  1CJ1 A;  5EEQ A;  1BHH A;  2YU7 A;  1IS0 A;  2C9W A;  1K9A A;  3BKB A;  5D0J A;  1CWD L;  2Y3A B;  3MAZ A;  3CWG A;  3VS2 A;  1BF5 A;  2Y1M A;  3EAZ A;  4L1B B;  1Y1U A;  4NWG A;  5EEL A;  3HIZ B;  4JE4 A;  2K79 B;  1SHA A;  1O4I A;  3VS7 A;  1YVL A;  1WQU A;  1A1A A;  4JEG A;  3PLF B;  2CI9 A;  3PSJ A;  3VRZ A;  2H46 E;  1GHU A;  1JYR A;  1BMB A;  1O4H A;  1R1S A;  1D4T A;  3N7Y A;  4EY0 A;  1O4E A;  1SHB A;  1OPL A;  5AUL A;  2AUG A;  1O4F A;  4X6S A;  5AXI A;  1CWE A;  4E68 A;  1HCS B;  2SHP A;  1O4K A;  1F2F A;  3PQZ A;  2L3T A;  2OZO A;  3KFJ A;  1KA6 A;  4D8K A;  2KK6 A;  5EHR A;  1O4Q A;  2MQI A;  3NHN A;  1IJR A;  2DM0 A;  3UYO A;  2HDV A;  3S8O A;  4LUE A;  5IBS A;  3OP0 A;  5GJH A;  4A4C A;  2MC1 A;  4GWF A;  3VRP A;  1BLK A;  4K2R A;  1A1E A;  4F5B A;  1F1W A;  4DGX A;  3BUO B;  4FBN A;  4XZ1 A;  5IBM A;  2PLD A;  3M7F A;  1O41 A;  1FU5 A;  4WWQ A;  2LNX A;  1JU5 A;  1X0N A;  1PIC A;  4U1P A;  1D1Z A;  5J3X A;  2LNW A;  1O42 A;  5DF6 A;  2C0T A;  4F59 A;  3S8N A;  3VS6 A;  1G83 A;  2KNO A;  4OHE A;  3UF4 A;  3QWY A;  2IUH A;  2PTK A;  1NRV A;  2HUW A;  5HKY A;  1JYQ A;  1OO4 A;  1Y57 A;  1FU6 A;  2C0I A;  1NZV A;  1AD5 A;  2CBL A;  5I6V A;  3N84 A;  2RMX A;  2XP1 A;  3MXC A;  1SKJ A;  1O48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...