2DLYA

Solution structure of the sh2 domain of murine fyn-related kinase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
121
structure length
121
Chain Sequence
b'GSSGSSGAEDRSLQAEPWFFGAIKRADAEKQLLYSENQTGAFLIRESESQKGDFSLSVLDEGVVKHYRIRRLDEGGFFLTRRKVFSTLNEFVNYYTTTSDGLCVKLEKPCLKIQVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fyn-related kinase
publication title Solution structure of the SH2 domain of murine Fyn-related kinase
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 15
structure length 121
sequence length 121
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2dlyA00
3HIZB 1O4EA 3OV1A 3N84A 1O4CA 2L6KA 4H1OA 3CBLA 1HCTB 3VS4A 1AB2A 5I6VA 1F2FA 1PICA 1AYBA 1O4GA 2MRJA 2C0TA 3BUXB 2Y1NA 2SHPA 1O48A 2SRCA 4U1PA 1I3ZA 3GXXA 5IBSA 3VRQA 2C9WA 2LQNA 4JE4A 2DLZA 4OHIA 4K2RA 2CS0A 2HCKA 3OVEA 3NHNA 5BO4A 1O4JA 3VS7A 1O41A 1BM2A 1O47A 2ABLA 1QG1E 2BBUA 2DX0A 3GQIB 2CR4A 2PTKA 4JEGA 1BHHA 3BUNB 4F59A 2AOBA 4H34A 1FMKA 3EAZA 1O43A 1UURA 2EU0A 3IMJA 3S8NA 1F1WA 3GXWA 1BLKA 1R1SA 1LUNA 4F5BA 3M7FA 1LUIA 3S8OA 1H9OA 5DF6A 1BFIA 1O4AA 3VGOA 3PJPA 3VS5A 2QMSA 1Y57A 5HKWA 5HKYA 4GPLB 2MK2A 1AOTF 1BFJA 1WQUA 4TZIA 3IN8A 1NZVA 1RQQC 3QWYA 3OB2B 4K11A 2EKXA 1AOUF 1FBVA 3VS6A 2FCIA 4OHEA 3OP0A 3PS5A 3EACA 1BHFA 1GRIA 2L3TA 1A09A 1GHUA 1BF5A 2YU7A 2PLDA 2IUHA 1RPYA 3BUWB 1A1BA 1X27A 3HCKA 2CBLA 3IN7A 2KNOA 1FHSA 3T04A 5J3XA 1HCSB 1A81A 1IJRA 4XZ1A 2GSBA 2PLEA 1Z3KA 2RVFA 1JYRA 2HMHA 1YVLA 4GL9E 2H46E 1QCFA 3UF4A 4XZ0A 1BKLA 2EO3A 2LNWA 2KK6A 1FYRA 3VRNA 1CWDL 2JYQA 3VS0A 1G83A 1FBZA 3BKBA 2EYZA 5EEQA 2L4KA 3VRRA 3MXYA 1CWEA 1JYUA 5KAZA 5CDWA 1SHBA 4K45A 1A1CA 2PNAA 2HUWA 3PQZA 1O4QA 1JU5A 3VS2A 2B3OA 2EYYA 4X6SA 3VRZA 2EL8A 1KA6A 1CJ1A 5AXIA 1JWOA 3BUOB 1SHDA 1MW4A 1TZEE 2HDVA 1D1ZA 2CIAA 4OHHA 1A1AA 3PSJA 1O44A 4JGHA 1X6CA 2IUGA 2AOAA 1O4MA 1O49A 1SPRA 2DM0A 4E68A 1IS0A 1FU5A 2Y3AB 3BUMB 4P9VA 1KSWA 1OO4A 2MQIA 1NRVA 1O4DA 4OHDA 1BHHB 3VROA 3CXLA 3S8LA 1O42A 4FL3A 1B47A 1KA7A 1OPLA 2IUIA 4WWQA 1AYAA 3QWXX 1D4TA 2CI9A 5GJIA 3VRPA 1O4PA 3ZNIA 1A07A 3US4A 1XA6A 1LUKA 4K44A 5EELA 1CSZA 2DLYA 2RSYA 5IBMA 1D4WA 1AD5A 1O4HA 4GWFA 5EG3B 1O4NA 2ETZA 3KFJA 2PNBA 1RJAA 2VIFA 1A1EA 1M61A 1O45A 4M4ZA 4NWFA 1SHAA 1O4KA 1NZLA 2DVJA 4L1BB 3VS3A 1LKKA 2OZOA 2K79B 4LUDA 3VRYA 5GJHA 4DGPA 1ZFPE 4D8KA 4EIHA 4A4BA 3C7IA 1TCEA 1X0NA 1BG1A 2H5KA 