1SHDA

Peptide inhibitors of src sh3-sh2-phosphoprotein interactions
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
101
Chain Sequence
b'SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESEAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-SRC TYROSINE KINASE SH2 DOMAIN
publication title Peptide inhibitors of src SH3-SH2-phosphoprotein interactions.
pubmed rcsb
source organism Homo sapiens
molecule tags Complex(transferase/peptide)
total genus 25
structure length 101
sequence length 105
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1shdA00
2CR4A 1F1WA 2RVFA 1O4IA 2EYZA 1JYQA 2L6KA 1GHUA 3PJPA 5EHPA 3CD3A 5BO4A 1O4LA 2EL8A 2EO3A 4DGPA 3VROA 3BUMB 2K7AB 1QCFA 2CI8A 2HCKA 4OHIA 2RMXA 1SPSA 4FL3A 2OQ1A 2HDVA 3VS4A 1R1QA 1P13A 1H9OA 2VIFA 3PSJA 5HKWA 3VS7A 1KA7A 1GRIA 2CRHA 1RQQC 1A1AA 2GE9A 3PLFB 1SHDA 2OZOA 1KA6A 5EHRA 1OPLA 1O4CA 1UURA 1O4OA 3PSKA 2AOBA 2QMSA 4EIHA 3S9KA 1BKMA 3PS5A 2C0TA 3VGOA 4H1OA 1O4NA 1BF5A 2KK6A 2CS0A 1A08A 3IN7A 2PNAA 1CWDL 4X6SA 2HMHA 3BUNB 2H8HA 1SHAA 2C9WA 3MXCA 4K45A 4JGHA 1TZEE 1FBVA 1LUKA 5CDWA 3QWXX 4A4CA 4GPLB 5DC4A 2MRJA 5D0JA 4DGXA 4GWFA 2ABLA 1RJAA 5HKZA 1LCKA 3VRQA 1O4KA 1A1BA 3TL0A 4U1PA 1BHFA 3S8LA 1BMBA 4LUEA 1MW4A 1OO4A 3HHMB 1O4EA 1AYBA 1X0NA 3OP0A 1XA6A 5AXIA 3CWGA 4K2RA 2LQNA 1ZFPE 4QSYA 3GQIB 2PNBA 4F5AA 3QWYA 3T04A 1BLJA 1TCEA 3US4A 2HDXA 1HCTB 1HCSB 3BKBA 1YVHA 2MQIA 3KFJA 1O48A 5DC0B 1O42A 3N8MA 3IMJA 2K79B 5IBSA 2H46E 1JYUA 3PQZA 3NHNA 1AOUF 1BFJA 2BBUA 1Y57A 2EYVA 2Y1NA 2C0OA 4E68A 1K9AA 5DF6A 3UF4A 2SRCA 1FYRA 1LKKA 1UUSA 4P9ZA 2DVJA 5HKYA 1M27A 3VRYA 2Y3AB 4E93A 1RPYA 2IZVA 4LUDA 1AYDA 2HUWA 4U17A 3GXWA 2IUGA 3VS5A 2CI9A 2H5KA 1KSWA 1A81A 3ZNIA 1O49A 3C7IA 1CWEA 4F59A 1A09A 4M4ZA 4XZ1A 3MAZA 1D1ZA 1AB2A 2YSXA 2LQWA 4GL9E 5EELA 4A4BA 3S8NA 1IS0A 4F5BA 5EG3B 1O4BA 1BHHA 1B47A 2DX0A 1Y1UA 2EKXA 2SHPA 1AD5A 1MILA 1O47A 1O4JA 1O43A 1O44A 3K2MA 3IMDA 1Z3KA 1O4HA 5J3XA 3VS3A 1A1CA 2MC1A 2PTKA 3PFVA 1O4FA 5GJIA 2ECDA 4ROJA 2LNXA 1O4AA 1O41A 2GSBA 4P9VA 3HCKA 2ETZA 1A1EA 1OPKA 1R1SA 1BM2A 2MK2A 5KAZA 1IJRA 4JEGA 1CSZA 1O4GA 2DLZA 2IUHA 2Y1MA 1JWOA 1M61A 4NWFA 1WQUA 2EYYA 2L3TA 1FBZA 2MRKA 3GXXA 1AYCA 2FO0A 2CBLA 3CBLA 2RORA 4NWGA 3BUXB 3VS0A 1CSYA 1JYRA 5DC9A 3VRPA 2FCIA 2LCTA 1YVLA 4OHEA 1NRVA 3WA4A 5I6VA 1BG1A 2L4KA 1O4QA 3UYOA 2AUGA 2B3OA 1LUIA 1O45A 5EEQA 