3HHMB

Crystal structure of p110alpha h1047r mutant in complex with nish2 of p85alpha and the drug wortmannin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
254
structure length
247
Chain Sequence
b'MSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQQVVKEDEAVGKHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic sub
publication title A frequent kinase domain mutation that changes the interaction between PI3K{alpha} and the membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/oncoprotein
total genus 73
structure length 247
sequence length 254
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00017 SH2 SH2 domain
B PF16454 PI3K_P85_iSH2 Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3hhmB01
3VS2A 1O41A 2IUGA 2JYQA 2PLEA 4F59A 3VS3A 2LQWA 3GXWA 2MQIA 1SPSA 1YVLA 2C0TA 1O42A 1LUKA 2DLZA 4GPLB 1HCSB 3VS7A 3BUNB 3EAZA 1X27A 4K11A 3CWGA 3PSKA 4JE4A 4OHIA 1BG1A 2ETZA 2PNBA 3PS5A 4E68A 1F2FA 1O4RA 1K9AA 4JGHA 1BLJA 3VS5A 4FL2A 1BKLA 1O46A 2H8HA 1O47A 5GJIA 1UUSA 1O4LA 2CI9A 1AYAA 2YSXA 1BFJA 3N84A 5EEQA 2K7AB 3CXLA 3UF4A 2MRKA 1LCKA 4L1BB 1BLKA 2OQ1A 2AOAA 2VIFA 1OPKA 2AOBA 2EYVA 2ECDA 1G83A 4NWGA 1A81A 1O4QA 2KK6A 1GHUA 5AXIA 2RVFA 1A09A 3N8MA 2SRCA 2EU0A 3C7IA 5EHPA 2EL8A 2H5KA 1GRIA 1NZVA 1NRVA 2GSBA 4OHEA 3TL0A 5IBSA 1M27A 1LUNA 1I3ZA 4FBNA 1O48A 3OB2B 5DC4A 4P9ZA 2DM0A 1A07A 1IJRA 1O4OA 3VRRA 1BHFA 4LUEA 1MILA 1O4GA 1BHHB 5EELA 1YVHA 2GE9A 4NWFA 1O4BA 2RORA 1NZLA 1AYDA 1SKJA 3MXYA 4F5AA 1Y1UA 2H46E 5EG3B 4ROJA 4OHLA 1QCFA 2PNAA 1BM2A 3OVEA 1FU6A 3VROA 4U1PA 3N7YA 2C9WA 3S8NA 5DF6A 1RQQC 4K45A 2L3TA 2HCKA 4OHHA 1B47A 3EACA 1O43A 3BUMB 4EY0A 1ZFPE 2PTKA 1FYRA 3VS0A 2MK2A 1O4FA 3OB1B 1RPYA 4P9VA 3BUWB 1TZEE 4TZIA 2CS0A 5AULA 3HIZB 2HDVA 1Y57A 2L4KA 1O4KA 1LUMA 1OO4A 5GJHA 2EO3A 2IZVA 3GXXA 4M4ZA 1BHHA 1O4CA 2EYYA 1O4MA 2EKXA 1FU5A 3PLFB 1FBVA 2Y1MA 2L6KA 3S8LA 4GL9E 1RJAA 3S8OA 2CRHA 2Y1NA 1PICA 3PSJA 2KNOA 1O4JA 1JYQA 2DX0A 4F5BA 5D0JA 1KC2A 1R1SA 4XZ1A 2PLDA 3HHMB 1HCTB 3QWXX 1D1ZA 3VS6A 1P13A 2LNXA 1A1EA 2C0OA 2LQNA 2YU7A 1LCJA 3KFJA 5HKZA 1Z3KA 1O4DA 1O4IA 1FHSA 1JYUA 1O45A 1AB2A 5EHRA 2HMHA 3IN8A 4GWFA 5IBMA 3UYOA 3HCKA 3MAZA 1O4HA 1KA6A 1O4AA 1OPLA 3BUOB 1FMKA 2AUGA 3VS4A 3CBLA 3IMDA 4K2RA 1AYCA 3BUXB 4E93A 1QADA 5I6VA 1X6CA 3VRPA 1KA7A 1D4WA 3TKZA 3VRZA 2C0IA 2ABLA 4DGPA 2CIAA 1XA6A 2MRJA 2IUIA 3OP0A 1SHBA 1OO3A 