4JE4A

Crystal structure of monobody nsa1/shp2 n-sh2 domain complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
102
structure length
102
Chain Sequence
SRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 11
publication title Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 27
structure length 102
sequence length 102
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4je4A00
2PLEA 2IUHA 3S8NA 1SHBA 1CJ1A 2EOBA 1SPRA 2ETZA 3CXLA 2EKXA 4OHHA 2VIFA 2ECDA 1A1AA 1LUIA 1JWOA 3PS5A 1IS0A 2PNBA 5IBMA 3VS7A 2EYVA 4LUEA 3IN8A 5AXIA 2OQ1A 1O4NA 2RORA 1O4QA 3S9KA 4ROJA 2Y3AB 2OZOA 4P9ZA 4FL2A 1D4WA 2PNAA 3CWGA 2BBUA 2LNXA 2LNWA 1RQQC 2RMXA 3VS1A 2RSYA 2LQWA 1AYDA 3GXWA 1AB2A 1O4PA 1O4KA 2MC1A 5I6VA 1BG1A 3VS3A 1FU5A 1O4IA 2SHPA 2KK6A 2H46E 1LKKA 4XZ0A 2CR4A 4F5BA 1BFJA 2DVJA 3VS6A 3T04A 4DGPA 3PFVA 2YSXA 4D8KA 2C0OA 4OHLA 2HDVA 4M4ZA 2LCTA 2GE9A 3VRYA 2CS0A 3NHNA 1CSZA 3MXYA 5DC0B 2EYYA 3OP0A 3IMDA 5DF6A 1O4OA 1FBZA 1Z3KA 2EU0A 5DC9A 2HCKA 3EAZA 2LQNA 2DLZA 3BUNB 4K44A 3S8LA 2XP1A 1F2FA 2DM0A 3VS2A 1GRIA 4JE4A 1JU5A 1M61A 1O4GA 2C0TA 3VROA 3IN7A 5EG3B 3WA4A 2EL8A 1O4CA 3ZNIA 1OPKA 3PSJA 3TKZA 2ABLA 1O45A 1M27A 4K45A 4F5AA 1SHDA 3VS4A 2PTKA 4GWFA 4WWQA 2L4KA 1FBVA 4LUDA 5HKWA 2H5KA 3BKBA 1CWEA 1O46A 1UURA 3VS0A 2PLDA 5EELA 1A1CA 1AYAA 1JYRA 3BUMB 1KSWA 4GPLB 4K11A 1X0NA 2CRHA 1RJAA 4OHEA 2AOAA 2RVFA 5KAZA 1SKJA 3BUWB 1SPSA 4H34A 3CBLA 1A1EA 1YVLA 3BUXB 1BLJA 1WQUA 2Y1NA 1GHUA 1SHAA 1O4EA 3S8OA 1YVHA 3IMJA 3VRRA 2DLYA 1K9AA 1O4AA 2IZVA 1RPYA 1G83A 2B3OA 2HUWA 1X6CA 5GJIA 5EEQA 3PQZA 3PSKA 3EACA 2HMHA 3HIZB 4TZIA 4L1BB 2K7AB 1TZEE 1O4HA 1BLKA 3HHMB 1JYUA 3BUOB 5DC4A 2YU7A 4EIHA 1FHSA 1O4RA 4P9VA 1QG1E 2MK2A 5AULA 1BHFA 1A1BA 1P13A 5HKZA 1AOUF 2IUGA 3N8MA 1Y1UA 1LCJA 2K79B 1O4BA 1A09A 3GXXA 1AYBA 3UF4A 2EYZA 1O44A 2KNOA 1BMBA 1O41A 5HKYA 1HCTB 2L3TA 2GSBA 1I3ZA 1BFIA 1R1PA 5EHRA 5J3XA 1FYRA 1MW4A 2QMSA 1LUKA 1KA7A 1F1WA 2FCIA 1AOTF 5GJHA 1XA6A 4EY0A 1R1SA 3QWYA 1OO3A 2IUIA 1O4MA 1R1QA 2EO6A 1NRVA 2H8HA 3GQIB 1O4FA 2Y1MA 1A08A 4JEGA 4A4CA 3OB2B 5CDWA 2JYQA 1OO4A 4A4BA 4QSYA 3CD3A 4DGXA 3QWXX 2HDXA 3K2MA 3VGOA 2FO0A 3VRNA 1LKLA 1KA6A 4E93A 3OB1B 3C7IA 1FU6A 1O4JA 3MXCA 2MRKA 1O4DA 4U17A 1FMKA 1LCKA 1LUMA 1O42A 5IBSA 1JYQA 1BHHB 1UUSA 1PICA 4FL3A 1O49A 2C9WA 4E68A 5BO4A 2CI9A 3HCKA 1HCSB 1A81A 4X6SA 1CSYA 