5GJHA 1BHHB 1CJ1A 3OB1B 3N84A 1AOTF 4H34A 3MXYA 3OV1A 3VRRA 1SPRA 1QADA 1NZVA 3N7YA 2AOAA 2DM0A 3EACA 4L1BB 1R1PA 1LKLA 2IUIA 2KNOA 3VS6A 3VRZA 4FL2A 4OHLA 2CIAA 1A07A 4JE4A 1OO3A 2DLYA 2EO6A 2RSYA 2JYQA 1SKJA 1FU6A 1O4DA 4TZIA 1LUMA 1FMKA 4OHHA 1FU5A 3OVEA 1BKLA 1O4PA 3BUWB 1O46A 2PLEA 3OB2B 1LUNA 1QG1E 1D4TA 4D8KA 3VS1A 1O4RA 2YU7A 1BFIA 3CXLA 1FHSA 1BLKA 2C0IA 2LNWA 3HIZB 3EAZA 1G83A 1D4WA 3M7FA 4XZ0A 4K11A 1I3ZA 1O4MA 4WWQA 3VS2A 1JU5A 1NZLA 5IBMA 2PLDA 1F2FA 1X6CA 4OHDA 3IN8A 4FBNA 2EU0A 4EY0A 3BUOB 3VRNA 4K44A 2XP1A 3S8OA 5AULA 2EOBA 1LCJA 1SHBA 1AYAA 1KC2A 1X27A 3TKZA 2DCRA 1PICA
chains in the Genus database with same CATH superfamily
2CR4A 1F1WA 2RVFA 1O4IA 2EYZA 1JYQA 2L6KA 1GHUA 3PJPA 5EHPA 3CD3A 5BO4A 1O4LA 2EL8A 2EO3A 4DGPA 3VROA 3BUMB 2K7AB 1QCFA 2CI8A 2HCKA 4OHIA 2RMXA 1SPSA 4FL3A 2OQ1A 2HDVA 3VS4A 1R1QA 1P13A 1H9OA 2VIFA 3PSJA 5HKWA 3VS7A 1KA7A 2KGYA 1GRIA 2CRHA 1RQQC 1A1AA 2GE9A 3PLFB 1SHDA 2OZOA 1KA6A 5EHRA 1OPLA 1O4CA 1UURA 1O4OA 3PSKA 2AOBA 2QMSA 4EIHA 3S9KA 1BKMA 3PS5A 2C0TA 3VGOA 4H1OA 1O4NA 1BF5A 2KK6A 2CS0A 1A08A 3IN7A 2PNAA 1CWDL 4X6SA 2HMHA 3BUNB 2H8HA 1SHAA 2C9WA 3MXCA 4K45A 4JGHA 1TZEE 1FBVA 1LUKA 5CDWA 3QWXX 4A4CA 4GPLB 5DC4A 2MRJA 5D0JA 4DGXA 4GWFA 2ABLA 1RJAA 5HKZA 1LCKA 3VRQA 1O4KA 1A1BA 3TL0A 4U1PA 1BHFA 3S8LA 1BMBA 4LUEA 1MW4A 1OO4A 3HHMB 1O4EA 1AYBA 1X0NA 3OP0A 1XA6A 5AXIA 3CWGA 4K2RA 2LQNA 1ZFPE 4QSYA 3GQIB 2PNBA 4F5AA 3QWYA 3T04A 1BLJA 1TCEA 3US4A 2HDXA 1HCTB 1HCSB 3BKBA 1YVHA 2MQIA 3KFJA 1O48A 5DC0B 1O42A 3N8MA 3IMJA 2K79B 5IBSA 2H46E 1JYUA 3PQZA 3NHNA 1AOUF 1BFJA 2BBUA 1Y57A 2EYVA 2Y1NA 3LYVA 2C0OA 4E68A 1K9AA 5DF6A 3UF4A 2SRCA 1FYRA 1LKKA 1UUSA 4P9ZA 2DVJA 5HKYA 1M27A 3VRYA 2Y3AB 4E93A 1RPYA 2IZVA 4LUDA 1AYDA 2HUWA 4U17A 3GXWA 2IUGA 3VS5A 2CI9A 2H5KA 1KSWA 1A81A 3ZNIA 1O49A 3C7IA 1CWEA 4F59A 1A09A 4M4ZA 4XZ1A 3MAZA 1D1ZA 1AB2A 2YSXA 2LQWA 4GL9E 5EELA 4A4BA 3S8NA 1IS0A 4F5BA 5EG3B 1O4BA 1BHHA 1B47A 2DX0A 1Y1UA 2EKXA 2SHPA 1AD5A 1MILA 1O47A 1O4JA 1O43A 1O44A 3K2MA 3IMDA 1Z3KA 1O4HA 5J3XA 3VS3A 1A1CA 2MC1A 2PTKA 3K2TA 3PFVA 1O4FA 5GJIA 2ECDA 4ROJA 2LNXA 1O4AA 1O41A 2GSBA 4P9VA 3HCKA 2ETZA 1A1EA 1OPKA 1R1SA 1BM2A 2MK2A 5KAZA 1IJRA 4JEGA 1CSZA 1O4GA 2DLZA 2IUHA 2Y1MA 1JWOA 1M61A 4NWFA 1WQUA 2EYYA 2L3TA 1FBZA 2MRKA 3GXXA 1AYCA 2FO0A 2CBLA 3CBLA 2RORA 4NWGA 3BUXB 3VS0A 1CSYA 1JYRA 5DC9A 3VRPA 