2IUIA

Crystal structure of the pi3-kinase p85 n-terminal sh2 domain in complex with pdgfr phosphotyrosyl peptide
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
b'MSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit alpha
publication title Crystal Structure of the Pi 3-Kinase P85 Amino- Terminal Sh2 Domain and its Phosphopeptide Complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2iuiA00
4OHHA 1AYCA 1A1CA 2HDXA 1OO3A 1TCEA 2KNOA 4X6SA 2PLDA 1CWDL 3MXYA 1A08A 2ETZA 1O45A 1O4GA 3OB1B 1D4TA 2LNXA 3NHNA 2MRJA 1A1EA 4K44A 2SHPA 2EO3A 4FL3A 3IMDA 3TKZA 1D4WA 1KC2A 1LCJA 2DX0A 1X6CA 3S8LA 4QSYA 2CS0A 1BHFA 1O4NA 1O4LA 3VS4A 3T04A 4F59A 1O4KA 1SHDA 1JYQA 3N84A 2RORA 1UURA 1AOUF 1BKLA 2GSBA 5EHPA 4LUDA 1BMBA 4E68A 2FCIA 1O4PA 2MK2A 2H5KA 2FO0A 4JGHA 1CWEA 5EELA 1G83A 1KSWA 5HKWA 5IBMA 2BBUA 1R1SA 1O4OA 1IS0A 1GRIA 1QADA 3VRZA 4ROJA 1YVHA 2ABLA 1UUSA 3TL0A 1JYUA 2CR4A 4NWFA 1AB2A 1A81A 3PLFB 1LKKA 3VROA 3CBLA 4H1OA 2OQ1A 1Y1UA 3VRRA 1BF5A 3WA4A 1M61A 1AYDA 4XZ0A 3VS1A 3GQIB 1JYRA 2MC1A 2CRHA 1AOTF 3HIZB 5EEQA 3MXCA 2L4KA 5AULA 2Y1MA 5D0JA 1BHHA 2EYYA 5J3XA 1F2FA 4DGXA 2DLYA 1O44A 1A07A 4A4BA 1RQQC 1QG1E 1CJ1A 3PS5A 3VRNA 1LUMA 1LUIA 3VRYA 2K79B 2EKXA 4JEGA 2C0IA 1O46A 4F5AA 2CIAA 2SRCA 2EO6A 1A1AA 1LUNA 5EHRA 1O48A 1HCSB 1AD5A 1B47A 4OHDA 1BG1A 1R1QA 1LUKA 2EYVA 3GXXA 3BUOB 2HMHA 4DGPA 2CI9A 1M27A 1O4DA 4U17A 1WQUA 4GL9E 5KAZA 4NWGA 2L3TA 1BLJA 1Y57A 2DCRA 5GJIA 2AOAA 1SPRA 2C0OA 1BKMA 2DVJA 3UF4A 1O4IA 1FHSA 2JYQA 3PSJA 3UYOA 2DLZA 3HHMB 5HKZA 3N8MA 2PTKA 1QCFA 4U1PA 4K45A 2EU0A 2HDVA 1O4FA 3BUWB 1SHAA 2PNBA 5I6VA 3N7YA 4K11A 2RVFA 5EG3B 1BFIA 1FBZA 1O4AA 2C9WA 2RSYA 4H34A 4FL2A 1NZLA 2AOBA 3OP0A 2Y1NA 3PSKA 3C7IA 1NRVA 5DF6A 1AYAA 3QWYA 1TZEE 1H9OA 2PLEA 1K9AA 2DM0A 3QWXX 2IUIA 1O4BA 5AXIA 3OB2B 1MW4A 4FBNA 2OZOA 1SKJA 2EL8A 3OVEA 1BFJA 4L1BB 3PJPA 1FU5A 2IZVA 1FBVA 4OHIA 1JU5A 2PNAA 2LNWA 2IUGA 4XZ1A 1O4HA 1XA6A 1FYRA 1SHBA 3HCKA 3BUXB 3BUMB 1O43A 4OHLA 2LQNA 2C0TA 3CD3A 4EIHA 3IN7A 4GPLB 3GXWA 1IJRA 5DC0B 2LCTA 3VS0A 1ZFPE 3PFVA 2RMXA 3K2MA 5GJHA 1O4EA 1BHHB 4JE4A 1JWOA 4K2RA 2HUWA 1Z3KA 5DC4A 1O41A 1O4MA 4WWQA 2YSXA 2YU7A 3OV1A 1KA6A 1LKLA 1OPKA 3EACA 3VGOA 2Y3AB 2IUHA 2HCKA 1CSYA 1PICA 3IMJA 3MAZA 3CWGA 1CSZA 2H46E 1D1ZA 1YVLA 2MQIA 3IN8A 4OHEA 3VS6A 1SPSA 1P13A 3VRPA 4GWFA 3PQZA 3VS7A 