1H9OA 1X27A 2CIAA 3US4A 4F59A 1BKMA 2MRJA 1B47A 1LUNA 2CBLA 1Y57A 1O48A 2AOBA 1MILA 4XZ1A 4FBNA 1AD5A 2DCRA 2C0IA 1OPLA 5D0JA 1NZVA 3UYOA 1ZFPE 4H1OA 4NWFA 1BKLA 1D1ZA 3VRPA 1A07A 3N84A 4U1PA 1KC2A 3OVEA 1O47A 2CI8A 4OHDA 1CWDL 1QCFA 1TCEA 4JGHA 2AUGA 3PJPA 1NZLA 1AYCA 3VS5A 3OV1A 1BM2A 2SRCA 4GL9E 4NWGA 1O43A 2MQIA 2DX0A 1BF5A 3M7FA 4K2RA 2L6KA 4OHIA 3PLFB 1BHHA 3MAZA 1D4TA 2EO3A 3TL0A 3VRZA 3N7YA 5EHPA 1O4LA 3KFJA 1IJRA 3VRQA 1QADA
chains in the Genus database with same CATH superfamily
2PLEA 2IUHA 3S8NA 1SHBA 1CJ1A 2EOBA 1SPRA 2ETZA 3CXLA 2EKXA 4OHHA 2VIFA 2ECDA 1A1AA 1LUIA 3K2TA 1JWOA 3PS5A 1IS0A 2PNBA 5IBMA 3VS7A 2EYVA 4LUEA 3IN8A 5AXIA 2OQ1A 1O4NA 2RORA 1O4QA 3S9KA 4ROJA 2Y3AB 2OZOA 4P9ZA 4FL2A 1D4WA 2PNAA 3CWGA 2BBUA 2LNXA 2LNWA 1RQQC 2RMXA 3VS1A 2RSYA 2LQWA 1AYDA 3GXWA 1AB2A 1O4PA 1O4KA 2MC1A 5I6VA 1BG1A 3VS3A 1FU5A 1O4IA 2SHPA 2KK6A 2H46E 1LKKA 4XZ0A 2CR4A 4F5BA 1BFJA 2DVJA 3VS6A 3T04A 4DGPA 3PFVA 2YSXA 4D8KA 2C0OA 4OHLA 2HDVA 4M4ZA 2LCTA 2GE9A 3VRYA 2CS0A 3NHNA 1CSZA 3MXYA 5DC0B 2EYYA 3OP0A 3IMDA 5DF6A 1O4OA 1FBZA 1Z3KA 2EU0A 5DC9A 2HCKA 3EAZA 2LQNA 2DLZA 3BUNB 4K44A 3S8LA 2XP1A 1F2FA 2DM0A 3VS2A 1GRIA 4JE4A 1JU5A 1M61A 1O4GA 2C0TA 3VROA 3IN7A 5EG3B 3WA4A 2EL8A 1O4CA 3ZNIA 1OPKA 3PSJA 3TKZA 2ABLA 1O45A 1M27A 4K45A 4F5AA 1SHDA 3VS4A 2PTKA 4GWFA 4WWQA 2L4KA 1FBVA 4LUDA 5HKWA 2H5KA 3BKBA 3LYVA 1CWEA 1O46A 1UURA 3VS0A 2PLDA 5EELA 1A1CA 1AYAA 1JYRA 3BUMB 1KSWA 4GPLB 4K11A 1X0NA 2CRHA 1RJAA 4OHEA 2AOAA 2RVFA 5KAZA 1SKJA 3BUWB 1SPSA 4H34A 3CBLA 1A1EA 1YVLA 3BUXB 1BLJA 1WQUA 2Y1NA 1GHUA 1SHAA 1O4EA 3S8OA 1YVHA 3IMJA 3VRRA 2DLYA 1K9AA 1O4AA 2IZVA 1RPYA 1G83A 2B3OA 2HUWA 1X6CA 5GJIA 5EEQA 3PQZA 3PSKA 3EACA 2HMHA 3HIZB 4TZIA 4L1BB 2K7AB 1TZEE 1O4HA 1BLKA 3HHMB 1JYUA 3BUOB 5DC4A 2YU7A 4EIHA 1FHSA 1O4RA 4P9VA 1QG1E 2MK2A 5AULA 1BHFA 1A1BA 1P13A 5HKZA 1AOUF 2IUGA 3N8MA 1Y1UA 1LCJA 2K79B 1O4BA 1A09A 3GXXA 1AYBA 3UF4A 2EYZA 1O44A 2KNOA 1BMBA 1O41A 5HKYA 1HCTB 2L3TA 2GSBA 1I3ZA 1BFIA 1R1PA 5EHRA 5J3XA 1FYRA 1MW4A 2QMSA 1LUKA 1KA7A 1F1WA 2FCIA 1AOTF 5GJHA 1XA6A 4EY0A 1R1SA 3QWYA 1OO3A 2IUIA 1O4MA 1R1QA 2EO6A 1NRVA 2H8HA 3GQIB 1O4FA 2Y1MA 1A08A 4JEGA 4A4CA 3OB2B 5CDWA 2JYQA 1OO4A 4A4BA 4QSYA 3CD3A 4DGXA 3QWXX 2HDXA 3K2MA 3VGOA 2FO0A 3VRNA 1LKLA 1KA6A 4E93A 3OB1B 3C7IA 1FU6A 1O4JA 3MXCA 2MRKA 1O4DA 4U17A 1FMKA 