4EY0A

Structure of tandem sh2 domains from plcgamma1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
234
Chain Sequence
NEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDFGAFVEANPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase ga
publication title Structural and Functional Integration of the PLCgamma Interaction Domains Critical for Regulatory Mechanisms and Signaling Deregulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 234
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4ey0A02
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4ey0A01
4NWGA 1YVLA 3N8MA 4U17A 1R1QA 4L1BB 1O4DA 1A81A 1I3ZA 1O47A 2MC1A 4F5BA 1CSYA 5EEQA 4F59A 5KAZA 4XZ0A 3S8NA 2RORA 2C9WA 2DLYA 1KA6A 4M4ZA 1YVHA 3BUOB 1O4RA 2GSBA 1O4IA 1BFIA 1UURA 4JE4A 5DF6A 1O4CA 1QG1E 1SHBA 1LKLA 1O43A 3GQIB 4XZ1A 1A1AA 1MW4A 3VRRA 2Y3AB 3PJPA 1GHUA 2JYQA 1SHDA 1GRIA 2L4KA 1JYRA 1NZVA 1D1ZA 2IZVA 1HCSB 5IBMA 2EYZA 4EIHA 2PNBA 2CS0A 1CSZA 2HDVA 4F5AA 5IBSA 1K9AA 2IUHA 1BMBA 1P13A 4A4CA 3QWYA 2FCIA 1Y1UA 1O4FA 3WA4A 3N84A 3OVEA 3VS4A 1IJRA 4ROJA 2Y1MA 1AYAA 2K7AB 2EYYA 2YU7A 1F1WA 1CJ1A 2VIFA 3BUXB 1LUKA 1BLKA 4K2RA 2CI9A 5EELA 3VRYA 3VS3A 4OHLA 2EO6A 1G83A 2RSYA 1LUNA 2H46E 4K45A 2LNWA 1TCEA 3US4A 3EAZA 1BKMA 4OHHA 2C0IA 3PQZA 4H34A 3KFJA 2DX0A 1AYBA 1UUSA 1A1EA 5HKYA 2CBLA 2H8HA 1Y57A 5GJHA 1X0NA 2MQIA 4EY0A 2CRHA 2MRKA 1O44A 1O4OA 1LCJA 1OO4A 3HHMB 3TKZA 3PSKA 2DVJA 5DC4A 3VROA 2CIAA 2EO3A 2K79B 1BFJA 2FO0A 2AOAA 2LCTA 1O42A 3PLFB 4FBNA 3VRPA 3VS7A 3CXLA 4LUDA 3MXCA 1AYDA 4JEGA 2RVFA 4P9ZA 1JWOA 1WQUA 3CBLA 1BM2A 2ECDA 2SRCA 3PFVA 1QCFA 5I6VA 1FU5A 3VS1A 2PLEA 1CWDL 1XA6A 1O4PA 4OHDA 5EG3B 1BKLA 4TZIA 2AUGA 1RJAA 3NHNA 1OO3A 4WWQA 4QSYA 1AD5A 3OV1A 4OHIA 2CI8A 1A07A 1FHSA 3VS5A 4JGHA 5HKZA 2L3TA 2HCKA 4DGPA 3CD3A 1KA7A 4NWFA 1A09A 5CDWA 3GXWA 2Y1NA 3VRNA 1B47A 1JYUA 5AULA 4GWFA 1O4JA 1BG1A 1FBVA 1O4NA 1O4KA 1NZLA 3VRZA 1BHHB 1AYCA 1KC2A 3OB1B 1NRVA 3VRQA 3PS5A 1AB2A 2IUIA 4K44A 1O4QA 5EHPA 4H1OA 1KSWA 3OB2B 1SPSA 1Z3KA 2C0OA 1A08A 2LNXA 3S8OA 1MILA 1JYQA 3CWGA 2PNAA 5HKWA 2C0TA 1PICA 1RQQC 2DCRA 1BLJA 2EYVA 3MXYA 2EKXA 2KNOA 2EL8A 2B3OA 3IN8A 2YSXA 1O4MA 4D8KA 1O49A 2EU0A 4A4BA 1CWEA 1O46A 3IMDA 1O48A 2SHPA 3VGOA 1LKKA 2L6KA 5DC0B 1LCKA 2ETZA 1X6CA 1M27A 3S9KA 5J3XA 1X27A 4GPLB 4OHEA 1JU5A 3BKBA 1BHHA 4GL9E 1SPRA 4K11A 2MRJA 3VS0A 1M61A 