2EOBA 2L6KA 4A4CA 5CDWA 2XP1A 1BM2A 1O42A 1O47A 1FMKA 1X27A 3BUNB 4LUEA 5BO4A 2CI8A 1KA7A 1MILA 1RJAA 3ZNIA 3KFJA 2MRKA 1OO4A 2AUGA 2EYZA 1GHUA 2ECDA 4D8KA 1AYBA 1X0NA 3M7FA 2H8HA 1HCTB 4E93A 1O4CA 2K7AB 5DC9A 3EAZA 3VRQA 3VS2A 1RPYA 4F5BA 1O49A 2LQWA 3S8NA 4P9ZA 1LCKA 1O4JA 1A09A 2KK6A 4P9VA 1NZVA 3US4A 4M4ZA 5IBSA 4TZIA 2CBLA 1BLKA 1F1WA 1O4RA 3VS5A 1A1BA 2QMSA 3VS3A 3BKBA 1OPLA 1R1PA 5HKYA 3CXLA 2VIFA 2GE9A 2B3OA 3S9KA 1I3ZA 1O4QA 4EY0A 1FU6A 3S8OA
chains in the Genus database with same CATH superfamily
4OHHA 1AYCA 1A1CA 2HDXA 1OO3A 1TCEA 2KNOA 4X6SA 2PLDA 1CWDL 3MXYA 1A08A 2ETZA 1O45A 1O4GA 3OB1B 1D4TA 2LNXA 3NHNA 2MRJA 1A1EA 4K44A 2SHPA 2EO3A 4FL3A 3IMDA 3TKZA 1D4WA 1KC2A 1LCJA 2DX0A 1X6CA 3S8LA 4QSYA 2CS0A 1BHFA 1O4NA 1O4LA 3VS4A 3T04A 4F59A 1O4KA 1SHDA 1JYQA 3N84A 2RORA 1UURA 1AOUF 1BKLA 2GSBA 5EHPA 3LYVA 4LUDA 1BMBA 4E68A 2FCIA 1O4PA 2MK2A 2H5KA 2FO0A 4JGHA 1CWEA 5EELA 1G83A 1KSWA 5HKWA 5IBMA 2BBUA 1R1SA 1O4OA 1IS0A 1GRIA 1QADA 3VRZA 4ROJA 1YVHA 2ABLA 1UUSA 3TL0A 1JYUA 2CR4A 4NWFA 1AB2A 1A81A 3PLFB 1LKKA 3VROA 3CBLA 4H1OA 2OQ1A 1Y1UA 3VRRA 1BF5A 3WA4A 1M61A 1AYDA 4XZ0A 3VS1A 3GQIB 1JYRA 2MC1A 2CRHA 1AOTF 3HIZB 5EEQA 3MXCA 2L4KA 5AULA 2Y1MA 5D0JA 1BHHA 2EYYA 5J3XA 1F2FA 4DGXA 2DLYA 1O44A 1A07A 4A4BA 1RQQC 1QG1E 1CJ1A 3PS5A 3VRNA 1LUMA 1LUIA 3VRYA 2K79B 2EKXA 4JEGA 2C0IA 1O46A 4F5AA 2CIAA 2SRCA 2EO6A 1A1AA 1LUNA 5EHRA 1O48A 1HCSB 1AD5A 1B47A 2KGYA 4OHDA 1BG1A 1R1QA 1LUKA 2EYVA 3GXXA 3BUOB 2HMHA 4DGPA 2CI9A 1M27A 1O4DA 4U17A 1WQUA 4GL9E 5KAZA 4NWGA 2L3TA 1BLJA 1Y57A 2DCRA 5GJIA 2AOAA 1SPRA 2C0OA 1BKMA 2DVJA 3UF4A 1O4IA 1FHSA 2JYQA 3PSJA 3UYOA 2DLZA 3HHMB 5HKZA 3N8MA 2PTKA 1QCFA 4U1PA 4K45A 2EU0A 2HDVA 1O4FA 3BUWB 1SHAA 2PNBA 5I6VA 3N7YA 4K11A 2RVFA 5EG3B 1BFIA 1FBZA 1O4AA 2C9WA 2RSYA 4H34A 4FL2A 1NZLA 2AOBA 3OP0A 2Y1NA 3PSKA 3C7IA 1NRVA 5DF6A 1AYAA 3QWYA 1TZEE 1H9OA 2PLEA 1K9AA 2DM0A 3QWXX 2IUIA 1O4BA 5AXIA 3OB2B 1MW4A 4FBNA 2OZOA 1SKJA 2EL8A 3OVEA 1BFJA 4L1BB 3PJPA 1FU5A 2IZVA 1FBVA 4OHIA 1JU5A 2PNAA 2LNWA 2IUGA 4XZ1A 1O4HA 1XA6A 1FYRA 1SHBA 3HCKA 3BUXB 3BUMB 1O43A 4OHLA 2LQNA 2C0TA 3CD3A 4EIHA 3IN7A 4GPLB 3GXWA 1IJRA 5DC0B 2LCTA 3VS0A 1ZFPE 3PFVA 2RMXA 3K2MA 5GJHA 1O4EA 1BHHB 4JE4A 1JWOA 4K2RA 2HUWA 1Z3KA 5DC4A 1O41A 1O4MA 4WWQA 2YSXA 2LRAA 2YU7A 3OV1A 1KA6A 1LKLA 1OPKA 3EACA 3VGOA 2Y3AB 2IUHA 2HCKA 