1LCKA 1LUMA 1O42A 5IBSA 1JYQA 1BHHB 1UUSA 1PICA 4FL3A 1O49A 2C9WA 4E68A 5BO4A 2CI9A 3HCKA 1HCSB 1A81A 4X6SA 1CSYA 1H9OA 1X27A 2CIAA 3US4A 4F59A 2KGYA 1BKMA 2MRJA 1B47A 1LUNA 2CBLA 1Y57A 1O48A 2AOBA 1MILA 4XZ1A 4FBNA 1AD5A 2DCRA 2C0IA 1OPLA 5D0JA 1NZVA 3UYOA 1ZFPE 4H1OA 4NWFA 1BKLA 1D1ZA 3VRPA 1A07A 3N84A 4U1PA 1KC2A 3OVEA 1O47A 2CI8A 4OHDA 1CWDL 1QCFA 1TCEA 4JGHA 2AUGA 3PJPA 1NZLA 1AYCA 3VS5A 3OV1A 1BM2A 2SRCA 4GL9E 4NWGA 1O43A 2MQIA 2DX0A 1BF5A 3M7FA 4K2RA 2L6KA 4OHIA 2LRAA 3PLFB 1BHHA 3MAZA 1D4TA 2EO3A 3TL0A 3VRZA 3N7YA 5EHPA 1O4LA 3KFJA 1IJRA 3VRQA 1QADA
chains in the Genus database with same CATH topology
2PLEA 2IUHA 3S8NA 1SHBA 1CJ1A 2EOBA 1SPRA 2ETZA 3CXLA 2EKXA 4OHHA 2VIFA 2ECDA 1A1AA 1LUIA 1JWOA 3PS5A 1IS0A 2PNBA 5IBMA 3VS7A 2EYVA 4LUEA 3IN8A 5AXIA 2OQ1A 1O4NA 2RORA 1O4QA 3S9KA 4ROJA 2Y3AB 2OZOA 4P9ZA 4FL2A 1D4WA 2PNAA 3CWGA 2BBUA 2LNXA 2LNWA 1RQQC 2RMXA 3VS1A 2RSYA 2LQWA 1AYDA 3GXWA 1AB2A 1O4PA 1O4KA 2MC1A 5I6VA 1BG1A 3VS3A 1FU5A 1O4IA 2SHPA 2KK6A 2H46E 1LKKA 4XZ0A 2CR4A 4F5BA 1BFJA 2DVJA 3VS6A 3T04A 4DGPA 3PFVA 2YSXA 4D8KA 2C0OA 4OHLA 2HDVA 4M4ZA 2LCTA 2GE9A 3VRYA 2CS0A 3NHNA 1CSZA 3MXYA 5DC0B 2EYYA 3OP0A 3IMDA 5DF6A 1O4OA 1FBZA 1Z3KA 2EU0A 5DC9A 2HCKA 3EAZA 2LQNA 2DLZA 3BUNB 4K44A 3S8LA 2XP1A 1F2FA 2DM0A 3VS2A 1GRIA 4JE4A 1JU5A 1M61A 1O4GA 2C0TA 3VROA 3IN7A 5EG3B 3WA4A 2EL8A 1O4CA 3ZNIA 1OPKA 3PSJA 3TKZA 2ABLA 1O45A 1M27A 4K45A 4F5AA 1SHDA 3VS4A 2PTKA 4GWFA 4WWQA 2L4KA 1FBVA 4LUDA 5HKWA 2H5KA 3BKBA 1CWEA 1O46A 1UURA 3VS0A 2PLDA 5EELA 1A1CA 1AYAA 1JYRA 3BUMB 1KSWA 4GPLB 4K11A 1X0NA 2CRHA 1RJAA 4OHEA 2AOAA 2RVFA 5KAZA 1SKJA 3BUWB 1SPSA 4H34A 3CBLA 1A1EA 1YVLA 3BUXB 1BLJA 1WQUA 2Y1NA 1GHUA 1SHAA 1O4EA 3S8OA 1YVHA 3IMJA 3VRRA 2DLYA 1K9AA 1O4AA 2IZVA 1RPYA 1G83A 2B3OA 2HUWA 1X6CA 5GJIA 5EEQA 3PQZA 3PSKA 3EACA 2HMHA 3HIZB 4TZIA 4L1BB 2K7AB 1TZEE 1O4HA 1BLKA 3HHMB 1JYUA 3BUOB 5DC4A 2YU7A 4EIHA 1FHSA 1O4RA 4P9VA 1QG1E 2MK2A 5AULA 1BHFA 1A1BA 1P13A 5HKZA 1AOUF 2IUGA 3N8MA 1Y1UA 1LCJA 2K79B 1O4BA 1A09A 3GXXA 1AYBA 3UF4A 2EYZA 1O44A 2KNOA 1BMBA 1O41A 5HKYA 1HCTB 2L3TA 2GSBA 1I3ZA 1BFIA 1R1PA 5EHRA 5J3XA 1FYRA 1MW4A 2QMSA 1LUKA 1KA7A 1F1WA 2FCIA 1AOTF 5GJHA 1XA6A 4EY0A 1R1SA 3QWYA 1OO3A 2IUIA 1O4MA 1R1QA 2EO6A 1NRVA 2H8HA 3GQIB 1O4FA 2Y1MA 1A08A 4JEGA 4A4CA 3OB2B 5CDWA 2JYQA 1OO4A 4A4BA 4QSYA 3CD3A 