4LUEA 2RORA 2MC1A 4U17A 1OPKA 1Y1UA 2IZVA 3MXCA 3MAZA 1LKLA 1LUMA 4DGXA 1LCKA 4FL2A 1UUSA 3K2MA 1BKMA 2LQWA 2YSXA 4FBNA 5DC0B 2CI8A 3HHMB 1P13A 5DC4A 2LNXA 1SKJA 5EHRA 1O4FA 2Y1MA 2EOBA 2EYVA 4F5AA 1M27A 1JYQA 3S9KA 2C0OA 3CWGA 1BMBA 1O4LA 2C0IA 2XP1A 4OHLA 5D0JA 2DCRA 1AYDA 3VS1A 1MILA 3CD3A 1O4BA 2HDXA 1O4RA 3OB1B 2K7AB 4A4CA 2ECDA 4NWGA 1AYCA 4E93A 1O4OA 1O4IA 2EO6A 3WA4A 1FU6A 5AULA 2GE9A 4ROJA 3PFVA 1K9AA 1BLJA 1QADA 2AUGA 2MRKA 5DC9A 1R1QA 4EY0A 1R1PA 3TKZA 1O46A 1SPSA 2FO0A 4P9ZA 2OQ1A 3N8MA 2H8HA 1A08A 3UYOA 1LCJA 1YVHA 3PSKA 3TL0A 2LCTA 4QSYA 3N7YA 2RMXA 1CSYA 1OO3A 5HKZA 1KC2A 2CRHA 3IMDA 3PLFB 5EHPA
chains in the Genus database with same CATH superfamily
3HIZB 1O4EA 3OV1A 3N84A 1O4CA 2L6KA 4H1OA 3CBLA 1HCTB 3VS4A 1AB2A 5I6VA 1F2FA 1PICA 1AYBA 1O4GA 2MRJA 2C0TA 3BUXB 2Y1NA 2SHPA 1O48A 2SRCA 4U1PA 1I3ZA 3GXXA 5IBSA 3VRQA 2C9WA 2LQNA 4JE4A 2DLZA 4OHIA 4K2RA 2CS0A 2HCKA 3OVEA 3NHNA 5BO4A 1O4JA 3VS7A 1O41A 1BM2A 1O47A 2ABLA 1QG1E 2BBUA 2DX0A 3GQIB 2CR4A 2PTKA 4JEGA 1BHHA 3BUNB 4F59A 2AOBA 4H34A 1FMKA 3EAZA 1O43A 1UURA 2EU0A 3IMJA 3S8NA 1F1WA 3GXWA 1BLKA 1R1SA 1LUNA 4F5BA 3M7FA 1LUIA 3S8OA 1H9OA 5DF6A 1BFIA 1O4AA 3VGOA 3PJPA 3VS5A 2QMSA 1Y57A 5HKWA 5HKYA 4GPLB 2MK2A 1AOTF 1BFJA 1WQUA 4TZIA 3IN8A 1NZVA 1RQQC 3QWYA 3OB2B 4K11A 2EKXA 1AOUF 1FBVA 3VS6A 2FCIA 4OHEA 3OP0A 3PS5A 3EACA 2KGYA 1BHFA 1GRIA 2L3TA 1A09A 1GHUA 1BF5A 2YU7A 2PLDA 2IUHA 1RPYA 3BUWB 1A1BA 1X27A 3HCKA 2CBLA 3IN7A 2KNOA 1FHSA 3T04A 5J3XA 1HCSB 1A81A 1IJRA 4XZ1A 2GSBA 2PLEA 1Z3KA 2RVFA 1JYRA 2HMHA 1YVLA 4GL9E 2H46E 1QCFA 3UF4A 4XZ0A 1BKLA 2EO3A 2LNWA 2KK6A 1FYRA 3VRNA 1CWDL 2JYQA 3VS0A 1G83A 1FBZA 3BKBA 2EYZA 5EEQA 2L4KA 3VRRA 3MXYA 3K2TA 1CWEA 1JYUA 5KAZA 5CDWA 1SHBA 4K45A 1A1CA 2PNAA 2HUWA 3PQZA 1O4QA 1JU5A 3VS2A 2B3OA 2EYYA 4X6SA 3VRZA 2EL8A 1KA6A 1CJ1A 5AXIA 1JWOA 3BUOB 1SHDA 1MW4A 1TZEE 2HDVA 1D1ZA 2CIAA 4OHHA 1A1AA 3PSJA 1O44A 4JGHA 1X6CA 2IUGA 2AOAA 1O4MA 1O49A 1SPRA 2DM0A 4E68A 1IS0A 1FU5A 2Y3AB 3BUMB 4P9VA 1KSWA 1OO4A 2MQIA 1NRVA 1O4DA 4OHDA 1BHHB 3VROA 3CXLA 3S8LA 1O42A 4FL3A 1B47A 1KA7A 1OPLA 2IUIA 4WWQA 1AYAA 3QWXX 1D4TA 2CI9A 5GJIA 3VRPA 1O4PA 3ZNIA 1A07A 3US4A 1XA6A 1LUKA 4K44A 5EELA 1CSZA 2DLYA 2RSYA 5IBMA 1D4WA 1AD5A 1O4HA 4GWFA 5EG3B 1O4NA 2ETZA 3KFJA 2PNBA 1RJAA 2VIFA 1A1EA 1M61A 1O45A 4M4ZA 4NWFA 1SHAA 1O4KA 1NZLA 2DVJA 4L1BB 3VS3A 1LKKA 