1X0NA

Nmr structure of growth factor receptor binding protein sh2 domain complexed with the inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Growth factor receptor-bound protein 2
publication title NMR structure of growth factor receptor binding protein SH2 domain complexed with the inhibitor
rcsb
source organism Homo sapiens
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1x0nA00
3VRPA 1I3ZA 3CWGA 3VRRA 1BG1A 1RQQC 1GHUA 1X27A 2SRCA 3BKBA 3HCKA 2C0TA 2CS0A 3OV1A 2RSYA 1O43A 5DC0B 3UYOA 2IZVA 1FU6A 1A81A 3VRQA 4OHIA 3IMJA 3MAZA 3VS0A 4OHDA 4DGPA 2LQNA 1OO4A 4D8KA 1A1CA 2EYZA 2L6KA 1BMBA 2ETZA 3IN8A 2H5KA 3VGOA 5D0JA 1WQUA 1O46A 1G83A 3BUWB 3N7YA 5IBMA 1LCJA 5HKYA 3OB2B 1SPSA 1BLJA 5AULA 1LKLA 1D4TA 2YU7A 3IN7A 3S8NA 2C9WA 1FHSA 1YVHA 2Y1MA 1O4BA 1BM2A 1CJ1A 4K2RA 3PJPA 3OP0A 1QG1E 2LQWA 3VRNA 4M4ZA 1O42A 5HKZA 3IMDA 2LNWA 3CD3A 3GQIB 3N84A 2EO3A 2OZOA 2HCKA 5DF6A 2K79B 2MC1A 1KSWA 1PICA 2CI8A 3NHNA 4X6SA 1O4LA 1Y1UA 2JYQA 1GRIA 1FBVA 3PFVA 1M27A 2ECDA 4NWGA 3BUNB 2C0IA 1M61A 2IUGA 2H8HA 3T04A 4H1OA 3CXLA 3VS5A 2LCTA 3N8MA 2HDXA 2MRJA 1O44A 1MILA 1XA6A 4A4BA 1A1EA 3VS1A 2AOBA 2DLYA 1O4DA 3HIZB 1B47A 4QSYA 3VRYA 1JYRA 1Z3KA 2KK6A 1K9AA 4E68A 2RORA 5I6VA 1JU5A 1JYQA 4GPLB 2EO6A 1SPRA 1F2FA 1FYRA 3EAZA 3VS7A 3C7IA 2ABLA 2VIFA 1CSZA 3QWXX 4U1PA 2IUHA 1OO3A 1BHHB 1O4IA 3PSJA 1O4OA 3S9KA 1CWDL 1SHBA 2PLEA 2RMXA 3K2MA 1ZFPE 3OB1B 4E93A 5EELA 5J3XA 1IS0A 1O4CA 4EY0A 4H34A 1AD5A 4JE4A 4XZ1A 2K7AB 5DC4A 4K44A 4OHEA 3BUMB 2MQIA 1HCSB 4TZIA 1O4RA 1O4JA 2AUGA 1RPYA 1KA7A 1X0NA 2SHPA 1CSYA 1KC2A 2DX0A 1BHFA 1O48A 2PNAA 1MW4A 1D1ZA 2EL8A 2DVJA 2QMSA 2PNBA 3MXCA 2EU0A 1AOUF 2L4KA 1AOTF 2CRHA 1BLKA 1RJAA 1A08A 1BKMA 5EHPA 1CWEA 4FBNA 1AYCA 1R1SA 4NWFA 3TL0A 2EKXA 1FBZA 4OHLA 5BO4A 4F59A 1AYAA 1O4AA 1A1BA 3ZNIA 4WWQA 2OQ1A 1AB2A 2YSXA 1O45A 3TKZA 2BBUA 2CIAA 2L3TA 1O4GA 4ROJA 5EHRA 4F5AA 1HCTB 3GXXA 1A1AA 1LUKA 1O4QA 5GJIA 1SHAA 2AOAA 3VS4A 1LKKA 1Y57A 2FO0A 3US4A 1FMKA 1KA6A 2DM0A 1O47A 1TZEE 2B3OA 4FL3A 3VRZA 1O4KA 1YVLA 1A07A 4DGXA 1NZLA 1QADA 1LCKA 3KFJA 2MK2A 4P9VA 1H9OA 1QCFA 1X6CA 1D4WA 1UUSA 4FL2A 4P9ZA 3M7FA 2GSBA 2MRKA 2Y1NA 4GWFA 2HUWA 2XP1A 2C0OA 2CBLA 1O4MA 1BF5A 5AXIA 1JYUA 2GE9A 1BFIA 3VS2A 4U17A 1FU5A 1SKJA 1O49A 3S8OA 1OPLA 3UF4A 5GJHA 3WA4A 5DC9A 1LUIA 1LUMA 4K11A 2DCRA 1F1WA 1JWOA 2PTKA 