4DGXA 3QWXX 2HDXA 3K2MA 3VGOA 2FO0A 3VRNA 1LKLA 1KA6A 4E93A 3OB1B 3C7IA 1FU6A 1O4JA 3MXCA 2MRKA 1O4DA 4U17A 1FMKA 1LCKA 1LUMA 1O42A 5IBSA 1JYQA 1BHHB 1UUSA 1PICA 4FL3A 1O49A 2C9WA 4E68A 5BO4A 2CI9A 3HCKA 1HCSB 1A81A 4X6SA 1CSYA 1H9OA 1X27A 2CIAA 3US4A 4F59A 1BKMA 2MRJA 1B47A 1LUNA 2CBLA 1Y57A 1O48A 2AOBA 1MILA 4XZ1A 4FBNA 1AD5A 2DCRA 2C0IA 1OPLA 5D0JA 1NZVA 3UYOA 1ZFPE 4H1OA 4NWFA 1BKLA 1D1ZA 3VRPA 1A07A 3N84A 4U1PA 1KC2A 3OVEA 1O47A 2CI8A 4OHDA 1CWDL 1QCFA 1TCEA 4JGHA 2AUGA 3PJPA 1NZLA 1AYCA 3VS5A 3OV1A 1BM2A 2SRCA 4GL9E 4NWGA 1O43A 2MQIA 2DX0A 1BF5A 3M7FA 4K2RA 2L6KA 4OHIA 3PLFB 1BHHA 3MAZA 1D4TA 2EO3A 3TL0A 3VRZA 3N7YA 5EHPA 1O4LA 3KFJA 1IJRA 3VRQA 1QADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PLE A;  2IUH A;  3S8N A;  1SHB A;  1CJ1 A;  2EOB A;  1SPR A;  2ETZ A;  3CXL A;  2EKX A;  4OHH A;  2VIF A;  2ECD A;  1A1A A;  1LUI A;  1JWO A;  3PS5 A;  1IS0 A;  2PNB A;  5IBM A;  3VS7 A;  2EYV A;  4LUE A;  3IN8 A;  5AXI A;  2OQ1 A;  1O4N A;  2ROR A;  1O4Q A;  3S9K A;  4ROJ A;  2Y3A B;  2OZO A;  4P9Z A;  4FL2 A;  1D4W A;  2PNA A;  3CWG A;  2BBU A;  2LNX A;  2LNW A;  1RQQ C;  2RMX A;  3VS1 A;  2RSY A;  2LQW A;  1AYD A;  3GXW A;  1AB2 A;  1O4P A;  1O4K A;  2MC1 A;  5I6V A;  1BG1 A;  3VS3 A;  1FU5 A;  1O4I A;  2SHP A;  2KK6 A;  2H46 E;  1LKK A;  4XZ0 A;  2CR4 A;  4F5B A;  1BFJ A;  2DVJ A;  3VS6 A;  3T04 A;  4DGP A;  3PFV A;  2YSX A;  4D8K A;  2C0O A;  4OHL A;  2HDV A;  4M4Z A;  2LCT A;  2GE9 A;  3VRY A;  2CS0 A;  3NHN A;  1CSZ A;  3MXY A;  5DC0 B;  2EYY A;  3OP0 A;  3IMD A;  5DF6 A;  1O4O A;  1FBZ A;  1Z3K A;  2EU0 A;  5DC9 A;  2HCK A;  3EAZ A;  2LQN A;  2DLZ A;  3BUN B;  4K44 A;  3S8L A;  2XP1 A;  1F2F A;  2DM0 A;  3VS2 A;  1GRI A;  4JE4 A;  1JU5 A;  1M61 A;  1O4G A;  2C0T A;  3VRO A;  3IN7 A;  5EG3 B;  3WA4 A;  2EL8 A;  1O4C A;  3ZNI A;  1OPK A;  3PSJ A;  3TKZ A;  2ABL A;  1O45 A;  1M27 A;  4K45 A;  4F5A A;  1SHD A;  3VS4 A;  2PTK A;  4GWF A;  4WWQ A;  2L4K A;  1FBV A;  4LUD A;  5HKW A;  2H5K A;  3BKB A;  1CWE A;  1O46 A;  1UUR A;  3VS0 A;  2PLD A;  5EEL A;  1A1C A;  1AYA A;  1JYR A;  3BUM B;  1KSW A;  4GPL B;  4K11 A;  1X0N A;  2CRH A;  1RJA A;  4OHE A;  2AOA A;  2RVF A;  5KAZ A;  1SKJ A;  3BUW B;  1SPS A;  4H34 A;  3CBL A;  1A1E A;  1YVL A;  3BUX B;  1BLJ A;  1WQU A;  2Y1N A;  1GHU A;  1SHA A;  1O4E