1X0NA

Nmr structure of growth factor receptor binding protein sh2 domain complexed with the inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
b'WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 2
publication title NMR structure of growth factor receptor binding protein SH2 domain complexed with the inhibitor
rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1x0nA00
2KK6A 3TL0A 2EO3A 3N8MA 3WA4A 2MK2A 1BG1A 1GRIA 2DLZA 1XA6A 1OPKA 5EG3B 1LUIA 5AULA 4H34A 2C0OA 2CS0A 1FHSA 4U17A 4OHIA 3TKZA 3C7IA 4TZIA 1AOUF 1A1BA 1A07A 2PNAA 5DC0B 2YU7A 2DVJA 1D4TA 2ECDA 1NZLA 3PLFB 1BLJA 2H5KA 1BHHB 3BUNB 3US4A 4GWFA 3OB2B 3S8NA 2LNXA 1CSZA 3VS0A 1QG1E 1LKLA 3S9KA 2LQNA 4EY0A 1O4OA 2Y1NA 1NZVA 2K79B 2QMSA 3N7YA 3OVEA 3OP0A 5DC4A 2K7AB 3HHMB 5HKYA 1SHAA 2EL8A 1BKLA 3OB1B 3OV1A 1KA7A 1PICA 4GL9E 4H1OA 1CSYA 1FBVA 1YVLA 4OHDA 4FBNA 1D1ZA 4F5AA 3K2MA 1P13A 1LUKA 2JYQA 2PLDA 1JWOA 2PLEA 2OQ1A 5EELA 3VRZA 1O41A 2Y1MA 1O4HA 1O4LA 2C0IA 5HKZA 1QADA 3VRRA 5EHPA 5GJIA 5DF6A 5EHRA 1UURA 2CI8A 4NWFA 4XZ1A 2IZVA 1O4KA 2EYZA 1SPSA 2H8HA 2RMXA 1O43A 3GXWA 1TZEE 3T04A 3IMJA 3VS2A 3KFJA 2PTKA 1LCJA 1FMKA 3CBLA 2SRCA 2FCIA 4EIHA 1AB2A 1GHUA 2RSYA 1HCSB 1BF5A 1WQUA 2CI9A 5IBSA 4A4BA 1X6CA 4NWGA 5KAZA 2EYYA 5IBMA 2LNWA 2B3OA 3CWGA 1O4MA 5BO4A 1R1SA 1O4FA 2CBLA 2AOAA 2RORA 1Y57A 1O4NA 3PQZA 1A1CA 1O48A 1O4EA 1RPYA 1SKJA 1SPRA 1O44A 1NRVA 1G83A 1M27A 2HMHA 2HDXA 3PSJA 3M7FA 1O4JA 1IJRA 5GJHA 1HCTB 2CIAA 1UUSA 3PS5A 1FU6A 2FO0A 2HUWA 2LCTA 1I3ZA 4OHHA 3VS4A 1CJ1A 1O47A 1OO3A 1JYRA 3PSKA 2C0TA 2ABLA 2EU0A 2CRHA 3VS6A 3VRYA 1LUMA 1BLKA 1O4BA 4L1BB 4U1PA 2AOBA 1X27A 1AYDA 3VRPA 3IN7A 2GSBA 1O4CA 1LKKA 3MXYA 1SHBA 4LUEA 1JYQA 3GQIB 4K44A 1BFIA 5HKWA 3QWXX 5I6VA 4ROJA 1BKMA 1QCFA 4A4CA 2MRJA 2KNOA 3S8LA 3VRNA 2HDVA 4XZ0A 1SHDA 1O4AA 1TCEA 1LUNA 3NHNA 1OPLA 3N84A 1F1WA 1JYUA 5J3XA 1F2FA 4JGHA 5D0JA 2OZOA 1A08A 2MC1A 3MXCA 4K45A 3UF4A 1CWEA 2CR4A 1X0NA 2Y3AB 4K11A 1OO4A 2EO6A 2IUGA 2DM0A 4D8KA 1B47A 1O45A 1O4DA 1RQQC 2DX0A 4FL3A 3VS7A 1O4QA 2IUIA 3VRQA 1ZFPE 3PFVA 1O4RA 1FU5A 1O4IA 3EACA 5DC9A 3VS5A 1BFJA 4LUDA 1O42A 3BUOB 3VS3A 1YVHA 3BKBA 4F5BA 3IMDA 2L6KA 4K2RA 5EEQA 1FBZA 3HIZB 3VROA 3ZNIA 3CD3A 2EKXA 2XP1A 3IN8A 5CDWA 1O46A 3BUXB 3S8OA 4P9VA 4OHLA 4JEGA 1IS0A 1AD5A 2H46E 4GPLB 3BUMB 2AUGA 3UYOA 1BMBA 1O4GA 2RVFA 5AXIA 1R1PA 