2EOBA 5EG3B 5KAZA 1UURA 1A09A 2LNXA 1OPKA 3VS3A 2PLDA 2FCIA 4LUDA 3VS6A 2HDVA 3BUOB 4GL9E 2H46E 4A4CA 3GXWA 4LUEA 1NRVA 1O41A 2KNOA 5EEQA 1AYDA 2DLZA 4XZ0A 3PSKA 1NZVA 3BUXB 1BHHA 3PLFB 1R1PA 2RVFA 2IUIA 5IBSA 4OHHA 1TCEA 1AYBA 2EYYA 4JEGA 3HHMB 4K45A 4L1BB 1IJRA 3PQZA 4JGHA 3MXYA 3S8LA 1BKLA 2CI9A 3CBLA 2HMHA 1LUNA 4EIHA 1O4EA 3VROA 1O4PA 5CDWA 1SHDA 2Y3AB 2EYVA 3EACA 1O4NA 1O4FA 2CR4A 4F5BA 1BFJA 1O4HA 1P13A 5HKWA 3PS5A 3QWYA 1R1QA 3OVEA
chains in the Genus database with same CATH superfamily
3VRPA 1I3ZA 3CWGA 3VRRA 1BG1A 1RQQC 1GHUA 1X27A 2SRCA 3BKBA 3HCKA 2C0TA 2CS0A 3OV1A 2RSYA 1O43A 5DC0B 3UYOA 2IZVA 1FU6A 1A81A 3VRQA 4OHIA 3IMJA 3MAZA 3VS0A 4OHDA 4DGPA 2LQNA 1OO4A 4D8KA 1A1CA 2EYZA 2L6KA 1BMBA 2ETZA 3IN8A 2H5KA 3VGOA 5D0JA 1WQUA 1O46A 1G83A 3BUWB 3N7YA 5IBMA 1LCJA 5HKYA 3OB2B 1SPSA 1BLJA 5AULA 1LKLA 1D4TA 2YU7A 3IN7A 3S8NA 2C9WA 1FHSA 1YVHA 2Y1MA 1O4BA 1BM2A 1CJ1A 4K2RA 3PJPA 3OP0A 1QG1E 2LQWA 3VRNA 4M4ZA 1O42A 5HKZA 3IMDA 2LNWA 3CD3A 3GQIB 3N84A 2EO3A 2OZOA 2HCKA 5DF6A 2K79B 3K2TA 2MC1A 1KSWA 1PICA 2CI8A 3NHNA 4X6SA 1O4LA 1Y1UA 2JYQA 1GRIA 1FBVA 3PFVA 1M27A 2ECDA 4NWGA 3BUNB 2C0IA 1M61A 2IUGA 2H8HA 3T04A 4H1OA 3CXLA 3VS5A 2LCTA 3N8MA 2HDXA 2MRJA 1O44A 1MILA 1XA6A 4A4BA 1A1EA 3VS1A 2AOBA 2DLYA 1O4DA 3HIZB 1B47A 4QSYA 3VRYA 1JYRA 1Z3KA 2KK6A 1K9AA 4E68A 2RORA 5I6VA 1JU5A 1JYQA 4GPLB 2EO6A 1SPRA 3LYVA 1F2FA 1FYRA 3EAZA 3VS7A 3C7IA 2ABLA 2VIFA 1CSZA 3QWXX 2KGYA 4U1PA 2IUHA 1OO3A 1BHHB 1O4IA 3PSJA 1O4OA 3S9KA 1CWDL 1SHBA 2PLEA 2RMXA 3K2MA 1ZFPE 3OB1B 4E93A 5EELA 5J3XA 1IS0A 1O4CA 4EY0A 4H34A 1AD5A 4JE4A 4XZ1A 2K7AB 5DC4A 4K44A 4OHEA 3BUMB 2MQIA 1HCSB 4TZIA 1O4RA 1O4JA 2AUGA 1RPYA 1KA7A 1X0NA 2SHPA 1CSYA 1KC2A 2DX0A 1BHFA 1O48A 2PNAA 1MW4A 1D1ZA 2EL8A 2DVJA 2QMSA 2PNBA 3MXCA 2EU0A 1AOUF 2L4KA 1AOTF 2CRHA 1BLKA 1RJAA 1A08A 1BKMA 5EHPA 1CWEA 4FBNA 1AYCA 1R1SA 4NWFA 3TL0A 2EKXA 1FBZA 4OHLA 5BO4A 4F59A 1AYAA 1O4AA 1A1BA 3ZNIA 4WWQA 2OQ1A 1AB2A 2YSXA 1O45A 3TKZA 2BBUA 2CIAA 2L3TA 1O4GA 4ROJA 5EHRA 4F5AA 1HCTB 3GXXA 1A1AA 1LUKA 1O4QA 5GJIA 1SHAA 2AOAA 3VS4A 1LKKA 1Y57A 2FO0A 3US4A 1FMKA 1KA6A 2DM0A 1O47A 1TZEE 2B3OA 4FL3A 3VRZA 1O4KA 1YVLA 1A07A 4DGXA 1NZLA 1QADA 1LCKA 3KFJA 2MK2A 4P9VA 1H9OA 1QCFA 1X6CA 1D4WA 1UUSA 4FL2A 4P9ZA 3M7FA 2GSBA 2MRKA 2Y1NA 4GWFA 2HUWA 2XP1A 2C0OA 2CBLA 1O4MA 1BF5A 5AXIA 1JYUA 