A;  3S8O A;  1YVH A;  3IMJ A;  3VRR A;  2DLY A;  1K9A A;  1O4A A;  2IZV A;  1RPY A;  1G83 A;  2B3O A;  2HUW A;  1X6C A;  5GJI A;  5EEQ A;  3PQZ A;  3PSK A;  3EAC A;  2HMH A;  3HIZ B;  4TZI A;  4L1B B;  2K7A B;  1TZE E;  1O4H A;  1BLK A;  3HHM B;  1JYU A;  3BUO B;  5DC4 A;  2YU7 A;  4EIH A;  1FHS A;  1O4R A;  4P9V A;  1QG1 E;  2MK2 A;  5AUL A;  1BHF A;  1A1B A;  1P13 A;  5HKZ A;  1AOU F;  2IUG A;  3N8M A;  1Y1U A;  1LCJ A;  2K79 B;  1O4B A;  1A09 A;  3GXX A;  1AYB A;  3UF4 A;  2EYZ A;  1O44 A;  2KNO A;  1BMB A;  1O41 A;  5HKY A;  1HCT B;  2L3T A;  2GSB A;  1I3Z A;  1BFI A;  1R1P A;  5EHR A;  5J3X A;  1FYR A;  1MW4 A;  2QMS A;  1LUK A;  1KA7 A;  1F1W A;  2FCI A;  1AOT F;  5GJH A;  1XA6 A;  4EY0 A;  1R1S A;  3QWY A;  1OO3 A;  2IUI A;  1O4M A;  1R1Q A;  2EO6 A;  1NRV A;  2H8H A;  3GQI B;  1O4F A;  2Y1M A;  1A08 A;  4JEG A;  4A4C A;  3OB2 B;  5CDW A;  2JYQ A;  1OO4 A;  4A4B A;  4QSY A;  3CD3 A;  4DGX A;  3QWX X;  2HDX A;  3K2M A;  3VGO A;  2FO0 A;  3VRN A;  1LKL A;  1KA6 A;  4E93 A;  3OB1 B;  3C7I A;  1FU6 A;  1O4J A;  3MXC A;  2MRK A;  1O4D A;  4U17 A;  1FMK A;  1LCK A;  1LUM A;  1O42 A;  5IBS A;  1JYQ A;  1BHH B;  1UUS A;  1PIC A;  4FL3 A;  1O49 A;  2C9W A;  4E68 A;  5BO4 A;  2CI9 A;  3HCK A;  1HCS B;  1A81 A;  4X6S A;  1CSY A;  1H9O A;  1X27 A;  2CIA A;  3US4 A;  4F59 A;  1BKM A;  2MRJ A;  1B47 A;  1LUN A;  2CBL A;  1Y57 A;  1O48 A;  2AOB A;  1MIL A;  4XZ1 A;  4FBN A;  1AD5 A;  2DCR A;  2C0I A;  1OPL A;  5D0J A;  1NZV A;  3UYO A;  1ZFP E;  4H1O A;  4NWF A;  1BKL A;  1D1Z A;  3VRP A;  1A07 A;  3N84 A;  4U1P A;  1KC2 A;  3OVE A;  1O47 A;  2CI8 A;  4OHD A;  1CWD L;  1QCF A;  1TCE A;  4JGH A;  2AUG A;  3PJP A;  1NZL A;  1AYC A;  3VS5 A;  3OV1 A;  1BM2 A;  2SRC A;  4GL9 E;  4NWG A;  1O43 A;  2MQI A;  2DX0 A;  1BF5 A;  3M7F A;  4K2R A;  2L6K A;  4OHI A;  3PLF B;  1BHH A;  3MAZ A;  1D4T A;  2EO3 A;  3TL0 A;  3VRZ A;  3N7Y A;  5EHP A;  1O4L A;  3KFJ A;  1IJR A;  3VRQ A;  1QAD A; 
#chains in the Genus database with same CATH topology
