1SKJA

Cocrystal structure of urea-substituted phosphopeptide complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
b'EEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PP60 V-SRC TYROSINE KINASE TRANSFORMING PROTEIN
publication title Design, synthesis, and cocrystal structure of a nonpeptide Src SH2 domain ligand.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Tyrosine-protein kinase
total genus 28
structure length 102
sequence length 102
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1skjA00
4OHHA 4ROJA 4XZ0A 1IJRA 1UURA 5DC4A 4A4CA 1RJAA 1BMBA 2C0OA 4OHDA 5I6VA 3VS0A 2CRHA 2L3TA 1BHFA 1AYBA 4P9ZA 2H8HA 2H46E 3S9KA 2MC1A 1O4AA 2L6KA 1O4CA 4FL3A 1BHHA 2ETZA 4E68A 2IZVA 2C9WA 1G83A 1R1PA 1O42A 1KSWA 4H34A 5J3XA 1SPRA 1B47A 2AOBA 2EKXA 3CXLA 1HCSB 1JWOA 1RQQC 4WWQA 2KK6A 3QWYA 1BHHB 3N8MA 4K45A 3EACA 2VIFA 2DX0A 2LCTA 2PNAA 1X6CA 1O4HA 2BBUA 5BO4A 3VRPA 1O4LA 1AYCA 2AOAA 1O4FA 4QSYA 1AB2A 4P9VA 5HKWA 3VGOA 3PS5A 5DC0B 4U17A 1O4KA 2YU7A 1F2FA 3OVEA 1R1SA 1NRVA 1LCKA 1OO3A 2DLZA 2PTKA 1GHUA 3N7YA 3IMJA 1LUIA 3OP0A 2LNXA 2ABLA 1H9OA 2EL8A 3VS1A 1BLKA 3BUWB 1A08A 3S8LA 3VS2A 2CI9A 3PFVA 1K9AA 1BG1A 4D8KA 2LQNA 3OB1B 3VS6A 3VRRA 1A1CA 2MRJA 1R1QA 3M7FA 1O47A 1OPLA 2MK2A 1NZVA 3US4A 2LNWA 2RVFA 4GPLB 5HKYA 1O4QA 1RPYA 3BUOB 4LUEA 2CIAA 2Y3AB 1O4MA 3EAZA 1O4OA 1CWEA 1NZLA 3CD3A 2QMSA 1LUMA 1SHBA 1FBVA 3VRZA 5IBMA 2CS0A 4OHIA 4X6SA 1A1BA 2IUHA 3IN7A 2EO3A 3PJPA 2FCIA 2PLEA 4E93A 1O4DA 2CBLA 2HDXA 5DF6A 5EELA 3QWXX 3GQIB 1SKJA 2DM0A 2DVJA 1P13A 1QCFA 1LCJA 2YSXA 2RMXA 3TL0A 1MILA 3CWGA 1O46A 2GE9A 4LUDA 2XP1A 1O4BA 2H5KA 3OB2B 4JGHA 1D1ZA 4XZ1A 1QADA 4F5BA 1O43A 3IN8A 1SPSA 1A09A 5CDWA 2EOBA 1LKKA 2AUGA 3S8NA 4OHLA 2EO6A 5AXIA 2JYQA 3GXWA 2OZOA 5KAZA 4U1PA 2ECDA 3PSKA 2K7AB 5EG3B 1AOUF 1LUNA 1BKMA 3WA4A 1AOTF 1JYRA 4NWFA 1A07A 1OO4A 4FL2A 1O48A 1A81A 1Y1UA 2EYVA 4M4ZA 3VRNA 1LKLA 4FBNA 2DCRA 1MW4A 1LUKA 1CSYA 2FO0A 1UUSA 2HDVA 1BLJA 2OQ1A 1FYRA 3UYOA 2RORA 2EYYA 5DC9A 1A1EA 3UF4A 1Z3KA 4NWGA 3BUXB 1JU5A 2Y1MA 1BF5A 1FMKA 5GJHA 4F59A 1AYAA 1O4GA 4EY0A 3VROA 3K2MA 1CSZA 1KA6A 1TZEE 1KC2A 1YVHA 5HKZA 3BUMB 1O4RA 1Y57A 3NHNA 1O4PA 1BKLA 3VS5A 3HIZB 2DLYA 3MXCA 1X27A 3PQZA 1BM2A 3IMDA 1CWDL 1JYQA 3OV1A 1BFJA 3BUNB 5EHRA 1BFIA 1M61A 1AD5A 1O44A 3VS4A 1FU5A 1M27A 2HMHA 2RSYA 1SHDA 3CBLA 4DGPA 5EHPA 4GL9E 1WQUA 