4DGXA 4E68A 3GXXA 3PJPA 2L3TA 1O49A 4E93A 1R1QA 1O4PA 4DGPA 1AYCA 2HCKA 4FL2A 1JU5A 2SHPA 1MW4A 3VS1A 1LCKA 2GE9A 1K9AA 4JE4A 4OHEA 1A1AA 2MRKA 2LQWA 2DCRA 1A09A 1CWDL 4WWQA 3MAZA 3HCKA 3VGOA 1Z3KA 4F59A 1KSWA 4P9ZA 2L4KA 1M61A 2C9WA 1MILA 2DLYA 1AYAA 1BHFA 2VIFA 1BHHA 1KC2A 1FYRA 1AOTF 2IUHA 3EAZA 1KA6A 1RJAA 1AYBA 2EYVA 2MQIA 1H9OA 1A1EA 2EOBA 1Y1UA 3QWYA 2ETZA 2PNBA 1BM2A 4X6SA 2BBUA 4M4ZA 1A81A 3CXLA 2YSXA 1D4WA 3BUWB 4QSYA
chains in the Genus database with same CATH superfamily
2KK6A 3TL0A 2EO3A 3N8MA 3WA4A 2MK2A 1BG1A 1GRIA 2DLZA 1XA6A 1OPKA 5EG3B 1LUIA 5AULA 4H34A 2C0OA 2CS0A 1FHSA 4U17A 4OHIA 3TKZA 3C7IA 4TZIA 1AOUF 1A1BA 1A07A 2PNAA 5DC0B 2YU7A 2DVJA 1D4TA 2ECDA 1NZLA 3PLFB 1BLJA 2H5KA 1BHHB 3BUNB 3US4A 4GWFA 3OB2B 3S8NA 2LNXA 1CSZA 3VS0A 1QG1E 1LKLA 3S9KA 2LQNA 4EY0A 1O4OA 2Y1NA 1NZVA 2K79B 2QMSA 3N7YA 3OVEA 3OP0A 5DC4A 2K7AB 3HHMB 5HKYA 1SHAA 2EL8A 1BKLA 3OB1B 3OV1A 1KA7A 1PICA 4GL9E 4H1OA 1CSYA 1FBVA 1YVLA 4OHDA 4FBNA 1D1ZA 4F5AA 3K2MA 1P13A 1LUKA 2JYQA 2PLDA 1JWOA 2PLEA 2OQ1A 5EELA 3VRZA 1O41A 2Y1MA 1O4HA 1O4LA 3LYVA 2C0IA 5HKZA 1QADA 3VRRA 5EHPA 5GJIA 5DF6A 5EHRA 1UURA 2CI8A 4NWFA 4XZ1A 2IZVA 1O4KA 2EYZA 1SPSA 2H8HA 2RMXA 1O43A 3GXWA 1TZEE 3T04A 3IMJA 3VS2A 3KFJA 2PTKA 1LCJA 1FMKA 3CBLA 2SRCA 2FCIA 4EIHA 1AB2A 1GHUA 2RSYA 1HCSB 1BF5A 1WQUA 2CI9A 5IBSA 4A4BA 1X6CA 4NWGA 5KAZA 2EYYA 5IBMA 2LNWA 2B3OA 3CWGA 1O4MA 5BO4A 1R1SA 1O4FA 2CBLA 2AOAA 2RORA 1Y57A 1O4NA 3PQZA 1A1CA 1O48A 1O4EA 1RPYA 1SKJA 1SPRA 1O44A 1NRVA 1G83A 1M27A 2HMHA 2HDXA 3PSJA 3M7FA 1O4JA 1IJRA 5GJHA 1HCTB 2CIAA 1UUSA 3PS5A 1FU6A 2FO0A 2HUWA 2LCTA 1I3ZA 4OHHA 3VS4A 1CJ1A 1O47A 1OO3A 1JYRA 3PSKA 2C0TA 2ABLA 2EU0A 2CRHA 3VS6A 3VRYA 1LUMA 1BLKA 1O4BA 4L1BB 4U1PA 2AOBA 1X27A 1AYDA 3VRPA 3IN7A 2GSBA 1O4CA 1LKKA 3MXYA 1SHBA 4LUEA 1JYQA 3GQIB 4K44A 2LRAA 1BFIA 5HKWA 3QWXX 5I6VA 4ROJA 1BKMA 1QCFA 4A4CA 2MRJA 2KNOA 3S8LA 3VRNA 2HDVA 4XZ0A 1SHDA 1O4AA 1TCEA 1LUNA 3NHNA 1OPLA 3N84A 1F1WA 1JYUA 5J3XA 1F2FA 4JGHA 5D0JA 2OZOA 1A08A 2MC1A 3MXCA 4K45A 3UF4A 1CWEA 2CR4A 1X0NA 2Y3AB 4K11A 1OO4A 2EO6A 2IUGA 2DM0A 4D8KA 1B47A 1O45A 1O4DA 1RQQC 2DX0A 4FL3A 3VS7A 1O4QA 2IUIA 2KGYA 3VRQA 1ZFPE 3PFVA 1O4RA 1FU5A 1O4IA 3EACA 5DC9A 3VS5A 1BFJA 4LUDA 1O42A 3BUOB 3VS3A 1YVHA 3BKBA 4F5BA 3IMDA 2L6KA 4K2RA 5EEQA 1FBZA 3HIZB 3VROA 3ZNIA 3CD3A 2EKXA 2XP1A 3IN8A 5CDWA 1O46A 3BUXB 3S8OA 4P9VA 4OHLA 4JEGA 1IS0A 1AD5A 2H46E 4GPLB 3BUMB 2AUGA 3UYOA 1BMBA 1O4GA 2RVFA 5AXIA 1R1PA 4DGXA 4E68A 3GXXA 3PJPA 2L3TA 1O49A 4E93A 1R1QA 1O4PA 4DGPA 1AYCA 2HCKA 4FL2A 1JU5A 2SHPA 1MW4A 3VS1A 1LCKA 2GE9A 1K9AA 4JE4A 4OHEA 1A1AA 2MRKA 2LQWA 2DCRA 1A09A 1CWDL 4WWQA 3MAZA 3HCKA 3VGOA 1Z3KA 4F59A 1KSWA 4P9ZA 2L4KA 1M61A 2C9WA 1MILA 2DLYA 1AYAA 1BHFA 2VIFA 1BHHA 1KC2A 3K2TA 1FYRA 1AOTF 2IUHA 3EAZA 1KA6A 1RJAA 1AYBA 2EYVA 2MQIA 1H9OA 1A1EA 2EOBA 1Y1UA 3QWYA 2ETZA 2PNBA 1BM2A 4X6SA 2BBUA 4M4ZA 1A81A 3CXLA 2YSXA 1D4WA 3BUWB 4QSYA
chains in the Genus database with same CATH topology
2KK6A 3TL0A 2EO3A 3N8MA 3WA4A 2MK2A 1BG1A 1GRIA 2DLZA 1XA6A 1OPKA 5EG3B 1LUIA 5AULA 4H34A 2C0OA 2CS0A 1FHSA 4U17A 4OHIA 3TKZA 3C7IA 4TZIA 1AOUF 1A1BA 1A07A 2PNAA 5DC0B 2YU7A 2DVJA 1D4TA 2ECDA 1NZLA 3PLFB 1BLJA 2H5KA 1BHHB 3BUNB 3US4A 4GWFA 3OB2B 3S8NA 2LNXA 1CSZA 3VS0A 1QG1E 1LKLA 3S9KA 2LQNA 4EY0A 1O4OA 2Y1NA 1NZVA 2K79B 2QMSA 3N7YA 3OVEA 3OP0A 5DC4A 2K7AB 3HHMB 5HKYA 1SHAA 2EL8A 1BKLA 3OB1B 3OV1A 1KA7A 1PICA 4GL9E 4H1OA 1CSYA 1FBVA 1YVLA 4OHDA 4FBNA 1D1ZA 4F5AA 3K2MA 1P13A 1LUKA 2JYQA 2PLDA 1JWOA 2PLEA 2OQ1A 5EELA 3VRZA 1O41A 2Y1MA 1O4HA 1O4LA 2C0IA 5HKZA 1QADA 3VRRA 5EHPA 5GJIA 5DF6A 5EHRA 1UURA 2CI8A 4NWFA 4XZ1A 2IZVA 1O4KA 2EYZA 1SPSA 2H8HA 2RMXA 1O43A 3GXWA 1TZEE 3T04A 3IMJA 3VS2A 3KFJA 2PTKA 1LCJA 1FMKA 3CBLA 2SRCA 2FCIA 4EIHA 1AB2A 1GHUA 2RSYA 1HCSB 1BF5A 1WQUA 2CI9A 5IBSA 4A4BA 1X6CA 4NWGA 5KAZA 2EYYA 5IBMA 2LNWA 2B3OA 3CWGA 1O4MA 5BO4A 1R1SA 1O4FA 2CBLA 2AOAA 2RORA 1Y57A 1O4NA 3PQZA 1A1CA 1O48A 1O4EA 1RPYA 1SKJA 1SPRA 1O44A 1NRVA 1G83A 1M27A 2HMHA 2HDXA 3PSJA 3M7FA 1O4JA 1IJRA 5GJHA 1HCTB 2CIAA 1UUSA 3PS5A 1FU6A 2FO0A 2HUWA 2LCTA 1I3ZA 4OHHA 3VS4A 1CJ1A 1O47A 1OO3A 1JYRA 3PSKA 2C0TA 2ABLA 2EU0A 2CRHA 3VS6A 3VRYA 1LUMA 1BLKA 1O4BA 4L1BB 4U1PA 2AOBA 1X27A 1AYDA 3VRPA 3IN7A 2GSBA 1O4CA 1LKKA 3MXYA 1SHBA 4LUEA 1JYQA 3GQIB 4K44A 1BFIA 5HKWA 3QWXX 5I6VA 4ROJA 1BKMA 1QCFA 4A4CA 2MRJA 2KNOA 3S8LA 3VRNA 2HDVA 4XZ0A 1SHDA 1O4AA 1TCEA 1LUNA 3NHNA 1OPLA 3N84A 1F1WA 1JYUA 5J3XA 1F2FA 4JGHA 5D0JA 2OZOA 1A08A 2MC1A 3MXCA 4K45A 3UF4A 1CWEA 2CR4A 1X0NA 2Y3AB 4K11A 1OO4A 2EO6A 2IUGA 2DM0A 4D8KA 1B47A 1O45A 1O4DA 1RQQC 2DX0A 4FL3A 3VS7A 1O4QA 2IUIA 3VRQA 1ZFPE 3PFVA 1O4RA 1FU5A 1O4IA 3EACA 5DC9A 3VS5A 1BFJA 