2IUIA

Crystal structure of the pi3-kinase p85 n-terminal sh2 domain in complex with pdgfr phosphotyrosyl peptide
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
MSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit alpha
publication title Crystal Structure of the Pi 3-Kinase P85 Amino- Terminal Sh2 Domain and its Phosphopeptide Complexes
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2iuiA00
2ABLA 2LNWA 3VRRA 2PLDA 1LUIA 3PSKA 3EAZA 2SRCA 3OB2B 1RPYA 5I6VA 2LQWA 2PLEA 3WA4A 2K79B 2DLZA 1UURA 2EYYA 2MQIA 2CIAA 1B47A 3NHNA 1P13A 2CI8A 5J3XA 1A81A 3CXLA 4NWFA 5BO4A 5EHRA 4GL9E 1O4IA 2PNAA 4F5AA 2IUHA 1JWOA 1O4BA 2HMHA 3ZNIA 3S8NA 2C0OA 3CD3A 3OB1B 3CWGA 3VS7A 4OHHA 1BMBA 1A08A 1TZEE 1AOTF 3S9KA 3VRNA 4XZ1A 3VS6A 1BHHB 4JEGA 4OHEA 3BUOB 4EY0A 1A1BA 1MW4A 1O42A 1YVHA 4JGHA 1R1PA 2C0IA 4A4CA 2LQNA 3PQZA 1IJRA 2H5KA 4K44A 3N7YA 1H9OA 1O4FA 3VGOA 1IS0A 2L6KA 1BLKA 1AYAA 1SKJA 1O45A 1O48A 1CWEA 4LUDA 3VS1A 3IN8A 2EOBA 1LKKA 4GWFA 3N8MA 1SHDA 2C9WA 2FCIA 3K2MA 1O4DA 1SPSA 1FYRA 3TL0A 4ROJA 2B3OA 2CRHA 4U17A 1CSZA 2CS0A 2H8HA 2EO6A 1Y57A 2H46E 1D4WA 1O4PA 5AULA 2DM0A 5CDWA 3CBLA 5D0JA 1QG1E 1OPLA 5IBSA 1BFIA 2Y1MA 1O4CA 4WWQA 5HKYA 2EO3A 4XZ0A 1O4RA 2JYQA 1Y1UA 2HDVA 1O41A 3GXWA 2EYVA 2VIFA 4M4ZA 2EKXA 1YVLA 3VS5A 3EACA 1FBZA 3BUXB 1KA7A 1AYCA 3S8LA 1A07A 5HKWA 1X0NA 1JYQA 4GPLB 2IUIA 1O4KA 2RVFA 5DF6A 2LCTA 2XP1A 2GE9A 1XA6A 1AB2A 4A4BA 1O4MA 4K45A 2ECDA 1BHHA 1M61A 4E93A 3T04A 4U1PA 2BBUA 1O46A 2L4KA 1GRIA 3BKBA 3UYOA 1O4EA 2Y1NA 3HHMB 1RQQC 3OP0A 1A09A 1PICA 1QCFA 3OV1A 1FBVA 2IZVA 4K11A 1JU5A 1O4LA 1CSYA 3MXYA 1O49A 1I3ZA 2HCKA 5DC4A 2EYZA 3UF4A 1OPKA 3VRYA 1LUKA 3PFVA 2YSXA 4FL3A 2Y3AB 4L1BB 1R1SA 3VROA 1KC2A 3TKZA 1AYBA 3VRQA 3M7FA 4DGXA 3US4A 4E68A 1HCSB 2ETZA 4P9VA 2MRKA 1SHAA 2PTKA 1BF5A 2DX0A 2OZOA 1WQUA 5EG3B 1ZFPE 3VS0A 1O4AA 2CI9A 3VRPA 1BG1A 1M27A 1O43A 2EU0A 2AUGA 3VS4A 4FL2A 1MILA 4OHIA 1FHSA 2K7AB 1LKLA 2MC1A 2DCRA 3S8OA 3BUNB 3HCKA 1O4HA 1BLJA 3VS3A 1AOUF 3VRZA 1FMKA 1A1CA 2L3TA 3BUMB 1AYDA 3QWXX 