3BKBA 4H1OA 1TCEA 1HCTB 3MAZA 2B3OA 3KFJA 2HUWA 3MXYA 2Y1NA 1FHSA 2IUIA 5AULA 2SRCA 3HHMB 3PLFB 4DGXA 1GRIA 2C0IA 1FU6A 1O4NA 2EYZA 2MQIA 4EIHA 3HCKA 2L4KA 1A1AA 1QG1E 2PLDA 4K44A 5EEQA 4L1BB 1YVLA 4TZIA 4OHEA 1I3ZA 4F5AA 5D0JA 5GJIA 2KNOA 3C7IA 2EU0A 2IUGA 1F1WA 2C0TA 1PICA 3PSJA 3S8OA 1CJ1A 2SHPA 4GWFA 3N84A 1XA6A 1O41A 2PNBA 2CR4A 1O4JA 1SHAA 3ZNIA 4K11A 1O4IA 2K79B 1D4TA 4K2RA 1IS0A 4A4BA 1OPKA 1O49A 2HCKA 1D4WA 4JE4A 2MRKA 3VRQA 3TKZA 1KA7A 2GSBA 1ZFPE 4JEGA 1FBZA 1X0NA 1JYUA 3T04A 3VRYA 1O45A 2CI8A 1O4EA 3VS7A 2LQWA 1AYDA 3GXXA 3VS3A 5IBSA
chains in the Genus database with same CATH superfamily
2KGYA 4OHHA 4ROJA 4XZ0A 1IJRA 1UURA 5DC4A 4A4CA 1RJAA 1BMBA 2C0OA 4OHDA 5I6VA 3VS0A 3K2TA 2CRHA 2L3TA 1BHFA 1AYBA 4P9ZA 2H8HA 2H46E 3S9KA 2MC1A 1O4AA 2L6KA 1O4CA 4FL3A 1BHHA 2ETZA 4E68A 2IZVA 2C9WA 1G83A 1R1PA 1O42A 1KSWA 4H34A 5J3XA 1SPRA 1B47A 2AOBA 2EKXA 3CXLA 1HCSB 1JWOA 1RQQC 4WWQA 2KK6A 3QWYA 1BHHB 3N8MA 4K45A 3EACA 2VIFA 2DX0A 2LCTA 2PNAA 1X6CA 1O4HA 2BBUA 5BO4A 3VRPA 1O4LA 1AYCA 2AOAA 1O4FA 4QSYA 1AB2A 4P9VA 5HKWA 3VGOA 3PS5A 5DC0B 4U17A 1O4KA 2YU7A 1F2FA 3OVEA 1R1SA 1NRVA 1LCKA 1OO3A 2DLZA 2PTKA 1GHUA 3N7YA 3IMJA 1LUIA 3OP0A 2LNXA 2ABLA 1H9OA 2EL8A 3VS1A 1BLKA 3BUWB 1A08A 3S8LA 3VS2A 2CI9A 3PFVA 1K9AA 1BG1A 4D8KA 2LQNA 3OB1B 3VS6A 3VRRA 1A1CA 2MRJA 1R1QA 3M7FA 1O47A 1OPLA 2MK2A 1NZVA 3US4A 2LNWA 2RVFA 4GPLB 5HKYA 1O4QA 1RPYA 3BUOB 4LUEA 2CIAA 2Y3AB 1O4MA 3EAZA 1O4OA 1CWEA 1NZLA 3CD3A 2QMSA 1LUMA 1SHBA 1FBVA 3VRZA 5IBMA 2CS0A 4OHIA 4X6SA 1A1BA 2IUHA 3IN7A 2EO3A 3PJPA 2FCIA 2PLEA 4E93A 1O4DA 2CBLA 2HDXA 5DF6A 5EELA 3QWXX 3GQIB 1SKJA 2DM0A 2DVJA 1P13A 1QCFA 1LCJA 2YSXA 2RMXA 3TL0A 1MILA 3CWGA 1O46A 2GE9A 4LUDA 2XP1A 1O4BA 2H5KA 3OB2B 4JGHA 1D1ZA 4XZ1A 1QADA 4F5BA 1O43A 3IN8A 1SPSA 1A09A 5CDWA 2EOBA 1LKKA 2AUGA 3S8NA 4OHLA 2EO6A 5AXIA 2JYQA 3GXWA 2OZOA 5KAZA 4U1PA 2ECDA 3PSKA 2K7AB 5EG3B 1AOUF 1LUNA 1BKMA 3WA4A 1AOTF 1JYRA 4NWFA 1A07A 1OO4A 4FL2A 1O48A 1A81A 1Y1UA 2EYVA 4M4ZA 3VRNA 1LKLA 4FBNA 2DCRA 1MW4A 1LUKA 1CSYA 2FO0A 1UUSA 2HDVA 1BLJA 2OQ1A 1FYRA 3UYOA 2RORA 2EYYA 5DC9A 1A1EA 3UF4A 1Z3KA 4NWGA 3BUXB 1JU5A 2Y1MA 1BF5A 1FMKA 5GJHA 4F59A 1AYAA 1O4GA 4EY0A 3VROA 3K2MA 1CSZA 1KA6A 1TZEE 1KC2A 1YVHA 5HKZA 3LYVA 3BUMB 1O4RA 1Y57A 3NHNA 1O4PA 1BKLA 3VS5A 3HIZB 2DLYA 3MXCA 1X27A 3PQZA 1BM2A 3IMDA 1CWDL 1JYQA 3OV1A 1BFJA 