4LUDA 1O42A 3BUOB 3VS3A 1YVHA 3BKBA 4F5BA 3IMDA 2L6KA 4K2RA 5EEQA 1FBZA 3HIZB 3VROA 3ZNIA 3CD3A 2EKXA 2XP1A 3IN8A 5CDWA 1O46A 3BUXB 3S8OA 4P9VA 4OHLA 4JEGA 1IS0A 1AD5A 2H46E 4GPLB 3BUMB 2AUGA 3UYOA 1BMBA 1O4GA 2RVFA 5AXIA 1R1PA 4DGXA 4E68A 3GXXA 3PJPA 2L3TA 1O49A 4E93A 1R1QA 1O4PA 4DGPA 1AYCA 2HCKA 4FL2A 1JU5A 2SHPA 1MW4A 3VS1A 1LCKA 2GE9A 1K9AA 4JE4A 4OHEA 1A1AA 2MRKA 2LQWA 2DCRA 1A09A 1CWDL 4WWQA 3MAZA 3HCKA 3VGOA 1Z3KA 4F59A 1KSWA 4P9ZA 2L4KA 1M61A 2C9WA 1MILA 2DLYA 1AYAA 1BHFA 2VIFA 1BHHA 1KC2A 1FYRA 1AOTF 2IUHA 3EAZA 1KA6A 1RJAA 1AYBA 2EYVA 2MQIA 1H9OA 1A1EA 2EOBA 1Y1UA 3QWYA 2ETZA 2PNBA 1BM2A 4X6SA 2BBUA 4M4ZA 1A81A 3CXLA 2YSXA 1D4WA 3BUWB 4QSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK6 A;  3TL0 A;  2EO3 A;  3N8M A;  3WA4 A;  2MK2 A;  1BG1 A;  1GRI A;  2DLZ A;  1XA6 A;  1OPK A;  5EG3 B;  1LUI A;  5AUL A;  4H34 A;  2C0O A;  2CS0 A;  1FHS A;  4U17 A;  4OHI A;  3TKZ A;  3C7I A;  4TZI A;  1AOU F;  1A1B A;  1A07 A;  2PNA A;  5DC0 B;  2YU7 A;  2DVJ A;  1D4T A;  2ECD A;  1NZL A;  3PLF B;  1BLJ A;  2H5K A;  1BHH B;  3BUN B;  3US4 A;  4GWF A;  3OB2 B;  3S8N A;  2LNX A;  1CSZ A;  3VS0 A;  1QG1 E;  1LKL A;  3S9K A;  2LQN A;  4EY0 A;  1O4O A;  2Y1N A;  1NZV A;  2K79 B;  2QMS A;  3N7Y A;  3OVE A;  3OP0 A;  5DC4 A;  2K7A B;  3HHM B;  5HKY A;  1SHA A;  2EL8 A;  1BKL A;  3OB1 B;  3OV1 A;  1KA7 A;  1PIC A;  4GL9 E;  4H1O A;  1CSY A;  1FBV A;  1YVL A;  4OHD A;  4FBN A;  1D1Z A;  4F5A A;  3K2M A;  1P13 A;  1LUK A;  2JYQ A;  2PLD A;  1JWO A;  2PLE A;  2OQ1 A;  5EEL A;  3VRZ A;  1O41 A;  2Y1M A;  1O4H A;  1O4L A;  2C0I A;  5HKZ A;  1QAD A;  3VRR A;  5EHP A;  5GJI A;  5DF6 A;  5EHR A;  1UUR A;  2CI8 A;  4NWF A;  4XZ1 A;  2IZV A;  1O4K A;  2EYZ A;  1SPS A;  2H8H A;  2RMX A;  1O43 A;  3GXW A;  1TZE E;  3T04 A;  3IMJ A;  3VS2 A;  3KFJ A;  2PTK A;  1LCJ A;  1FMK A;  3CBL A;  2SRC A;  2FCI A;  4EIH A;  1AB2 A;  1GHU A;  2RSY A;  1HCS B;  1BF5 A;  1WQU A;  2CI9 A;  5IBS A;  4A4B A;  1X6C A;  4NWG A;  5KAZ A;  2EYY A;  5IBM A;  2LNW A;  2B3O A;  3CWG A;  1O4M A;  5BO4 A;  1R1S A;  1O4F A;  2CBL A;  2AOA A;  2ROR A;  1Y57 A;  1O4N A;  3PQZ A;  1A1C A;  1O48 A;  1O4E A;  1RPY A;  1SKJ A;  1SPR A;  1O44 A;  1NRV A;  1G83 A;  1M27 A;  2HMH A;  2HDX A;  3PSJ A;  3M7F A;  1O4J A;  1IJR A;  5GJH A;  1HCT B;  2CIA A;  