2KNOA 5HKZA 1NZLA 1BM2A 1X6CA 1O4JA 1UUSA 1LUNA 3GQIB 2AOAA 1X27A 1K9AA 1BKLA 2OQ1A 1NRVA 4H34A 3IMJA 1BFJA 4NWGA 4DGPA 1FU5A 5EHPA 1O4QA 2HDXA 1A1AA 3VS2A 3N84A 1CJ1A 2QMSA 1R1QA 3PS5A 5GJHA 2CR4A 1F2FA 2GSBA 1FU6A 2PNBA 1NZVA 1LCJA 1O4GA 4P9ZA 1O47A 1F1WA 1AD5A 3GXXA 1O4NA 3MAZA 1LCKA 4H1OA 1CWDL 3PLFB 1OO3A 4X6SA 2DVJA 4TZIA 1BHFA 4F5BA 1JYUA 5KAZA 3BUWB 1D1ZA 1O44A 2CBLA 2RSYA 2RORA 5GJIA 2LNXA 3OVEA 2DLYA 2HUWA 1QADA 4F59A 3PSJA 1BKMA 2SHPA 5DC0B 1OO4A 2EL8A 5DC9A 1HCTB 4D8KA 3IN7A 1A1EA 3QWYA 5IBMA 3IMDA 1SPRA 2C0TA 4FBNA 4JE4A 4OHLA 1KSWA 2IUGA 2MK2A 1Z3KA 2AOBA 2YU7A 1KA6A 1LUMA 2MRJA 1O4OA 1G83A 1SHBA 4QSYA 4OHDA 3MXCA 1GHUA 5EELA 1TCEA 2KK6A 4K2RA 3PJPA 2FO0A 4EIHA 5AXIA 1JYRA 3C7IA 3HIZB 5EEQA 4LUEA 1D4TA 3KFJA 1RJAA 2RMXA
chains in the Genus database with same CATH superfamily
2ABLA 2LNWA 3VRRA 2PLDA 1LUIA 3PSKA 3EAZA 2SRCA 3OB2B 1RPYA 5I6VA 2LQWA 2PLEA 3WA4A 2K79B 2DLZA 1UURA 2EYYA 2MQIA 2CIAA 1B47A 3NHNA 1P13A 2CI8A 5J3XA 1A81A 3CXLA 4NWFA 5BO4A 5EHRA 4GL9E 1O4IA 2PNAA 4F5AA 2IUHA 1JWOA 1O4BA 2HMHA 3ZNIA 3S8NA 2C0OA 3CD3A 3OB1B 3CWGA 3VS7A 4OHHA 3LYVA 1BMBA 1A08A 1TZEE 1AOTF 3S9KA 3VRNA 4XZ1A 3VS6A 1BHHB 4JEGA 4OHEA 3BUOB 4EY0A 1A1BA 1MW4A 1O42A 1YVHA 4JGHA 1R1PA 2C0IA 4A4CA 2LQNA 3PQZA 1IJRA 2H5KA 4K44A 3N7YA 1H9OA 1O4FA 3VGOA 1IS0A 2L6KA 1BLKA 1AYAA 1SKJA 1O45A 1O48A 1CWEA 4LUDA 3VS1A 3IN8A 2EOBA 1LKKA 4GWFA 3N8MA 1SHDA 2C9WA 2FCIA 3K2MA 1O4DA 1SPSA 1FYRA 3TL0A 4ROJA 2B3OA 2CRHA 4U17A 1CSZA 2CS0A 2H8HA 2EO6A 1Y57A 2H46E 1D4WA 1O4PA 5AULA 2DM0A 5CDWA 3CBLA 5D0JA 1QG1E 1OPLA 5IBSA 1BFIA 2Y1MA 1O4CA 4WWQA 5HKYA 2EO3A 4XZ0A 1O4RA 2JYQA 1Y1UA 2HDVA 1O41A 3GXWA 2EYVA 2VIFA 4M4ZA 2EKXA 1YVLA 3VS5A 2LRAA 3EACA 1FBZA 3BUXB 1KA7A 1AYCA 3S8LA 1A07A 5HKWA 1X0NA 1JYQA 4GPLB 2IUIA 1O4KA 2RVFA 5DF6A 2LCTA 2XP1A 2GE9A 1XA6A 1AB2A 4A4BA 1O4MA 4K45A 2ECDA 1BHHA 1M61A 4E93A 3T04A 4U1PA 2BBUA 1O46A 2L4KA 1GRIA 3BKBA 3UYOA 1O4EA 2Y1NA 3HHMB 1RQQC 3OP0A 1A09A 1PICA 1QCFA 3OV1A 1FBVA 2IZVA 4K11A 1JU5A 1O4LA 1CSYA 3MXYA 1O49A 1I3ZA 