 2PLE A;  2IUH A;  3S8N A;  1SHB A;  1CJ1 A;  2EOB A;  1SPR A;  2ETZ A;  3CXL A;  2EKX A;  4OHH A;  2VIF A;  2ECD A;  1A1A A;  1LUI A;  3K2T A;  1JWO A;  3PS5 A;  1IS0 A;  2PNB A;  5IBM A;  3VS7 A;  2EYV A;  4LUE A;  3IN8 A;  5AXI A;  2OQ1 A;  1O4N A;  2ROR A;  1O4Q A;  3S9K A;  4ROJ A;  2Y3A B;  2OZO A;  4P9Z A;  4FL2 A;  1D4W A;  2PNA A;  3CWG A;  2BBU A;  2LNX A;  2LNW A;  1RQQ C;  2RMX A;  3VS1 A;  2RSY A;  2LQW A;  1AYD A;  3GXW A;  1AB2 A;  1O4P A;  1O4K A;  2MC1 A;  5I6V A;  1BG1 A;  3VS3 A;  1FU5 A;  1O4I A;  2SHP A;  2KK6 A;  2H46 E;  1LKK A;  4XZ0 A;  2CR4 A;  4F5B A;  1BFJ A;  2DVJ A;  3VS6 A;  3T04 A;  4DGP A;  3PFV A;  2YSX A;  4D8K A;  2C0O A;  4OHL A;  2HDV A;  4M4Z A;  2LCT A;  2GE9 A;  3VRY A;  2CS0 A;  3NHN A;  1CSZ A;  3MXY A;  5DC0 B;  2EYY A;  3OP0 A;  3IMD A;  5DF6 A;  1O4O A;  1FBZ A;  1Z3K A;  2EU0 A;  5DC9 A;  2HCK A;  3EAZ A;  2LQN A;  2DLZ A;  3BUN B;  4K44 A;  3S8L A;  2XP1 A;  1F2F A;  2DM0 A;  3VS2 A;  1GRI A;  4JE4 A;  1JU5 A;  1M61 A;  1O4G A;  2C0T A;  3VRO A;  3IN7 A;  5EG3 B;  3WA4 A;  2EL8 A;  1O4C A;  3ZNI A;  1OPK A;  3PSJ A;  3TKZ A;  2ABL A;  1O45 A;  1M27 A;  4K45 A;  4F5A A;  1SHD A;  3VS4 A;  2PTK A;  4GWF A;  4WWQ A;  2L4K A;  1FBV A;  4LUD A;  5HKW A;  2H5K A;  3BKB A;  3LYV A;  1CWE A;  1O46 A;  1UUR A;  3VS0 A;  2PLD A;  5EEL A;  1A1C A;  1AYA A;  1JYR A;  3BUM B;  1KSW A;  4GPL B;  4K11 A;  1X0N A;  2CRH A;  1RJA A;  4OHE A;  2AOA A;  2RVF A;  5KAZ A;  1SKJ A;  3BUW B;  1SPS A;  4H34 A;  3CBL A;  1A1E A;  1YVL A;  3BUX B;  1BLJ A;  1WQU A;  2Y1N A;  1GHU A;  1SHA A;  1O4E A;  3S8O A;  1YVH A;  3IMJ A;  3VRR A;  2DLY A;  1K9A A;  1O4A A;  2IZV A;  1RPY A;  1G83 A;  2B3O A;  2HUW A;  1X6C A;  5GJI A;  5EEQ A;  3PQZ A;  3PSK A;  3EAC A;  2HMH A;  3HIZ B;  4TZI A;  4L1B B;  2K7A B;  1TZE E;  1O4H A;  1BLK A;  3HHM B;  1JYU A;  3BUO B;  5DC4 A;  2YU7 A;  4EIH A;  1FHS A;  1O4R A;  4P9V A;  1QG1 E;  2MK2 A;  5AUL A;  1BHF A;  1A1B A;  1P13 A;  5HKZ A;  1AOU F;  2IUG A;  3N8M A;  1Y1U A;  1LCJ A;  2K79 B;  1O4B A;  1A09 A;  3GXX A;  1AYB A;  3UF4 A;  2EYZ A;  1O44 A;  2KNO A;  1BMB A;  1O41 A;  5HKY A;  1HCT B;  2L3T A;  2GSB A;  1I3Z A;  1BFI A;  1R1P A;  5EHR A;  5J3X A;  1FYR A;  1MW4 A;  2QMS A;  1LUK A;  1KA7 A;  1F1W A;  2FCI A;  1AOT F;  5GJH A;  1XA6 A;  4EY0 A;  1R1S A;  3QWY A;  1OO3 A;  2IUI A;  1O4M A;  1R1Q A;  2EO6 A;  1NRV A;  2H8H A;  3GQI B;  1O4F A;  2Y1M A;  1A08 A;  4JEG A;  4A4C A;  3OB2 B;  5CDW A;  2JYQ A;  1OO4 A;  4A4B A;  4QSY A;  3CD3 A;  4DGX A;  3QWX X;  2HDX A;  3K2M A;  3VGO A;  2FO0 A;  3VRN A;  1LKL A;  