1CSYA 1PICA 3IMJA 3MAZA 3CWGA 1CSZA 2H46E 1D1ZA 1YVLA 2MQIA 3IN8A 4OHEA 3VS6A 1SPSA 1P13A 3VRPA 4GWFA 3PQZA 3VS7A 2EOBA 2L6KA 4A4CA 5CDWA 2XP1A 1BM2A 1O42A 1O47A 1FMKA 1X27A 3BUNB 4LUEA 5BO4A 2CI8A 1KA7A 1MILA 1RJAA 3ZNIA 3KFJA 2MRKA 1OO4A 2AUGA 2EYZA 1GHUA 2ECDA 4D8KA 1AYBA 1X0NA 3M7FA 2H8HA 3K2TA 1HCTB 4E93A 1O4CA 2K7AB 5DC9A 3EAZA 3VRQA 3VS2A 1RPYA 4F5BA 1O49A 2LQWA 3S8NA 4P9ZA 1LCKA 1O4JA 1A09A 2KK6A 4P9VA 1NZVA 3US4A 4M4ZA 5IBSA 4TZIA 2CBLA 1BLKA 1F1WA 1O4RA 3VS5A 1A1BA 2QMSA 3VS3A 3BKBA 1OPLA 1R1PA 5HKYA 3CXLA 2VIFA 2GE9A 2B3OA 3S9KA 1I3ZA 1O4QA 4EY0A 1FU6A 3S8OA
chains in the Genus database with same CATH topology
4OHHA 1AYCA 1A1CA 2HDXA 1OO3A 1TCEA 2KNOA 4X6SA 2PLDA 1CWDL 3MXYA 1A08A 2ETZA 1O45A 1O4GA 3OB1B 1D4TA 2LNXA 3NHNA 2MRJA 1A1EA 4K44A 2SHPA 2EO3A 4FL3A 3IMDA 3TKZA 1D4WA 1KC2A 1LCJA 2DX0A 1X6CA 3S8LA 4QSYA 2CS0A 1BHFA 1O4NA 1O4LA 3VS4A 3T04A 4F59A 1O4KA 1SHDA 1JYQA 3N84A 2RORA 1UURA 1AOUF 1BKLA 2GSBA 5EHPA 4LUDA 1BMBA 4E68A 2FCIA 1O4PA 2MK2A 2H5KA 2FO0A 4JGHA 1CWEA 5EELA 1G83A 1KSWA 5HKWA 5IBMA 2BBUA 1R1SA 1O4OA 1IS0A 1GRIA 1QADA 3VRZA 4ROJA 1YVHA 2ABLA 1UUSA 3TL0A 1JYUA 2CR4A 4NWFA 1AB2A 1A81A 3PLFB 1LKKA 3VROA 3CBLA 4H1OA 2OQ1A 1Y1UA 3VRRA 1BF5A 3WA4A 1M61A 1AYDA 4XZ0A 3VS1A 3GQIB 1JYRA 2MC1A 2CRHA 1AOTF 3HIZB 5EEQA 3MXCA 2L4KA 5AULA 2Y1MA 5D0JA 1BHHA 2EYYA 5J3XA 1F2FA 4DGXA 2DLYA 1O44A 1A07A 4A4BA 1RQQC 1QG1E 1CJ1A 3PS5A 3VRNA 1LUMA 1LUIA 3VRYA 2K79B 2EKXA 4JEGA 2C0IA 1O46A 4F5AA 2CIAA 2SRCA 2EO6A 1A1AA 1LUNA 5EHRA 1O48A 1HCSB 1AD5A 1B47A 4OHDA 1BG1A 1R1QA 1LUKA 2EYVA 3GXXA 3BUOB 2HMHA 4DGPA 2CI9A 1M27A 1O4DA 4U17A 1WQUA 4GL9E 5KAZA 4NWGA 2L3TA 1BLJA 1Y57A 2DCRA 5GJIA 2AOAA 1SPRA 2C0OA 1BKMA 2DVJA 3UF4A 1O4IA 1FHSA 2JYQA 3PSJA 3UYOA 2DLZA 3HHMB 5HKZA 3N8MA 2PTKA 1QCFA 4U1PA 4K45A 2EU0A 2HDVA 1O4FA 3BUWB 1SHAA 2PNBA 5I6VA 3N7YA 4K11A 2RVFA 5EG3B 1BFIA 1FBZA 1O4AA 2C9WA 2RSYA 4H34A 4FL2A 1NZLA 2AOBA 3OP0A 2Y1NA 3PSKA 3C7IA 1NRVA 5DF6A 1AYAA 3QWYA 1TZEE 1H9OA 2PLEA 1K9AA 2DM0A 3QWXX 2IUIA 1O4BA 5AXIA 3OB2B 1MW4A 4FBNA 2OZOA 1SKJA 2EL8A 3OVEA 1BFJA 4L1BB 3PJPA 1FU5A 2IZVA 1FBVA 4OHIA 1JU5A 2PNAA 2LNWA 2IUGA 4XZ1A 1O4HA 1XA6A 1FYRA 1SHBA 3HCKA 3BUXB 3BUMB 1O43A 4OHLA 2LQNA 2C0TA 3CD3A 4EIHA 3IN7A 4GPLB 3GXWA 1IJRA 5DC0B 2LCTA 3VS0A 1ZFPE 3PFVA 2RMXA 3K2MA 5GJHA 1O4EA 1BHHB 4JE4A 1JWOA 