4E68A 1IS0A 3QWXX 3OP0A 4X6SA 1R1PA 4FL2A 3C7IA 5D0JA 3HCKA 1F2FA 1R1SA 2HDXA 5DC9A 5AXIA 2IUGA 1O4EA 1LUIA 2HUWA 4LUEA 1HCTB 1FMKA 2H5KA 3MAZA 3GXXA 2LQWA 3BUMB 4U1PA 2LQNA 5BO4A 3HIZB 3TL0A 1A1BA 1FU6A 4DGXA 1SKJA 1A1CA 3VS6A 1O4BA 3T04A 1FYRA 1AOTF 1O4AA 1O41A 3IMJA 1OPLA 1BF5A 1O4GA 3BUWB 2CR4A 3K2MA 3BUNB 1FBZA 2PLDA 4P9VA 1LUMA 1AOUF 1BHFA 3UYOA 2PTKA 2OZOA 2MK2A 2GE9A 2DLZA 3UF4A 1O4LA 1OPKA 1D4TA 3EACA 2BBUA 3S8LA 1ZFPE 2RMXA 2ABLA 1O4HA 1H9OA 2OQ1A 5GJIA 3M7FA 2HMHA 2AOBA 3ZNIA 2QMSA 1TZEE 1QADA 2DM0A 2XP1A 3PSJA 3VS2A 4E93A 1SHAA 3IN7A 4FL3A 2EOBA 2KK6A 1D4WA 1O45A 3N7YA 5EHRA 1RPYA
chains in the Genus database with same CATH superfamily
4NWGA 1YVLA 3N8MA 4U17A 1R1QA 4L1BB 1O4DA 1A81A 1I3ZA 1O47A 2MC1A 4F5BA 1CSYA 5EEQA 4F59A 5KAZA 4XZ0A 3S8NA 2RORA 2C9WA 2DLYA 3LYVA 1KA6A 4M4ZA 1YVHA 3BUOB 1O4RA 2GSBA 1O4IA 1BFIA 1UURA 4JE4A 5DF6A 1O4CA 1QG1E 1SHBA 1LKLA 1O43A 3GQIB 4XZ1A 1A1AA 1MW4A 3VRRA 2Y3AB 3PJPA 1GHUA 2JYQA 1SHDA 1GRIA 2L4KA 1JYRA 1NZVA 1D1ZA 2IZVA 1HCSB 5IBMA 2EYZA 4EIHA 2PNBA 2CS0A 1CSZA 2HDVA 4F5AA 5IBSA 1K9AA 2IUHA 1BMBA 1P13A 4A4CA 3QWYA 2FCIA 1Y1UA 1O4FA 3WA4A 3N84A 3OVEA 3VS4A 1IJRA 4ROJA 2Y1MA 1AYAA 2K7AB 2EYYA 2YU7A 1F1WA 1CJ1A 2VIFA 3BUXB 1LUKA 1BLKA 4K2RA 2CI9A 5EELA 3VRYA 3VS3A 4OHLA 2EO6A 1G83A 2RSYA 1LUNA 2H46E 4K45A 2LNWA 1TCEA 3US4A 3EAZA 1BKMA 4OHHA 2C0IA 3PQZA 4H34A 3KFJA 2DX0A 1AYBA 1UUSA 1A1EA 5HKYA 2CBLA 2H8HA 1Y57A 5GJHA 1X0NA 2MQIA 4EY0A 2CRHA 2MRKA 1O44A 1O4OA 1LCJA 1OO4A 3HHMB 3TKZA 3PSKA 2DVJA 5DC4A 3VROA 2CIAA 2EO3A 2K79B 1BFJA 2FO0A 2AOAA 2LCTA 1O42A 3PLFB 4FBNA 3VRPA 3VS7A 3CXLA 4LUDA 3MXCA 1AYDA 4JEGA 2RVFA 4P9ZA 1JWOA 1WQUA 3CBLA 1BM2A 2ECDA 2SRCA 3PFVA 1QCFA 5I6VA 1FU5A 3VS1A 2PLEA 1CWDL 1XA6A 1O4PA 4OHDA 3K2TA 5EG3B 1BKLA 4TZIA 2AUGA 1RJAA 3NHNA 1OO3A 4WWQA 4QSYA 1AD5A 3OV1A 4OHIA 2CI8A 1A07A 1FHSA 3VS5A 4JGHA 5HKZA 2L3TA 2HCKA 4DGPA 3CD3A 1KA7A 4NWFA 1A09A 5CDWA 3GXWA 2Y1NA 3VRNA 1B47A 1JYUA 5AULA 4GWFA 1O4JA 1BG1A 1FBVA 1O4NA 1O4KA 1NZLA 3VRZA 1BHHB 1AYCA 1KC2A 3OB1B 1NRVA 3VRQA 3PS5A 1AB2A 2IUIA 4K44A 1O4QA 5EHPA 4H1OA 1KSWA 3OB2B 1SPSA 1Z3KA 2C0OA 1A08A 2KGYA 2LNXA 3S8OA 1MILA 1JYQA 3CWGA 2PNAA 5HKWA 2C0TA 1PICA 1RQQC 2DCRA 1BLJA 2EYVA 3MXYA 2EKXA 2KNOA 2EL8A 2B3OA 3IN8A 2YSXA 1O4MA 4D8KA 1O49A 2EU0A 4A4BA 1CWEA 1O46A 3IMDA 1O48A 2SHPA 3VGOA 1LKKA 2L6KA 5DC0B 1LCKA 