3BUNB 5EHRA 1BFIA 1M61A 1AD5A 1O44A 3VS4A 1FU5A 1M27A 2HMHA 2RSYA 1SHDA 3CBLA 4DGPA 5EHPA 4GL9E 1WQUA 3BKBA 4H1OA 1TCEA 1HCTB 3MAZA 2B3OA 2LRAA 3KFJA 2HUWA 3MXYA 2Y1NA 1FHSA 2IUIA 5AULA 2SRCA 3HHMB 3PLFB 4DGXA 1GRIA 2C0IA 1FU6A 1O4NA 2EYZA 2MQIA 4EIHA 3HCKA 2L4KA 1A1AA 1QG1E 2PLDA 4K44A 5EEQA 4L1BB 1YVLA 4TZIA 4OHEA 1I3ZA 4F5AA 5D0JA 5GJIA 2KNOA 3C7IA 2EU0A 2IUGA 1F1WA 2C0TA 1PICA 3PSJA 3S8OA 1CJ1A 2SHPA 4GWFA 3N84A 1XA6A 1O41A 2PNBA 2CR4A 1O4JA 1SHAA 3ZNIA 4K11A 1O4IA 2K79B 1D4TA 4K2RA 1IS0A 4A4BA 1OPKA 1O49A 2HCKA 1D4WA 4JE4A 2MRKA 3VRQA 3TKZA 1KA7A 2GSBA 1ZFPE 4JEGA 1FBZA 1X0NA 1JYUA 3T04A 3VRYA 1O45A 2CI8A 1O4EA 3VS7A 2LQWA 1AYDA 3GXXA 3VS3A 5IBSA
chains in the Genus database with same CATH topology
4OHHA 4ROJA 4XZ0A 1IJRA 1UURA 5DC4A 4A4CA 1RJAA 1BMBA 2C0OA 4OHDA 5I6VA 3VS0A 2CRHA 2L3TA 1BHFA 1AYBA 4P9ZA 2H8HA 2H46E 3S9KA 2MC1A 1O4AA 2L6KA 1O4CA 4FL3A 1BHHA 2ETZA 4E68A 2IZVA 2C9WA 1G83A 1R1PA 1O42A 1KSWA 4H34A 5J3XA 1SPRA 1B47A 2AOBA 2EKXA 3CXLA 1HCSB 1JWOA 1RQQC 4WWQA 2KK6A 3QWYA 1BHHB 3N8MA 4K45A 3EACA 2VIFA 2DX0A 2LCTA 2PNAA 1X6CA 1O4HA 2BBUA 5BO4A 3VRPA 1O4LA 1AYCA 2AOAA 1O4FA 4QSYA 1AB2A 4P9VA 5HKWA 3VGOA 3PS5A 5DC0B 4U17A 1O4KA 2YU7A 1F2FA 3OVEA 1R1SA 1NRVA 1LCKA 1OO3A 2DLZA 2PTKA 1GHUA 3N7YA 3IMJA 1LUIA 3OP0A 2LNXA 2ABLA 1H9OA 2EL8A 3VS1A 1BLKA 3BUWB 1A08A 3S8LA 3VS2A 2CI9A 3PFVA 1K9AA 1BG1A 4D8KA 2LQNA 3OB1B 3VS6A 3VRRA 1A1CA 2MRJA 1R1QA 3M7FA 1O47A 1OPLA 2MK2A 1NZVA 3US4A 2LNWA 2RVFA 4GPLB 5HKYA 1O4QA 1RPYA 3BUOB 4LUEA 2CIAA 2Y3AB 1O4MA 3EAZA 1O4OA 1CWEA 1NZLA 3CD3A 2QMSA 1LUMA 1SHBA 1FBVA 3VRZA 5IBMA 2CS0A 4OHIA 4X6SA 1A1BA 2IUHA 3IN7A 2EO3A 3PJPA 2FCIA 2PLEA 4E93A 1O4DA 2CBLA 2HDXA 5DF6A 5EELA 3QWXX 3GQIB 1SKJA 2DM0A 2DVJA 1P13A 1QCFA 1LCJA 2YSXA 2RMXA 3TL0A 1MILA 3CWGA 1O46A 2GE9A 4LUDA 2XP1A 1O4BA 2H5KA 3OB2B 4JGHA 1D1ZA 4XZ1A 1QADA 4F5BA 1O43A 3IN8A 1SPSA 1A09A 5CDWA 2EOBA 1LKKA 2AUGA 3S8NA 4OHLA 2EO6A 5AXIA 2JYQA 3GXWA 2OZOA 5KAZA 4U1PA 2ECDA 3PSKA 2K7AB 5EG3B 1AOUF 1LUNA 1BKMA 3WA4A 1AOTF 1JYRA 4NWFA 1A07A 1OO4A 4FL2A 1O48A 1A81A 1Y1UA 2EYVA 4M4ZA 3VRNA 1LKLA 4FBNA 2DCRA 1MW4A 1LUKA 1CSYA 2FO0A 1UUSA 2HDVA 1BLJA 2OQ1A 1FYRA 3UYOA 2RORA 2EYYA 5DC9A 1A1EA 3UF4A 1Z3KA 4NWGA 3BUXB 1JU5A 2Y1MA 1BF5A 1FMKA 5GJHA 4F59A 1AYAA 1O4GA 4EY0A 3VROA 3K2MA 1CSZA 1KA6A 1TZEE 1KC2A 1YVHA 5HKZA 3BUMB 1O4RA 1Y57A 