2HCKA 5DC4A 2EYZA 3UF4A 1OPKA 3VRYA 1LUKA 3PFVA 2YSXA 4FL3A 2Y3AB 4L1BB 1R1SA 3VROA 1KC2A 3TKZA 1AYBA 3VRQA 3M7FA 4DGXA 3US4A 4E68A 1HCSB 2ETZA 4P9VA 2MRKA 1SHAA 2PTKA 1BF5A 2DX0A 2OZOA 1WQUA 5EG3B 1ZFPE 3VS0A 1O4AA 2CI9A 3VRPA 1BG1A 1M27A 1O43A 2EU0A 2AUGA 3VS4A 4FL2A 1MILA 4OHIA 1FHSA 2K7AB 1LKLA 2MC1A 2DCRA 3S8OA 3BUNB 3HCKA 1O4HA 1BLJA 3VS3A 1AOUF 3VRZA 1FMKA 1A1CA 2L3TA 3BUMB 1AYDA 3QWXX 2KNOA 5HKZA 1NZLA 1BM2A 1X6CA 1O4JA 1UUSA 1LUNA 3GQIB 2AOAA 1X27A 1K9AA 1BKLA 2OQ1A 1NRVA 3K2TA 4H34A 3IMJA 1BFJA 4NWGA 4DGPA 1FU5A 5EHPA 1O4QA 2HDXA 1A1AA 3VS2A 3N84A 1CJ1A 2QMSA 1R1QA 3PS5A 5GJHA 2CR4A 1F2FA 2GSBA 1FU6A 2PNBA 1NZVA 1LCJA 1O4GA 4P9ZA 2KGYA 1O47A 1F1WA 1AD5A 3GXXA 1O4NA 3MAZA 1LCKA 4H1OA 1CWDL 3PLFB 1OO3A 4X6SA 2DVJA 4TZIA 1BHFA 4F5BA 1JYUA 5KAZA 3BUWB 1D1ZA 1O44A 2CBLA 2RSYA 2RORA 5GJIA 2LNXA 3OVEA 2DLYA 2HUWA 1QADA 4F59A 3PSJA 1BKMA 2SHPA 5DC0B 1OO4A 2EL8A 5DC9A 1HCTB 4D8KA 3IN7A 1A1EA 3QWYA 5IBMA 3IMDA 1SPRA 2C0TA 4FBNA 4JE4A 4OHLA 1KSWA 2IUGA 2MK2A 1Z3KA 2AOBA 2YU7A 1KA6A 1LUMA 2MRJA 1O4OA 1G83A 1SHBA 4QSYA 4OHDA 3MXCA 1GHUA 5EELA 1TCEA 2KK6A 4K2RA 3PJPA 2FO0A 4EIHA 5AXIA 1JYRA 3C7IA 3HIZB 5EEQA 4LUEA 1D4TA 3KFJA 1RJAA 2RMXA
chains in the Genus database with same CATH topology
2ABLA 2LNWA 3VRRA 2PLDA 1LUIA 3PSKA 3EAZA 2SRCA 3OB2B 1RPYA 5I6VA 2LQWA 2PLEA 3WA4A 2K79B 2DLZA 1UURA 2EYYA 2MQIA 2CIAA 1B47A 3NHNA 1P13A 2CI8A 5J3XA 1A81A 3CXLA 4NWFA 5BO4A 5EHRA 4GL9E 1O4IA 2PNAA 4F5AA 2IUHA 1JWOA 1O4BA 2HMHA 3ZNIA 3S8NA 2C0OA 3CD3A 3OB1B 3CWGA 3VS7A 4OHHA 1BMBA 1A08A 1TZEE 1AOTF 3S9KA 3VRNA 4XZ1A 3VS6A 1BHHB 4JEGA 4OHEA 3BUOB 4EY0A 1A1BA 1MW4A 1O42A 1YVHA 4JGHA 1R1PA 2C0IA 4A4CA 2LQNA 3PQZA 1IJRA 2H5KA 4K44A 3N7YA 1H9OA 1O4FA 3VGOA 1IS0A 2L6KA 1BLKA 1AYAA 1SKJA 1O45A 1O48A 1CWEA 4LUDA 3VS1A 3IN8A 2EOBA 1LKKA 4GWFA 3N8MA 1SHDA 2C9WA 2FCIA 3K2MA 1O4DA 1SPSA 1FYRA 3TL0A 4ROJA 2B3OA 2CRHA 4U17A 1CSZA 2CS0A 2H8HA 2EO6A 1Y57A 2H46E 1D4WA 1O4PA 5AULA 2DM0A 5CDWA 3CBLA 5D0JA 1QG1E 1OPLA 5IBSA 1BFIA 2Y1MA 1O4CA 4WWQA 5HKYA 