2OZOA 2K79B 4LUDA 3VRYA 5GJHA 4DGPA 1ZFPE 4D8KA 4EIHA 4A4BA 3C7IA 1TCEA 1X0NA 1BG1A 2H5KA 4LUEA 2RORA 2MC1A 4U17A 1OPKA 1Y1UA 2IZVA 3MXCA 3MAZA 1LKLA 1LUMA 4DGXA 1LCKA 4FL2A 1UUSA 3K2MA 1BKMA 2LQWA 2YSXA 4FBNA 5DC0B 2CI8A 3HHMB 3LYVA 1P13A 5DC4A 2LNXA 1SKJA 5EHRA 1O4FA 2Y1MA 2EOBA 2EYVA 4F5AA 1M27A 1JYQA 3S9KA 2C0OA 3CWGA 1BMBA 2LRAA 1O4LA 2C0IA 2XP1A 4OHLA 5D0JA 2DCRA 1AYDA 3VS1A 1MILA 3CD3A 1O4BA 2HDXA 1O4RA 3OB1B 2K7AB 4A4CA 2ECDA 4NWGA 1AYCA 4E93A 1O4OA 1O4IA 2EO6A 3WA4A 1FU6A 5AULA 2GE9A 4ROJA 3PFVA 1K9AA 1BLJA 1QADA 2AUGA 2MRKA 5DC9A 1R1QA 4EY0A 1R1PA 3TKZA 1O46A 1SPSA 2FO0A 4P9ZA 2OQ1A 3N8MA 2H8HA 1A08A 3UYOA 1LCJA 1YVHA 3PSKA 3TL0A 2LCTA 4QSYA 3N7YA 2RMXA 1CSYA 1OO3A 5HKZA 1KC2A 2CRHA 3IMDA 3PLFB 5EHPA
chains in the Genus database with same CATH topology
3HIZB 1O4EA 3OV1A 3N84A 1O4CA 2L6KA 4H1OA 3CBLA 1HCTB 3VS4A 1AB2A 5I6VA 1F2FA 1PICA 1AYBA 1O4GA 2MRJA 2C0TA 3BUXB 2Y1NA 2SHPA 1O48A 2SRCA 4U1PA 1I3ZA 3GXXA 5IBSA 3VRQA 2C9WA 2LQNA 4JE4A 2DLZA 4OHIA 4K2RA 2CS0A 2HCKA 3OVEA 3NHNA 5BO4A 1O4JA 3VS7A 1O41A 1BM2A 1O47A 2ABLA 1QG1E 2BBUA 2DX0A 3GQIB 2CR4A 2PTKA 4JEGA 1BHHA 3BUNB 4F59A 2AOBA 4H34A 1FMKA 3EAZA 1O43A 1UURA 2EU0A 3IMJA 3S8NA 1F1WA 3GXWA 1BLKA 1R1SA 1LUNA 4F5BA 3M7FA 1LUIA 3S8OA 1H9OA 5DF6A 1BFIA 1O4AA 3VGOA 3PJPA 3VS5A 2QMSA 1Y57A 5HKWA 5HKYA 4GPLB 2MK2A 1AOTF 1BFJA 1WQUA 4TZIA 3IN8A 1NZVA 1RQQC 3QWYA 3OB2B 4K11A 2EKXA 1AOUF 1FBVA 3VS6A 2FCIA 4OHEA 3OP0A 3PS5A 3EACA 1BHFA 1GRIA 2L3TA 1A09A 1GHUA 1BF5A 2YU7A 2PLDA 2IUHA 1RPYA 3BUWB 1A1BA 1X27A 3HCKA 2CBLA 3IN7A 2KNOA 1FHSA 3T04A 5J3XA 1HCSB 1A81A 1IJRA 4XZ1A 2GSBA 2PLEA 1Z3KA 2RVFA 1JYRA 2HMHA 1YVLA 4GL9E 2H46E 1QCFA 3UF4A 4XZ0A 1BKLA 2EO3A 2LNWA 2KK6A 1FYRA 3VRNA 1CWDL 2JYQA 3VS0A 1G83A 1FBZA 3BKBA 2EYZA 5EEQA 2L4KA 3VRRA 3MXYA 1CWEA 1JYUA 5KAZA 5CDWA 1SHBA 4K45A 1A1CA 2PNAA 2HUWA 3PQZA 1O4QA 1JU5A 3VS2A 2B3OA 2EYYA 4X6SA 3VRZA 2EL8A 1KA6A 1CJ1A 5AXIA 1JWOA 3BUOB 1SHDA 1MW4A 1TZEE 2HDVA 1D1ZA 2CIAA 4OHHA 1A1AA 3PSJA 1O44A 4JGHA 1X6CA 2IUGA 2AOAA 1O4MA 1O49A 1SPRA 2DM0A 4E68A 1IS0A 1FU5A 2Y3AB 3BUMB 4P9VA 1KSWA 1OO4A 2MQIA 1NRVA 1O4DA 4OHDA 1BHHB 3VROA 3CXLA 3S8LA 1O42A 4FL3A 1B47A 1KA7A 1OPLA 2IUIA 4WWQA 1AYAA 3QWXX 1D4TA 2CI9A 5GJIA 3VRPA 1O4PA 3ZNIA 1A07A 3US4A 1XA6A 1LUKA 4K44A 5EELA 1CSZA 2DLYA 2RSYA 5IBMA 1D4WA 1AD5A 1O4HA 4GWFA 5EG3B 1O4NA 2ETZA 3KFJA 2PNBA 