4K2RA 2HUWA 1Z3KA 5DC4A 1O41A 1O4MA 4WWQA 2YSXA 2YU7A 3OV1A 1KA6A 1LKLA 1OPKA 3EACA 3VGOA 2Y3AB 2IUHA 2HCKA 1CSYA 1PICA 3IMJA 3MAZA 3CWGA 1CSZA 2H46E 1D1ZA 1YVLA 2MQIA 3IN8A 4OHEA 3VS6A 1SPSA 1P13A 3VRPA 4GWFA 3PQZA 3VS7A 2EOBA 2L6KA 4A4CA 5CDWA 2XP1A 1BM2A 1O42A 1O47A 1FMKA 1X27A 3BUNB 4LUEA 5BO4A 2CI8A 1KA7A 1MILA 1RJAA 3ZNIA 3KFJA 2MRKA 1OO4A 2AUGA 2EYZA 1GHUA 2ECDA 4D8KA 1AYBA 1X0NA 3M7FA 2H8HA 1HCTB 4E93A 1O4CA 2K7AB 5DC9A 3EAZA 3VRQA 3VS2A 1RPYA 4F5BA 1O49A 2LQWA 3S8NA 4P9ZA 1LCKA 1O4JA 1A09A 2KK6A 4P9VA 1NZVA 3US4A 4M4ZA 5IBSA 4TZIA 2CBLA 1BLKA 1F1WA 1O4RA 3VS5A 1A1BA 2QMSA 3VS3A 3BKBA 1OPLA 1R1PA 5HKYA 3CXLA 2VIFA 2GE9A 2B3OA 3S9KA 1I3ZA 1O4QA 4EY0A 1FU6A 3S8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OHH A;  1AYC A;  1A1C A;  2HDX A;  1OO3 A;  1TCE A;  2KNO A;  4X6S A;  2PLD A;  1CWD L;  3MXY A;  1A08 A;  2ETZ A;  1O45 A;  1O4G A;  3OB1 B;  1D4T A;  2LNX A;  3NHN A;  2MRJ A;  1A1E A;  4K44 A;  2SHP A;  2EO3 A;  4FL3 A;  3IMD A;  3TKZ A;  1D4W A;  1KC2 A;  1LCJ A;  2DX0 A;  1X6C A;  3S8L A;  4QSY A;  2CS0 A;  1BHF A;  1O4N A;  1O4L A;  3VS4 A;  3T04 A;  4F59 A;  1O4K A;  1SHD A;  1JYQ A;  3N84 A;  2ROR A;  1UUR A;  1AOU F;  1BKL A;  2GSB A;  5EHP A;  4LUD A;  1BMB A;  4E68 A;  2FCI A;  1O4P A;  2MK2 A;  2H5K A;  2FO0 A;  4JGH A;  1CWE A;  5EEL A;  1G83 A;  1KSW A;  5HKW A;  5IBM A;  2BBU A;  1R1S A;  1O4O A;  1IS0 A;  1GRI A;  1QAD A;  3VRZ A;  4ROJ A;  1YVH A;  2ABL A;  1UUS A;  3TL0 A;  1JYU A;  2CR4 A;  4NWF A;  1AB2 A;  1A81 A;  3PLF B;  1LKK A;  3VRO A;  3CBL A;  4H1O A;  2OQ1 A;  1Y1U A;  3VRR A;  1BF5 A;  3WA4 A;  1M61 A;  1AYD A;  4XZ0 A;  3VS1 A;  3GQI B;  1JYR A;  2MC1 A;  2CRH A;  1AOT F;  3HIZ B;  5EEQ A;  3MXC A;  2L4K A;  5AUL A;  2Y1M A;  5D0J A;  1BHH A;  2EYY A;  5J3X A;  1F2F A;  4DGX A;  2DLY A;  1O44 A;  1A07 A;  4A4B A;  1RQQ C;  1QG1 E;  1CJ1 A;  3PS5 A;  3VRN A;  1LUM A;  1LUI A;  3VRY A;  2K79 B;  2EKX A;  4JEG A;  2C0I A;  1O46 A;  4F5A A;  2CIA A;  2SRC A;  2EO6 A;  1A1A A;  1LUN A;  5EHR A;  1O48 A;  1HCS B;  1AD5 A;  1B47 A;  4OHD A;  1BG1 A;  1R1Q A;  1LUK A;  2EYV A;  3GXX A;  3BUO B;  2HMH A;  4DGP A;  2CI9 A;  1M27 A;  1O4D A;  4U17 A;  1WQU A;  4GL9 E;  5KAZ A;  4NWG A;  2L3T A;  1BLJ A;  1Y57 A;  2DCR A;  5GJI A;  2AOA A;  1SPR A;  2C0O A;  1BKM A;  2DVJ A;  3UF4 A;  1O4I A;  1FHS A;  2JYQ A;  3PSJ A;  3UYO A;  2DLZ A;  3HHM B;  5HKZ A;  3N8M A;  2PTK A;  1QCF A;  4U1P A;  4K45 A;  2EU0 A;  2HDV A;  1O4F A;  3BUW B;  1SHA A;  2PNB A;  5I6V A;  3N7Y A;  4K11 A;  2RVF A;  5EG3 B;  1BFI A;  1FBZ A;  1O4A A;  2C9W A;  2RSY A;  4H34 A;  4FL2 A;  1NZL A;  2AOB A;  3OP0 A;  2Y1N A;  3PSK A;  3C7I A;  1NRV A;  5DF6 A;  1AYA A;  3QWY A;  1TZE E;  1H9O A;  2PLE A;  1K9A A;  2DM0 A;  3QWX X;  2IUI A;  1O4B A;  5AXI A;  3OB2 B;  1MW4 A;  4FBN A;  2OZO A;  1SKJ A;  2EL8 A;  3OVE A;  1BFJ A;  4L1B B;  3PJP A;  1FU5 A;  2IZV A;  1FBV A;  4OHI A;  1JU5 A;  2PNA A;  2LNW A;  2IUG A;  4XZ1 A;  1O4H A;  1XA6 A;  1FYR A;  1SHB A;  3HCK A;  3BUX B;  3BUM B;  1O43 A;  4OHL A;  2LQN A;  2C0T A;  3CD3 A;  4EIH A;  3IN7 A;  4GPL B;  3GXW A;  1IJR A;  5DC0 B;  2LCT A;  3VS0 A;  1ZFP E;  3PFV A;  2RMX A;  3K2M A;  5GJH A;  1O4E A;  1BHH B;  4JE4 A;  1JWO A;  4K2R A;  2HUW A;  1Z3K A;  5DC4 A;  1O41 A;  1O4M A;  4WWQ A;  2YSX A;  2YU7 A;  3OV1 A;  1KA6 A;  1LKL A;  1OPK A;  3EAC A;  3VGO A;  2Y3A B;  2IUH A;  2HCK A;  1CSY A;  1PIC A;  3IMJ A;  3MAZ A;  3CWG A;  1CSZ A;  2H46 E;  1D1Z A;  1YVL A;  2MQI A;  3IN8 A;  4OHE A;  3VS6 A;  1SPS A;  1P13 A;  3VRP A;  4GWF A;  3PQZ A;  3VS7 A;  2EOB A;  2L6K A;  4A4C A;  5CDW A;  2XP1 A;  1BM2 A;  1O42 A;  1O47 A;  1FMK A;  1X27 A;  3BUN B;  4LUE A;  5BO4 A;  2CI8 A;  1KA7 A;  1MIL A;  1RJA A;  3ZNI A;  3KFJ A;  2MRK A;  1OO4 A;  2AUG A;  2EYZ A;  1GHU A;  2ECD A;  4D8K A;  1AYB A;  1X0N A;  3M7F A;  2H8H A;  1HCT B;  4E93 A;  1O4C A;  2K7A B;  5DC9 A;  3EAZ A;  3VRQ A;  3VS2 A;  1RPY A;  4F5B A;  1O49 A;  2LQW A;  3S8N A;  4P9Z A;  1LCK A;  1O4J A;  1A09 A;  2KK6 A;  4P9V A;  1NZV A;  3US4 A;  4M4Z A;  5IBS A;  4TZI A;  2CBL A;  1BLK A;  1F1W A;  1O4R A;  3VS5 A;  1A1B A;  2QMS A;  3VS3 A;  3BKB A;  1OPL A;  1R1P A;  5HKY A;  3CXL A;  2VIF A;  2GE9 A;  2B3O A;  3S9K A;  1I3Z A;  1O4Q A;  4EY0 A;  1FU6 A;  3S8O A; 
#chains in the Genus database with same CATH topology