2EO3A 4XZ0A 1O4RA 2JYQA 1Y1UA 2HDVA 1O41A 3GXWA 2EYVA 2VIFA 4M4ZA 2EKXA 1YVLA 3VS5A 3EACA 1FBZA 3BUXB 1KA7A 1AYCA 3S8LA 1A07A 5HKWA 1X0NA 1JYQA 4GPLB 2IUIA 1O4KA 2RVFA 5DF6A 2LCTA 2XP1A 2GE9A 1XA6A 1AB2A 4A4BA 1O4MA 4K45A 2ECDA 1BHHA 1M61A 4E93A 3T04A 4U1PA 2BBUA 1O46A 2L4KA 1GRIA 3BKBA 3UYOA 1O4EA 2Y1NA 3HHMB 1RQQC 3OP0A 1A09A 1PICA 1QCFA 3OV1A 1FBVA 2IZVA 4K11A 1JU5A 1O4LA 1CSYA 3MXYA 1O49A 1I3ZA 2HCKA 5DC4A 2EYZA 3UF4A 1OPKA 3VRYA 1LUKA 3PFVA 2YSXA 4FL3A 2Y3AB 4L1BB 1R1SA 3VROA 1KC2A 3TKZA 1AYBA 3VRQA 3M7FA 4DGXA 3US4A 4E68A 1HCSB 2ETZA 4P9VA 2MRKA 1SHAA 2PTKA 1BF5A 2DX0A 2OZOA 1WQUA 5EG3B 1ZFPE 3VS0A 1O4AA 2CI9A 3VRPA 1BG1A 1M27A 1O43A 2EU0A 2AUGA 3VS4A 4FL2A 1MILA 4OHIA 1FHSA 2K7AB 1LKLA 2MC1A 2DCRA 3S8OA 3BUNB 3HCKA 1O4HA 1BLJA 3VS3A 1AOUF 3VRZA 1FMKA 1A1CA 2L3TA 3BUMB 1AYDA 3QWXX 2KNOA 5HKZA 1NZLA 1BM2A 1X6CA 1O4JA 1UUSA 1LUNA 3GQIB 2AOAA 1X27A 1K9AA 1BKLA 2OQ1A 1NRVA 4H34A 3IMJA 1BFJA 4NWGA 4DGPA 1FU5A 5EHPA 1O4QA 2HDXA 1A1AA 3VS2A 3N84A 1CJ1A 2QMSA 1R1QA 3PS5A 5GJHA 2CR4A 1F2FA 2GSBA 1FU6A 2PNBA 1NZVA 1LCJA 1O4GA 4P9ZA 1O47A 1F1WA 1AD5A 3GXXA 1O4NA 3MAZA 1LCKA 4H1OA 1CWDL 3PLFB 1OO3A 4X6SA 2DVJA 4TZIA 1BHFA 4F5BA 1JYUA 5KAZA 3BUWB 1D1ZA 1O44A 2CBLA 2RSYA 2RORA 5GJIA 2LNXA 3OVEA 2DLYA 2HUWA 1QADA 4F59A 3PSJA 1BKMA 2SHPA 5DC0B 1OO4A 2EL8A 5DC9A 1HCTB 4D8KA 3IN7A 1A1EA 3QWYA 5IBMA 3IMDA 1SPRA 2C0TA 4FBNA 4JE4A 4OHLA 1KSWA 2IUGA 2MK2A 1Z3KA 2AOBA 2YU7A 1KA6A 1LUMA 2MRJA 1O4OA 1G83A 1SHBA 4QSYA 4OHDA 3MXCA 1GHUA 5EELA 1TCEA 2KK6A 4K2RA 3PJPA 2FO0A 4EIHA 5AXIA 1JYRA 3C7IA 3HIZB 5EEQA 4LUEA 1D4TA 3KFJA 1RJAA 2RMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABL A;  2LNW A;  3VRR A;  2PLD A;  1LUI A;  3PSK A;  3EAZ A;  2SRC A;  3OB2 B;  1RPY A;  5I6V A;  2LQW A;  2PLE A;  3WA4 A;  2K79 B;  2DLZ A;  1UUR A;  2EYY A;  2MQI A;  2CIA A;  1B47 A;  3NHN A;  1P13 A;  2CI8 A;  5J3X A;  1A81 A;  3CXL A;  4NWF A;  5BO4 A;  5EHR A;  4GL9 E;  1O4I A;  2PNA A;  4F5A A;  2IUH A;  1JWO A;  1O4B A;  2HMH A;  3ZNI A;  3S8N A;  2C0O