2GE9A 1BFIA 3VS2A 4U17A 1FU5A 1SKJA 1O49A 3S8OA 1OPLA 3UF4A 5GJHA 3WA4A 5DC9A 1LUIA 1LUMA 4K11A 2DCRA 1F1WA 1JWOA 2PTKA 2EOBA 5EG3B 5KAZA 1UURA 1A09A 2LNXA 1OPKA 3VS3A 2PLDA 2FCIA 4LUDA 3VS6A 2HDVA 3BUOB 4GL9E 2H46E 4A4CA 3GXWA 4LUEA 1NRVA 1O41A 2KNOA 5EEQA 1AYDA 2DLZA 4XZ0A 3PSKA 1NZVA 3BUXB 1BHHA 3PLFB 1R1PA 2RVFA 2IUIA 5IBSA 4OHHA 1TCEA 1AYBA 2EYYA 4JEGA 3HHMB 4K45A 4L1BB 1IJRA 3PQZA 4JGHA 3MXYA 3S8LA 1BKLA 2CI9A 3CBLA 2HMHA 1LUNA 4EIHA 1O4EA 3VROA 1O4PA 5CDWA 1SHDA 2Y3AB 2EYVA 3EACA 1O4NA 1O4FA 2CR4A 4F5BA 1BFJA 2LRAA 1O4HA 1P13A 5HKWA 3PS5A 3QWYA 1R1QA 3OVEA
chains in the Genus database with same CATH topology
3VRPA 1I3ZA 3CWGA 3VRRA 1BG1A 1RQQC 1GHUA 1X27A 2SRCA 3BKBA 3HCKA 2C0TA 2CS0A 3OV1A 2RSYA 1O43A 5DC0B 3UYOA 2IZVA 1FU6A 1A81A 3VRQA 4OHIA 3IMJA 3MAZA 3VS0A 4OHDA 4DGPA 2LQNA 1OO4A 4D8KA 1A1CA 2EYZA 2L6KA 1BMBA 2ETZA 3IN8A 2H5KA 3VGOA 5D0JA 1WQUA 1O46A 1G83A 3BUWB 3N7YA 5IBMA 1LCJA 5HKYA 3OB2B 1SPSA 1BLJA 5AULA 1LKLA 1D4TA 2YU7A 3IN7A 3S8NA 2C9WA 1FHSA 1YVHA 2Y1MA 1O4BA 1BM2A 1CJ1A 4K2RA 3PJPA 3OP0A 1QG1E 2LQWA 3VRNA 4M4ZA 1O42A 5HKZA 3IMDA 2LNWA 3CD3A 3GQIB 3N84A 2EO3A 2OZOA 2HCKA 5DF6A 2K79B 2MC1A 1KSWA 1PICA 2CI8A 3NHNA 4X6SA 1O4LA 1Y1UA 2JYQA 1GRIA 1FBVA 3PFVA 1M27A 2ECDA 4NWGA 3BUNB 2C0IA 1M61A 2IUGA 2H8HA 3T04A 4H1OA 3CXLA 3VS5A 2LCTA 3N8MA 2HDXA 2MRJA 1O44A 1MILA 1XA6A 4A4BA 1A1EA 3VS1A 2AOBA 2DLYA 1O4DA 3HIZB 1B47A 4QSYA 3VRYA 1JYRA 1Z3KA 2KK6A 1K9AA 4E68A 2RORA 5I6VA 1JU5A 1JYQA 4GPLB 2EO6A 1SPRA 1F2FA 1FYRA 3EAZA 3VS7A 3C7IA 2ABLA 2VIFA 1CSZA 3QWXX 4U1PA 2IUHA 1OO3A 1BHHB 1O4IA 3PSJA 1O4OA 3S9KA 1CWDL 1SHBA 2PLEA 2RMXA 3K2MA 1ZFPE 3OB1B 4E93A 5EELA 5J3XA 1IS0A 1O4CA 4EY0A 4H34A 1AD5A 4JE4A 4XZ1A 2K7AB 5DC4A 4K44A 4OHEA 3BUMB 2MQIA 1HCSB 4TZIA 1O4RA 1O4JA 2AUGA 1RPYA 1KA7A 1X0NA 2SHPA 1CSYA 1KC2A 2DX0A 1BHFA 1O48A 2PNAA 1MW4A 1D1ZA 2EL8A 2DVJA 2QMSA 2PNBA 3MXCA 2EU0A 1AOUF 2L4KA 1AOTF 2CRHA 1BLKA 1RJAA 1A08A 1BKMA 5EHPA 1CWEA 4FBNA 1AYCA 1R1SA 4NWFA 3TL0A 2EKXA 1FBZA 4OHLA 5BO4A 4F59A 1AYAA 1O4AA 1A1BA 3ZNIA 4WWQA 2OQ1A 1AB2A 2YSXA 1O45A 3TKZA 2BBUA 2CIAA 2L3TA 1O4GA 4ROJA 5EHRA 4F5AA 1HCTB 3GXXA 1A1AA 1LUKA 1O4QA 5GJIA 1SHAA 2AOAA 3VS4A 1LKKA 1Y57A 2FO0A 3US4A 1FMKA 1KA6A 2DM0A 1O47A 1TZEE 2B3OA 4FL3A 3VRZA 1O4KA 1YVLA 1A07A 4DGXA 1NZLA 1QADA 1LCKA 3KFJA 2MK2A 4P9VA 1H9OA 1QCFA 1X6CA 