 4OHH A;  1AYC A;  1A1C A;  2HDX A;  1OO3 A;  1TCE A;  2KNO A;  4X6S A;  2PLD A;  1CWD L;  3MXY A;  1A08 A;  2ETZ A;  1O45 A;  1O4G A;  3OB1 B;  1D4T A;  2LNX A;  3NHN A;  2MRJ A;  1A1E A;  4K44 A;  2SHP A;  2EO3 A;  4FL3 A;  3IMD A;  3TKZ A;  1D4W A;  1KC2 A;  1LCJ A;  2DX0 A;  1X6C A;  3S8L A;  4QSY A;  2CS0 A;  1BHF A;  1O4N A;  1O4L A;  3VS4 A;  3T04 A;  4F59 A;  1O4K A;  1SHD A;  1JYQ A;  3N84 A;  2ROR A;  1UUR A;  1AOU F;  1BKL A;  2GSB A;  5EHP A;  3LYV A;  4LUD A;  1BMB A;  4E68 A;  2FCI A;  1O4P A;  2MK2 A;  2H5K A;  2FO0 A;  4JGH A;  1CWE A;  5EEL A;  1G83 A;  1KSW A;  5HKW A;  5IBM A;  2BBU A;  1R1S A;  1O4O A;  1IS0 A;  1GRI A;  1QAD A;  3VRZ A;  4ROJ A;  1YVH A;  2ABL A;  1UUS A;  3TL0 A;  1JYU A;  2CR4 A;  4NWF A;  1AB2 A;  1A81 A;  3PLF B;  1LKK A;  3VRO A;  3CBL A;  4H1O A;  2OQ1 A;  1Y1U A;  3VRR A;  1BF5 A;  3WA4 A;  1M61 A;  1AYD A;  4XZ0 A;  3VS1 A;  3GQI B;  1JYR A;  2MC1 A;  2CRH A;  1AOT F;  3HIZ B;  5EEQ A;  3MXC A;  2L4K A;  5AUL A;  2Y1M A;  5D0J A;  1BHH A;  2EYY A;  5J3X A;  1F2F A;  4DGX A;  2DLY A;  1O44 A;  1A07 A;  4A4B A;  1RQQ C;  1QG1 E;  1CJ1 A;  3PS5 A;  3VRN A;  1LUM A;  1LUI A;  3VRY A;  2K79 B;  2EKX A;  4JEG A;  2C0I A;  1O46 A;  4F5A A;  2CIA A;  2SRC A;  2EO6 A;  1A1A A;  1LUN A;  5EHR A;  1O48 A;  1HCS B;  1AD5 A;  1B47 A;  2KGY A;  4OHD A;  1BG1 A;  1R1Q A;  1LUK A;  2EYV A;  3GXX A;  3BUO B;  2HMH A;  4DGP A;  2CI9 A;  1M27 A;  1O4D A;  4U17 A;  1WQU A;  4GL9 E;  5KAZ A;  4NWG A;  2L3T A;  1BLJ A;  1Y57 A;  2DCR A;  5GJI A;  2AOA A;  1SPR A;  2C0O A;  1BKM A;  2DVJ A;  3UF4 A;  1O4I A;  1FHS A;  2JYQ A;  3PSJ A;  3UYO A;  2DLZ A;  3HHM B;  5HKZ A;  3N8M A;  2PTK A;  1QCF A;  4U1P A;  4K45 A;  2EU0 A;  2HDV A;  1O4F A;  3BUW B;  1SHA A;  2PNB A;  5I6V A;  3N7Y A;  4K11 A;  2RVF A;  5EG3 B;  1BFI A;  1FBZ A;  1O4A A;  2C9W A;  2RSY A;  4H34 A;  4FL2 A;  1NZL A;  2AOB A;  3OP0 A;  2Y1N A;  3PSK A;  3C7I A;  1NRV A;  5DF6 A;  1AYA A;  3QWY A;  1TZE E;  1H9O A;  2PLE A;  1K9A A;  2DM0 A;  3QWX X;  2IUI A;  1O4B A;  5AXI A;  3OB2 B;  1MW4 A;  4FBN A;  2OZO A;  1SKJ A;  2EL8 A;  3OVE A;  1BFJ A;  4L1B B;  3PJP A;  1FU5 A;  2IZV A;  1FBV A;  4OHI A;  1JU5 A;  2PNA A;  2LNW A;  2IUG A;  4XZ1 A;  1O4H A;  1XA6 A;  1FYR A;  1SHB A;  3HCK A;  3BUX B;  3BUM B;  1O43 A;  4OHL A;  2LQN A;  2C0T A;  3CD3 A;  4EIH A;  3IN7 A;  4GPL B;  3GXW A;  1IJR A;  5DC0 B;  2LCT A;  3VS0 A;  1ZFP E;  3PFV A;  2RMX A;  3K2M A;  5GJH A;  1O4E A;  1BHH B;  4JE4 A;  1JWO A;  4K2R A;  2HUW A;  1Z3K A;  5DC4 A;  1O41 A;  1O4M A;  4WWQ A;  2YSX A;  2LRA A;  2YU7 