2FCIA 2LCTA 1YVLA 4OHEA 1NRVA 3WA4A 5I6VA 1BG1A 2L4KA 1O4QA 3UYOA 2AUGA 2B3OA 1LUIA 1O45A 5EEQA 5GJHA 1BHHB 1CJ1A 3OB1B 3N84A 1AOTF 4H34A 3MXYA 3OV1A 3VRRA 1SPRA 1QADA 1NZVA 3N7YA 2AOAA 2DM0A 3EACA 4L1BB 1R1PA 1LKLA 2IUIA 2KNOA 3VS6A 3VRZA 4FL2A 4OHLA 2CIAA 1A07A 4JE4A 1OO3A 2DLYA 2EO6A 2RSYA 2JYQA 1SKJA 1FU6A 1O4DA 4TZIA 1LUMA 1FMKA 4OHHA 1FU5A 3OVEA 1BKLA 1O4PA 3BUWB 1O46A 2PLEA 3OB2B 1LUNA 1QG1E 2LRAA 1D4TA 4D8KA 3VS1A 1O4RA 2YU7A 1BFIA 3CXLA 1FHSA 1BLKA 2C0IA 2LNWA 3HIZB 3EAZA 1G83A 1D4WA 3M7FA 4XZ0A 4K11A 1I3ZA 1O4MA 4WWQA 3VS2A 1JU5A 1NZLA 5IBMA 2PLDA 1F2FA 1X6CA 4OHDA 3IN8A 4FBNA 2EU0A 4EY0A 3BUOB 3VRNA 4K44A 2XP1A 3S8OA 5AULA 2EOBA 1LCJA 1SHBA 1AYAA 1KC2A 1X27A 3TKZA 2DCRA 1PICA
chains in the Genus database with same CATH topology
2CR4A 1F1WA 2RVFA 1O4IA 2EYZA 1JYQA 2L6KA 1GHUA 3PJPA 5EHPA 3CD3A 5BO4A 1O4LA 2EL8A 2EO3A 4DGPA 3VROA 3BUMB 2K7AB 1QCFA 2CI8A 2HCKA 4OHIA 2RMXA 1SPSA 4FL3A 2OQ1A 2HDVA 3VS4A 1R1QA 1P13A 1H9OA 2VIFA 3PSJA 5HKWA 3VS7A 1KA7A 1GRIA 2CRHA 1RQQC 1A1AA 2GE9A 3PLFB 1SHDA 2OZOA 1KA6A 5EHRA 1OPLA 1O4CA 1UURA 1O4OA 3PSKA 2AOBA 2QMSA 4EIHA 3S9KA 1BKMA 3PS5A 2C0TA 3VGOA 4H1OA 1O4NA 1BF5A 2KK6A 2CS0A 1A08A 3IN7A 2PNAA 1CWDL 4X6SA 2HMHA 3BUNB 2H8HA 1SHAA 2C9WA 3MXCA 4K45A 4JGHA 1TZEE 1FBVA 1LUKA 5CDWA 3QWXX 4A4CA 4GPLB 5DC4A 2MRJA 5D0JA 4DGXA 4GWFA 2ABLA 1RJAA 5HKZA 1LCKA 3VRQA 1O4KA 1A1BA 3TL0A 4U1PA 1BHFA 3S8LA 1BMBA 4LUEA 1MW4A 1OO4A 3HHMB 1O4EA 1AYBA 1X0NA 3OP0A 1XA6A 5AXIA 3CWGA 4K2RA 2LQNA 1ZFPE 4QSYA 3GQIB 2PNBA 4F5AA 3QWYA 3T04A 1BLJA 1TCEA 3US4A 2HDXA 1HCTB 1HCSB 3BKBA 1YVHA 2MQIA 3KFJA 1O48A 5DC0B 1O42A 3N8MA 3IMJA 2K79B 5IBSA 2H46E 1JYUA 3PQZA 3NHNA 1AOUF 1BFJA 2BBUA 1Y57A 2EYVA 2Y1NA 2C0OA 4E68A 1K9AA 5DF6A 3UF4A 2SRCA 1FYRA 1LKKA 1UUSA 4P9ZA 2DVJA 5HKYA 1M27A 3VRYA 2Y3AB 4E93A 1RPYA 2IZVA 4LUDA 1AYDA 2HUWA 4U17A 3GXWA 2IUGA 3VS5A 2CI9A 2H5KA 1KSWA 1A81A 3ZNIA 1O49A 3C7IA 1CWEA 4F59A 1A09A 4M4ZA 4XZ1A 3MAZA 1D1ZA 1AB2A 2YSXA 2LQWA 4GL9E 5EELA 4A4BA 3S8NA 1IS0A 4F5BA 5EG3B 1O4BA 1BHHA 1B47A 2DX0A 1Y1UA 2EKXA 2SHPA 1AD5A 1MILA 1O47A 1O4JA 1O43A 1O44A 3K2MA 3IMDA 1Z3KA 1O4HA 5J3XA 3VS3A 1A1CA 2MC1A 2PTKA 3PFVA 1O4FA 5GJIA 2ECDA 4ROJA 2LNXA 1O4AA 1O41A 2GSBA 4P9VA 3HCKA 2ETZA 1A1EA 1OPKA 1R1SA 1BM2A 2MK2A 5KAZA 1IJRA 4JEGA 1CSZA 1O4GA 2DLZA 2IUHA 2Y1MA 1JWOA 1M61A 4NWFA 1WQUA 2EYYA 2L3TA 1FBZA 