3NHNA 1O4PA 1BKLA 3VS5A 3HIZB 2DLYA 3MXCA 1X27A 3PQZA 1BM2A 3IMDA 1CWDL 1JYQA 3OV1A 1BFJA 3BUNB 5EHRA 1BFIA 1M61A 1AD5A 1O44A 3VS4A 1FU5A 1M27A 2HMHA 2RSYA 1SHDA 3CBLA 4DGPA 5EHPA 4GL9E 1WQUA 3BKBA 4H1OA 1TCEA 1HCTB 3MAZA 2B3OA 3KFJA 2HUWA 3MXYA 2Y1NA 1FHSA 2IUIA 5AULA 2SRCA 3HHMB 3PLFB 4DGXA 1GRIA 2C0IA 1FU6A 1O4NA 2EYZA 2MQIA 4EIHA 3HCKA 2L4KA 1A1AA 1QG1E 2PLDA 4K44A 5EEQA 4L1BB 1YVLA 4TZIA 4OHEA 1I3ZA 4F5AA 5D0JA 5GJIA 2KNOA 3C7IA 2EU0A 2IUGA 1F1WA 2C0TA 1PICA 3PSJA 3S8OA 1CJ1A 2SHPA 4GWFA 3N84A 1XA6A 1O41A 2PNBA 2CR4A 1O4JA 1SHAA 3ZNIA 4K11A 1O4IA 2K79B 1D4TA 4K2RA 1IS0A 4A4BA 1OPKA 1O49A 2HCKA 1D4WA 4JE4A 2MRKA 3VRQA 3TKZA 1KA7A 2GSBA 1ZFPE 4JEGA 1FBZA 1X0NA 1JYUA 3T04A 3VRYA 1O45A 2CI8A 1O4EA 3VS7A 2LQWA 1AYDA 3GXXA 3VS3A 5IBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OHH A;  4ROJ A;  4XZ0 A;  1IJR A;  1UUR A;  5DC4 A;  4A4C A;  1RJA A;  1BMB A;  2C0O A;  4OHD A;  5I6V A;  3VS0 A;  2CRH A;  2L3T A;  1BHF A;  1AYB A;  4P9Z A;  2H8H A;  2H46 E;  3S9K A;  2MC1 A;  1O4A A;  2L6K A;  1O4C A;  4FL3 A;  1BHH A;  2ETZ A;  4E68 A;  2IZV A;  2C9W A;  1G83 A;  1R1P A;  1O42 A;  1KSW A;  4H34 A;  5J3X A;  1SPR A;  1B47 A;  2AOB A;  2EKX A;  3CXL A;  1HCS B;  1JWO A;  1RQQ C;  4WWQ A;  2KK6 A;  3QWY A;  1BHH B;  3N8M A;  4K45 A;  3EAC A;  2VIF A;  2DX0 A;  2LCT A;  2PNA A;  1X6C A;  1O4H A;  2BBU A;  5BO4 A;  3VRP A;  1O4L A;  1AYC A;  2AOA A;  1O4F A;  4QSY A;  1AB2 A;  4P9V A;  5HKW A;  3VGO A;  3PS5 A;  5DC0 B;  4U17 A;  1O4K A;  2YU7 A;  1F2F A;  3OVE A;  1R1S A;  1NRV A;  1LCK A;  1OO3 A;  2DLZ A;  2PTK A;  1GHU A;  3N7Y A;  3IMJ A;  1LUI A;  3OP0 A;  2LNX A;  2ABL A;  1H9O A;  2EL8 A;  3VS1 A;  1BLK A;  3BUW B;  1A08 A;  3S8L A;  3VS2 A;  2CI9 A;  3PFV A;  1K9A A;  1BG1 A;  4D8K A;  2LQN A;  3OB1 B;  3VS6 A;  3VRR A;  1A1C A;  2MRJ A;  1R1Q A;  3M7F A;  1O47 A;  1OPL A;  2MK2 A;  1NZV A;  3US4 A;  2LNW A;  2RVF A;  4GPL B;  5HKY A;  1O4Q A;  1RPY A;  3BUO B;  4LUE A;  2CIA A;  2Y3A B;  1O4M A;  3EAZ A;  1O4O A;  1CWE A;  1NZL A;  3CD3 A;  2QMS A;  1LUM A;  1SHB A;  1FBV A;  3VRZ A;  5IBM A;  2CS0 A;  4OHI A;  4X6S A;  1A1B A;  2IUH A;  3IN7 A;  2EO3 A;  3PJP A;  2FCI A;  2PLE A;  4E93 A;  1O4D A;  2CBL A;  2HDX A;  5DF6 A;  5EEL A;  3QWX X;  3GQI B;  1SKJ A;  2DM0 A;  2DVJ A;  1P13 A;  1QCF A;  1LCJ A;  2YSX