1UUS A;  3PS5 A;  1FU6 A;  2FO0 A;  2HUW A;  2LCT A;  1I3Z A;  4OHH A;  3VS4 A;  1CJ1 A;  1O47 A;  1OO3 A;  1JYR A;  3PSK A;  2C0T A;  2ABL A;  2EU0 A;  2CRH A;  3VS6 A;  3VRY A;  1LUM A;  1BLK A;  1O4B A;  4L1B B;  4U1P A;  2AOB A;  1X27 A;  1AYD A;  3VRP A;  3IN7 A;  2GSB A;  1O4C A;  1LKK A;  3MXY A;  1SHB A;  4LUE A;  1JYQ A;  3GQI B;  4K44 A;  1BFI A;  5HKW A;  3QWX X;  5I6V A;  4ROJ A;  1BKM A;  1QCF A;  4A4C A;  2MRJ A;  2KNO A;  3S8L A;  3VRN A;  2HDV A;  4XZ0 A;  1SHD A;  1O4A A;  1TCE A;  1LUN A;  3NHN A;  1OPL A;  3N84 A;  1F1W A;  1JYU A;  5J3X A;  1F2F A;  4JGH A;  5D0J A;  2OZO A;  1A08 A;  2MC1 A;  3MXC A;  4K45 A;  3UF4 A;  1CWE A;  2CR4 A;  1X0N A;  2Y3A B;  4K11 A;  1OO4 A;  2EO6 A;  2IUG A;  2DM0 A;  4D8K A;  1B47 A;  1O45 A;  1O4D A;  1RQQ C;  2DX0 A;  4FL3 A;  3VS7 A;  1O4Q A;  2IUI A;  3VRQ A;  1ZFP E;  3PFV A;  1O4R A;  1FU5 A;  1O4I A;  3EAC A;  5DC9 A;  3VS5 A;  1BFJ A;  4LUD A;  1O42 A;  3BUO B;  3VS3 A;  1YVH A;  3BKB A;  4F5B A;  3IMD A;  2L6K A;  4K2R A;  5EEQ A;  1FBZ A;  3HIZ B;  3VRO A;  3ZNI A;  3CD3 A;  2EKX A;  2XP1 A;  3IN8 A;  5CDW A;  1O46 A;  3BUX B;  3S8O A;  4P9V A;  4OHL A;  4JEG A;  1IS0 A;  1AD5 A;  2H46 E;  4GPL B;  3BUM B;  2AUG A;  3UYO A;  1BMB A;  1O4G A;  2RVF A;  5AXI A;  1R1P A;  4DGX A;  4E68 A;  3GXX A;  3PJP A;  2L3T A;  1O49 A;  4E93 A;  1R1Q A;  1O4P A;  4DGP A;  1AYC A;  2HCK A;  4FL2 A;  1JU5 A;  2SHP A;  1MW4 A;  3VS1 A;  1LCK A;  2GE9 A;  1K9A A;  4JE4 A;  4OHE A;  1A1A A;  2MRK A;  2LQW A;  2DCR A;  1A09 A;  1CWD L;  4WWQ A;  3MAZ A;  3HCK A;  3VGO A;  1Z3K A;  4F59 A;  1KSW A;  4P9Z A;  2L4K A;  1M61 A;  2C9W A;  1MIL A;  2DLY A;  1AYA A;  1BHF A;  2VIF A;  1BHH A;  1KC2 A;  1FYR A;  1AOT F;  2IUH A;  3EAZ A;  1KA6 A;  1RJA A;  1AYB A;  2EYV A;  2MQI A;  1H9O A;  1A1E A;  2EOB A;  1Y1U A;  3QWY A;  2ETZ A;  2PNB A;  1BM2 A;  4X6S A;  2BBU A;  4M4Z A;  1A81 A;  3CXL A;  2YSX A;  1D4W A;  3BUW B;  4QSY A; 
#chains in the Genus database with same CATH topology