1RJAA 2VIFA 1A1EA 1M61A 1O45A 4M4ZA 4NWFA 1SHAA 1O4KA 1NZLA 2DVJA 4L1BB 3VS3A 1LKKA 2OZOA 2K79B 4LUDA 3VRYA 5GJHA 4DGPA 1ZFPE 4D8KA 4EIHA 4A4BA 3C7IA 1TCEA 1X0NA 1BG1A 2H5KA 4LUEA 2RORA 2MC1A 4U17A 1OPKA 1Y1UA 2IZVA 3MXCA 3MAZA 1LKLA 1LUMA 4DGXA 1LCKA 4FL2A 1UUSA 3K2MA 1BKMA 2LQWA 2YSXA 4FBNA 5DC0B 2CI8A 3HHMB 1P13A 5DC4A 2LNXA 1SKJA 5EHRA 1O4FA 2Y1MA 2EOBA 2EYVA 4F5AA 1M27A 1JYQA 3S9KA 2C0OA 3CWGA 1BMBA 1O4LA 2C0IA 2XP1A 4OHLA 5D0JA 2DCRA 1AYDA 3VS1A 1MILA 3CD3A 1O4BA 2HDXA 1O4RA 3OB1B 2K7AB 4A4CA 2ECDA 4NWGA 1AYCA 4E93A 1O4OA 1O4IA 2EO6A 3WA4A 1FU6A 5AULA 2GE9A 4ROJA 3PFVA 1K9AA 1BLJA 1QADA 2AUGA 2MRKA 5DC9A 1R1QA 4EY0A 1R1PA 3TKZA 1O46A 1SPSA 2FO0A 4P9ZA 2OQ1A 3N8MA 2H8HA 1A08A 3UYOA 1LCJA 1YVHA 3PSKA 3TL0A 2LCTA 4QSYA 3N7YA 2RMXA 1CSYA 1OO3A 5HKZA 1KC2A 2CRHA 3IMDA 3PLFB 5EHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIZ B;  1O4E A;  3OV1 A;  3N84 A;  1O4C A;  2L6K A;  4H1O A;  3CBL A;  1HCT B;  3VS4 A;  1AB2 A;  5I6V A;  1F2F A;  1PIC A;  1AYB A;  1O4G A;  2MRJ A;  2C0T A;  3BUX B;  2Y1N A;  2SHP A;  1O48 A;  2SRC A;  4U1P A;  1I3Z A;  3GXX A;  5IBS A;  3VRQ A;  2C9W A;  2LQN A;  4JE4 A;  2DLZ A;  4OHI A;  4K2R A;  2CS0 A;  2HCK A;  3OVE A;  3NHN A;  5BO4 A;  1O4J A;  3VS7 A;  1O41 A;  1BM2 A;  1O47 A;  2ABL A;  1QG1 E;  2BBU A;  2DX0 A;  3GQI B;  2CR4 A;  2PTK A;  4JEG A;  1BHH A;  3BUN B;  4F59 A;  2AOB A;  4H34 A;  1FMK A;  3EAZ A;  1O43 A;  1UUR A;  2EU0 A;  3IMJ A;  3S8N A;  1F1W A;  3GXW A;  1BLK A;  1R1S A;  1LUN A;  4F5B A;  3M7F A;  1LUI A;  3S8O A;  1H9O A;  5DF6 A;  1BFI A;  1O4A A;  3VGO A;  3PJP A;  3VS5 A;  2QMS A;  1Y57 A;  5HKW A;  5HKY A;  4GPL B;  2MK2 A;  1AOT F;  1BFJ A;  1WQU A;  4TZI A;  3IN8 A;  1NZV A;  1RQQ C;  3QWY A;  3OB2 B;  4K11 A;  2EKX A;  1AOU F;  1FBV A;  3VS6 A;  2FCI A;  4OHE A;  3OP0 A;  3PS5 A;  3EAC A;  1BHF A;  1GRI A;  2L3T A;  1A09 A;  1GHU A;  1BF5 A;  2YU7 A;  2PLD A;  2IUH A;  1RPY A;  3BUW B;  1A1B A;  1X27 A;  3HCK A;  2CBL A;  3IN7 A;  2KNO A;  1FHS A;  3T04 A;  5J3X A;  1HCS B;  1A81 A;  1IJR A;  4XZ1 A;  2GSB A;  2PLE A;  1Z3K A;  2RVF A;  1JYR A;  2HMH A;  1YVL A;  4GL9 E;  2H46 E;  1QCF A;  3UF4 A;  4XZ0 A;  1BKL A;  2EO3 A;  2LNW A;  2KK6 A;  1FYR A;  3VRN A;  1CWD L;  2JYQ A;  3VS0 A;  1G83 A;  1FBZ A;  3BKB A;  2EYZ A;  5EEQ A;  2L4K A;  3VRR A;  3MXY A;  1CWE A;  1JYU A;  5KAZ A;  5CDW A;  1SHB A;  4K45 A;  1A1C A;  2PNA A;  2HUW A;  3PQZ A;  1O4Q A;  1JU5 A;  3VS2 A;  2B3O A;  2EYY A;  4X6S A;  3VRZ A;  2EL8 A;  1KA6 A;  1CJ1 A;  5AXI A;  1JWO A;  3BUO B;  1SHD A;  1MW4 A;  1TZE E;  2HDV A;  1D1Z A;  2CIA A;  4OHH A;  1A1A A;  3PSJ A;  1O44 A;  4JGH A;  1X6C A;  2IUG A;  2AOA A;  1O4M A;  1O49 A;  1SPR A;  2DM0 A;  4E68 A;  1IS0 A;  1FU5 A;  2Y3A B;  3BUM B;  4P9V A;  1KSW A;  1OO4 A;  2MQI A;  1NRV A;  1O4D A;  4OHD A;  1BHH B;  3VRO A;  3CXL A;  3S8L A;  1O42 A;  4FL3 A;  1B47 A;  1KA7 A;  1OPL A;  2IUI A;  4WWQ A;  1AYA A;  3QWX X;  1D4T A;  2CI9 A;  5GJI A;  3VRP A;  1O4P A;  3ZNI A;  1A07 A;  3US4 A;  1XA6 A;  1LUK A;  4K44 A;  5EEL A;  1CSZ A;  2DLY A;  2RSY A;  5IBM A;  1D4W A;  1AD5 A;  1O4H A;  4GWF A;  5EG3 B;  1O4N A;  2ETZ A;  3KFJ A;  2PNB A;  1RJA A;  2VIF A;  1A1E A;  1M61 A;  1O45 A;  4M4Z A;  4NWF A;  1SHA A;  1O4K A;  1NZL A;  2DVJ A;  4L1B B;  3VS3 A;  1LKK A;  2OZO A;  2K79 B;  4LUD A;  3VRY A;  5GJH A;  4DGP A;  1ZFP E;  4D8K A;  4EIH A;  4A4B A;  3C7I A;  1TCE A;  1X0N A;  1BG1 A;  2H5K A;  4LUE A;  2ROR A;  2MC1 A;  4U17 A;  1OPK A;  1Y1U A;  2IZV A;  3MXC A;  3MAZ A;  1LKL A;  1LUM A;  4DGX A;  1LCK A;  4FL2 A;  1UUS A;  3K2M A;  1BKM A;  2LQW A;  2YSX A;  4FBN A;  5DC0 B;  2CI8 A;  3HHM B;  1P13 A;  5DC4 A;  2LNX A;  1SKJ A;  5EHR A;  1O4F A;  2Y1M A;  2EOB A;  2EYV A;  4F5A A;  1M27 A;  1JYQ A;  3S9K A;  2C0O A;  3CWG A;  1BMB A;  1O4L A;  2C0I A;  2XP1 A;  4OHL A;  5D0J A;  2DCR A;  1AYD A;  3VS1 A;  1MIL A;  3CD3 A;  1O4B A;  2HDX A;  1O4R A;  3OB1 B;  2K7A B;  4A4C A;  2ECD A;  4NWG A;  1AYC A;  4E93 A;  1O4O A;  1O4I A;  2EO6 A;  3WA4 A;  1FU6 A;  5AUL A;  2GE9 A;  4ROJ A;  3PFV A;  1K9A A;  1BLJ A;  1QAD A;  2AUG A;  2MRK A;  5DC9 A;  1R1Q A;  4EY0 A;  1R1P A;  3TKZ A;  1O46 A;  1SPS A;  2FO0 A;  4P9Z A;  2OQ1 A;  3N8M A;  2H8H A;  1A08 A;  3UYO A;  1LCJ A;  1YVH A;  3PSK A;  3TL0 A;  2LCT A;  4QSY A;  3N7Y A;  2RMX A;  1CSY A;  1OO3 A;  5HKZ A;  1KC2 A;  2CRH A;  3IMD A;  3PLF B;  5EHP A; 
#chains in the Genus database with same CATH topology