2ETZA 1X6CA 1M27A 3S9KA 5J3XA 1X27A 4GPLB 4OHEA 1JU5A 3BKBA 1BHHA 4GL9E 1SPRA 4K11A 2MRJA 3VS0A 1M61A 4E68A 1IS0A 3QWXX 3OP0A 4X6SA 1R1PA 2LRAA 4FL2A 3C7IA 5D0JA 3HCKA 1F2FA 1R1SA 2HDXA 5DC9A 5AXIA 2IUGA 1O4EA 1LUIA 2HUWA 4LUEA 1HCTB 1FMKA 2H5KA 3MAZA 3GXXA 2LQWA 3BUMB 4U1PA 2LQNA 5BO4A 3HIZB 3TL0A 1A1BA 1FU6A 4DGXA 1SKJA 1A1CA 3VS6A 1O4BA 3T04A 1FYRA 1AOTF 1O4AA 1O41A 3IMJA 1OPLA 1BF5A 1O4GA 3BUWB 2CR4A 3K2MA 3BUNB 1FBZA 2PLDA 4P9VA 1LUMA 1AOUF 1BHFA 3UYOA 2PTKA 2OZOA 2MK2A 2GE9A 2DLZA 3UF4A 1O4LA 1OPKA 1D4TA 3EACA 2BBUA 3S8LA 1ZFPE 2RMXA 2ABLA 1O4HA 1H9OA 2OQ1A 5GJIA 3M7FA 2HMHA 2AOBA 3ZNIA 2QMSA 1TZEE 1QADA 2DM0A 2XP1A 3PSJA 3VS2A 4E93A 1SHAA 3IN7A 4FL3A 2EOBA 2KK6A 1D4WA 1O45A 3N7YA 5EHRA 1RPYA
chains in the Genus database with same CATH topology
4NWGA 1YVLA 3N8MA 4U17A 1R1QA 4L1BB 1O4DA 1A81A 1I3ZA 1O47A 2MC1A 4F5BA 1CSYA 5EEQA 4F59A 5KAZA 4XZ0A 3S8NA 2RORA 2C9WA 2DLYA 1KA6A 4M4ZA 1YVHA 3BUOB 1O4RA 2GSBA 1O4IA 1BFIA 1UURA 4JE4A 5DF6A 1O4CA 1QG1E 1SHBA 1LKLA 1O43A 3GQIB 4XZ1A 1A1AA 1MW4A 3VRRA 2Y3AB 3PJPA 1GHUA 2JYQA 1SHDA 1GRIA 2L4KA 1JYRA 1NZVA 1D1ZA 2IZVA 1HCSB 5IBMA 2EYZA 4EIHA 2PNBA 2CS0A 1CSZA 2HDVA 4F5AA 5IBSA 1K9AA 2IUHA 1BMBA 1P13A 4A4CA 3QWYA 2FCIA 1Y1UA 1O4FA 3WA4A 3N84A 3OVEA 3VS4A 1IJRA 4ROJA 2Y1MA 1AYAA 2K7AB 2EYYA 2YU7A 1F1WA 1CJ1A 2VIFA 3BUXB 1LUKA 1BLKA 4K2RA 2CI9A 5EELA 3VRYA 3VS3A 4OHLA 2EO6A 1G83A 2RSYA 1LUNA 2H46E 4K45A 2LNWA 1TCEA 3US4A 3EAZA 1BKMA 4OHHA 2C0IA 3PQZA 4H34A 3KFJA 2DX0A 1AYBA 1UUSA 1A1EA 5HKYA 2CBLA 2H8HA 1Y57A 5GJHA 1X0NA 2MQIA 4EY0A 2CRHA 2MRKA 1O44A 1O4OA 1LCJA 1OO4A 3HHMB 3TKZA 3PSKA 2DVJA 5DC4A 3VROA 2CIAA 2EO3A 2K79B 1BFJA 2FO0A 2AOAA 2LCTA 1O42A 3PLFB 4FBNA 3VRPA 3VS7A 3CXLA 4LUDA 3MXCA 1AYDA 4JEGA 2RVFA 4P9ZA 1JWOA 1WQUA 3CBLA 1BM2A 2ECDA 2SRCA 3PFVA 1QCFA 5I6VA 1FU5A 3VS1A 2PLEA 1CWDL 1XA6A 1O4PA 4OHDA 5EG3B 1BKLA 4TZIA 2AUGA 1RJAA 3NHNA 1OO3A 4WWQA 4QSYA 1AD5A 3OV1A 4OHIA 2CI8A 1A07A 1FHSA 3VS5A 4JGHA 5HKZA 2L3TA 2HCKA 4DGPA 3CD3A 1KA7A 4NWFA 1A09A 5CDWA 3GXWA 2Y1NA 3VRNA 1B47A 1JYUA 5AULA 4GWFA 1O4JA 1BG1A 1FBVA 1O4NA 1O4KA 1NZLA 3VRZA 1BHHB 1AYCA 1KC2A 3OB1B 1NRVA 3VRQA 3PS5A 1AB2A 2IUIA 4K44A 1O4QA 5EHPA 4H1OA 1KSWA 3OB2B 1SPSA 1Z3KA 2C0OA 1A08A 2LNXA 3S8OA 1MILA 1JYQA 3CWGA 2PNAA 5HKWA 2C0TA 1PICA 1RQQC 2DCRA 1BLJA 2EYVA 3MXYA 2EKXA 2KNOA 2EL8A 2B3OA 3IN8A 2YSXA 1O4MA 4D8KA 