1O4PA 4EIHA 2SHPA 1A1CA 1QG1E 1KSWA 2K79B 4H1OA 4H34A 2RSYA 2EOBA 2DLYA 1WQUA 4WWQA 4A4CA 3VGOA 3QWYA 2OZOA 4QSYA 1AOTF 2B3OA 1TCEA 3M7FA 1BF5A 1M61A 1LKLA 4JEGA 3WA4A 1R1QA 5HKYA 3VRYA 1A1AA 5BO4A 2Y3AB 3IMJA 4X6SA 2RMXA 1JU5A 1BFIA 1O4EA 1A1BA 3NHNA 1BKMA 1MW4A 1JWOA 2FCIA 1IS0A 1CSYA 3MXCA 1SHDA 2XP1A 1CWDL 5J3XA 4LUDA 1X0NA 4U17A 1F1WA 1AOUF 3OV1A 3T04A 5DC0B 2CR4A 4D8KA 1CWEA 3BKBA 1BMBA 2CBLA 1LKKA 3CD3A 4K44A 5CDWA 1R1PA 2CI8A 2LNWA 3IN7A 4XZ0A 5HKWA 3PQZA 1JYRA 5KAZA 1CJ1A 3VS1A 2BBUA 1A08A 1H9OA 2DVJA 1O49A 1SHAA 1O4NA 1D4TA 3K2MA 3GQIB 1O44A 4FL3A 2HUWA 2EYZA 1SPRA 2FO0A 5DC9A 3US4A 2LCTA 4A4BA 3PFVA 3PJPA 1AD5A 1CSZA 4DGXA 4OHDA 3VRNA 3ZNIA 3S9KA 2QMSA 2DCRA 1FBZA 1AYBA 2HDXA 1UURA 2EO6A 2MC1A 3VRQA 2IUHA 1LUIA
chains in the Genus database with same CATH superfamily
3VS2A 1O41A 2IUGA 2JYQA 2PLEA 4F59A 3VS3A 2LQWA 3GXWA 2MQIA 1SPSA 1YVLA 2C0TA 1O42A 1LUKA 2DLZA 4GPLB 1HCSB 3VS7A 3BUNB 3EAZA 1X27A 4K11A 3CWGA 3PSKA 4JE4A 4OHIA 1BG1A 2ETZA 2PNBA 3PS5A 4E68A 1F2FA 1O4RA 1K9AA 4JGHA 1BLJA 3VS5A 4FL2A 1BKLA 1O46A 2H8HA 1O47A 5GJIA 1UUSA 1O4LA 2CI9A 1AYAA 2YSXA 1BFJA 3N84A 5EEQA 2K7AB 3CXLA 3UF4A 2MRKA 1LCKA 4L1BB 1BLKA 2OQ1A 2AOAA 2VIFA 1OPKA 2AOBA 2EYVA 2ECDA 1G83A 4NWGA 1A81A 1O4QA 2KK6A 1GHUA 5AXIA 2RVFA 1A09A 3N8MA 2SRCA 2EU0A 3C7IA 5EHPA 2EL8A 2H5KA 1GRIA 1NZVA 1NRVA 2GSBA 4OHEA 3TL0A 5IBSA 1M27A 1LUNA 1I3ZA 4FBNA 1O48A 3OB2B 5DC4A 4P9ZA 2DM0A 1A07A 1IJRA 1O4OA 3VRRA 1BHFA 4LUEA 1MILA 1O4GA 2KGYA 1BHHB 5EELA 1YVHA 2GE9A 4NWFA 1O4BA 2RORA 1NZLA 1AYDA 1SKJA 3MXYA 4F5AA 1Y1UA 3LYVA 2H46E 5EG3B 4ROJA 4OHLA 1QCFA 2PNAA 1BM2A 3OVEA 1FU6A 3VROA 4U1PA 3N7YA 2C9WA 3S8NA 5DF6A 1RQQC 4K45A 2L3TA 2HCKA 4OHHA 1B47A 3EACA 1O43A 3BUMB 4EY0A 1ZFPE 2PTKA 1FYRA 3VS0A 2MK2A 1O4FA 3OB1B 1RPYA 4P9VA 3BUWB 1TZEE 4TZIA 2CS0A 5AULA 3HIZB 2HDVA 1Y57A 2L4KA 1O4KA 1LUMA 1OO4A 5GJHA 2EO3A 2IZVA 3GXXA 4M4ZA 1BHHA 1O4CA 2EYYA 1O4MA 2EKXA 1FU5A 3PLFB 1FBVA 2Y1MA 2L6KA 3S8LA 4GL9E 1RJAA 3S8OA 2CRHA 2Y1NA 1PICA 3PSJA 2KNOA 1O4JA 1JYQA 2DX0A 4F5BA 5D0JA 1KC2A 1R1SA 4XZ1A 2PLDA 3HHMB 1HCTB 3QWXX 1D1ZA 3VS6A 1P13A 2LNXA 1A1EA 2C0OA 2LQNA 2YU7A 2LRAA 1LCJA 3KFJA 5HKZA 1Z3KA 1O4DA 1O4IA 1FHSA 1JYUA 1O45A 1AB2A 5EHRA 2HMHA 3IN8A 4GWFA 5IBMA 3UYOA 3HCKA 3MAZA 1O4HA 1KA6A 1O4AA 1OPLA 3BUOB 1FMKA 2AUGA 3VS4A 3CBLA 3IMDA 4K2RA 1AYCA 3BUXB 4E93A 1QADA 5I6VA 1X6CA 3VRPA 1KA7A 