A;  3CD3 A;  3OB1 B;  3CWG A;  3VS7 A;  4OHH A;  1BMB A;  1A08 A;  1TZE E;  1AOT F;  3S9K A;  3VRN A;  4XZ1 A;  3VS6 A;  1BHH B;  4JEG A;  4OHE A;  3BUO B;  4EY0 A;  1A1B A;  1MW4 A;  1O42 A;  1YVH A;  4JGH A;  1R1P A;  2C0I A;  4A4C A;  2LQN A;  3PQZ A;  1IJR A;  2H5K A;  4K44 A;  3N7Y A;  1H9O A;  1O4F A;  3VGO A;  1IS0 A;  2L6K A;  1BLK A;  1AYA A;  1SKJ A;  1O45 A;  1O48 A;  1CWE A;  4LUD A;  3VS1 A;  3IN8 A;  2EOB A;  1LKK A;  4GWF A;  3N8M A;  1SHD A;  2C9W A;  2FCI A;  3K2M A;  1O4D A;  1SPS A;  1FYR A;  3TL0 A;  4ROJ A;  2B3O A;  2CRH A;  4U17 A;  1CSZ A;  2CS0 A;  2H8H A;  2EO6 A;  1Y57 A;  2H46 E;  1D4W A;  1O4P A;  5AUL A;  2DM0 A;  5CDW A;  3CBL A;  5D0J A;  1QG1 E;  1OPL A;  5IBS A;  1BFI A;  2Y1M A;  1O4C A;  4WWQ A;  5HKY A;  2EO3 A;  4XZ0 A;  1O4R A;  2JYQ A;  1Y1U A;  2HDV A;  1O41 A;  3GXW A;  2EYV A;  2VIF A;  4M4Z A;  2EKX A;  1YVL A;  3VS5 A;  3EAC A;  1FBZ A;  3BUX B;  1KA7 A;  1AYC A;  3S8L A;  1A07 A;  5HKW A;  1X0N A;  1JYQ A;  4GPL B;  2IUI A;  1O4K A;  2RVF A;  5DF6 A;  2LCT A;  2XP1 A;  2GE9 A;  1XA6 A;  1AB2 A;  4A4B A;  1O4M A;  4K45 A;  2ECD A;  1BHH A;  1M61 A;  4E93 A;  3T04 A;  4U1P A;  2BBU A;  1O46 A;  2L4K A;  1GRI A;  3BKB A;  3UYO A;  1O4E A;  2Y1N A;  3HHM B;  1RQQ C;  3OP0 A;  1A09 A;  1PIC A;  1QCF A;  3OV1 A;  1FBV A;  2IZV A;  4K11 A;  1JU5 A;  1O4L A;  1CSY A;  3MXY A;  1O49 A;  1I3Z A;  2HCK A;  5DC4 A;  2EYZ A;  3UF4 A;  1OPK A;  3VRY A;  1LUK A;  3PFV A;  2YSX A;  4FL3 A;  2Y3A B;  4L1B B;  1R1S A;  3VRO A;  1KC2 A;  3TKZ A;  1AYB A;  3VRQ A;  3M7F A;  4DGX A;  3US4 A;  4E68 A;  1HCS B;  2ETZ A;  4P9V A;  2MRK A;  1SHA A;  2PTK A;  1BF5 A;  2DX0 A;  2OZO A;  1WQU A;  5EG3 B;  1ZFP E;  3VS0 A;  1O4A A;  2CI9 A;  3VRP A;  1BG1 A;  1M27 A;  1O43 A;  2EU0 A;  2AUG A;  3VS4 A;  4FL2 A;  1MIL A;  4OHI A;  1FHS A;  2K7A B;  1LKL A;  2MC1 A;  2DCR A;  3S8O A;  3BUN B;  3HCK A;  1O4H A;  1BLJ A;  3VS3 A;  1AOU F;  3VRZ A;  1FMK A;  1A1C A;  2L3T A;  3BUM B;  1AYD A;  3QWX X;  2KNO A;  