1O49A 2EU0A 4A4BA 1CWEA 1O46A 3IMDA 1O48A 2SHPA 3VGOA 1LKKA 2L6KA 5DC0B 1LCKA 2ETZA 1X6CA 1M27A 3S9KA 5J3XA 1X27A 4GPLB 4OHEA 1JU5A 3BKBA 1BHHA 4GL9E 1SPRA 4K11A 2MRJA 3VS0A 1M61A 4E68A 1IS0A 3QWXX 3OP0A 4X6SA 1R1PA 4FL2A 3C7IA 5D0JA 3HCKA 1F2FA 1R1SA 2HDXA 5DC9A 5AXIA 2IUGA 1O4EA 1LUIA 2HUWA 4LUEA 1HCTB 1FMKA 2H5KA 3MAZA 3GXXA 2LQWA 3BUMB 4U1PA 2LQNA 5BO4A 3HIZB 3TL0A 1A1BA 1FU6A 4DGXA 1SKJA 1A1CA 3VS6A 1O4BA 3T04A 1FYRA 1AOTF 1O4AA 1O41A 3IMJA 1OPLA 1BF5A 1O4GA 3BUWB 2CR4A 3K2MA 3BUNB 1FBZA 2PLDA 4P9VA 1LUMA 1AOUF 1BHFA 3UYOA 2PTKA 2OZOA 2MK2A 2GE9A 2DLZA 3UF4A 1O4LA 1OPKA 1D4TA 3EACA 2BBUA 3S8LA 1ZFPE 2RMXA 2ABLA 1O4HA 1H9OA 2OQ1A 5GJIA 3M7FA 2HMHA 2AOBA 3ZNIA 2QMSA 1TZEE 1QADA 2DM0A 2XP1A 3PSJA 3VS2A 4E93A 1SHAA 3IN7A 4FL3A 2EOBA 2KK6A 1D4WA 1O45A 3N7YA 5EHRA 1RPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NWG A;  1YVL A;  3N8M A;  4U17 A;  1R1Q A;  4L1B B;  1O4D A;  1A81 A;  1I3Z A;  1O47 A;  2MC1 A;  4F5B A;  1CSY A;  5EEQ A;  4F59 A;  5KAZ A;  4XZ0 A;  3S8N A;  2ROR A;  2C9W A;  2DLY A;  1KA6 A;  4M4Z A;  1YVH A;  3BUO B;  1O4R A;  2GSB A;  1O4I A;  1BFI A;  1UUR A;  4JE4 A;  5DF6 A;  1O4C A;  1QG1 E;  1SHB A;  1LKL A;  1O43 A;  3GQI B;  4XZ1 A;  1A1A A;  1MW4 A;  3VRR A;  2Y3A B;  3PJP A;  1GHU A;  2JYQ A;  1SHD A;  1GRI A;  2L4K A;  1JYR A;  1NZV A;  1D1Z A;  2IZV A;  1HCS B;  5IBM A;  2EYZ A;  4EIH A;  2PNB A;  2CS0 A;  1CSZ A;  2HDV A;  4F5A A;  5IBS A;  1K9A A;  2IUH A;  1BMB A;  1P13 A;  4A4C A;  3QWY A;  2FCI A;  1Y1U A;  1O4F A;  3WA4 A;  3N84 A;  3OVE A;  3VS4 A;  1IJR A;  4ROJ A;  2Y1M A;  1AYA A;  2K7A B;  2EYY A;  2YU7 A;  1F1W A;  1CJ1 A;  2VIF A;  3BUX B;  1LUK A;  1BLK A;  4K2R A;  2CI9 A;  5EEL A;  3VRY A;  3VS3 A;  4OHL A;  2EO6 A;  1G83 A;  2RSY A;  1LUN A;  2H46 E;  4K45 A;  2LNW A;  1TCE A;  3US4 A;  3EAZ A;  1BKM A;  4OHH A;  2C0I A;  3PQZ A;  4H34 A;  3KFJ A;  2DX0 A;  1AYB A;  1UUS A;  1A1E A;  5HKY A;  2CBL A;  2H8H A;  1Y57 A;  5GJH A;  1X0N A;  2MQI A;  4EY0 A;  2CRH A;  2MRK A;  1O44 A;  1O4O A;  1LCJ A;  1OO4 A;  3HHM B;  3TKZ A;  3PSK A;  2DVJ A;  5DC4 A;  3VRO A;  2CIA A;  2EO3 A;  2K79 B;  1BFJ A;  2FO0 A;  2AOA A;  2LCT A;  1O42 A;  3PLF B;  4FBN A;  3VRP A;  3VS7 A;  3CXL A;  4LUD A;  3MXC A;  1AYD A;  4JEG A;  2RVF A;  4P9Z A;  1JWO A;  1WQU A;  3CBL A;  1BM2 A;  2ECD A;  