1D4WA 3TKZA 3VRZA 2C0IA 2ABLA 4DGPA 2CIAA 1XA6A 2MRJA 2IUIA 3OP0A 1SHBA 1OO3A 1O4PA 4EIHA 2SHPA 1A1CA 1QG1E 1KSWA 2K79B 4H1OA 4H34A 2RSYA 2EOBA 2DLYA 1WQUA 4WWQA 4A4CA 3VGOA 3QWYA 2OZOA 4QSYA 1AOTF 2B3OA 1TCEA 3M7FA 1BF5A 1M61A 1LKLA 4JEGA 3WA4A 1R1QA 5HKYA 3VRYA 1A1AA 5BO4A 2Y3AB 3IMJA 4X6SA 2RMXA 1JU5A 1BFIA 1O4EA 1A1BA 3NHNA 1BKMA 1MW4A 1JWOA 2FCIA 3K2TA 1IS0A 1CSYA 3MXCA 1SHDA 2XP1A 1CWDL 5J3XA 4LUDA 1X0NA 4U17A 1F1WA 1AOUF 3OV1A 3T04A 5DC0B 2CR4A 4D8KA 1CWEA 3BKBA 1BMBA 2CBLA 1LKKA 3CD3A 4K44A 5CDWA 1R1PA 2CI8A 2LNWA 3IN7A 4XZ0A 5HKWA 3PQZA 1JYRA 5KAZA 1CJ1A 3VS1A 2BBUA 1A08A 1H9OA 2DVJA 1O49A 1SHAA 1O4NA 1D4TA 3K2MA 3GQIB 1O44A 4FL3A 2HUWA 2EYZA 1SPRA 2FO0A 5DC9A 3US4A 2LCTA 4A4BA 3PFVA 3PJPA 1AD5A 1CSZA 4DGXA 4OHDA 3VRNA 3ZNIA 3S9KA 2QMSA 2DCRA 1FBZA 1AYBA 2HDXA 1UURA 2EO6A 2MC1A 3VRQA 2IUHA 1LUIA
chains in the Genus database with same CATH topology
3VS2A 1O41A 2IUGA 2JYQA 2PLEA 4F59A 3VS3A 2LQWA 3GXWA 2MQIA 1SPSA 1YVLA 2C0TA 1O42A 1LUKA 2DLZA 4GPLB 1HCSB 3VS7A 3BUNB 3EAZA 1X27A 4K11A 3CWGA 3PSKA 4JE4A 4OHIA 1BG1A 2ETZA 2PNBA 3PS5A 4E68A 1F2FA 1O4RA 1K9AA 4JGHA 1BLJA 3VS5A 4FL2A 1BKLA 1O46A 2H8HA 1O47A 5GJIA 1UUSA 1O4LA 2CI9A 1AYAA 2YSXA 1BFJA 3N84A 5EEQA 2K7AB 3CXLA 3UF4A 2MRKA 1LCKA 4L1BB 1BLKA 2OQ1A 2AOAA 2VIFA 1OPKA 2AOBA 2EYVA 2ECDA 1G83A 4NWGA 1A81A 1O4QA 2KK6A 1GHUA 5AXIA 2RVFA 1A09A 3N8MA 2SRCA 2EU0A 3C7IA 5EHPA 2EL8A 2H5KA 1GRIA 1NZVA 1NRVA 2GSBA 4OHEA 3TL0A 5IBSA 1M27A 1LUNA 1I3ZA 4FBNA 1O48A 3OB2B 5DC4A 4P9ZA 2DM0A 1A07A 1IJRA 1O4OA 3VRRA 1BHFA 4LUEA 1MILA 1O4GA 1BHHB 5EELA 1YVHA 2GE9A 4NWFA 1O4BA 2RORA 1NZLA 1AYDA 1SKJA 3MXYA 4F5AA 1Y1UA 2H46E 5EG3B 4ROJA 4OHLA 1QCFA 2PNAA 1BM2A 3OVEA 1FU6A 3VROA 4U1PA 3N7YA 2C9WA 3S8NA 5DF6A 1RQQC 4K45A 2L3TA 2HCKA 4OHHA 1B47A 3EACA 1O43A 3BUMB 4EY0A 1ZFPE 2PTKA 1FYRA 3VS0A 2MK2A 1O4FA 3OB1B 1RPYA 4P9VA 3BUWB 1TZEE 4TZIA 2CS0A 5AULA 3HIZB 2HDVA 1Y57A 2L4KA 1O4KA 1LUMA 1OO4A 5GJHA 2EO3A 2IZVA 3GXXA 4M4ZA 1BHHA 1O4CA 2EYYA 1O4MA 2EKXA 1FU5A 3PLFB 1FBVA 2Y1MA 2L6KA 3S8LA 4GL9E 1RJAA 3S8OA 2CRHA 2Y1NA 1PICA 3PSJA 2KNOA 1O4JA 1JYQA 2DX0A 4F5BA 5D0JA 1KC2A 1R1SA 4XZ1A 2PLDA 3HHMB 1HCTB 3QWXX 1D1ZA 3VS6A 1P13A 2LNXA 1A1EA 2C0OA 2LQNA 2YU7A 1LCJA 3KFJA 5HKZA 1Z3KA 1O4DA 1O4IA 1FHSA 1JYUA 1O45A 1AB2A 5EHRA 2HMHA 3IN8A 4GWFA 5IBMA 3UYOA 3HCKA 3MAZA 1O4HA 1KA6A 1O4AA 1OPLA 3BUOB 1FMKA 2AUGA 3VS4A 