1D4WA 1UUSA 4FL2A 4P9ZA 3M7FA 2GSBA 2MRKA 2Y1NA 4GWFA 2HUWA 2XP1A 2C0OA 2CBLA 1O4MA 1BF5A 5AXIA 1JYUA 2GE9A 1BFIA 3VS2A 4U17A 1FU5A 1SKJA 1O49A 3S8OA 1OPLA 3UF4A 5GJHA 3WA4A 5DC9A 1LUIA 1LUMA 4K11A 2DCRA 1F1WA 1JWOA 2PTKA 2EOBA 5EG3B 5KAZA 1UURA 1A09A 2LNXA 1OPKA 3VS3A 2PLDA 2FCIA 4LUDA 3VS6A 2HDVA 3BUOB 4GL9E 2H46E 4A4CA 3GXWA 4LUEA 1NRVA 1O41A 2KNOA 5EEQA 1AYDA 2DLZA 4XZ0A 3PSKA 1NZVA 3BUXB 1BHHA 3PLFB 1R1PA 2RVFA 2IUIA 5IBSA 4OHHA 1TCEA 1AYBA 2EYYA 4JEGA 3HHMB 4K45A 4L1BB 1IJRA 3PQZA 4JGHA 3MXYA 3S8LA 1BKLA 2CI9A 3CBLA 2HMHA 1LUNA 4EIHA 1O4EA 3VROA 1O4PA 5CDWA 1SHDA 2Y3AB 2EYVA 3EACA 1O4NA 1O4FA 2CR4A 4F5BA 1BFJA 1O4HA 1P13A 5HKWA 3PS5A 3QWYA 1R1QA 3OVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRP A;  1I3Z A;  3CWG A;  3VRR A;  1BG1 A;  1RQQ C;  1GHU A;  1X27 A;  2SRC A;  3BKB A;  3HCK A;  2C0T A;  2CS0 A;  3OV1 A;  2RSY A;  1O43 A;  5DC0 B;  3UYO A;  2IZV A;  1FU6 A;  1A81 A;  3VRQ A;  4OHI A;  3IMJ A;  3MAZ A;  3VS0 A;  4OHD A;  4DGP A;  2LQN A;  1OO4 A;  4D8K A;  1A1C A;  2EYZ A;  2L6K A;  1BMB A;  2ETZ A;  3IN8 A;  2H5K A;  3VGO A;  5D0J A;  1WQU A;  1O46 A;  1G83 A;  3BUW B;  3N7Y A;  5IBM A;  1LCJ A;  5HKY A;  3OB2 B;  1SPS A;  1BLJ A;  5AUL A;  1LKL A;  1D4T A;  2YU7 A;  3IN7 A;  3S8N A;  2C9W A;  1FHS A;  1YVH A;  2Y1M A;  1O4B A;  1BM2 A;  1CJ1 A;  4K2R A;  3PJP A;  3OP0 A;  1QG1 E;  2LQW A;  3VRN A;  4M4Z A;  1O42 A;  5HKZ A;  3IMD A;  2LNW A;  3CD3 A;  3GQI B;  3N84 A;  2EO3 A;  2OZO A;  2HCK A;  5DF6 A;  2K79 B;  2MC1 A;  1KSW A;  1PIC A;  2CI8 A;  3NHN A;  4X6S A;  1O4L A;  1Y1U A;  2JYQ A;  1GRI A;  1FBV A;  3PFV A;  1M27 A;  2ECD A;  4NWG A;  3BUN B;  2C0I A;  1M61 A;  2IUG A;  2H8H A;  3T04 A;  4H1O A;  3CXL A;  3VS5 A;  2LCT A;  3N8M A;  2HDX A;  2MRJ A;  1O44 A;  1MIL A;  1XA6 A;  4A4B A;  1A1E A;  3VS1 A;  2AOB A;  2DLY A;  1O4D A;  3HIZ B;  1B47 A;  4QSY A;  3VRY A;  1JYR A;  1Z3K A;  2KK6 A;  1K9A A;  4E68 A;  2ROR A;  5I6V A;  1JU5 A;  1JYQ A;  4GPL B;  2EO6 A;  1SPR A;  1F2F A;  1FYR A;  3EAZ A;  3VS7 A;  3C7I A;  2ABL A;  2VIF A;  1CSZ A;  3QWX X;  4U1P A;  2IUH A;  1OO3 A;  1BHH B;  1O4I A;  3PSJ A;  1O4O A;  3S9K A;  1CWD L;  1SHB A;  2PLE A;  2RMX A;  3K2M A;  1ZFP E;  3OB1 B;  4E93 A;  5EEL A;  5J3X A;  1IS0 A;  1O4C A;  4EY0 A;  4H34 A;  1AD5 A;  4JE4 A;  4XZ1 