2SRC A;  3PFV A;  1QCF A;  5I6V A;  1FU5 A;  3VS1 A;  2PLE A;  1CWD L;  1XA6 A;  1O4P A;  4OHD A;  5EG3 B;  1BKL A;  4TZI A;  2AUG A;  1RJA A;  3NHN A;  1OO3 A;  4WWQ A;  4QSY A;  1AD5 A;  3OV1 A;  4OHI A;  2CI8 A;  1A07 A;  1FHS A;  3VS5 A;  4JGH A;  5HKZ A;  2L3T A;  2HCK A;  4DGP A;  3CD3 A;  1KA7 A;  4NWF A;  1A09 A;  5CDW A;  3GXW A;  2Y1N A;  3VRN A;  1B47 A;  1JYU A;  5AUL A;  4GWF A;  1O4J A;  1BG1 A;  1FBV A;  1O4N A;  1O4K A;  1NZL A;  3VRZ A;  1BHH B;  1AYC A;  1KC2 A;  3OB1 B;  1NRV A;  3VRQ A;  3PS5 A;  1AB2 A;  2IUI A;  4K44 A;  1O4Q A;  5EHP A;  4H1O A;  1KSW A;  3OB2 B;  1SPS A;  1Z3K A;  2C0O A;  1A08 A;  2LNX A;  3S8O A;  1MIL A;  1JYQ A;  3CWG A;  2PNA A;  5HKW A;  2C0T A;  1PIC A;  1RQQ C;  2DCR A;  1BLJ A;  2EYV A;  3MXY A;  2EKX A;  2KNO A;  2EL8 A;  2B3O A;  3IN8 A;  2YSX A;  1O4M A;  4D8K A;  1O49 A;  2EU0 A;  4A4B A;  1CWE A;  1O46 A;  3IMD A;  1O48 A;  2SHP A;  3VGO A;  1LKK A;  2L6K A;  5DC0 B;  1LCK A;  2ETZ A;  1X6C A;  1M27 A;  3S9K A;  5J3X A;  1X27 A;  4GPL B;  4OHE A;  1JU5 A;  3BKB A;  1BHH A;  4GL9 E;  1SPR A;  4K11 A;  2MRJ A;  3VS0 A;  1M61 A;  4E68 A;  1IS0 A;  3QWX X;  3OP0 A;  4X6S A;  1R1P A;  4FL2 A;  3C7I A;  5D0J A;  3HCK A;  1F2F A;  1R1S A;  2HDX A;  5DC9 A;  5AXI A;  2IUG A;  1O4E A;  1LUI A;  2HUW A;  4LUE A;  1HCT B;  1FMK A;  2H5K A;  3MAZ A;  3GXX A;  2LQW A;  3BUM B;  4U1P A;  2LQN A;  5BO4 A;  3HIZ B;  3TL0 A;  1A1B A;  1FU6 A;  4DGX A;  1SKJ A;  1A1C A;  3VS6 A;  1O4B A;  3T04 A;  1FYR A;  1AOT F;  1O4A A;  1O41 A;  3IMJ A;  1OPL A;  1BF5 A;  1O4G A;  3BUW B;  2CR4 A;  3K2M A;  3BUN B;  1FBZ A;  2PLD A;  4P9V A;  1LUM A;  1AOU F;  1BHF A;  3UYO A;  2PTK A;  2OZO A;  2MK2 A;  2GE9 A;  2DLZ A;  3UF4 A;  1O4L A;  1OPK A;  1D4T A;  3EAC A;  2BBU A;  3S8L A;  1ZFP E;  2RMX A;  2ABL A;  1O4H A;  1H9O A;  2OQ1 A;  5GJI A;  3M7F A;  2HMH A;  2AOB A;  3ZNI A;  2QMS A;  1TZE E;  1QAD A;  2DM0 A;  2XP1 A;  3PSJ A;  3VS2 A;  4E93 A;  1SHA A;  3IN7 A;  4FL3 A;  2EOB A;  2KK6 A;  1D4W A;  1O45 A;  3N7Y A;  5EHR A;  1RPY A; 
#chains in the Genus database with same CATH topology