3CBLA 3IMDA 4K2RA 1AYCA 3BUXB 4E93A 1QADA 5I6VA 1X6CA 3VRPA 1KA7A 1D4WA 3TKZA 3VRZA 2C0IA 2ABLA 4DGPA 2CIAA 1XA6A 2MRJA 2IUIA 3OP0A 1SHBA 1OO3A 1O4PA 4EIHA 2SHPA 1A1CA 1QG1E 1KSWA 2K79B 4H1OA 4H34A 2RSYA 2EOBA 2DLYA 1WQUA 4WWQA 4A4CA 3VGOA 3QWYA 2OZOA 4QSYA 1AOTF 2B3OA 1TCEA 3M7FA 1BF5A 1M61A 1LKLA 4JEGA 3WA4A 1R1QA 5HKYA 3VRYA 1A1AA 5BO4A 2Y3AB 3IMJA 4X6SA 2RMXA 1JU5A 1BFIA 1O4EA 1A1BA 3NHNA 1BKMA 1MW4A 1JWOA 2FCIA 1IS0A 1CSYA 3MXCA 1SHDA 2XP1A 1CWDL 5J3XA 4LUDA 1X0NA 4U17A 1F1WA 1AOUF 3OV1A 3T04A 5DC0B 2CR4A 4D8KA 1CWEA 3BKBA 1BMBA 2CBLA 1LKKA 3CD3A 4K44A 5CDWA 1R1PA 2CI8A 2LNWA 3IN7A 4XZ0A 5HKWA 3PQZA 1JYRA 5KAZA 1CJ1A 3VS1A 2BBUA 1A08A 1H9OA 2DVJA 1O49A 1SHAA 1O4NA 1D4TA 3K2MA 3GQIB 1O44A 4FL3A 2HUWA 2EYZA 1SPRA 2FO0A 5DC9A 3US4A 2LCTA 4A4BA 3PFVA 3PJPA 1AD5A 1CSZA 4DGXA 4OHDA 3VRNA 3ZNIA 3S9KA 2QMSA 2DCRA 1FBZA 1AYBA 2HDXA 1UURA 2EO6A 2MC1A 3VRQA 2IUHA 1LUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS2 A;  1O41 A;  2IUG A;  2JYQ A;  2PLE A;  4F59 A;  3VS3 A;  2LQW A;  3GXW A;  2MQI A;  1SPS A;  1YVL A;  2C0T A;  1O42 A;  1LUK A;  2DLZ A;  4GPL B;  1HCS B;  3VS7 A;  3BUN B;  3EAZ A;  1X27 A;  4K11 A;  3CWG A;  3PSK A;  4JE4 A;  4OHI A;  1BG1 A;  2ETZ A;  2PNB A;  3PS5 A;  4E68 A;  1F2F A;  1O4R A;  1K9A A;  4JGH A;  1BLJ A;  3VS5 A;  4FL2 A;  1BKL A;  1O46 A;  2H8H A;  1O47 A;  5GJI A;  1UUS A;  1O4L A;  2CI9 A;  1AYA A;  2YSX A;  1BFJ A;  3N84 A;  5EEQ A;  2K7A B;  3CXL A;  3UF4 A;  2MRK A;  1LCK A;  4L1B B;  1BLK A;  2OQ1 A;  2AOA A;  2VIF A;  1OPK A;  2AOB A;  2EYV A;  2ECD A;  1G83 A;  4NWG A;  1A81 A;  1O4Q A;  2KK6 A;  1GHU A;  5AXI A;  2RVF A;  1A09 A;  3N8M A;  2SRC A;  2EU0 A;  3C7I A;  5EHP A;  2EL8 A;  2H5K A;  1GRI A;  1NZV A;  1NRV A;  2GSB A;  4OHE A;  3TL0 A;  5IBS A;  1M27 A;  1LUN A;  1I3Z A;  4FBN A;  1O48 A;  3OB2 B;  5DC4 A;  4P9Z A;  2DM0 A;  1A07 A;  1IJR A;  1O4O A;  3VRR A;  1BHF A;  4LUE A;  1MIL A;  1O4G A;  1BHH B;  5EEL A;  1YVH A;  2GE9 A;  4NWF A;  1O4B A;  2ROR A;  1NZL A;  1AYD A;  1SKJ A;  3MXY A;  4F5A A;  1Y1U A;  2H46 E;  5EG3 B;  4ROJ A;  4OHL A;  1QCF A;  2PNA A;  1BM2 A;  3OVE A;  1FU6 A;  3VRO A;  4U1P A;  3N7Y A;  2C9W A;  3S8N A;  5DF6 A;  1RQQ C;  4K45 A;  2L3T A;  2HCK A;  4OHH A;  1B47 A;  3EAC A;  1O43 A;  3BUM B;  4EY0 A;  1ZFP E;  2PTK A;  1FYR A;  3VS0 A;  2MK2 A;  1O4F A;  3OB1 B;  