A;  2K7A B;  5DC4 A;  4K44 A;  4OHE A;  3BUM B;  2MQI A;  1HCS B;  4TZI A;  1O4R A;  1O4J A;  2AUG A;  1RPY A;  1KA7 A;  1X0N A;  2SHP A;  1CSY A;  1KC2 A;  2DX0 A;  1BHF A;  1O48 A;  2PNA A;  1MW4 A;  1D1Z A;  2EL8 A;  2DVJ A;  2QMS A;  2PNB A;  3MXC A;  2EU0 A;  1AOU F;  2L4K A;  1AOT F;  2CRH A;  1BLK A;  1RJA A;  1A08 A;  1BKM A;  5EHP A;  1CWE A;  4FBN A;  1AYC A;  1R1S A;  4NWF A;  3TL0 A;  2EKX A;  1FBZ A;  4OHL A;  5BO4 A;  4F59 A;  1AYA A;  1O4A A;  1A1B A;  3ZNI A;  4WWQ A;  2OQ1 A;  1AB2 A;  2YSX A;  1O45 A;  3TKZ A;  2BBU A;  2CIA A;  2L3T A;  1O4G A;  4ROJ A;  5EHR A;  4F5A A;  1HCT B;  3GXX A;  1A1A A;  1LUK A;  1O4Q A;  5GJI A;  1SHA A;  2AOA A;  3VS4 A;  1LKK A;  1Y57 A;  2FO0 A;  3US4 A;  1FMK A;  1KA6 A;  2DM0 A;  1O47 A;  1TZE E;  2B3O A;  4FL3 A;  3VRZ A;  1O4K A;  1YVL A;  1A07 A;  4DGX A;  1NZL A;  1QAD A;  1LCK A;  3KFJ A;  2MK2 A;  4P9V A;  1H9O A;  1QCF A;  1X6C A;  1D4W A;  1UUS A;  4FL2 A;  4P9Z A;  3M7F A;  2GSB A;  2MRK A;  2Y1N A;  4GWF A;  2HUW A;  2XP1 A;  2C0O A;  2CBL A;  1O4M A;  1BF5 A;  5AXI A;  1JYU A;  2GE9 A;  1BFI A;  3VS2 A;  4U17 A;  1FU5 A;  1SKJ A;  1O49 A;  3S8O A;  1OPL A;  3UF4 A;  5GJH A;  3WA4 A;  5DC9 A;  1LUI A;  1LUM A;  4K11 A;  2DCR A;  1F1W A;  1JWO A;  2PTK A;  2EOB A;  5EG3 B;  5KAZ A;  1UUR A;  1A09 A;  2LNX A;  1OPK A;  3VS3 A;  2PLD A;  2FCI A;  4LUD A;  3VS6 A;  2HDV A;  3BUO B;  4GL9 E;  2H46 E;  4A4C A;  3GXW A;  4LUE A;  1NRV A;  1O41 A;  2KNO A;  5EEQ A;  1AYD A;  2DLZ A;  4XZ0 A;  3PSK A;  1NZV A;  3BUX B;  1BHH A;  3PLF B;  1R1P A;  2RVF A;  2IUI A;  5IBS A;  4OHH A;  1TCE A;  1AYB A;  2EYY A;  4JEG A;  3HHM B;  4K45 A;  4L1B B;  1IJR A;  3PQZ A;  4JGH A;  3MXY A;  3S8L A;  1BKL A;  2CI9 A;  3CBL A;  2HMH A;  1LUN A;  4EIH A;  1O4E A;  3VRO A;  1O4P A;  5CDW A;  1SHD A;  2Y3A B;  2EYV A;  3EAC A;  1O4N A;  1O4F A;  2CR4 A;  4F5B A;  1BFJ A;  1O4H A;  1P13 A;  5HKW A;  3PS5 A;  3QWY A;  1R1Q A;  3OVE A; 
#chains in the Genus database with same CATH topology