5HKZ A;  1NZL A;  1BM2 A;  1X6C A;  1O4J A;  1UUS A;  1LUN A;  3GQI B;  2AOA A;  1X27 A;  1K9A A;  1BKL A;  2OQ1 A;  1NRV A;  4H34 A;  3IMJ A;  1BFJ A;  4NWG A;  4DGP A;  1FU5 A;  5EHP A;  1O4Q A;  2HDX A;  1A1A A;  3VS2 A;  3N84 A;  1CJ1 A;  2QMS A;  1R1Q A;  3PS5 A;  5GJH A;  2CR4 A;  1F2F A;  2GSB A;  1FU6 A;  2PNB A;  1NZV A;  1LCJ A;  1O4G A;  4P9Z A;  1O47 A;  1F1W A;  1AD5 A;  3GXX A;  1O4N A;  3MAZ A;  1LCK A;  4H1O A;  1CWD L;  3PLF B;  1OO3 A;  4X6S A;  2DVJ A;  4TZI A;  1BHF A;  4F5B A;  1JYU A;  5KAZ A;  3BUW B;  1D1Z A;  1O44 A;  2CBL A;  2RSY A;  2ROR A;  5GJI A;  2LNX A;  3OVE A;  2DLY A;  2HUW A;  1QAD A;  4F59 A;  3PSJ A;  1BKM A;  2SHP A;  5DC0 B;  1OO4 A;  2EL8 A;  5DC9 A;  1HCT B;  4D8K A;  3IN7 A;  1A1E A;  3QWY A;  5IBM A;  3IMD A;  1SPR A;  2C0T A;  4FBN A;  4JE4 A;  4OHL A;  1KSW A;  2IUG A;  2MK2 A;  1Z3K A;  2AOB A;  2YU7 A;  1KA6 A;  1LUM A;  2MRJ A;  1O4O A;  1G83 A;  1SHB A;  4QSY A;  4OHD A;  3MXC A;  1GHU A;  5EEL A;  1TCE A;  2KK6 A;  4K2R A;  3PJP A;  2FO0 A;  4EIH A;  5AXI A;  1JYR A;  3C7I A;  3HIZ B;  5EEQ A;  4LUE A;  1D4T A;  3KFJ A;  1RJA A;  2RMX A; 
#chains in the Genus database with same CATH topology
 2ABL A;  2LNW A;  3VRR A;  2PLD A;  1LUI A;  3PSK A;  3EAZ A;  2SRC A;  3OB2 B;  1RPY A;  5I6V A;  2LQW A;  2PLE A;  3WA4 A;  2K79 B;  2DLZ A;  1UUR A;  2EYY A;  2MQI A;  2CIA A;  1B47 A;  3NHN A;  1P13 A;  2CI8 A;  5J3X A;  1A81 A;  3CXL A;  4NWF A;  5BO4 A;  5EHR A;  4GL9 E;  1O4I A;  2PNA A;  4F5A A;  2IUH A;  1JWO A;  1O4B A;  2HMH A;  3ZNI A;  3S8N A;  2C0O A;  3CD3 A;  3OB1 B;  3CWG A;  3VS7 A;  4OHH A;  3LYV A;  1BMB A;  1A08 A;  1TZE E;  1AOT F;  3S9K A;  3VRN A;  4XZ1 A;  3VS6 A;  1BHH B;  4JEG A;  4OHE A;  3BUO B;  4EY0 A;  1A1B A;  1MW4 A;  1O42 A;  1YVH A;  4JGH A;  1R1P A;  2C0I A;  4A4C A;  2LQN A;  3PQZ A;  1IJR A;  2H5K A;  4K44 A;  3N7Y A;  1H9O A;  1O4F A;  3VGO A;  1IS0 A;  2L6K A;  1BLK A;  1AYA A;  1SKJ A;  1O45 A;  1O48 A;  1CWE A;  4LUD A;  3VS1 A;  3IN8 A;  