2MRKA 3GXXA 1AYCA 2FO0A 2CBLA 3CBLA 2RORA 4NWGA 3BUXB 3VS0A 1CSYA 1JYRA 5DC9A 3VRPA 2FCIA 2LCTA 1YVLA 4OHEA 1NRVA 3WA4A 5I6VA 1BG1A 2L4KA 1O4QA 3UYOA 2AUGA 2B3OA 1LUIA 1O45A 5EEQA 5GJHA 1BHHB 1CJ1A 3OB1B 3N84A 1AOTF 4H34A 3MXYA 3OV1A 3VRRA 1SPRA 1QADA 1NZVA 3N7YA 2AOAA 2DM0A 3EACA 4L1BB 1R1PA 1LKLA 2IUIA 2KNOA 3VS6A 3VRZA 4FL2A 4OHLA 2CIAA 1A07A 4JE4A 1OO3A 2DLYA 2EO6A 2RSYA 2JYQA 1SKJA 1FU6A 1O4DA 4TZIA 1LUMA 1FMKA 4OHHA 1FU5A 3OVEA 1BKLA 1O4PA 3BUWB 1O46A 2PLEA 3OB2B 1LUNA 1QG1E 1D4TA 4D8KA 3VS1A 1O4RA 2YU7A 1BFIA 3CXLA 1FHSA 1BLKA 2C0IA 2LNWA 3HIZB 3EAZA 1G83A 1D4WA 3M7FA 4XZ0A 4K11A 1I3ZA 1O4MA 4WWQA 3VS2A 1JU5A 1NZLA 5IBMA 2PLDA 1F2FA 1X6CA 4OHDA 3IN8A 4FBNA 2EU0A 4EY0A 3BUOB 3VRNA 4K44A 2XP1A 3S8OA 5AULA 2EOBA 1LCJA 1SHBA 1AYAA 1KC2A 1X27A 3TKZA 2DCRA 1PICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CR4 A;  1F1W A;  2RVF A;  1O4I A;  2EYZ A;  1JYQ A;  2L6K A;  1GHU A;  3PJP A;  5EHP A;  3CD3 A;  5BO4 A;  1O4L A;  2EL8 A;  2EO3 A;  4DGP A;  3VRO A;  3BUM B;  2K7A B;  1QCF A;  2CI8 A;  2HCK A;  4OHI A;  2RMX A;  1SPS A;  4FL3 A;  2OQ1 A;  2HDV A;  3VS4 A;  1R1Q A;  1P13 A;  1H9O A;  2VIF A;  3PSJ A;  5HKW A;  3VS7 A;  1KA7 A;  1GRI A;  2CRH A;  1RQQ C;  1A1A A;  2GE9 A;  3PLF B;  1SHD A;  2OZO A;  1KA6 A;  5EHR A;  1OPL A;  1O4C A;  1UUR A;  1O4O A;  3PSK A;  2AOB A;  2QMS A;  4EIH A;  3S9K A;  1BKM A;  3PS5 A;  2C0T A;  3VGO A;  4H1O A;  1O4N A;  1BF5 A;  2KK6 A;  2CS0 A;  1A08 A;  3IN7 A;  2PNA A;  1CWD L;  4X6S A;  2HMH A;  3BUN B;  2H8H A;  1SHA A;  2C9W A;  3MXC A;  4K45 A;  4JGH A;  1TZE E;  1FBV A;  1LUK A;  5CDW A;  3QWX X;  4A4C A;  4GPL B;  5DC4 A;  2MRJ A;  5D0J A;  4DGX A;  4GWF A;  2ABL A;  1RJA A;  5HKZ A;  1LCK A;  3VRQ A;  1O4K A;  1A1B A;  3TL0 A;  4U1P A;  1BHF A;  3S8L A;  1BMB A;  4LUE A;  1MW4 A;  1OO4 A;  3HHM B;  1O4E A;  1AYB A;  1X0N A;  3OP0 A;  1XA6 A;  5AXI A;  3CWG A;  4K2R A;  2LQN A;  1ZFP E;  4QSY A;  3GQI B;  2PNB A;  4F5A A;  3QWY A;  3T04 A;  1BLJ A;  1TCE A;  3US4 A;  2HDX A;  1HCT B;  1HCS B;  3BKB A;  1YVH A;  2MQI A;  3KFJ A;  1O48 A;  5DC0 B;  1O42 A;  3N8M A;  3IMJ A;  2K79 B;  5IBS A;  2H46 E;  1JYU A;  3PQZ A;  3NHN A;  1AOU F;  1BFJ A;  2BBU A;  1Y57 A;  2EYV A;  2Y1N A;  2C0O A;  4E68 A;  1K9A A;  5DF6 A;  3UF4 A;  2SRC A;  1FYR A;  1LKK A;  1UUS A;  4P9Z A;  2DVJ A;  5HKY A;  1M27 A;  3VRY A;  2Y3A B;  4E93 A;  1RPY A;  2IZV A;  4LUD A;  1AYD A;  2HUW A;  4U17 A;  3GXW A;  2IUG A;  3VS5 A;  2CI9 A;  2H5K A;  1KSW A;  1A81 A;  3ZNI A;  1O49 A;  3C7I A;  1CWE A;  4F59 A;  1A09 A;  4M4Z A;  4XZ1 A;  3MAZ A;  1D1Z A;  1AB2 A;  2YSX A;  2LQW A;  4GL9 E;  5EEL A;  4A4B A;  3S8N A;  1IS0 A;  4F5B A;  5EG3 B;  1O4B A;  1BHH A;  1B47 A;  2DX0 A;  1Y1U A;  2EKX A;  2SHP A;  1AD5 A;  1MIL A;  1O47 A;  1O4J A;  1O43 A;  1O44 A;  3K2M A;  3IMD A;  1Z3K A;  1O4H A;  5J3X A;  3VS3 A;  1A1C A;  2MC1 A;  2PTK A;  3PFV A;  1O4F A;  5GJI A;  2ECD A;  4ROJ A;  2LNX A;  1O4A A;  1O41 A;  2GSB A;  4P9V A;  3HCK A;  2ETZ A;  1A1E A;  1OPK A;  1R1S A;  1BM2 A;  2MK2 A;  5KAZ A;  1IJR A;  4JEG A;  1CSZ A;  1O4G A;  2DLZ A;  2IUH A;  2Y1M A;  1JWO A;  1M61 A;  4NWF A;  1WQU A;  2EYY A;  2L3T A;  1FBZ A;  2MRK A;  3GXX A;  1AYC A;  2FO0 A;  2CBL A;  3CBL A;  2ROR A;  4NWG A;  3BUX B;  3VS0 A;  1CSY A;  1JYR A;  5DC9 A;  3VRP A;  2FCI A;  2LCT A;  1YVL A;  4OHE A;  1NRV A;  3WA4 A;  5I6V A;  1BG1 A;  2L4K A;  1O4Q A;  3UYO A;  2AUG A;  2B3O A;  1LUI A;  1O45 A;  5EEQ A;  5GJH A;  1BHH B;  1CJ1 A;  3OB1 B;  3N84 A;  1AOT F;  4H34 A;  3MXY A;  3OV1 A;  3VRR A;  1SPR A;  1QAD A;  1NZV A;  3N7Y A;  2AOA A;  2DM0 A;  3EAC A;  4L1B B;  1R1P A;  1LKL A;  2IUI A;  2KNO A;  3VS6 A;  3VRZ A;  4FL2 A;  4OHL A;  2CIA A;  1A07 A;  4JE4 A;  1OO3 A;  2DLY A;  2EO6 A;  2RSY A;  2JYQ A;  1SKJ A;  1FU6 A;  1O4D A;  4TZI A;  1LUM A;  1FMK A;  4OHH A;  1FU5 A;  3OVE A;  1BKL A;  1O4P A;  3BUW B;  1O46 A;  2PLE A;  3OB2 B;  1LUN A;  1QG1 E;  1D4T A;  4D8K A;  3VS1 A;  1O4R A;  2YU7 A;  1BFI A;  3CXL A;  1FHS A;  1BLK A;  2C0I A;  2LNW A;  3HIZ B;  3EAZ A;  1G83 A;  1D4W A;  3M7F A;  4XZ0 A;  4K11 A;  1I3Z A;  1O4M A;  4WWQ A;  3VS2 A;  1JU5 A;  1NZL A;  5IBM A;  2PLD A;  1F2F A;  1X6C A;  4OHD A;  3IN8 A;  4FBN A;  2EU0 A;  4EY0 A;  3BUO B;  3VRN A;  4K44 A;  2XP1 A;  3S8O A;  5AUL A;  2EOB A;  1LCJ A;  1SHB A;  1AYA A;  1KC2 A;  1X27 A;  3TKZ A;  2DCR A;  1PIC A; 
#chains in the Genus database with same CATH topology