1RPY A;  4P9V A;  3BUW B;  1TZE E;  4TZI A;  2CS0 A;  5AUL A;  3HIZ B;  2HDV A;  1Y57 A;  2L4K A;  1O4K A;  1LUM A;  1OO4 A;  5GJH A;  2EO3 A;  2IZV A;  3GXX A;  4M4Z A;  1BHH A;  1O4C A;  2EYY A;  1O4M A;  2EKX A;  1FU5 A;  3PLF B;  1FBV A;  2Y1M A;  2L6K A;  3S8L A;  4GL9 E;  1RJA A;  3S8O A;  2CRH A;  2Y1N A;  1PIC A;  3PSJ A;  2KNO A;  1O4J A;  1JYQ A;  2DX0 A;  4F5B A;  5D0J A;  1KC2 A;  1R1S A;  4XZ1 A;  2PLD A;  3HHM B;  1HCT B;  3QWX X;  1D1Z A;  3VS6 A;  1P13 A;  2LNX A;  1A1E A;  2C0O A;  2LQN A;  2YU7 A;  1LCJ A;  3KFJ A;  5HKZ A;  1Z3K A;  1O4D A;  1O4I A;  1FHS A;  1JYU A;  1O45 A;  1AB2 A;  5EHR A;  2HMH A;  3IN8 A;  4GWF A;  5IBM A;  3UYO A;  3HCK A;  3MAZ A;  1O4H A;  1KA6 A;  1O4A A;  1OPL A;  3BUO B;  1FMK A;  2AUG A;  3VS4 A;  3CBL A;  3IMD A;  4K2R A;  1AYC A;  3BUX B;  4E93 A;  1QAD A;  5I6V A;  1X6C A;  3VRP A;  1KA7 A;  1D4W A;  3TKZ A;  3VRZ A;  2C0I A;  2ABL A;  4DGP A;  2CIA A;  1XA6 A;  2MRJ A;  2IUI A;  3OP0 A;  1SHB A;  1OO3 A;  1O4P A;  4EIH A;  2SHP A;  1A1C A;  1QG1 E;  1KSW A;  2K79 B;  4H1O A;  4H34 A;  2RSY A;  2EOB A;  2DLY A;  1WQU A;  4WWQ A;  4A4C A;  3VGO A;  3QWY A;  2OZO A;  4QSY A;  1AOT F;  2B3O A;  1TCE A;  3M7F A;  1BF5 A;  1M61 A;  1LKL A;  4JEG A;  3WA4 A;  1R1Q A;  5HKY A;  3VRY A;  1A1A A;  5BO4 A;  2Y3A B;  3IMJ A;  4X6S A;  2RMX A;  1JU5 A;  1BFI A;  1O4E A;  1A1B A;  3NHN A;  1BKM A;  1MW4 A;  1JWO A;  2FCI A;  1IS0 A;  1CSY A;  3MXC A;  1SHD A;  2XP1 A;  1CWD L;  5J3X A;  4LUD A;  1X0N A;  4U17 A;  1F1W A;  1AOU F;  3OV1 A;  3T04 A;  5DC0 B;  2CR4 A;  4D8K A;  1CWE A;  3BKB A;  1BMB A;  2CBL A;  1LKK A;  3CD3 A;  4K44 A;  5CDW A;  1R1P A;  2CI8 A;  2LNW A;  3IN7 A;  4XZ0 A;  5HKW A;  3PQZ A;  1JYR A;  5KAZ A;  1CJ1 A;  3VS1 A;  2BBU A;  1A08 A;  1H9O A;  2DVJ A;  1O49 A;  1SHA A;  1O4N A;  1D4T A;  3K2M A;  3GQI B;  1O44 A;  4FL3 A;  2HUW A;  2EYZ A;  1SPR A;  2FO0 A;  5DC9 A;  3US4 A;  2LCT A;  4A4B A;  3PFV A;  3PJP A;  1AD5 A;  1CSZ A;  4DGX A;  4OHD A;  3VRN A;  3ZNI A;  3S9K A;  2QMS A;  2DCR A;  1FBZ A;  1AYB A;  2HDX A;  1UUR A;  2EO6 A;  2MC1 A;  3VRQ A;  2IUH A;  1LUI A; 
#chains in the Genus database with same CATH topology