A;  2RMX A;  3TL0 A;  1MIL A;  3CWG A;  1O46 A;  2GE9 A;  4LUD A;  2XP1 A;  1O4B A;  2H5K A;  3OB2 B;  4JGH A;  1D1Z A;  4XZ1 A;  1QAD A;  4F5B A;  1O43 A;  3IN8 A;  1SPS A;  1A09 A;  5CDW A;  2EOB A;  1LKK A;  2AUG A;  3S8N A;  4OHL A;  2EO6 A;  5AXI A;  2JYQ A;  3GXW A;  2OZO A;  5KAZ A;  4U1P A;  2ECD A;  3PSK A;  2K7A B;  5EG3 B;  1AOU F;  1LUN A;  1BKM A;  3WA4 A;  1AOT F;  1JYR A;  4NWF A;  1A07 A;  1OO4 A;  4FL2 A;  1O48 A;  1A81 A;  1Y1U A;  2EYV A;  4M4Z A;  3VRN A;  1LKL A;  4FBN A;  2DCR A;  1MW4 A;  1LUK A;  1CSY A;  2FO0 A;  1UUS A;  2HDV A;  1BLJ A;  2OQ1 A;  1FYR A;  3UYO A;  2ROR A;  2EYY A;  5DC9 A;  1A1E A;  3UF4 A;  1Z3K A;  4NWG A;  3BUX B;  1JU5 A;  2Y1M A;  1BF5 A;  1FMK A;  5GJH A;  4F59 A;  1AYA A;  1O4G A;  4EY0 A;  3VRO A;  3K2M A;  1CSZ A;  1KA6 A;  1TZE E;  1KC2 A;  1YVH A;  5HKZ A;  3BUM B;  1O4R A;  1Y57 A;  3NHN A;  1O4P A;  1BKL A;  3VS5 A;  3HIZ B;  2DLY A;  3MXC A;  1X27 A;  3PQZ A;  1BM2 A;  3IMD A;  1CWD L;  1JYQ A;  3OV1 A;  1BFJ A;  3BUN B;  5EHR A;  1BFI A;  1M61 A;  1AD5 A;  1O44 A;  3VS4 A;  1FU5 A;  1M27 A;  2HMH A;  2RSY A;  1SHD A;  3CBL A;  4DGP A;  5EHP A;  4GL9 E;  1WQU A;  3BKB A;  4H1O A;  1TCE A;  1HCT B;  3MAZ A;  2B3O A;  3KFJ A;  2HUW A;  3MXY A;  2Y1N A;  1FHS A;  2IUI A;  5AUL A;  2SRC A;  3HHM B;  3PLF B;  4DGX A;  1GRI A;  2C0I A;  1FU6 A;  1O4N A;  2EYZ A;  2MQI A;  4EIH A;  3HCK A;  2L4K A;  1A1A A;  1QG1 E;  2PLD A;  4K44 A;  5EEQ A;  4L1B B;  1YVL A;  4TZI A;  4OHE A;  1I3Z A;  4F5A A;  5D0J A;  5GJI A;  2KNO A;  3C7I A;  2EU0 A;  2IUG A;  1F1W A;  2C0T A;  1PIC A;  3PSJ A;  3S8O A;  1CJ1 A;  2SHP A;  4GWF A;  3N84 A;  1XA6 A;  1O41 A;  2PNB A;  2CR4 A;  1O4J A;  1SHA A;  3ZNI A;  4K11 A;  1O4I A;  2K79 B;  1D4T A;  4K2R A;  1IS0 A;  4A4B A;  1OPK A;  1O49 A;  2HCK A;  1D4W A;  4JE4 A;  2MRK A;  3VRQ A;  3TKZ A;  1KA7 A;  2GSB A;  1ZFP E;  4JEG A;  1FBZ A;  1X0N A;  1JYU A;  3T04 A;  3VRY A;  1O45 A;  2CI8 A;  1O4E A;  3VS7 A;  2LQW A;  1AYD A;  3GXX A;  3VS3 A;  5IBS A; 
#chains in the Genus database with same CATH topology