1KA6 A;  4E93 A;  3OB1 B;  3C7I A;  1FU6 A;  1O4J A;  3MXC A;  2MRK A;  1O4D A;  4U17 A;  1FMK A;  1LCK A;  1LUM A;  1O42 A;  5IBS A;  1JYQ A;  1BHH B;  1UUS A;  1PIC A;  4FL3 A;  1O49 A;  2C9W A;  4E68 A;  5BO4 A;  2CI9 A;  3HCK A;  1HCS B;  1A81 A;  4X6S A;  1CSY A;  1H9O A;  1X27 A;  2CIA A;  3US4 A;  4F59 A;  2KGY A;  1BKM A;  2MRJ A;  1B47 A;  1LUN A;  2CBL A;  1Y57 A;  1O48 A;  2AOB A;  1MIL A;  4XZ1 A;  4FBN A;  1AD5 A;  2DCR A;  2C0I A;  1OPL A;  5D0J A;  1NZV A;  3UYO A;  1ZFP E;  4H1O A;  4NWF A;  1BKL A;  1D1Z A;  3VRP A;  1A07 A;  3N84 A;  4U1P A;  1KC2 A;  3OVE A;  1O47 A;  2CI8 A;  4OHD A;  1CWD L;  1QCF A;  1TCE A;  4JGH A;  2AUG A;  3PJP A;  1NZL A;  1AYC A;  3VS5 A;  3OV1 A;  1BM2 A;  2SRC A;  4GL9 E;  4NWG A;  1O43 A;  2MQI A;  2DX0 A;  1BF5 A;  3M7F A;  4K2R A;  2L6K A;  4OHI A;  2LRA A;  3PLF B;  1BHH A;  3MAZ A;  1D4T A;  2EO3 A;  3TL0 A;  3VRZ A;  3N7Y A;  5EHP A;  1O4L A;  3KFJ A;  1IJR A;  3VRQ A;  1QAD A; 
#chains in the Genus database with same CATH homology
 2PLE A;  2IUH A;  3S8N A;  1SHB A;  1CJ1 A;  2EOB A;  1SPR A;  2ETZ A;  3CXL A;  2EKX A;  4OHH A;  2VIF A;  2ECD A;  1A1A A;  1LUI A;  1JWO A;  3PS5 A;  1IS0 A;  2PNB A;  5IBM A;  3VS7 A;  2EYV A;  4LUE A;  3IN8 A;  5AXI A;  2OQ1 A;  1O4N A;  2ROR A;  1O4Q A;  3S9K A;  4ROJ A;  2Y3A B;  2OZO A;  4P9Z A;  4FL2 A;  1D4W A;  2PNA A;  3CWG A;  2BBU A;  2LNX A;  2LNW A;  1RQQ C;  2RMX A;  3VS1 A;  2RSY A;  2LQW A;  1AYD A;  3GXW A;  1AB2 A;  1O4P A;  1O4K A;  2MC1 A;  5I6V A;  1BG1 A;  3VS3 A;  1FU5 A;  1O4I A;  2SHP A;  2KK6 A;  2H46 E;  1LKK A;  4XZ0 A;  2CR4 A;  4F5B A;  1BFJ A;  2DVJ A;  3VS6 A;  3T04 A;  4DGP A;  3PFV A;  2YSX A;  4D8K A;  2C0O A;  4OHL A;  2HDV A;  4M4Z A;  2LCT A;  2GE9 A;  3VRY A;  2CS0 A;  3NHN A;  1CSZ A;  3MXY A;  5DC0 B;  2EYY A;  3OP0 A;  3IMD A;  5DF6 A;  1O4O A;  1FBZ A;  1Z3K A;  2EU0 A;  5DC9 A;  2HCK A;  3EAZ A;  2LQN A;  2DLZ A;  3BUN B;  4K44 A;  3S8L A;  2XP1 A;  1F2F A;  2DM0 A;  3VS2 A;  1GRI A;  4JE4 A;  1JU5 A;  1M61 A;  1O4G A;  2C0T A;  3VRO A;  3IN7 A;  5EG3 B;  3WA4 A;  2EL8 A;  1O4C A;  3ZNI A;  1OPK A;  3PSJ A;  3TKZ A;  2ABL A;  1O45 A;  1M27 A;  4K45 A;  4F5A A;  1SHD A;  3VS4 A;  2PTK A;  4GWF A;  4WWQ A;  2L4K A;  1FBV A;  4LUD A;  5HKW A;  2H5K A;  3BKB A;  1CWE A;  1O46 