 3VS2 A;  1O41 A;  2IUG A;  2JYQ A;  2PLE A;  4F59 A;  3VS3 A;  2LQW A;  3GXW A;  2MQI A;  1SPS A;  1YVL A;  2C0T A;  1O42 A;  1LUK A;  2DLZ A;  4GPL B;  1HCS B;  3VS7 A;  3BUN B;  3EAZ A;  1X27 A;  4K11 A;  3CWG A;  3PSK A;  4JE4 A;  4OHI A;  1BG1 A;  2ETZ A;  2PNB A;  3PS5 A;  4E68 A;  1F2F A;  1O4R A;  1K9A A;  4JGH A;  1BLJ A;  3VS5 A;  4FL2 A;  1BKL A;  1O46 A;  2H8H A;  1O47 A;  5GJI A;  1UUS A;  1O4L A;  2CI9 A;  1AYA A;  2YSX A;  1BFJ A;  3N84 A;  5EEQ A;  2K7A B;  3CXL A;  3UF4 A;  2MRK A;  1LCK A;  4L1B B;  1BLK A;  2OQ1 A;  2AOA A;  2VIF A;  1OPK A;  2AOB A;  2EYV A;  2ECD A;  1G83 A;  4NWG A;  1A81 A;  1O4Q A;  2KK6 A;  1GHU A;  5AXI A;  2RVF A;  1A09 A;  3N8M A;  2SRC A;  2EU0 A;  3C7I A;  5EHP A;  2EL8 A;  2H5K A;  1GRI A;  1NZV A;  1NRV A;  2GSB A;  4OHE A;  3TL0 A;  5IBS A;  1M27 A;  1LUN A;  1I3Z A;  4FBN A;  1O48 A;  3OB2 B;  5DC4 A;  4P9Z A;  2DM0 A;  1A07 A;  1IJR A;  1O4O A;  3VRR A;  1BHF A;  4LUE A;  1MIL A;  1O4G A;  2KGY A;  1BHH B;  5EEL A;  1YVH A;  2GE9 A;  4NWF A;  1O4B A;  2ROR A;  1NZL A;  1AYD A;  1SKJ A;  3MXY A;  4F5A A;  1Y1U A;  3LYV A;  2H46 E;  5EG3 B;  4ROJ A;  4OHL A;  1QCF A;  2PNA A;  1BM2 A;  3OVE A;  1FU6 A;  3VRO A;  4U1P A;  3N7Y A;  2C9W A;  3S8N A;  5DF6 A;  1RQQ C;  4K45 A;  2L3T A;  2HCK A;  4OHH A;  1B47 A;  3EAC A;  1O43 A;  3BUM B;  4EY0 A;  1ZFP E;  2PTK A;  1FYR A;  3VS0 A;  2MK2 A;  1O4F A;  3OB1 B;  1RPY A;  4P9V A;  3BUW B;  1TZE E;  4TZI A;  2CS0 A;  5AUL A;  3HIZ B;  2HDV A;  1Y57 A;  2L4K A;  1O4K A;  1LUM A;  1OO4 A;  5GJH A;  2EO3 A;  2IZV A;  3GXX A;  4M4Z A;  1BHH A;  1O4C A;  2EYY A;  1O4M A;  2EKX A;  1FU5 A;  3PLF B;  1FBV A;  2Y1M A;  2L6K A;  3S8L A;  4GL9 E;  1RJA A;  3S8O A;  2CRH A;  2Y1N A;  1PIC A;  3PSJ A;  2KNO A;  1O4J A;  1JYQ A;  2DX0 A;  4F5B A;  5D0J A;  1KC2 A;  1R1S A;  4XZ1 A;  2PLD A;  3HHM B;  1HCT B;  3QWX X;  1D1Z A;  3VS6 A;  1P13 A;  2LNX A;  1A1E A;  2C0O A;  2LQN A;  2YU7 A;  2LRA A;  1LCJ A;  3KFJ A;  5HKZ A;  1Z3K A;  1O4D A;  1O4I A;  1FHS A;  1JYU A;  1O45 A;  1AB2 A;  5EHR A;  2HMH A;  3IN8 A;  4GWF A;  5IBM A;  3UYO A;  3HCK A;  3MAZ A;  1O4H A;  1KA6 A;  1O4A A;  1OPL A;  3BUO B;  1FMK A;  2AUG A;  3VS4 A;  3CBL A;  3IMD A;  4K2R A;  1AYC A;  3BUX B;  4E93 A;  1QAD A;  5I6V A;  1X6C A;  3VRP A;  1KA7 A;  1D4W A;  3TKZ A;  3VRZ A;  2C0I A;  2ABL A;  4DGP A;  2CIA A;  1XA6 A;  2MRJ A;  2IUI A;  3OP0 A;  1SHB A;  1OO3 A;  1O4P A;  4EIH A;  2SHP A;  1A1C A;  1QG1 E;  1KSW A;  2K79 B;  4H1O A;  4H34 