A;  3OV1 A;  1KA6 A;  1LKL A;  1OPK A;  3EAC A;  3VGO A;  2Y3A B;  2IUH A;  2HCK A;  1CSY A;  1PIC A;  3IMJ A;  3MAZ A;  3CWG A;  1CSZ A;  2H46 E;  1D1Z A;  1YVL A;  2MQI A;  3IN8 A;  4OHE A;  3VS6 A;  1SPS A;  1P13 A;  3VRP A;  4GWF A;  3PQZ A;  3VS7 A;  2EOB A;  2L6K A;  4A4C A;  5CDW A;  2XP1 A;  1BM2 A;  1O42 A;  1O47 A;  1FMK A;  1X27 A;  3BUN B;  4LUE A;  5BO4 A;  2CI8 A;  1KA7 A;  1MIL A;  1RJA A;  3ZNI A;  3KFJ A;  2MRK A;  1OO4 A;  2AUG A;  2EYZ A;  1GHU A;  2ECD A;  4D8K A;  1AYB A;  1X0N A;  3M7F A;  2H8H A;  3K2T A;  1HCT B;  4E93 A;  1O4C A;  2K7A B;  5DC9 A;  3EAZ A;  3VRQ A;  3VS2 A;  1RPY A;  4F5B A;  1O49 A;  2LQW A;  3S8N A;  4P9Z A;  1LCK A;  1O4J A;  1A09 A;  2KK6 A;  4P9V A;  1NZV A;  3US4 A;  4M4Z A;  5IBS A;  4TZI A;  2CBL A;  1BLK A;  1F1W A;  1O4R A;  3VS5 A;  1A1B A;  2QMS A;  3VS3 A;  3BKB A;  1OPL A;  1R1P A;  5HKY A;  3CXL A;  2VIF A;  2GE9 A;  2B3O A;  3S9K A;  1I3Z A;  1O4Q A;  4EY0 A;  1FU6 A;  3S8O A; 
#chains in the Genus database with same CATH homology
 4OHH A;  1AYC A;  1A1C A;  2HDX A;  1OO3 A;  1TCE A;  2KNO A;  4X6S A;  2PLD A;  1CWD L;  3MXY A;  1A08 A;  2ETZ A;  1O45 A;  1O4G A;  3OB1 B;  1D4T A;  2LNX A;  3NHN A;  2MRJ A;  1A1E A;  4K44 A;  2SHP A;  2EO3 A;  4FL3 A;  3IMD A;  3TKZ A;  1D4W A;  1KC2 A;  1LCJ A;  2DX0 A;  1X6C A;  3S8L A;  4QSY A;  2CS0 A;  1BHF A;  1O4N A;  1O4L A;  3VS4 A;  3T04 A;  4F59 A;  1O4K A;  1SHD A;  1JYQ A;  3N84 A;  2ROR A;  1UUR A;  1AOU F;  1BKL A;  2GSB A;  5EHP A;  4LUD A;  1BMB A;  4E68 A;  2FCI A;  1O4P A;  2MK2 A;  2H5K A;  2FO0 A;  4JGH A;  1CWE A;  5EEL A;  1G83 A;  1KSW A;  5HKW A;  5IBM A;  2BBU A;  1R1S A;  1O4O A;  1IS0 A;  1GRI A;  1QAD A;  3VRZ A;  4ROJ A;  1YVH A;  2ABL A;  1UUS A;  3TL0 A;  1JYU A;  2CR4 A;  4NWF A;  1AB2 A;  1A81 A;  3PLF B;  1LKK A;  3VRO A;  3CBL A;  4H1O A;  2OQ1 A;  1Y1U A;  3VRR A;  1BF5 A;  3WA4 A;  1M61 A;  1AYD A;  4XZ0 A;  3VS1 A;  3GQI B;  1JYR A;  2MC1 A;  2CRH A;  1AOT F;  3HIZ B;  5EEQ A;  3MXC A;  2L4K A;  5AUL A;  2Y1M A;  5D0J A;  1BHH A;  2EYY A;  5J3X A;  1F2F A;  4DGX A;  2DLY A;  1O44 A;  1A07 A;  4A4B A;  1RQQ C;  1QG1 E;  1CJ1 A;  3PS5 A;  3VRN A;  1LUM A;  1LUI A;  3VRY A;  2K79 B;  2EKX A;  4JEG A;  2C0I A;  1O46 A;  4F5A A;  2CIA A;  2SRC A;  2EO6 A;  1A1A A;  1LUN A;  5EHR