 2KGY A;  4OHH A;  4ROJ A;  4XZ0 A;  1IJR A;  1UUR A;  5DC4 A;  4A4C A;  1RJA A;  1BMB A;  2C0O A;  4OHD A;  5I6V A;  3VS0 A;  3K2T A;  2CRH A;  2L3T A;  1BHF A;  1AYB A;  4P9Z A;  2H8H A;  2H46 E;  3S9K A;  2MC1 A;  1O4A A;  2L6K A;  1O4C A;  4FL3 A;  1BHH A;  2ETZ A;  4E68 A;  2IZV A;  2C9W A;  1G83 A;  1R1P A;  1O42 A;  1KSW A;  4H34 A;  5J3X A;  1SPR A;  1B47 A;  2AOB A;  2EKX A;  3CXL A;  1HCS B;  1JWO A;  1RQQ C;  4WWQ A;  2KK6 A;  3QWY A;  1BHH B;  3N8M A;  4K45 A;  3EAC A;  2VIF A;  2DX0 A;  2LCT A;  2PNA A;  1X6C A;  1O4H A;  2BBU A;  5BO4 A;  3VRP A;  1O4L A;  1AYC A;  2AOA A;  1O4F A;  4QSY A;  1AB2 A;  4P9V A;  5HKW A;  3VGO A;  3PS5 A;  5DC0 B;  4U17 A;  1O4K A;  2YU7 A;  1F2F A;  3OVE A;  1R1S A;  1NRV A;  1LCK A;  1OO3 A;  2DLZ A;  2PTK A;  1GHU A;  3N7Y A;  3IMJ A;  1LUI A;  3OP0 A;  2LNX A;  2ABL A;  1H9O A;  2EL8 A;  3VS1 A;  1BLK A;  3BUW B;  1A08 A;  3S8L A;  3VS2 A;  2CI9 A;  3PFV A;  1K9A A;  1BG1 A;  4D8K A;  2LQN A;  3OB1 B;  3VS6 A;  3VRR A;  1A1C A;  2MRJ A;  1R1Q A;  3M7F A;  1O47 A;  1OPL A;  2MK2 A;  1NZV A;  3US4 A;  2LNW A;  2RVF A;  4GPL B;  5HKY A;  1O4Q A;  1RPY A;  3BUO B;  4LUE A;  2CIA A;  2Y3A B;  1O4M A;  3EAZ A;  1O4O A;  1CWE A;  1NZL A;  3CD3 A;  2QMS A;  1LUM A;  1SHB A;  1FBV A;  3VRZ A;  5IBM A;  2CS0 A;  4OHI A;  4X6S A;  1A1B A;  2IUH A;  3IN7 A;  2EO3 A;  3PJP A;  2FCI A;  2PLE A;  4E93 A;  1O4D A;  2CBL A;  2HDX A;  5DF6 A;  5EEL A;  3QWX X;  3GQI B;  1SKJ A;  2DM0 A;  2DVJ A;  1P13 A;  1QCF A;  1LCJ A;  2YSX A;  2RMX A;  3TL0 A;  1MIL A;  3CWG A;  1O46 A;  2GE9 A;  4LUD A;  2XP1 A;  1O4B A;  2H5K A;  3OB2 B;  4JGH A;  1D1Z A;  4XZ1 A;  1QAD A;  4F5B A;  1O43 A;  3IN8 A;  1SPS A;  1A09 A;  5CDW A;  2EOB A;  1LKK A;  2AUG A;  3S8N A;  4OHL A;  2EO6 A;  5AXI A;  2JYQ A;  3GXW A;  2OZO A;  5KAZ A;  4U1P A;  2ECD A;  3PSK A;  2K7A B;  5EG3 B;  1AOU F;  1LUN A;  1BKM A;  3WA4 A;  1AOT F;  1JYR A;  4NWF A;  1A07 A;  1OO4 A;  4FL2 A;  1O48 A;  1A81 A;  1Y1U A;  2EYV A;  4M4Z A;  3VRN A;  1LKL A;  4FBN A;  2DCR A;  1MW4 A;  1LUK A;  1CSY A;  2FO0 A;  1UUS A;  2HDV A;  1BLJ A;  2OQ1 A;  1FYR A;  3UYO A;  2ROR A;  2EYY A;  5DC9 A;  1A1E A;  3UF4 A;  1Z3K A;  4NWG A;  3BUX B;  1JU5 A;  2Y1M A;  1BF5 A;  1FMK A;  5GJH A;  4F59 A;  1AYA A;  1O4G A;  4EY0 A;  3VRO A;  3K2M A;  1CSZ A;  1KA6 A;  1TZE E;  1KC2 A;  1YVH A;  5HKZ A;  3LYV A;  3BUM B;  1O4R A;  1Y57 A;  3NHN A;  1O4P A;  1BKL A;  3VS5 A;  3HIZ B;  2DLY A;  3MXC A;  1X27 A;  3PQZ A;  1BM2 A;  3IMD A;  1CWD L;  1JYQ A;  3OV1 A;  1BFJ A;  3BUN B;  5EHR