A;  2RSY A;  2EOB A;  2DLY A;  1WQU A;  4WWQ A;  4A4C A;  3VGO A;  3QWY A;  2OZO A;  4QSY A;  1AOT F;  2B3O A;  1TCE A;  3M7F A;  1BF5 A;  1M61 A;  1LKL A;  4JEG A;  3WA4 A;  1R1Q A;  5HKY A;  3VRY A;  1A1A A;  5BO4 A;  2Y3A B;  3IMJ A;  4X6S A;  2RMX A;  1JU5 A;  1BFI A;  1O4E A;  1A1B A;  3NHN A;  1BKM A;  1MW4 A;  1JWO A;  2FCI A;  3K2T A;  1IS0 A;  1CSY A;  3MXC A;  1SHD A;  2XP1 A;  1CWD L;  5J3X A;  4LUD A;  1X0N A;  4U17 A;  1F1W A;  1AOU F;  3OV1 A;  3T04 A;  5DC0 B;  2CR4 A;  4D8K A;  1CWE A;  3BKB A;  1BMB A;  2CBL A;  1LKK A;  3CD3 A;  4K44 A;  5CDW A;  1R1P A;  2CI8 A;  2LNW A;  3IN7 A;  4XZ0 A;  5HKW A;  3PQZ A;  1JYR A;  5KAZ A;  1CJ1 A;  3VS1 A;  2BBU A;  1A08 A;  1H9O A;  2DVJ A;  1O49 A;  1SHA A;  1O4N A;  1D4T A;  3K2M A;  3GQI B;  1O44 A;  4FL3 A;  2HUW A;  2EYZ A;  1SPR A;  2FO0 A;  5DC9 A;  3US4 A;  2LCT A;  4A4B A;  3PFV A;  3PJP A;  1AD5 A;  1CSZ A;  4DGX A;  4OHD A;  3VRN A;  3ZNI A;  3S9K A;  2QMS A;  2DCR A;  1FBZ A;  1AYB A;  2HDX A;  1UUR A;  2EO6 A;  2MC1 A;  3VRQ A;  2IUH A;  1LUI A; 
#chains in the Genus database with same CATH homology
 3VS2 A;  1O41 A;  2IUG A;  2JYQ A;  2PLE A;  4F59 A;  3VS3 A;  2LQW A;  3GXW A;  2MQI A;  1SPS A;  1YVL A;  2C0T A;  1O42 A;  1LUK A;  2DLZ A;  4GPL B;  1HCS B;  3VS7 A;  3BUN B;  3EAZ A;  1X27 A;  4K11 A;  3CWG A;  3PSK A;  4JE4 A;  4OHI A;  1BG1 A;  2ETZ A;  2PNB A;  3PS5 A;  4E68 A;  1F2F A;  1O4R A;  1K9A A;  4JGH A;  1BLJ A;  3VS5 A;  4FL2 A;  1BKL A;  1O46 A;  2H8H A;  1O47 A;  5GJI A;  1UUS A;  1O4L A;  2CI9 A;  1AYA A;  2YSX A;  1BFJ A;  3N84 A;  5EEQ A;  2K7A B;  3CXL A;  3UF4 A;  2MRK A;  1LCK A;  4L1B B;  1BLK A;  2OQ1 A;  2AOA A;  2VIF A;  1OPK A;  2AOB A;  2EYV A;  2ECD A;  1G83 A;  4NWG A;  1A81 A;  1O4Q A;  2KK6 A;  1GHU A;  5AXI A;  2RVF A;  1A09 A;  3N8M A;  2SRC A;  2EU0 A;  3C7I A;  5EHP A;  2EL8 A;  2H5K A;  1GRI A;  1NZV A;  1NRV A;  2GSB A;  4OHE A;  3TL0 A;  5IBS A;  1M27 A;  1LUN A;  1I3Z A;  4FBN A;  1O48 A;  3OB2 B;  5DC4 A;  4P9Z A;  2DM0 A;  1A07 A;  1IJR A;  1O4O A;  3VRR A;  1BHF A;  4LUE A;  1MIL A;  1O4G A;  1BHH B;  5EEL A;  1YVH A;  2GE9 A;  4NWF A;  1O4B A;  2ROR A;  1NZL A;  1AYD A;  1SKJ A;  3MXY A;  4F5A A;  1Y1U A;  2H46 E;  5EG3 B;  4ROJ A;  4OHL A;  1QCF A;  2PNA A;  1BM2 A;  3OVE A;  1FU6 A;  3VRO A;  4U1P A;  3N7Y A;  2C9W A;  3S8N A;  