 4NWG A;  1YVL A;  3N8M A;  4U17 A;  1R1Q A;  4L1B B;  1O4D A;  1A81 A;  1I3Z A;  1O47 A;  2MC1 A;  4F5B A;  1CSY A;  5EEQ A;  4F59 A;  5KAZ A;  4XZ0 A;  3S8N A;  2ROR A;  2C9W A;  2DLY A;  3LYV A;  1KA6 A;  4M4Z A;  1YVH A;  3BUO B;  1O4R A;  2GSB A;  1O4I A;  1BFI A;  1UUR A;  4JE4 A;  5DF6 A;  1O4C A;  1QG1 E;  1SHB A;  1LKL A;  1O43 A;  3GQI B;  4XZ1 A;  1A1A A;  1MW4 A;  3VRR A;  2Y3A B;  3PJP A;  1GHU A;  2JYQ A;  1SHD A;  1GRI A;  2L4K A;  1JYR A;  1NZV A;  1D1Z A;  2IZV A;  1HCS B;  5IBM A;  2EYZ A;  4EIH A;  2PNB A;  2CS0 A;  1CSZ A;  2HDV A;  4F5A A;  5IBS A;  1K9A A;  2IUH A;  1BMB A;  1P13 A;  4A4C A;  3QWY A;  2FCI A;  1Y1U A;  1O4F A;  3WA4 A;  3N84 A;  3OVE A;  3VS4 A;  1IJR A;  4ROJ A;  2Y1M A;  1AYA A;  2K7A B;  2EYY A;  2YU7 A;  1F1W A;  1CJ1 A;  2VIF A;  3BUX B;  1LUK A;  1BLK A;  4K2R A;  2CI9 A;  5EEL A;  3VRY A;  3VS3 A;  4OHL A;  2EO6 A;  1G83 A;  2RSY A;  1LUN A;  2H46 E;  4K45 A;  2LNW A;  1TCE A;  3US4 A;  3EAZ A;  1BKM A;  4OHH A;  2C0I A;  3PQZ A;  4H34 A;  3KFJ A;  2DX0 A;  1AYB A;  1UUS A;  1A1E A;  5HKY A;  2CBL A;  2H8H A;  1Y57 A;  5GJH A;  1X0N A;  2MQI A;  4EY0 A;  2CRH A;  2MRK A;  1O44 A;  1O4O A;  1LCJ A;  1OO4 A;  3HHM B;  3TKZ A;  3PSK A;  2DVJ A;  5DC4 A;  3VRO A;  2CIA A;  2EO3 A;  2K79 B;  1BFJ A;  2FO0 A;  2AOA A;  2LCT A;  1O42 A;  3PLF B;  4FBN A;  3VRP A;  3VS7 A;  3CXL A;  4LUD A;  3MXC A;  1AYD A;  4JEG A;  2RVF A;  4P9Z A;  1JWO A;  1WQU A;  3CBL A;  1BM2 A;  2ECD A;  2SRC A;  3PFV A;  1QCF A;  5I6V A;  1FU5 A;  3VS1 A;  2PLE A;  1CWD L;  1XA6 A;  1O4P A;  4OHD A;  3K2T A;  5EG3 B;  1BKL A;  4TZI A;  2AUG A;  1RJA A;  3NHN A;  1OO3 A;  4WWQ A;  4QSY A;  1AD5 A;  3OV1 A;  4OHI A;  2CI8 A;  1A07 A;  1FHS A;  3VS5 A;  4JGH A;  5HKZ A;  2L3T A;  2HCK A;  4DGP A;  3CD3 A;  1KA7 A;  4NWF A;  1A09 A;  5CDW A;  3GXW A;  2Y1N A;  3VRN A;  1B47 A;  1JYU A;  5AUL A;  4GWF A;  1O4J A;  1BG1 A;  1FBV A;  1O4N A;  1O4K A;  1NZL A;  3VRZ A;  1BHH B;  1AYC A;  1KC2 A;  3OB1 B;  1NRV A;  3VRQ A;  3PS5 A;  1AB2 A;  2IUI A;  4K44 A;  1O4Q A;  5EHP A;  4H1O A;  1KSW A;  3OB2 B;  1SPS A;  1Z3K A;  2C0O A;  1A08 A;  2KGY A;  2LNX A;  3S8O A;  1MIL A;  1JYQ A;  3CWG A;  2PNA A;  5HKW A;  2C0T A;  1PIC A;  1RQQ C;  2DCR A;  1BLJ A;  2EYV A;  3MXY A;  2EKX A;  2KNO A;  2EL8 A;  2B3O A;  3IN8 A;  2YSX A;  1O4M A;  4D8K A;  1O49 A;  2EU0 A;  4A4B A;  1CWE A;  1O46 A;  3IMD A;  1O48 A;  2SHP A;  3VGO A;  1LKK A;  2L6K A;  5DC0 B;  1LCK A;  2ETZ A;  1X6C A;  1M27 A;  3S9K A;  5J3X A;  1X27 A;  4GPL B;  4OHE A;  