 3VRP A;  1I3Z A;  3CWG A;  3VRR A;  1BG1 A;  1RQQ C;  1GHU A;  1X27 A;  2SRC A;  3BKB A;  3HCK A;  2C0T A;  2CS0 A;  3OV1 A;  2RSY A;  1O43 A;  5DC0 B;  3UYO A;  2IZV A;  1FU6 A;  1A81 A;  3VRQ A;  4OHI A;  3IMJ A;  3MAZ A;  3VS0 A;  4OHD A;  4DGP A;  2LQN A;  1OO4 A;  4D8K A;  1A1C A;  2EYZ A;  2L6K A;  1BMB A;  2ETZ A;  3IN8 A;  2H5K A;  3VGO A;  5D0J A;  1WQU A;  1O46 A;  1G83 A;  3BUW B;  3N7Y A;  5IBM A;  1LCJ A;  5HKY A;  3OB2 B;  1SPS A;  1BLJ A;  5AUL A;  1LKL A;  1D4T A;  2YU7 A;  3IN7 A;  3S8N A;  2C9W A;  1FHS A;  1YVH A;  2Y1M A;  1O4B A;  1BM2 A;  1CJ1 A;  4K2R A;  3PJP A;  3OP0 A;  1QG1 E;  2LQW A;  3VRN A;  4M4Z A;  1O42 A;  5HKZ A;  3IMD A;  2LNW A;  3CD3 A;  3GQI B;  3N84 A;  2EO3 A;  2OZO A;  2HCK A;  5DF6 A;  2K79 B;  3K2T A;  2MC1 A;  1KSW A;  1PIC A;  2CI8 A;  3NHN A;  4X6S A;  1O4L A;  1Y1U A;  2JYQ A;  1GRI A;  1FBV A;  3PFV A;  1M27 A;  2ECD A;  4NWG A;  3BUN B;  2C0I A;  1M61 A;  2IUG A;  2H8H A;  3T04 A;  4H1O A;  3CXL A;  3VS5 A;  2LCT A;  3N8M A;  2HDX A;  2MRJ A;  1O44 A;  1MIL A;  1XA6 A;  4A4B A;  1A1E A;  3VS1 A;  2AOB A;  2DLY A;  1O4D A;  3HIZ B;  1B47 A;  4QSY A;  3VRY A;  1JYR A;  1Z3K A;  2KK6 A;  1K9A A;  4E68 A;  2ROR A;  5I6V A;  1JU5 A;  1JYQ A;  4GPL B;  2EO6 A;  1SPR A;  3LYV A;  1F2F A;  1FYR A;  3EAZ A;  3VS7 A;  3C7I A;  2ABL A;  2VIF A;  1CSZ A;  3QWX X;  2KGY A;  4U1P A;  2IUH A;  1OO3 A;  1BHH B;  1O4I A;  3PSJ A;  1O4O A;  3S9K A;  1CWD L;  1SHB A;  2PLE A;  2RMX A;  3K2M A;  1ZFP E;  3OB1 B;  4E93 A;  5EEL A;  5J3X A;  1IS0 A;  1O4C A;  4EY0 A;  4H34 A;  1AD5 A;  4JE4 A;  4XZ1 A;  2K7A B;  5DC4 A;  4K44 A;  4OHE A;  3BUM B;  2MQI A;  1HCS B;  4TZI A;  1O4R A;  1O4J A;  2AUG A;  1RPY A;  1KA7 A;  1X0N A;  2SHP A;  1CSY A;  1KC2 A;  2DX0 A;  1BHF A;  1O48 A;  2PNA A;  1MW4 A;  1D1Z A;  2EL8 A;  2DVJ A;  2QMS A;  2PNB A;  3MXC A;  2EU0 A;  1AOU F;  2L4K A;  1AOT F;  2CRH A;  1BLK A;  1RJA A;  1A08 A;  1BKM A;  5EHP A;  1CWE A;  4FBN A;  1AYC A;  1R1S A;  4NWF A;  3TL0 A;  2EKX A;  1FBZ A;  4OHL A;  5BO4 A;  4F59 A;  1AYA A;  1O4A A;  1A1B A;  3ZNI A;  4WWQ A;  2OQ1 A;  1AB2 A;  2YSX A;  1O45 A;  3TKZ A;  2BBU A;  2CIA A;  2L3T A;  1O4G A;  4ROJ A;  5EHR A;  4F5A A;  1HCT B;  3GXX A;  1A1A A;  1LUK A;  1O4Q A;  5GJI A;  1SHA A;  2AOA A;  3VS4 A;  1LKK A;  1Y57 A;  2FO0 A;  3US4 A;  1FMK A;  1KA6 A;  2DM0 A;  1O47 A;  1TZE E;  2B3O A;  4FL3 A;  3VRZ A;  1O4K A;  1YVL A;  1A07 A;  4DGX A;  1NZL A;  1QAD A;  1LCK A;  3KFJ A;  2MK2 A;  4P9V A;  1H9O A;  1QCF A;  1X6C A;  1D4W A;  1UUS A;  4FL2 A;  4P9Z A;  3M7F A;  2GSB A;  2MRK A;  