5DF6 A;  1RQQ C;  4K45 A;  2L3T A;  2HCK A;  4OHH A;  1B47 A;  3EAC A;  1O43 A;  3BUM B;  4EY0 A;  1ZFP E;  2PTK A;  1FYR A;  3VS0 A;  2MK2 A;  1O4F A;  3OB1 B;  1RPY A;  4P9V A;  3BUW B;  1TZE E;  4TZI A;  2CS0 A;  5AUL A;  3HIZ B;  2HDV A;  1Y57 A;  2L4K A;  1O4K A;  1LUM A;  1OO4 A;  5GJH A;  2EO3 A;  2IZV A;  3GXX A;  4M4Z A;  1BHH A;  1O4C A;  2EYY A;  1O4M A;  2EKX A;  1FU5 A;  3PLF B;  1FBV A;  2Y1M A;  2L6K A;  3S8L A;  4GL9 E;  1RJA A;  3S8O A;  2CRH A;  2Y1N A;  1PIC A;  3PSJ A;  2KNO A;  1O4J A;  1JYQ A;  2DX0 A;  4F5B A;  5D0J A;  1KC2 A;  1R1S A;  4XZ1 A;  2PLD A;  3HHM B;  1HCT B;  3QWX X;  1D1Z A;  3VS6 A;  1P13 A;  2LNX A;  1A1E A;  2C0O A;  2LQN A;  2YU7 A;  1LCJ A;  3KFJ A;  5HKZ A;  1Z3K A;  1O4D A;  1O4I A;  1FHS A;  1JYU A;  1O45 A;  1AB2 A;  5EHR A;  2HMH A;  3IN8 A;  4GWF A;  5IBM A;  3UYO A;  3HCK A;  3MAZ A;  1O4H A;  1KA6 A;  1O4A A;  1OPL A;  3BUO B;  1FMK A;  2AUG A;  3VS4 A;  3CBL A;  3IMD A;  4K2R A;  1AYC A;  3BUX B;  4E93 A;  1QAD A;  5I6V A;  1X6C A;  3VRP A;  1KA7 A;  1D4W A;  3TKZ A;  3VRZ A;  2C0I A;  2ABL A;  4DGP A;  2CIA A;  1XA6 A;  2MRJ A;  2IUI A;  3OP0 A;  1SHB A;  1OO3 A;  1O4P A;  4EIH A;  2SHP A;  1A1C A;  1QG1 E;  1KSW A;  2K79 B;  4H1O A;  4H34 A;  2RSY A;  2EOB A;  2DLY A;  1WQU A;  4WWQ A;  4A4C A;  3VGO A;  3QWY A;  2OZO A;  4QSY A;  1AOT F;  2B3O A;  1TCE A;  3M7F A;  1BF5 A;  1M61 A;  1LKL A;  4JEG A;  3WA4 A;  1R1Q A;  5HKY A;  3VRY A;  1A1A A;  5BO4 A;  2Y3A B;  3IMJ A;  4X6S A;  2RMX A;  1JU5 A;  1BFI A;  1O4E A;  1A1B A;  3NHN A;  1BKM A;  1MW4 A;  1JWO A;  2FCI A;  1IS0 A;  1CSY A;  3MXC A;  1SHD A;  2XP1 A;  1CWD L;  5J3X A;  4LUD A;  1X0N A;  4U17 A;  1F1W A;  1AOU F;  3OV1 A;  3T04 A;  5DC0 B;  2CR4 A;  4D8K A;  1CWE A;  3BKB A;  1BMB A;  2CBL A;  1LKK A;  3CD3 A;  4K44 A;  5CDW A;  1R1P A;  2CI8 A;  2LNW A;  3IN7 A;  4XZ0 A;  5HKW A;  3PQZ A;  1JYR A;  5KAZ A;  1CJ1 A;  3VS1 A;  2BBU A;  1A08 A;  1H9O A;  2DVJ A;  1O49 A;  1SHA A;  1O4N A;  1D4T A;  3K2M A;  3GQI B;  1O44 A;  4FL3 A;  2HUW A;  2EYZ A;  1SPR A;  2FO0 A;  5DC9 A;  3US4 A;  2LCT A;  4A4B A;  3PFV A;  3PJP A;  1AD5 A;  1CSZ A;  4DGX A;  4OHD A;  3VRN A;  3ZNI A;  3S9K A;  2QMS A;  2DCR A;  1FBZ A;  1AYB A;  2HDX A;  1UUR A;  2EO6 A;  2MC1 A;  3VRQ A;  2IUH A;  1LUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...