A;  1BFI A;  1M61 A;  1AD5 A;  1O44 A;  3VS4 A;  1FU5 A;  1M27 A;  2HMH A;  2RSY A;  1SHD A;  3CBL A;  4DGP A;  5EHP A;  4GL9 E;  1WQU A;  3BKB A;  4H1O A;  1TCE A;  1HCT B;  3MAZ A;  2B3O A;  2LRA A;  3KFJ A;  2HUW A;  3MXY A;  2Y1N A;  1FHS A;  2IUI A;  5AUL A;  2SRC A;  3HHM B;  3PLF B;  4DGX A;  1GRI A;  2C0I A;  1FU6 A;  1O4N A;  2EYZ A;  2MQI A;  4EIH A;  3HCK A;  2L4K A;  1A1A A;  1QG1 E;  2PLD A;  4K44 A;  5EEQ A;  4L1B B;  1YVL A;  4TZI A;  4OHE A;  1I3Z A;  4F5A A;  5D0J A;  5GJI A;  2KNO A;  3C7I A;  2EU0 A;  2IUG A;  1F1W A;  2C0T A;  1PIC A;  3PSJ A;  3S8O A;  1CJ1 A;  2SHP A;  4GWF A;  3N84 A;  1XA6 A;  1O41 A;  2PNB A;  2CR4 A;  1O4J A;  1SHA A;  3ZNI A;  4K11 A;  1O4I A;  2K79 B;  1D4T A;  4K2R A;  1IS0 A;  4A4B A;  1OPK A;  1O49 A;  2HCK A;  1D4W A;  4JE4 A;  2MRK A;  3VRQ A;  3TKZ A;  1KA7 A;  2GSB A;  1ZFP E;  4JEG A;  1FBZ A;  1X0N A;  1JYU A;  3T04 A;  3VRY A;  1O45 A;  2CI8 A;  1O4E A;  3VS7 A;  2LQW A;  1AYD A;  3GXX A;  3VS3 A;  5IBS A; 
#chains in the Genus database with same CATH homology
 4OHH A;  4ROJ A;  4XZ0 A;  1IJR A;  1UUR A;  5DC4 A;  4A4C A;  1RJA A;  1BMB A;  2C0O A;  4OHD A;  5I6V A;  3VS0 A;  2CRH A;  2L3T A;  1BHF A;  1AYB A;  4P9Z A;  2H8H A;  2H46 E;  3S9K A;  2MC1 A;  1O4A A;  2L6K A;  1O4C A;  4FL3 A;  1BHH A;  2ETZ A;  4E68 A;  2IZV A;  2C9W A;  1G83 A;  1R1P A;  1O42 A;  1KSW A;  4H34 A;  5J3X A;  1SPR A;  1B47 A;  2AOB A;  2EKX A;  3CXL A;  1HCS B;  1JWO A;  1RQQ C;  4WWQ A;  2KK6 A;  3QWY A;  1BHH B;  3N8M A;  4K45 A;  3EAC A;  2VIF A;  2DX0 A;  2LCT A;  2PNA A;  1X6C A;  1O4H A;  2BBU A;  5BO4 A;  3VRP A;  1O4L A;  1AYC A;  2AOA A;  1O4F A;  4QSY A;  1AB2 A;  4P9V A;  5HKW A;  3VGO A;  3PS5 A;  5DC0 B;  4U17 A;  1O4K A;  2YU7 A;  1F2F A;  3OVE A;  1R1S A;  1NRV A;  1LCK A;  1OO3 A;  2DLZ A;  2PTK A;  1GHU A;  3N7Y A;  3IMJ A;  1LUI A;  3OP0 A;  2LNX A;  2ABL A;  1H9O A;  2EL8 A;  3VS1 A;  1BLK A;  3BUW B;  1A08 A;  3S8L A;  3VS2 A;  2CI9 A;  3PFV A;  1K9A A;  1BG1 A;  4D8K A;  2LQN A;  3OB1 B;  3VS6 A;  3VRR A;  1A1C A;  2MRJ A;  1R1Q A;  3M7F A;  1O47 A;  1OPL A;  2MK2 A;  1NZV A;  3US4 A;  2LNW A;  2RVF A;  4GPL B;  5HKY A;  1O4Q A;  1RPY A;  3BUO B;  4LUE A;  2CIA A;  2Y3A B;  1O4M A;  3EAZ A;  1O4O A;  1CWE A;  1NZL A;  3CD3 A;  2QMS A;  1LUM A;  1SHB A;  1FBV A;  