2EOB A;  1LKK A;  4GWF A;  3N8M A;  1SHD A;  2C9W A;  2FCI A;  3K2M A;  1O4D A;  1SPS A;  1FYR A;  3TL0 A;  4ROJ A;  2B3O A;  2CRH A;  4U17 A;  1CSZ A;  2CS0 A;  2H8H A;  2EO6 A;  1Y57 A;  2H46 E;  1D4W A;  1O4P A;  5AUL A;  2DM0 A;  5CDW A;  3CBL A;  5D0J A;  1QG1 E;  1OPL A;  5IBS A;  1BFI A;  2Y1M A;  1O4C A;  4WWQ A;  5HKY A;  2EO3 A;  4XZ0 A;  1O4R A;  2JYQ A;  1Y1U A;  2HDV A;  1O41 A;  3GXW A;  2EYV A;  2VIF A;  4M4Z A;  2EKX A;  1YVL A;  3VS5 A;  2LRA A;  3EAC A;  1FBZ A;  3BUX B;  1KA7 A;  1AYC A;  3S8L A;  1A07 A;  5HKW A;  1X0N A;  1JYQ A;  4GPL B;  2IUI A;  1O4K A;  2RVF A;  5DF6 A;  2LCT A;  2XP1 A;  2GE9 A;  1XA6 A;  1AB2 A;  4A4B A;  1O4M A;  4K45 A;  2ECD A;  1BHH A;  1M61 A;  4E93 A;  3T04 A;  4U1P A;  2BBU A;  1O46 A;  2L4K A;  1GRI A;  3BKB A;  3UYO A;  1O4E A;  2Y1N A;  3HHM B;  1RQQ C;  3OP0 A;  1A09 A;  1PIC A;  1QCF A;  3OV1 A;  1FBV A;  2IZV A;  4K11 A;  1JU5 A;  1O4L A;  1CSY A;  3MXY A;  1O49 A;  1I3Z A;  2HCK A;  5DC4 A;  2EYZ A;  3UF4 A;  1OPK A;  3VRY A;  1LUK A;  3PFV A;  2YSX A;  4FL3 A;  2Y3A B;  4L1B B;  1R1S A;  3VRO A;  1KC2 A;  3TKZ A;  1AYB A;  3VRQ A;  3M7F A;  4DGX A;  3US4 A;  4E68 A;  1HCS B;  2ETZ A;  4P9V A;  2MRK A;  1SHA A;  2PTK A;  1BF5 A;  2DX0 A;  2OZO A;  1WQU A;  5EG3 B;  1ZFP E;  3VS0 A;  1O4A A;  2CI9 A;  3VRP A;  1BG1 A;  1M27 A;  1O43 A;  2EU0 A;  2AUG A;  3VS4 A;  4FL2 A;  1MIL A;  4OHI A;  1FHS A;  2K7A B;  1LKL A;  2MC1 A;  2DCR A;  3S8O A;  3BUN B;  3HCK A;  1O4H A;  1BLJ A;  3VS3 A;  1AOU F;  3VRZ A;  1FMK A;  1A1C A;  2L3T A;  3BUM B;  1AYD A;  3QWX X;  2KNO A;  5HKZ A;  1NZL A;  1BM2 A;  1X6C A;  1O4J A;  1UUS A;  1LUN A;  3GQI B;  2AOA A;  1X27 A;  1K9A A;  1BKL A;  2OQ1 A;  1NRV A;  3K2T A;  4H34 A;  3IMJ A;  1BFJ A;  4NWG A;  4DGP A;  1FU5 A;  5EHP A;  1O4Q A;  2HDX A;  1A1A A;  3VS2 A;  3N84 A;  1CJ1 A;  2QMS A;  1R1Q A;  3PS5 A;  5GJH A;  2CR4 A;  1F2F A;  2GSB A;  1FU6 A;  2PNB A;  1NZV A;  1LCJ A;  1O4G A;  4P9Z A;  2KGY A;  1O47 A;  1F1W A;  1AD5 A;  