 2KK6 A;  3TL0 A;  2EO3 A;  3N8M A;  3WA4 A;  2MK2 A;  1BG1 A;  1GRI A;  2DLZ A;  1XA6 A;  1OPK A;  5EG3 B;  1LUI A;  5AUL A;  4H34 A;  2C0O A;  2CS0 A;  1FHS A;  4U17 A;  4OHI A;  3TKZ A;  3C7I A;  4TZI A;  1AOU F;  1A1B A;  1A07 A;  2PNA A;  5DC0 B;  2YU7 A;  2DVJ A;  1D4T A;  2ECD A;  1NZL A;  3PLF B;  1BLJ A;  2H5K A;  1BHH B;  3BUN B;  3US4 A;  4GWF A;  3OB2 B;  3S8N A;  2LNX A;  1CSZ A;  3VS0 A;  1QG1 E;  1LKL A;  3S9K A;  2LQN A;  4EY0 A;  1O4O A;  2Y1N A;  1NZV A;  2K79 B;  2QMS A;  3N7Y A;  3OVE A;  3OP0 A;  5DC4 A;  2K7A B;  3HHM B;  5HKY A;  1SHA A;  2EL8 A;  1BKL A;  3OB1 B;  3OV1 A;  1KA7 A;  1PIC A;  4GL9 E;  4H1O A;  1CSY A;  1FBV A;  1YVL A;  4OHD A;  4FBN A;  1D1Z A;  4F5A A;  3K2M A;  1P13 A;  1LUK A;  2JYQ A;  2PLD A;  1JWO A;  2PLE A;  2OQ1 A;  5EEL A;  3VRZ A;  1O41 A;  2Y1M A;  1O4H A;  1O4L A;  3LYV A;  2C0I A;  5HKZ A;  1QAD A;  3VRR A;  5EHP A;  5GJI A;  5DF6 A;  5EHR A;  1UUR A;  2CI8 A;  4NWF A;  4XZ1 A;  2IZV A;  1O4K A;  2EYZ A;  1SPS A;  2H8H A;  2RMX A;  1O43 A;  3GXW A;  1TZE E;  3T04 A;  3IMJ A;  3VS2 A;  3KFJ A;  2PTK A;  1LCJ A;  1FMK A;  3CBL A;  2SRC A;  2FCI A;  4EIH A;  1AB2 A;  1GHU A;  2RSY A;  1HCS B;  1BF5 A;  1WQU A;  2CI9 A;  5IBS A;  4A4B A;  1X6C A;  4NWG A;  5KAZ A;  2EYY A;  5IBM A;  2LNW A;  2B3O A;  3CWG A;  1O4M A;  5BO4 A;  1R1S A;  1O4F A;  2CBL A;  2AOA A;  2ROR A;  1Y57 A;  1O4N A;  3PQZ A;  1A1C A;  1O48 A;  1O4E A;  1RPY A;  1SKJ A;  1SPR A;  1O44 A;  1NRV A;  1G83 A;  1M27 A;  2HMH A;  2HDX A;  3PSJ A;  3M7F A;  1O4J A;  1IJR A;  5GJH A;  1HCT B;  2CIA A;  1UUS A;  3PS5 A;  1FU6 A;  2FO0 A;  2HUW A;  2LCT A;  1I3Z A;  4OHH A;  3VS4 A;  1CJ1 A;  1O47 A;  1OO3 A;  1JYR A;  3PSK A;  2C0T A;  2ABL A;  2EU0 A;  2CRH A;  3VS6 A;  3VRY A;  1LUM A;  1BLK A;  1O4B A;  4L1B B;  4U1P A;  2AOB A;  1X27 A;  1AYD A;  3VRP A;  3IN7 A;  2GSB A;  1O4C A;  1LKK A;  3MXY A;  1SHB A;  4LUE A;  1JYQ A;  3GQI B;  4K44 A;  2LRA A;  1BFI A;  5HKW A;  3QWX X;  5I6V A;  4ROJ A;  1BKM A;  1QCF A;  4A4C A;  2MRJ A;  2KNO A;  3S8L A;  3VRN A;  2HDV A;  4XZ0 A;  1SHD A;  1O4A A;  1TCE A;  1LUN A;  3NHN A;  1OPL A;  3N84 A;  1F1W A;  1JYU A;  5J3X A;  1F2F A;  4JGH A;  5D0J A;  2OZO A;  1A08 A;  2MC1 A;  3MXC A;  4K45 A;  3UF4 A;  1CWE A;  2CR4 A;  1X0N A;  2Y3A B;  4K11 A;  1OO4 A;  2EO6 A;  2IUG A;  2DM0 A;  4D8K A;  1B47 A;  1O45 A;  1O4D A;  1RQQ C;  2DX0 A;  4FL3 A;  3VS7 A;  1O4Q A;  2IUI A;  2KGY A;  3VRQ A;  1ZFP E;  3PFV A;  1O4R A;  1FU5 A;  1O4I A;  3EAC A;  5DC9 A;  3VS5 A;  1BFJ A;  4LUD A;  1O42 A;  3BUO B;  3VS3 A;  1YVH A;  3BKB A;  