2Y1N A;  4GWF A;  2HUW A;  2XP1 A;  2C0O A;  2CBL A;  1O4M A;  1BF5 A;  5AXI A;  1JYU A;  2GE9 A;  1BFI A;  3VS2 A;  4U17 A;  1FU5 A;  1SKJ A;  1O49 A;  3S8O A;  1OPL A;  3UF4 A;  5GJH A;  3WA4 A;  5DC9 A;  1LUI A;  1LUM A;  4K11 A;  2DCR A;  1F1W A;  1JWO A;  2PTK A;  2EOB A;  5EG3 B;  5KAZ A;  1UUR A;  1A09 A;  2LNX A;  1OPK A;  3VS3 A;  2PLD A;  2FCI A;  4LUD A;  3VS6 A;  2HDV A;  3BUO B;  4GL9 E;  2H46 E;  4A4C A;  3GXW A;  4LUE A;  1NRV A;  1O41 A;  2KNO A;  5EEQ A;  1AYD A;  2DLZ A;  4XZ0 A;  3PSK A;  1NZV A;  3BUX B;  1BHH A;  3PLF B;  1R1P A;  2RVF A;  2IUI A;  5IBS A;  4OHH A;  1TCE A;  1AYB A;  2EYY A;  4JEG A;  3HHM B;  4K45 A;  4L1B B;  1IJR A;  3PQZ A;  4JGH A;  3MXY A;  3S8L A;  1BKL A;  2CI9 A;  3CBL A;  2HMH A;  1LUN A;  4EIH A;  1O4E A;  3VRO A;  1O4P A;  5CDW A;  1SHD A;  2Y3A B;  2EYV A;  3EAC A;  1O4N A;  1O4F A;  2CR4 A;  4F5B A;  1BFJ A;  2LRA A;  1O4H A;  1P13 A;  5HKW A;  3PS5 A;  3QWY A;  1R1Q A;  3OVE A; 
#chains in the Genus database with same CATH homology
 3VRP A;  1I3Z A;  3CWG A;  3VRR A;  1BG1 A;  1RQQ C;  1GHU A;  1X27 A;  2SRC A;  3BKB A;  3HCK A;  2C0T A;  2CS0 A;  3OV1 A;  2RSY A;  1O43 A;  5DC0 B;  3UYO A;  2IZV A;  1FU6 A;  1A81 A;  3VRQ A;  4OHI A;  3IMJ A;  3MAZ A;  3VS0 A;  4OHD A;  4DGP A;  2LQN A;  1OO4 A;  4D8K A;  1A1C A;  2EYZ A;  2L6K A;  1BMB A;  2ETZ A;  3IN8 A;  2H5K A;  3VGO A;  5D0J A;  1WQU A;  1O46 A;  1G83 A;  3BUW B;  3N7Y A;  5IBM A;  1LCJ A;  5HKY A;  3OB2 B;  1SPS A;  1BLJ A;  5AUL A;  1LKL A;  1D4T A;  2YU7 A;  3IN7 A;  3S8N A;  2C9W A;  1FHS A;  1YVH A;  2Y1M A;  1O4B A;  1BM2 A;  1CJ1 A;  4K2R A;  3PJP A;  3OP0 A;  1QG1 E;  2LQW A;  3VRN A;  4M4Z A;  1O42 A;  5HKZ A;  3IMD A;  2LNW A;  3CD3 A;  3GQI B;  3N84 A;  2EO3 A;  2OZO A;  2HCK A;  5DF6 A;  2K79 B;  2MC1 A;  1KSW A;  1PIC A;  2CI8 A;  3NHN A;  4X6S A;  1O4L A;  1Y1U A;  2JYQ A;  1GRI A;  1FBV A;  3PFV A;  1M27 A;  2ECD A;  4NWG A;  3BUN B;  2C0I A;  1M61 A;  2IUG A;  2H8H A;  3T04 A;  4H1O A;  3CXL A;  3VS5 A;  2LCT A;  3N8M A;  2HDX A;  2MRJ A;  1O44 A;  1MIL A;  1XA6 A;  4A4B A;  1A1E A;  3VS1 A;  2AOB A;  2DLY A;  1O4D A;  3HIZ B;  1B47 A;  4QSY A;  3VRY A;  1JYR A;  1Z3K A;  2KK6 A;  1K9A A;  4E68 A;  2ROR A;  5I6V A;  1JU5 A;  1JYQ A;  4GPL B;  2EO6 A;  1SPR A;  1F2F A;  1FYR