1JU5 A;  3BKB A;  1BHH A;  4GL9 E;  1SPR A;  4K11 A;  2MRJ A;  3VS0 A;  1M61 A;  4E68 A;  1IS0 A;  3QWX X;  3OP0 A;  4X6S A;  1R1P A;  2LRA A;  4FL2 A;  3C7I A;  5D0J A;  3HCK A;  1F2F A;  1R1S A;  2HDX A;  5DC9 A;  5AXI A;  2IUG A;  1O4E A;  1LUI A;  2HUW A;  4LUE A;  1HCT B;  1FMK A;  2H5K A;  3MAZ A;  3GXX A;  2LQW A;  3BUM B;  4U1P A;  2LQN A;  5BO4 A;  3HIZ B;  3TL0 A;  1A1B A;  1FU6 A;  4DGX A;  1SKJ A;  1A1C A;  3VS6 A;  1O4B A;  3T04 A;  1FYR A;  1AOT F;  1O4A A;  1O41 A;  3IMJ A;  1OPL A;  1BF5 A;  1O4G A;  3BUW B;  2CR4 A;  3K2M A;  3BUN B;  1FBZ A;  2PLD A;  4P9V A;  1LUM A;  1AOU F;  1BHF A;  3UYO A;  2PTK A;  2OZO A;  2MK2 A;  2GE9 A;  2DLZ A;  3UF4 A;  1O4L A;  1OPK A;  1D4T A;  3EAC A;  2BBU A;  3S8L A;  1ZFP E;  2RMX A;  2ABL A;  1O4H A;  1H9O A;  2OQ1 A;  5GJI A;  3M7F A;  2HMH A;  2AOB A;  3ZNI A;  2QMS A;  1TZE E;  1QAD A;  2DM0 A;  2XP1 A;  3PSJ A;  3VS2 A;  4E93 A;  1SHA A;  3IN7 A;  4FL3 A;  2EOB A;  2KK6 A;  1D4W A;  1O45 A;  3N7Y A;  5EHR A;  1RPY A; 
#chains in the Genus database with same CATH homology
 4NWG A;  1YVL A;  3N8M A;  4U17 A;  1R1Q A;  4L1B B;  1O4D A;  1A81 A;  1I3Z A;  1O47 A;  2MC1 A;  4F5B A;  1CSY A;  5EEQ A;  4F59 A;  5KAZ A;  4XZ0 A;  3S8N A;  2ROR A;  2C9W A;  2DLY A;  1KA6 A;  4M4Z A;  1YVH A;  3BUO B;  1O4R A;  2GSB A;  1O4I A;  1BFI A;  1UUR A;  4JE4 A;  5DF6 A;  1O4C A;  1QG1 E;  1SHB A;  1LKL A;  1O43 A;  3GQI B;  4XZ1 A;  1A1A A;  1MW4 A;  3VRR A;  2Y3A B;  3PJP A;  1GHU A;  2JYQ A;  1SHD A;  1GRI A;  2L4K A;  1JYR A;  1NZV A;  1D1Z A;  2IZV A;  1HCS B;  5IBM A;  2EYZ A;  4EIH A;  2PNB A;  2CS0 A;  1CSZ A;  2HDV A;  4F5A A;  5IBS A;  1K9A A;  2IUH A;  1BMB A;  1P13 A;  4A4C A;  3QWY A;  2FCI A;  1Y1U A;  1O4F A;  3WA4 A;  3N84 A;  3OVE A;  3VS4 A;  1IJR A;  4ROJ A;  2Y1M A;  1AYA A;  2K7A B;  2EYY A;  2YU7 A;  1F1W A;  1CJ1 A;  2VIF A;  3BUX B;  1LUK A;  1BLK A;  4K2R A;  2CI9 A;  5EEL A;  3VRY A;  3VS3 A;  4OHL A;  2EO6 A;  1G83 A;  2RSY A;  1LUN A;  2H46 E;  4K45 A;  2LNW A;  1TCE A;  3US4 A;  3EAZ A;  1BKM A;  4OHH A;  2C0I A;  3PQZ A;  4H34 A;  3KFJ A;  2DX0 A;  1AYB A;  1UUS A;  1A1E A;  5HKY A;  2CBL A;  2H8H A;  1Y57 A;  5GJH A;  1X0N A;  2MQI A;  4EY0 A;  2CRH A;  2MRK A;  1O44 A;  1O4O A;  1LCJ A;  1OO4 A;  3HHM B;  3TKZ A;  3PSK A;  2DVJ A;  5DC4 A;  3VRO A;  