 2CR4 A;  1F1W A;  2RVF A;  1O4I A;  2EYZ A;  1JYQ A;  2L6K A;  1GHU A;  3PJP A;  5EHP A;  3CD3 A;  5BO4 A;  1O4L A;  2EL8 A;  2EO3 A;  4DGP A;  3VRO A;  3BUM B;  2K7A B;  1QCF A;  2CI8 A;  2HCK A;  4OHI A;  2RMX A;  1SPS A;  4FL3 A;  2OQ1 A;  2HDV A;  3VS4 A;  1R1Q A;  1P13 A;  1H9O A;  2VIF A;  3PSJ A;  5HKW A;  3VS7 A;  1KA7 A;  2KGY A;  1GRI A;  2CRH A;  1RQQ C;  1A1A A;  2GE9 A;  3PLF B;  1SHD A;  2OZO A;  1KA6 A;  5EHR A;  1OPL A;  1O4C A;  1UUR A;  1O4O A;  3PSK A;  2AOB A;  2QMS A;  4EIH A;  3S9K A;  1BKM A;  3PS5 A;  2C0T A;  3VGO A;  4H1O A;  1O4N A;  1BF5 A;  2KK6 A;  2CS0 A;  1A08 A;  3IN7 A;  2PNA A;  1CWD L;  4X6S A;  2HMH A;  3BUN B;  2H8H A;  1SHA A;  2C9W A;  3MXC A;  4K45 A;  4JGH A;  1TZE E;  1FBV A;  1LUK A;  5CDW A;  3QWX X;  4A4C A;  4GPL B;  5DC4 A;  2MRJ A;  5D0J A;  4DGX A;  4GWF A;  2ABL A;  1RJA A;  5HKZ A;  1LCK A;  3VRQ A;  1O4K A;  1A1B A;  3TL0 A;  4U1P A;  1BHF A;  3S8L A;  1BMB A;  4LUE A;  1MW4 A;  1OO4 A;  3HHM B;  1O4E A;  1AYB A;  1X0N A;  3OP0 A;  1XA6 A;  5AXI A;  3CWG A;  4K2R A;  2LQN A;  1ZFP E;  4QSY A;  3GQI B;  2PNB A;  4F5A A;  3QWY A;  3T04 A;  1BLJ A;  1TCE A;  3US4 A;  2HDX A;  1HCT B;  1HCS B;  3BKB A;  1YVH A;  2MQI A;  3KFJ A;  1O48 A;  5DC0 B;  1O42 A;  3N8M A;  3IMJ A;  2K79 B;  5IBS A;  2H46 E;  1JYU A;  3PQZ A;  3NHN A;  1AOU F;  1BFJ A;  2BBU A;  1Y57 A;  2EYV A;  2Y1N A;  3LYV A;  2C0O A;  4E68 A;  1K9A A;  5DF6 A;  3UF4 A;  2SRC A;  1FYR A;  1LKK A;  1UUS A;  4P9Z A;  2DVJ A;  5HKY A;  1M27 A;  3VRY A;  2Y3A B;  4E93 A;  1RPY A;  2IZV A;  4LUD A;  1AYD A;  2HUW A;  4U17 A;  3GXW A;  2IUG A;  3VS5 A;  2CI9 A;  2H5K A;  1KSW A;  1A81 A;  3ZNI A;  1O49 A;  3C7I A;  1CWE A;  4F59 A;  1A09 A;  4M4Z A;  4XZ1 A;  3MAZ A;  1D1Z A;  1AB2 A;  2YSX A;  2LQW A;  4GL9 E;  5EEL A;  4A4B A;  3S8N A;  1IS0 A;  4F5B A;  5EG3 B;  1O4B A;  1BHH A;  1B47 A;  2DX0 A;  1Y1U A;  2EKX A;  2SHP A;  1AD5 A;  1MIL A;  1O47 A;  1O4J A;  1O43 A;  1O44 A;  3K2M A;  3IMD A;  1Z3K A;  1O4H A;  5J3X A;  3VS3 A;  1A1C A;  2MC1 A;  2PTK A;  3K2T A;  3PFV A;  1O4F A;  5GJI A;  2ECD A;  4ROJ A;  2LNX A;  1O4A A;  1O41 A;  2GSB A;  4P9V A;  3HCK A;  2ETZ A;  1A1E A;  1OPK A;  1R1S A;  1BM2 A;  2MK2 A;  5KAZ A;  1IJR A;  4JEG A;  1CSZ A;  1O4G A;  2DLZ A;  2IUH A;  2Y1M A;  1JWO A;  1M61 A;  4NWF A;  1WQU A;  2EYY A;  2L3T A;  1FBZ A;  2MRK A;  3GXX A;  1AYC A;  2FO0 A;  2CBL A;  3CBL A;  2ROR A;  4NWG A;  3BUX B;  3VS0 A;  1CSY A;  1JYR A;  5DC9 A;  3VRP A;  2FCI A;  2LCT A;  1YVL A;  4OHE A;  1NRV A;  3WA4 A;  