 3HIZ B;  1O4E A;  3OV1 A;  3N84 A;  1O4C A;  2L6K A;  4H1O A;  3CBL A;  1HCT B;  3VS4 A;  1AB2 A;  5I6V A;  1F2F A;  1PIC A;  1AYB A;  1O4G A;  2MRJ A;  2C0T A;  3BUX B;  2Y1N A;  2SHP A;  1O48 A;  2SRC A;  4U1P A;  1I3Z A;  3GXX A;  5IBS A;  3VRQ A;  2C9W A;  2LQN A;  4JE4 A;  2DLZ A;  4OHI A;  4K2R A;  2CS0 A;  2HCK A;  3OVE A;  3NHN A;  5BO4 A;  1O4J A;  3VS7 A;  1O41 A;  1BM2 A;  1O47 A;  2ABL A;  1QG1 E;  2BBU A;  2DX0 A;  3GQI B;  2CR4 A;  2PTK A;  4JEG A;  1BHH A;  3BUN B;  4F59 A;  2AOB A;  4H34 A;  1FMK A;  3EAZ A;  1O43 A;  1UUR A;  2EU0 A;  3IMJ A;  3S8N A;  1F1W A;  3GXW A;  1BLK A;  1R1S A;  1LUN A;  4F5B A;  3M7F A;  1LUI A;  3S8O A;  1H9O A;  5DF6 A;  1BFI A;  1O4A A;  3VGO A;  3PJP A;  3VS5 A;  2QMS A;  1Y57 A;  5HKW A;  5HKY A;  4GPL B;  2MK2 A;  1AOT F;  1BFJ A;  1WQU A;  4TZI A;  3IN8 A;  1NZV A;  1RQQ C;  3QWY A;  3OB2 B;  4K11 A;  2EKX A;  1AOU F;  1FBV A;  3VS6 A;  2FCI A;  4OHE A;  3OP0 A;  3PS5 A;  3EAC A;  2KGY A;  1BHF A;  1GRI A;  2L3T A;  1A09 A;  1GHU A;  1BF5 A;  2YU7 A;  2PLD A;  2IUH A;  1RPY A;  3BUW B;  1A1B A;  1X27 A;  3HCK A;  2CBL A;  3IN7 A;  2KNO A;  1FHS A;  3T04 A;  5J3X A;  1HCS B;  1A81 A;  1IJR A;  4XZ1 A;  2GSB A;  2PLE A;  1Z3K A;  2RVF A;  1JYR A;  2HMH A;  1YVL A;  4GL9 E;  2H46 E;  1QCF A;  3UF4 A;  4XZ0 A;  1BKL A;  2EO3 A;  2LNW A;  2KK6 A;  1FYR A;  3VRN A;  1CWD L;  2JYQ A;  3VS0 A;  1G83 A;  1FBZ A;  3BKB A;  2EYZ A;  5EEQ A;  2L4K A;  3VRR A;  3MXY A;  3K2T A;  1CWE A;  1JYU A;  5KAZ A;  5CDW A;  1SHB A;  4K45 A;  1A1C A;  2PNA A;  2HUW A;  3PQZ A;  1O4Q A;  1JU5 A;  3VS2 A;  2B3O A;  2EYY A;  4X6S A;  3VRZ A;  2EL8 A;  1KA6 A;  1CJ1 A;  5AXI A;  1JWO A;  3BUO B;  1SHD A;  1MW4 A;  1TZE E;  2HDV A;  1D1Z A;  2CIA A;  4OHH A;  1A1A A;  3PSJ A;  1O44 A;  4JGH A;  1X6C A;  2IUG A;  2AOA A;  1O4M A;  1O49 A;  1SPR A;  2DM0 A;  4E68 A;  1IS0 A;  1FU5 A;  2Y3A B;  3BUM B;  4P9V A;  1KSW A;  1OO4 A;  2MQI A;  1NRV A;  1O4D A;  4OHD A;  1BHH B;  3VRO A;  3CXL A;  3S8L A;  1O42 A;  4FL3 A;  1B47 A;  1KA7 A;  1OPL A;  2IUI A;  4WWQ A;  1AYA A;  3QWX X;  1D4T A;  2CI9 A;  5GJI A;  3VRP A;  1O4P A;  3ZNI A;  1A07 A;  3US4 A;  1XA6 A;  1LUK A;  4K44 A;  5EEL A;  1CSZ A;  2DLY A;  2RSY A;  5IBM A;  1D4W A;  1AD5 A;  1O4H A;  4GWF A;  5EG3 B;  1O4N A;  2ETZ A;  3KFJ A;  2PNB A;  1RJA A;  2VIF A;  1A1E A;  1M61 A;  1O45 A;  4M4Z A;  4NWF A;  1SHA A;  1O4K A;  1NZL A;  2DVJ A;  4L1B B;  3VS3 A;  1LKK A;  2OZO A;  2K79 B;  4LUD A;  3VRY A;  5GJH A;  4DGP A;  1ZFP E;  4D8K A;  4EIH A;  4A4B