2CIA A;  2EO3 A;  2K79 B;  1BFJ A;  2FO0 A;  2AOA A;  2LCT A;  1O42 A;  3PLF B;  4FBN A;  3VRP A;  3VS7 A;  3CXL A;  4LUD A;  3MXC A;  1AYD A;  4JEG A;  2RVF A;  4P9Z A;  1JWO A;  1WQU A;  3CBL A;  1BM2 A;  2ECD A;  2SRC A;  3PFV A;  1QCF A;  5I6V A;  1FU5 A;  3VS1 A;  2PLE A;  1CWD L;  1XA6 A;  1O4P A;  4OHD A;  5EG3 B;  1BKL A;  4TZI A;  2AUG A;  1RJA A;  3NHN A;  1OO3 A;  4WWQ A;  4QSY A;  1AD5 A;  3OV1 A;  4OHI A;  2CI8 A;  1A07 A;  1FHS A;  3VS5 A;  4JGH A;  5HKZ A;  2L3T A;  2HCK A;  4DGP A;  3CD3 A;  1KA7 A;  4NWF A;  1A09 A;  5CDW A;  3GXW A;  2Y1N A;  3VRN A;  1B47 A;  1JYU A;  5AUL A;  4GWF A;  1O4J A;  1BG1 A;  1FBV A;  1O4N A;  1O4K A;  1NZL A;  3VRZ A;  1BHH B;  1AYC A;  1KC2 A;  3OB1 B;  1NRV A;  3VRQ A;  3PS5 A;  1AB2 A;  2IUI A;  4K44 A;  1O4Q A;  5EHP A;  4H1O A;  1KSW A;  3OB2 B;  1SPS A;  1Z3K A;  2C0O A;  1A08 A;  2LNX A;  3S8O A;  1MIL A;  1JYQ A;  3CWG A;  2PNA A;  5HKW A;  2C0T A;  1PIC A;  1RQQ C;  2DCR A;  1BLJ A;  2EYV A;  3MXY A;  2EKX A;  2KNO A;  2EL8 A;  2B3O A;  3IN8 A;  2YSX A;  1O4M A;  4D8K A;  1O49 A;  2EU0 A;  4A4B A;  1CWE A;  1O46 A;  3IMD A;  1O48 A;  2SHP A;  3VGO A;  1LKK A;  2L6K A;  5DC0 B;  1LCK A;  2ETZ A;  1X6C A;  1M27 A;  3S9K A;  5J3X A;  1X27 A;  4GPL B;  4OHE A;  1JU5 A;  3BKB A;  1BHH A;  4GL9 E;  1SPR A;  4K11 A;  2MRJ A;  3VS0 A;  1M61 A;  4E68 A;  1IS0 A;  3QWX X;  3OP0 A;  4X6S A;  1R1P A;  4FL2 A;  3C7I A;  5D0J A;  3HCK A;  1F2F A;  1R1S A;  2HDX A;  5DC9 A;  5AXI A;  2IUG A;  1O4E A;  1LUI A;  2HUW A;  4LUE A;  1HCT B;  1FMK A;  2H5K A;  3MAZ A;  3GXX A;  2LQW A;  3BUM B;  4U1P A;  2LQN A;  5BO4 A;  3HIZ B;  3TL0 A;  1A1B A;  1FU6 A;  4DGX A;  1SKJ A;  1A1C A;  3VS6 A;  1O4B A;  3T04 A;  1FYR A;  1AOT F;  1O4A A;  1O41 A;  3IMJ A;  1OPL A;  1BF5 A;  1O4G A;  3BUW B;  2CR4 A;  3K2M A;  3BUN B;  1FBZ A;  2PLD A;  4P9V A;  1LUM A;  1AOU F;  1BHF A;  3UYO A;  2PTK A;  2OZO A;  2MK2 A;  2GE9 A;  2DLZ A;  3UF4 A;  1O4L A;  1OPK A;  1D4T A;  3EAC A;  2BBU A;  3S8L A;  1ZFP E;  2RMX A;  2ABL A;  1O4H A;  1H9O A;  2OQ1 A;  5GJI A;  3M7F A;  2HMH A;  2AOB A;  3ZNI A;  2QMS A;  1TZE E;  1QAD A;  2DM0 A;  2XP1 A;  3PSJ A;  3VS2 A;  4E93 A;  1SHA A;  3IN7 A;  4FL3 A;  2EOB A;  2KK6 A;  1D4W A;  1O45 A;  3N7Y A;  5EHR A;  1RPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...