5I6V A;  1BG1 A;  2L4K A;  1O4Q A;  3UYO A;  2AUG A;  2B3O A;  1LUI A;  1O45 A;  5EEQ A;  5GJH A;  1BHH B;  1CJ1 A;  3OB1 B;  3N84 A;  1AOT F;  4H34 A;  3MXY A;  3OV1 A;  3VRR A;  1SPR A;  1QAD A;  1NZV A;  3N7Y A;  2AOA A;  2DM0 A;  3EAC A;  4L1B B;  1R1P A;  1LKL A;  2IUI A;  2KNO A;  3VS6 A;  3VRZ A;  4FL2 A;  4OHL A;  2CIA A;  1A07 A;  4JE4 A;  1OO3 A;  2DLY A;  2EO6 A;  2RSY A;  2JYQ A;  1SKJ A;  1FU6 A;  1O4D A;  4TZI A;  1LUM A;  1FMK A;  4OHH A;  1FU5 A;  3OVE A;  1BKL A;  1O4P A;  3BUW B;  1O46 A;  2PLE A;  3OB2 B;  1LUN A;  1QG1 E;  2LRA A;  1D4T A;  4D8K A;  3VS1 A;  1O4R A;  2YU7 A;  1BFI A;  3CXL A;  1FHS A;  1BLK A;  2C0I A;  2LNW A;  3HIZ B;  3EAZ A;  1G83 A;  1D4W A;  3M7F A;  4XZ0 A;  4K11 A;  1I3Z A;  1O4M A;  4WWQ A;  3VS2 A;  1JU5 A;  1NZL A;  5IBM A;  2PLD A;  1F2F A;  1X6C A;  4OHD A;  3IN8 A;  4FBN A;  2EU0 A;  4EY0 A;  3BUO B;  3VRN A;  4K44 A;  2XP1 A;  3S8O A;  5AUL A;  2EOB A;  1LCJ A;  1SHB A;  1AYA A;  1KC2 A;  1X27 A;  3TKZ A;  2DCR A;  1PIC A; 
#chains in the Genus database with same CATH homology
 2CR4 A;  1F1W A;  2RVF A;  1O4I A;  2EYZ A;  1JYQ A;  2L6K A;  1GHU A;  3PJP A;  5EHP A;  3CD3 A;  5BO4 A;  1O4L A;  2EL8 A;  2EO3 A;  4DGP A;  3VRO A;  3BUM B;  2K7A B;  1QCF A;  2CI8 A;  2HCK A;  4OHI A;  2RMX A;  1SPS A;  4FL3 A;  2OQ1 A;  2HDV A;  3VS4 A;  1R1Q A;  1P13 A;  1H9O A;  2VIF A;  3PSJ A;  5HKW A;  3VS7 A;  1KA7 A;  1GRI A;  2CRH A;  1RQQ C;  1A1A A;  2GE9 A;  3PLF B;  1SHD A;  2OZO A;  1KA6 A;  5EHR A;  1OPL A;  1O4C A;  1UUR A;  1O4O A;  3PSK A;  2AOB A;  2QMS A;  4EIH A;  3S9K A;  1BKM A;  3PS5 A;  2C0T A;  3VGO A;  4H1O A;  1O4N A;  1BF5 A;  2KK6 A;  2CS0 A;  1A08 A;  3IN7 A;  2PNA A;  1CWD L;  4X6S A;  2HMH A;  3BUN B;  2H8H A;  1SHA A;  2C9W A;  3MXC A;  4K45 A;  4JGH A;  1TZE E;  1FBV A;  1LUK A;  5CDW A;  3QWX X;  4A4C A;  4GPL B;  5DC4 A;  2MRJ A;  5D0J A;  4DGX A;  4GWF A;  2ABL A;  1RJA A;  5HKZ A;  1LCK A;  3VRQ A;  1O4K A;  1A1B A;  3TL0 A;  4U1P A;  1BHF A;  3S8L A;  1BMB A;  4LUE A;  1MW4 A;  1OO4 A;  3HHM B;  1O4E A;  1AYB A;  1X0N A;  3OP0 A;  1XA6 A;  5AXI A;  3CWG A;  4K2R A;  2LQN A;  1ZFP E;  4QSY A;  3GQI B;  2PNB A;  4F5A A;  3QWY A;  3T04 A;  1BLJ A;  1TCE A;  3US4 A;  2HDX A;  1HCT B;  1HCS B;  3BKB A;  1YVH A;  2MQI A;  3KFJ A;  1O48 A;  5DC0 B;  1O42 A;  