A;  1O48 A;  1HCS B;  1AD5 A;  1B47 A;  4OHD A;  1BG1 A;  1R1Q A;  1LUK A;  2EYV A;  3GXX A;  3BUO B;  2HMH A;  4DGP A;  2CI9 A;  1M27 A;  1O4D A;  4U17 A;  1WQU A;  4GL9 E;  5KAZ A;  4NWG A;  2L3T A;  1BLJ A;  1Y57 A;  2DCR A;  5GJI A;  2AOA A;  1SPR A;  2C0O A;  1BKM A;  2DVJ A;  3UF4 A;  1O4I A;  1FHS A;  2JYQ A;  3PSJ A;  3UYO A;  2DLZ A;  3HHM B;  5HKZ A;  3N8M A;  2PTK A;  1QCF A;  4U1P A;  4K45 A;  2EU0 A;  2HDV A;  1O4F A;  3BUW B;  1SHA A;  2PNB A;  5I6V A;  3N7Y A;  4K11 A;  2RVF A;  5EG3 B;  1BFI A;  1FBZ A;  1O4A A;  2C9W A;  2RSY A;  4H34 A;  4FL2 A;  1NZL A;  2AOB A;  3OP0 A;  2Y1N A;  3PSK A;  3C7I A;  1NRV A;  5DF6 A;  1AYA A;  3QWY A;  1TZE E;  1H9O A;  2PLE A;  1K9A A;  2DM0 A;  3QWX X;  2IUI A;  1O4B A;  5AXI A;  3OB2 B;  1MW4 A;  4FBN A;  2OZO A;  1SKJ A;  2EL8 A;  3OVE A;  1BFJ A;  4L1B B;  3PJP A;  1FU5 A;  2IZV A;  1FBV A;  4OHI A;  1JU5 A;  2PNA A;  2LNW A;  2IUG A;  4XZ1 A;  1O4H A;  1XA6 A;  1FYR A;  1SHB A;  3HCK A;  3BUX B;  3BUM B;  1O43 A;  4OHL A;  2LQN A;  2C0T A;  3CD3 A;  4EIH A;  3IN7 A;  4GPL B;  3GXW A;  1IJR A;  5DC0 B;  2LCT A;  3VS0 A;  1ZFP E;  3PFV A;  2RMX A;  3K2M A;  5GJH A;  1O4E A;  1BHH B;  4JE4 A;  1JWO A;  4K2R A;  2HUW A;  1Z3K A;  5DC4 A;  1O41 A;  1O4M A;  4WWQ A;  2YSX A;  2YU7 A;  3OV1 A;  1KA6 A;  1LKL A;  1OPK A;  3EAC A;  3VGO A;  2Y3A B;  2IUH A;  2HCK A;  1CSY A;  1PIC A;  3IMJ A;  3MAZ A;  3CWG A;  1CSZ A;  2H46 E;  1D1Z A;  1YVL A;  2MQI A;  3IN8 A;  4OHE A;  3VS6 A;  1SPS A;  1P13 A;  3VRP A;  4GWF A;  3PQZ A;  3VS7 A;  2EOB A;  2L6K A;  4A4C A;  5CDW A;  2XP1 A;  1BM2 A;  1O42 A;  1O47 A;  1FMK A;  1X27 A;  3BUN B;  4LUE A;  5BO4 A;  2CI8 A;  1KA7 A;  1MIL A;  1RJA A;  3ZNI A;  3KFJ A;  2MRK A;  1OO4 A;  2AUG A;  2EYZ A;  1GHU A;  2ECD A;  4D8K A;  1AYB A;  1X0N A;  3M7F A;  2H8H A;  1HCT B;  4E93 A;  1O4C A;  2K7A B;  5DC9 A;  3EAZ A;  3VRQ A;  3VS2 A;  1RPY A;  4F5B A;  1O49 A;  2LQW A;  3S8N A;  4P9Z A;  1LCK A;  1O4J A;  1A09 A;  2KK6 A;  4P9V A;  1NZV A;  3US4 A;  4M4Z A;  5IBS A;  4TZI A;  2CBL A;  1BLK A;  1F1W A;  1O4R A;  3VS5 A;  1A1B A;  2QMS A;  3VS3 A;  3BKB A;  1OPL A;  1R1P A;  5HKY A;  3CXL A;  2VIF A;  2GE9 A;  2B3O A;  3S9K A;  1I3Z A;  1O4Q A;  4EY0 A;  1FU6 A;  3S8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...