A;  3C7I A;  1TCE A;  1X0N A;  1BG1 A;  2H5K A;  4LUE A;  2ROR A;  2MC1 A;  4U17 A;  1OPK A;  1Y1U A;  2IZV A;  3MXC A;  3MAZ A;  1LKL A;  1LUM A;  4DGX A;  1LCK A;  4FL2 A;  1UUS A;  3K2M A;  1BKM A;  2LQW A;  2YSX A;  4FBN A;  5DC0 B;  2CI8 A;  3HHM B;  3LYV A;  1P13 A;  5DC4 A;  2LNX A;  1SKJ A;  5EHR A;  1O4F A;  2Y1M A;  2EOB A;  2EYV A;  4F5A A;  1M27 A;  1JYQ A;  3S9K A;  2C0O A;  3CWG A;  1BMB A;  2LRA A;  1O4L A;  2C0I A;  2XP1 A;  4OHL A;  5D0J A;  2DCR A;  1AYD A;  3VS1 A;  1MIL A;  3CD3 A;  1O4B A;  2HDX A;  1O4R A;  3OB1 B;  2K7A B;  4A4C A;  2ECD A;  4NWG A;  1AYC A;  4E93 A;  1O4O A;  1O4I A;  2EO6 A;  3WA4 A;  1FU6 A;  5AUL A;  2GE9 A;  4ROJ A;  3PFV A;  1K9A A;  1BLJ A;  1QAD A;  2AUG A;  2MRK A;  5DC9 A;  1R1Q A;  4EY0 A;  1R1P A;  3TKZ A;  1O46 A;  1SPS A;  2FO0 A;  4P9Z A;  2OQ1 A;  3N8M A;  2H8H A;  1A08 A;  3UYO A;  1LCJ A;  1YVH A;  3PSK A;  3TL0 A;  2LCT A;  4QSY A;  3N7Y A;  2RMX A;  1CSY A;  1OO3 A;  5HKZ A;  1KC2 A;  2CRH A;  3IMD A;  3PLF B;  5EHP A; 
#chains in the Genus database with same CATH homology
 3HIZ B;  1O4E A;  3OV1 A;  3N84 A;  1O4C A;  2L6K A;  4H1O A;  3CBL A;  1HCT B;  3VS4 A;  1AB2 A;  5I6V A;  1F2F A;  1PIC A;  1AYB A;  1O4G A;  2MRJ A;  2C0T A;  3BUX B;  2Y1N A;  2SHP A;  1O48 A;  2SRC A;  4U1P A;  1I3Z A;  3GXX A;  5IBS A;  3VRQ A;  2C9W A;  2LQN A;  4JE4 A;  2DLZ A;  4OHI A;  4K2R A;  2CS0 A;  2HCK A;  3OVE A;  3NHN A;  5BO4 A;  1O4J A;  3VS7 A;  1O41 A;  1BM2 A;  1O47 A;  2ABL A;  1QG1 E;  2BBU A;  2DX0 A;  3GQI B;  2CR4 A;  2PTK A;  4JEG A;  1BHH A;  3BUN B;  4F59 A;  2AOB A;  4H34 A;  1FMK A;  3EAZ A;  1O43 A;  1UUR A;  2EU0 A;  3IMJ A;  3S8N A;  1F1W A;  3GXW A;  1BLK A;  1R1S A;  1LUN A;  4F5B A;  3M7F A;  1LUI A;  3S8O A;  1H9O A;  5DF6 A;  1BFI A;  1O4A A;  3VGO A;  3PJP A;  3VS5 A;  2QMS A;  1Y57 A;  5HKW A;  5HKY A;  4GPL B;  2MK2 A;  1AOT F;  1BFJ A;  1WQU A;  4TZI A;  3IN8 A;  1NZV A;  1RQQ C;  3QWY A;  3OB2 B;  4K11 A;  2EKX A;  1AOU F;  1FBV A;  3VS6 A;  2FCI A;  4OHE A;  3OP0 A;  3PS5 A;  3EAC A;  1BHF A;  1GRI A;  2L3T A;  1A09 A;  1GHU A;  1BF5 A;  2YU7 A;  2PLD A;  2IUH A;  1RPY A;  3BUW B;  1A1B A;  1X27 A;  3HCK A;  2CBL A;  3IN7 A;  2KNO A;  1FHS A;  3T04 A;  5J3X A;  1HCS B;  1A81 A;  1IJR A;  4XZ1 A;  2GSB A;  2PLE A;  1Z3K A;  2RVF A;  1JYR A;  2HMH A;  