3N8M A;  3IMJ A;  2K79 B;  5IBS A;  2H46 E;  1JYU A;  3PQZ A;  3NHN A;  1AOU F;  1BFJ A;  2BBU A;  1Y57 A;  2EYV A;  2Y1N A;  2C0O A;  4E68 A;  1K9A A;  5DF6 A;  3UF4 A;  2SRC A;  1FYR A;  1LKK A;  1UUS A;  4P9Z A;  2DVJ A;  5HKY A;  1M27 A;  3VRY A;  2Y3A B;  4E93 A;  1RPY A;  2IZV A;  4LUD A;  1AYD A;  2HUW A;  4U17 A;  3GXW A;  2IUG A;  3VS5 A;  2CI9 A;  2H5K A;  1KSW A;  1A81 A;  3ZNI A;  1O49 A;  3C7I A;  1CWE A;  4F59 A;  1A09 A;  4M4Z A;  4XZ1 A;  3MAZ A;  1D1Z A;  1AB2 A;  2YSX A;  2LQW A;  4GL9 E;  5EEL A;  4A4B A;  3S8N A;  1IS0 A;  4F5B A;  5EG3 B;  1O4B A;  1BHH A;  1B47 A;  2DX0 A;  1Y1U A;  2EKX A;  2SHP A;  1AD5 A;  1MIL A;  1O47 A;  1O4J A;  1O43 A;  1O44 A;  3K2M A;  3IMD A;  1Z3K A;  1O4H A;  5J3X A;  3VS3 A;  1A1C A;  2MC1 A;  2PTK A;  3PFV A;  1O4F A;  5GJI A;  2ECD A;  4ROJ A;  2LNX A;  1O4A A;  1O41 A;  2GSB A;  4P9V A;  3HCK A;  2ETZ A;  1A1E A;  1OPK A;  1R1S A;  1BM2 A;  2MK2 A;  5KAZ A;  1IJR A;  4JEG A;  1CSZ A;  1O4G A;  2DLZ A;  2IUH A;  2Y1M A;  1JWO A;  1M61 A;  4NWF A;  1WQU A;  2EYY A;  2L3T A;  1FBZ A;  2MRK A;  3GXX A;  1AYC A;  2FO0 A;  2CBL A;  3CBL A;  2ROR A;  4NWG A;  3BUX B;  3VS0 A;  1CSY A;  1JYR A;  5DC9 A;  3VRP A;  2FCI A;  2LCT A;  1YVL A;  4OHE A;  1NRV A;  3WA4 A;  5I6V A;  1BG1 A;  2L4K A;  1O4Q A;  3UYO A;  2AUG A;  2B3O A;  1LUI A;  1O45 A;  5EEQ A;  5GJH A;  1BHH B;  1CJ1 A;  3OB1 B;  3N84 A;  1AOT F;  4H34 A;  3MXY A;  3OV1 A;  3VRR A;  1SPR A;  1QAD A;  1NZV A;  3N7Y A;  2AOA A;  2DM0 A;  3EAC A;  4L1B B;  1R1P A;  1LKL A;  2IUI A;  2KNO A;  3VS6 A;  3VRZ A;  4FL2 A;  4OHL A;  2CIA A;  1A07 A;  4JE4 A;  1OO3 A;  2DLY A;  2EO6 A;  2RSY A;  2JYQ A;  1SKJ A;  1FU6 A;  1O4D A;  4TZI A;  1LUM A;  1FMK A;  4OHH A;  1FU5 A;  3OVE A;  1BKL A;  1O4P A;  3BUW B;  1O46 A;  2PLE A;  3OB2 B;  1LUN A;  1QG1 E;  1D4T A;  4D8K A;  3VS1 A;  1O4R A;  2YU7 A;  1BFI A;  3CXL A;  1FHS A;  1BLK A;  2C0I A;  2LNW A;  3HIZ B;  3EAZ A;  1G83 A;  1D4W A;  3M7F A;  4XZ0 A;  4K11 A;  1I3Z A;  1O4M A;  4WWQ A;  3VS2 A;  1JU5 A;  1NZL A;  5IBM A;  2PLD A;  1F2F A;  1X6C A;  4OHD A;  3IN8 A;  4FBN A;  2EU0 A;  4EY0 A;  3BUO B;  3VRN A;  4K44 A;  2XP1 A;  3S8O A;  5AUL A;  2EOB A;  1LCJ A;  1SHB A;  1AYA A;  1KC2 A;  1X27 A;  3TKZ A;  2DCR A;  1PIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...