4F5B A;  3IMD A;  2L6K A;  4K2R A;  5EEQ A;  1FBZ A;  3HIZ B;  3VRO A;  3ZNI A;  3CD3 A;  2EKX A;  2XP1 A;  3IN8 A;  5CDW A;  1O46 A;  3BUX B;  3S8O A;  4P9V A;  4OHL A;  4JEG A;  1IS0 A;  1AD5 A;  2H46 E;  4GPL B;  3BUM B;  2AUG A;  3UYO A;  1BMB A;  1O4G A;  2RVF A;  5AXI A;  1R1P A;  4DGX A;  4E68 A;  3GXX A;  3PJP A;  2L3T A;  1O49 A;  4E93 A;  1R1Q A;  1O4P A;  4DGP A;  1AYC A;  2HCK A;  4FL2 A;  1JU5 A;  2SHP A;  1MW4 A;  3VS1 A;  1LCK A;  2GE9 A;  1K9A A;  4JE4 A;  4OHE A;  1A1A A;  2MRK A;  2LQW A;  2DCR A;  1A09 A;  1CWD L;  4WWQ A;  3MAZ A;  3HCK A;  3VGO A;  1Z3K A;  4F59 A;  1KSW A;  4P9Z A;  2L4K A;  1M61 A;  2C9W A;  1MIL A;  2DLY A;  1AYA A;  1BHF A;  2VIF A;  1BHH A;  1KC2 A;  3K2T A;  1FYR A;  1AOT F;  2IUH A;  3EAZ A;  1KA6 A;  1RJA A;  1AYB A;  2EYV A;  2MQI A;  1H9O A;  1A1E A;  2EOB A;  1Y1U A;  3QWY A;  2ETZ A;  2PNB A;  1BM2 A;  4X6S A;  2BBU A;  4M4Z A;  1A81 A;  3CXL A;  2YSX A;  1D4W A;  3BUW B;  4QSY A; 
#chains in the Genus database with same CATH homology
 2KK6 A;  3TL0 A;  2EO3 A;  3N8M A;  3WA4 A;  2MK2 A;  1BG1 A;  1GRI A;  2DLZ A;  1XA6 A;  1OPK A;  5EG3 B;  1LUI A;  5AUL A;  4H34 A;  2C0O A;  2CS0 A;  1FHS A;  4U17 A;  4OHI A;  3TKZ A;  3C7I A;  4TZI A;  1AOU F;  1A1B A;  1A07 A;  2PNA A;  5DC0 B;  2YU7 A;  2DVJ A;  1D4T A;  2ECD A;  1NZL A;  3PLF B;  1BLJ A;  2H5K A;  1BHH B;  3BUN B;  3US4 A;  4GWF A;  3OB2 B;  3S8N A;  2LNX A;  1CSZ A;  3VS0 A;  1QG1 E;  1LKL A;  3S9K A;  2LQN A;  4EY0 A;  1O4O A;  2Y1N A;  1NZV A;  2K79 B;  2QMS A;  3N7Y A;  3OVE A;  3OP0 A;  5DC4 A;  2K7A B;  3HHM B;  5HKY A;  1SHA A;  2EL8 A;  1BKL A;  3OB1 B;  3OV1 A;  1KA7 A;  1PIC A;  4GL9 E;  4H1O A;  1CSY A;  1FBV A;  1YVL A;  4OHD A;  4FBN A;  1D1Z A;  4F5A A;  3K2M A;  1P13 A;  1LUK A;  2JYQ A;  2PLD A;  1JWO A;  2PLE A;  2OQ1 A;  5EEL A;  3VRZ A;  1O41 A;  2Y1M A;  1O4H A;  1O4L A;  2C0I A;  5HKZ A;  1QAD A;  3VRR A;  5EHP A;  5GJI A;  5DF6 A;  5EHR A;  1UUR A;  2CI8 A;  4NWF A;  4XZ1 A;  2IZV A;  1O4K A;  2EYZ A;  1SPS A;  2H8H A;  2RMX A;  1O43 A;  3GXW A;  1TZE E;  3T04 A;  3IMJ A;  3VS2 A;  3KFJ A;  2PTK A;  1LCJ A;  1FMK A;  3CBL A;  2SRC A;  2FCI A;  4EIH A;  1AB2 A;  1GHU A;  2RSY A;  1HCS B;  1BF5 A;  1WQU A;  2CI9 A;  5IBS A;  4A4B A;  1X6C A;  4NWG A;  5KAZ A;  2EYY A;  5IBM A;  