A;  1UUR A;  3VS0 A;  2PLD A;  5EEL A;  1A1C A;  1AYA A;  1JYR A;  3BUM B;  1KSW A;  4GPL B;  4K11 A;  1X0N A;  2CRH A;  1RJA A;  4OHE A;  2AOA A;  2RVF A;  5KAZ A;  1SKJ A;  3BUW B;  1SPS A;  4H34 A;  3CBL A;  1A1E A;  1YVL A;  3BUX B;  1BLJ A;  1WQU A;  2Y1N A;  1GHU A;  1SHA A;  1O4E A;  3S8O A;  1YVH A;  3IMJ A;  3VRR A;  2DLY A;  1K9A A;  1O4A A;  2IZV A;  1RPY A;  1G83 A;  2B3O A;  2HUW A;  1X6C A;  5GJI A;  5EEQ A;  3PQZ A;  3PSK A;  3EAC A;  2HMH A;  3HIZ B;  4TZI A;  4L1B B;  2K7A B;  1TZE E;  1O4H A;  1BLK A;  3HHM B;  1JYU A;  3BUO B;  5DC4 A;  2YU7 A;  4EIH A;  1FHS A;  1O4R A;  4P9V A;  1QG1 E;  2MK2 A;  5AUL A;  1BHF A;  1A1B A;  1P13 A;  5HKZ A;  1AOU F;  2IUG A;  3N8M A;  1Y1U A;  1LCJ A;  2K79 B;  1O4B A;  1A09 A;  3GXX A;  1AYB A;  3UF4 A;  2EYZ A;  1O44 A;  2KNO A;  1BMB A;  1O41 A;  5HKY A;  1HCT B;  2L3T A;  2GSB A;  1I3Z A;  1BFI A;  1R1P A;  5EHR A;  5J3X A;  1FYR A;  1MW4 A;  2QMS A;  1LUK A;  1KA7 A;  1F1W A;  2FCI A;  1AOT F;  5GJH A;  1XA6 A;  4EY0 A;  1R1S A;  3QWY A;  1OO3 A;  2IUI A;  1O4M A;  1R1Q A;  2EO6 A;  1NRV A;  2H8H A;  3GQI B;  1O4F A;  2Y1M A;  1A08 A;  4JEG A;  4A4C A;  3OB2 B;  5CDW A;  2JYQ A;  1OO4 A;  4A4B A;  4QSY A;  3CD3 A;  4DGX A;  3QWX X;  2HDX A;  3K2M A;  3VGO A;  2FO0 A;  3VRN A;  1LKL A;  1KA6 A;  4E93 A;  3OB1 B;  3C7I A;  1FU6 A;  1O4J A;  3MXC A;  2MRK A;  1O4D A;  4U17 A;  1FMK A;  1LCK A;  1LUM A;  1O42 A;  5IBS A;  1JYQ A;  1BHH B;  1UUS A;  1PIC A;  4FL3 A;  1O49 A;  2C9W A;  4E68 A;  5BO4 A;  2CI9 A;  3HCK A;  1HCS B;  1A81 A;  4X6S A;  1CSY A;  1H9O A;  1X27 A;  2CIA A;  3US4 A;  4F59 A;  1BKM A;  2MRJ A;  1B47 A;  1LUN A;  2CBL A;  1Y57 A;  1O48 A;  2AOB A;  1MIL A;  4XZ1 A;  4FBN A;  1AD5 A;  2DCR A;  2C0I A;  1OPL A;  5D0J A;  1NZV A;  3UYO A;  1ZFP E;  4H1O A;  4NWF A;  1BKL A;  1D1Z A;  3VRP A;  1A07 A;  3N84 A;  4U1P A;  1KC2 A;  3OVE A;  1O47 A;  2CI8 A;  4OHD A;  1CWD L;  1QCF A;  1TCE A;  4JGH A;  2AUG A;  3PJP A;  1NZL A;  1AYC A;  3VS5 A;  3OV1 A;  1BM2 A;  2SRC A;  4GL9 E;  4NWG A;  1O43 A;  2MQI A;  2DX0 A;  1BF5 A;  3M7F A;  4K2R A;  2L6K A;  4OHI A;  3PLF B;  1BHH A;  3MAZ A;  1D4T A;  2EO3 A;  3TL0 A;  3VRZ A;  3N7Y A;  5EHP A;  1O4L A;  3KFJ A;  1IJR A;  3VRQ A;  1QAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...