1YVL A;  4GL9 E;  2H46 E;  1QCF A;  3UF4 A;  4XZ0 A;  1BKL A;  2EO3 A;  2LNW A;  2KK6 A;  1FYR A;  3VRN A;  1CWD L;  2JYQ A;  3VS0 A;  1G83 A;  1FBZ A;  3BKB A;  2EYZ A;  5EEQ A;  2L4K A;  3VRR A;  3MXY A;  1CWE A;  1JYU A;  5KAZ A;  5CDW A;  1SHB A;  4K45 A;  1A1C A;  2PNA A;  2HUW A;  3PQZ A;  1O4Q A;  1JU5 A;  3VS2 A;  2B3O A;  2EYY A;  4X6S A;  3VRZ A;  2EL8 A;  1KA6 A;  1CJ1 A;  5AXI A;  1JWO A;  3BUO B;  1SHD A;  1MW4 A;  1TZE E;  2HDV A;  1D1Z A;  2CIA A;  4OHH A;  1A1A A;  3PSJ A;  1O44 A;  4JGH A;  1X6C A;  2IUG A;  2AOA A;  1O4M A;  1O49 A;  1SPR A;  2DM0 A;  4E68 A;  1IS0 A;  1FU5 A;  2Y3A B;  3BUM B;  4P9V A;  1KSW A;  1OO4 A;  2MQI A;  1NRV A;  1O4D A;  4OHD A;  1BHH B;  3VRO A;  3CXL A;  3S8L A;  1O42 A;  4FL3 A;  1B47 A;  1KA7 A;  1OPL A;  2IUI A;  4WWQ A;  1AYA A;  3QWX X;  1D4T A;  2CI9 A;  5GJI A;  3VRP A;  1O4P A;  3ZNI A;  1A07 A;  3US4 A;  1XA6 A;  1LUK A;  4K44 A;  5EEL A;  1CSZ A;  2DLY A;  2RSY A;  5IBM A;  1D4W A;  1AD5 A;  1O4H A;  4GWF A;  5EG3 B;  1O4N A;  2ETZ A;  3KFJ A;  2PNB A;  1RJA A;  2VIF A;  1A1E A;  1M61 A;  1O45 A;  4M4Z A;  4NWF A;  1SHA A;  1O4K A;  1NZL A;  2DVJ A;  4L1B B;  3VS3 A;  1LKK A;  2OZO A;  2K79 B;  4LUD A;  3VRY A;  5GJH A;  4DGP A;  1ZFP E;  4D8K A;  4EIH A;  4A4B A;  3C7I A;  1TCE A;  1X0N A;  1BG1 A;  2H5K A;  4LUE A;  2ROR A;  2MC1 A;  4U17 A;  1OPK A;  1Y1U A;  2IZV A;  3MXC A;  3MAZ A;  1LKL A;  1LUM A;  4DGX A;  1LCK A;  4FL2 A;  1UUS A;  3K2M A;  1BKM A;  2LQW A;  2YSX A;  4FBN A;  5DC0 B;  2CI8 A;  3HHM B;  1P13 A;  5DC4 A;  2LNX A;  1SKJ A;  5EHR A;  1O4F A;  2Y1M A;  2EOB A;  2EYV A;  4F5A A;  1M27 A;  1JYQ A;  3S9K A;  2C0O A;  3CWG A;  1BMB A;  1O4L A;  2C0I A;  2XP1 A;  4OHL A;  5D0J A;  2DCR A;  1AYD A;  3VS1 A;  1MIL A;  3CD3 A;  1O4B A;  2HDX A;  1O4R A;  3OB1 B;  2K7A B;  4A4C A;  2ECD A;  4NWG A;  1AYC A;  4E93 A;  1O4O A;  1O4I A;  2EO6 A;  3WA4 A;  1FU6 A;  5AUL A;  2GE9 A;  4ROJ A;  3PFV A;  1K9A A;  1BLJ A;  1QAD A;  2AUG A;  2MRK A;  5DC9 A;  1R1Q A;  4EY0 A;  1R1P A;  3TKZ A;  1O46 A;  1SPS A;  2FO0 A;  4P9Z A;  2OQ1 A;  3N8M A;  2H8H A;  1A08 A;  3UYO A;  1LCJ A;  1YVH A;  3PSK A;  3TL0 A;  2LCT A;  4QSY A;  3N7Y A;  2RMX A;  1CSY A;  1OO3 A;  5HKZ A;  1KC2 A;  2CRH A;  3IMD A;  3PLF B;  5EHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...