2LNW A;  2B3O A;  3CWG A;  1O4M A;  5BO4 A;  1R1S A;  1O4F A;  2CBL A;  2AOA A;  2ROR A;  1Y57 A;  1O4N A;  3PQZ A;  1A1C A;  1O48 A;  1O4E A;  1RPY A;  1SKJ A;  1SPR A;  1O44 A;  1NRV A;  1G83 A;  1M27 A;  2HMH A;  2HDX A;  3PSJ A;  3M7F A;  1O4J A;  1IJR A;  5GJH A;  1HCT B;  2CIA A;  1UUS A;  3PS5 A;  1FU6 A;  2FO0 A;  2HUW A;  2LCT A;  1I3Z A;  4OHH A;  3VS4 A;  1CJ1 A;  1O47 A;  1OO3 A;  1JYR A;  3PSK A;  2C0T A;  2ABL A;  2EU0 A;  2CRH A;  3VS6 A;  3VRY A;  1LUM A;  1BLK A;  1O4B A;  4L1B B;  4U1P A;  2AOB A;  1X27 A;  1AYD A;  3VRP A;  3IN7 A;  2GSB A;  1O4C A;  1LKK A;  3MXY A;  1SHB A;  4LUE A;  1JYQ A;  3GQI B;  4K44 A;  1BFI A;  5HKW A;  3QWX X;  5I6V A;  4ROJ A;  1BKM A;  1QCF A;  4A4C A;  2MRJ A;  2KNO A;  3S8L A;  3VRN A;  2HDV A;  4XZ0 A;  1SHD A;  1O4A A;  1TCE A;  1LUN A;  3NHN A;  1OPL A;  3N84 A;  1F1W A;  1JYU A;  5J3X A;  1F2F A;  4JGH A;  5D0J A;  2OZO A;  1A08 A;  2MC1 A;  3MXC A;  4K45 A;  3UF4 A;  1CWE A;  2CR4 A;  1X0N A;  2Y3A B;  4K11 A;  1OO4 A;  2EO6 A;  2IUG A;  2DM0 A;  4D8K A;  1B47 A;  1O45 A;  1O4D A;  1RQQ C;  2DX0 A;  4FL3 A;  3VS7 A;  1O4Q A;  2IUI A;  3VRQ A;  1ZFP E;  3PFV A;  1O4R A;  1FU5 A;  1O4I A;  3EAC A;  5DC9 A;  3VS5 A;  1BFJ A;  4LUD A;  1O42 A;  3BUO B;  3VS3 A;  1YVH A;  3BKB A;  4F5B A;  3IMD A;  2L6K A;  4K2R A;  5EEQ A;  1FBZ A;  3HIZ B;  3VRO A;  3ZNI A;  3CD3 A;  2EKX A;  2XP1 A;  3IN8 A;  5CDW A;  1O46 A;  3BUX B;  3S8O A;  4P9V A;  4OHL A;  4JEG A;  1IS0 A;  1AD5 A;  2H46 E;  4GPL B;  3BUM B;  2AUG A;  3UYO A;  1BMB A;  1O4G A;  2RVF A;  5AXI A;  1R1P A;  4DGX A;  4E68 A;  3GXX A;  3PJP A;  2L3T A;  1O49 A;  4E93 A;  1R1Q A;  1O4P A;  4DGP A;  1AYC A;  2HCK A;  4FL2 A;  1JU5 A;  2SHP A;  1MW4 A;  3VS1 A;  1LCK A;  2GE9 A;  1K9A A;  4JE4 A;  4OHE A;  1A1A A;  2MRK A;  2LQW A;  2DCR A;  1A09 A;  1CWD L;  4WWQ A;  3MAZ A;  3HCK A;  3VGO A;  1Z3K A;  4F59 A;  1KSW A;  4P9Z A;  2L4K A;  1M61 A;  2C9W A;  1MIL A;  2DLY A;  1AYA A;  1BHF A;  2VIF A;  1BHH A;  1KC2 A;  1FYR A;  1AOT F;  2IUH A;  3EAZ A;  1KA6 A;  1RJA A;  1AYB A;  2EYV A;  2MQI A;  1H9O A;  1A1E A;  2EOB A;  1Y1U A;  3QWY A;  2ETZ A;  2PNB A;  1BM2 A;  4X6S A;  2BBU A;  4M4Z A;  1A81 A;  3CXL A;  2YSX A;  1D4W A;  3BUW B;  4QSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...