A;  3EAZ A;  3VS7 A;  3C7I A;  2ABL A;  2VIF A;  1CSZ A;  3QWX X;  4U1P A;  2IUH A;  1OO3 A;  1BHH B;  1O4I A;  3PSJ A;  1O4O A;  3S9K A;  1CWD L;  1SHB A;  2PLE A;  2RMX A;  3K2M A;  1ZFP E;  3OB1 B;  4E93 A;  5EEL A;  5J3X A;  1IS0 A;  1O4C A;  4EY0 A;  4H34 A;  1AD5 A;  4JE4 A;  4XZ1 A;  2K7A B;  5DC4 A;  4K44 A;  4OHE A;  3BUM B;  2MQI A;  1HCS B;  4TZI A;  1O4R A;  1O4J A;  2AUG A;  1RPY A;  1KA7 A;  1X0N A;  2SHP A;  1CSY A;  1KC2 A;  2DX0 A;  1BHF A;  1O48 A;  2PNA A;  1MW4 A;  1D1Z A;  2EL8 A;  2DVJ A;  2QMS A;  2PNB A;  3MXC A;  2EU0 A;  1AOU F;  2L4K A;  1AOT F;  2CRH A;  1BLK A;  1RJA A;  1A08 A;  1BKM A;  5EHP A;  1CWE A;  4FBN A;  1AYC A;  1R1S A;  4NWF A;  3TL0 A;  2EKX A;  1FBZ A;  4OHL A;  5BO4 A;  4F59 A;  1AYA A;  1O4A A;  1A1B A;  3ZNI A;  4WWQ A;  2OQ1 A;  1AB2 A;  2YSX A;  1O45 A;  3TKZ A;  2BBU A;  2CIA A;  2L3T A;  1O4G A;  4ROJ A;  5EHR A;  4F5A A;  1HCT B;  3GXX A;  1A1A A;  1LUK A;  1O4Q A;  5GJI A;  1SHA A;  2AOA A;  3VS4 A;  1LKK A;  1Y57 A;  2FO0 A;  3US4 A;  1FMK A;  1KA6 A;  2DM0 A;  1O47 A;  1TZE E;  2B3O A;  4FL3 A;  3VRZ A;  1O4K A;  1YVL A;  1A07 A;  4DGX A;  1NZL A;  1QAD A;  1LCK A;  3KFJ A;  2MK2 A;  4P9V A;  1H9O A;  1QCF A;  1X6C A;  1D4W A;  1UUS A;  4FL2 A;  4P9Z A;  3M7F A;  2GSB A;  2MRK A;  2Y1N A;  4GWF A;  2HUW A;  2XP1 A;  2C0O A;  2CBL A;  1O4M A;  1BF5 A;  5AXI A;  1JYU A;  2GE9 A;  1BFI A;  3VS2 A;  4U17 A;  1FU5 A;  1SKJ A;  1O49 A;  3S8O A;  1OPL A;  3UF4 A;  5GJH A;  3WA4 A;  5DC9 A;  1LUI A;  1LUM A;  4K11 A;  2DCR A;  1F1W A;  1JWO A;  2PTK A;  2EOB A;  5EG3 B;  5KAZ A;  1UUR A;  1A09 A;  2LNX A;  1OPK A;  3VS3 A;  2PLD A;  2FCI A;  4LUD A;  3VS6 A;  2HDV A;  3BUO B;  4GL9 E;  2H46 E;  4A4C A;  3GXW A;  4LUE A;  1NRV A;  1O41 A;  2KNO A;  5EEQ A;  1AYD A;  2DLZ A;  4XZ0 A;  3PSK A;  1NZV A;  3BUX B;  1BHH A;  3PLF B;  1R1P A;  2RVF A;  2IUI A;  5IBS A;  4OHH A;  1TCE A;  1AYB A;  2EYY A;  4JEG A;  3HHM B;  4K45 A;  4L1B B;  1IJR A;  3PQZ A;  4JGH A;  3MXY A;  3S8L A;  1BKL A;  2CI9 A;  3CBL A;  2HMH A;  1LUN A;  4EIH A;  1O4E A;  3VRO A;  1O4P A;  5CDW A;  1SHD A;  2Y3A B;  2EYV A;  3EAC A;  1O4N A;  1O4F A;  2CR4 A;  4F5B A;  1BFJ A;  1O4H A;  1P13 A;  5HKW A;  3PS5 A;  3QWY A;  1R1Q A;  3OVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...