3VRZ A;  5IBM A;  2CS0 A;  4OHI A;  4X6S A;  1A1B A;  2IUH A;  3IN7 A;  2EO3 A;  3PJP A;  2FCI A;  2PLE A;  4E93 A;  1O4D A;  2CBL A;  2HDX A;  5DF6 A;  5EEL A;  3QWX X;  3GQI B;  1SKJ A;  2DM0 A;  2DVJ A;  1P13 A;  1QCF A;  1LCJ A;  2YSX A;  2RMX A;  3TL0 A;  1MIL A;  3CWG A;  1O46 A;  2GE9 A;  4LUD A;  2XP1 A;  1O4B A;  2H5K A;  3OB2 B;  4JGH A;  1D1Z A;  4XZ1 A;  1QAD A;  4F5B A;  1O43 A;  3IN8 A;  1SPS A;  1A09 A;  5CDW A;  2EOB A;  1LKK A;  2AUG A;  3S8N A;  4OHL A;  2EO6 A;  5AXI A;  2JYQ A;  3GXW A;  2OZO A;  5KAZ A;  4U1P A;  2ECD A;  3PSK A;  2K7A B;  5EG3 B;  1AOU F;  1LUN A;  1BKM A;  3WA4 A;  1AOT F;  1JYR A;  4NWF A;  1A07 A;  1OO4 A;  4FL2 A;  1O48 A;  1A81 A;  1Y1U A;  2EYV A;  4M4Z A;  3VRN A;  1LKL A;  4FBN A;  2DCR A;  1MW4 A;  1LUK A;  1CSY A;  2FO0 A;  1UUS A;  2HDV A;  1BLJ A;  2OQ1 A;  1FYR A;  3UYO A;  2ROR A;  2EYY A;  5DC9 A;  1A1E A;  3UF4 A;  1Z3K A;  4NWG A;  3BUX B;  1JU5 A;  2Y1M A;  1BF5 A;  1FMK A;  5GJH A;  4F59 A;  1AYA A;  1O4G A;  4EY0 A;  3VRO A;  3K2M A;  1CSZ A;  1KA6 A;  1TZE E;  1KC2 A;  1YVH A;  5HKZ A;  3BUM B;  1O4R A;  1Y57 A;  3NHN A;  1O4P A;  1BKL A;  3VS5 A;  3HIZ B;  2DLY A;  3MXC A;  1X27 A;  3PQZ A;  1BM2 A;  3IMD A;  1CWD L;  1JYQ A;  3OV1 A;  1BFJ A;  3BUN B;  5EHR A;  1BFI A;  1M61 A;  1AD5 A;  1O44 A;  3VS4 A;  1FU5 A;  1M27 A;  2HMH A;  2RSY A;  1SHD A;  3CBL A;  4DGP A;  5EHP A;  4GL9 E;  1WQU A;  3BKB A;  4H1O A;  1TCE A;  1HCT B;  3MAZ A;  2B3O A;  3KFJ A;  2HUW A;  3MXY A;  2Y1N A;  1FHS A;  2IUI A;  5AUL A;  2SRC A;  3HHM B;  3PLF B;  4DGX A;  1GRI A;  2C0I A;  1FU6 A;  1O4N A;  2EYZ A;  2MQI A;  4EIH A;  3HCK A;  2L4K A;  1A1A A;  1QG1 E;  2PLD A;  4K44 A;  5EEQ A;  4L1B B;  1YVL A;  4TZI A;  4OHE A;  1I3Z A;  4F5A A;  5D0J A;  5GJI A;  2KNO A;  3C7I A;  2EU0 A;  2IUG A;  1F1W A;  2C0T A;  1PIC A;  3PSJ A;  3S8O A;  1CJ1 A;  2SHP A;  4GWF A;  3N84 A;  1XA6 A;  1O41 A;  2PNB A;  2CR4 A;  1O4J A;  1SHA A;  3ZNI A;  4K11 A;  1O4I A;  2K79 B;  1D4T A;  4K2R A;  1IS0 A;  4A4B A;  1OPK A;  1O49 A;  2HCK A;  1D4W A;  4JE4 A;  2MRK A;  3VRQ A;  3TKZ A;  1KA7 A;  2GSB A;  1ZFP E;  4JEG A;  1FBZ A;  1X0N A;  1JYU A;  3T04 A;  3VRY A;  1O45 A;  2CI8 A;  1O4E A;  3VS7 A;  2LQW A;  1AYD A;  3GXX A;  3VS3 A;  5IBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...