3GXX A;  1O4N A;  3MAZ A;  1LCK A;  4H1O A;  1CWD L;  3PLF B;  1OO3 A;  4X6S A;  2DVJ A;  4TZI A;  1BHF A;  4F5B A;  1JYU A;  5KAZ A;  3BUW B;  1D1Z A;  1O44 A;  2CBL A;  2RSY A;  2ROR A;  5GJI A;  2LNX A;  3OVE A;  2DLY A;  2HUW A;  1QAD A;  4F59 A;  3PSJ A;  1BKM A;  2SHP A;  5DC0 B;  1OO4 A;  2EL8 A;  5DC9 A;  1HCT B;  4D8K A;  3IN7 A;  1A1E A;  3QWY A;  5IBM A;  3IMD A;  1SPR A;  2C0T A;  4FBN A;  4JE4 A;  4OHL A;  1KSW A;  2IUG A;  2MK2 A;  1Z3K A;  2AOB A;  2YU7 A;  1KA6 A;  1LUM A;  2MRJ A;  1O4O A;  1G83 A;  1SHB A;  4QSY A;  4OHD A;  3MXC A;  1GHU A;  5EEL A;  1TCE A;  2KK6 A;  4K2R A;  3PJP A;  2FO0 A;  4EIH A;  5AXI A;  1JYR A;  3C7I A;  3HIZ B;  5EEQ A;  4LUE A;  1D4T A;  3KFJ A;  1RJA A;  2RMX A; 
#chains in the Genus database with same CATH homology
 2ABL A;  2LNW A;  3VRR A;  2PLD A;  1LUI A;  3PSK A;  3EAZ A;  2SRC A;  3OB2 B;  1RPY A;  5I6V A;  2LQW A;  2PLE A;  3WA4 A;  2K79 B;  2DLZ A;  1UUR A;  2EYY A;  2MQI A;  2CIA A;  1B47 A;  3NHN A;  1P13 A;  2CI8 A;  5J3X A;  1A81 A;  3CXL A;  4NWF A;  5BO4 A;  5EHR A;  4GL9 E;  1O4I A;  2PNA A;  4F5A A;  2IUH A;  1JWO A;  1O4B A;  2HMH A;  3ZNI A;  3S8N A;  2C0O A;  3CD3 A;  3OB1 B;  3CWG A;  3VS7 A;  4OHH A;  1BMB A;  1A08 A;  1TZE E;  1AOT F;  3S9K A;  3VRN A;  4XZ1 A;  3VS6 A;  1BHH B;  4JEG A;  4OHE A;  3BUO B;  4EY0 A;  1A1B A;  1MW4 A;  1O42 A;  1YVH A;  4JGH A;  1R1P A;  2C0I A;  4A4C A;  2LQN A;  3PQZ A;  1IJR A;  2H5K A;  4K44 A;  3N7Y A;  1H9O A;  1O4F A;  3VGO A;  1IS0 A;  2L6K A;  1BLK A;  1AYA A;  1SKJ A;  1O45 A;  1O48 A;  1CWE A;  4LUD A;  3VS1 A;  3IN8 A;  2EOB A;  1LKK A;  4GWF A;  3N8M A;  1SHD A;  2C9W A;  2FCI A;  3K2M A;  1O4D A;  1SPS A;  1FYR A;  3TL0 A;  4ROJ A;  2B3O A;  2CRH A;  4U17 A;  1CSZ A;  2CS0 A;  2H8H A;  2EO6 A;  1Y57 A;  2H46 E;  1D4W A;  1O4P A;  5AUL A;  2DM0 A;  5CDW A;  3CBL A;  5D0J A;  1QG1 E;  1OPL A;  5IBS A;  1BFI A;  2Y1M A;  1O4C A;  4WWQ A;  5HKY A;  2EO3 A;  4XZ0 A;  1O4R A;  2JYQ A;  1Y1U A;  2HDV A;  1O41 A;  3GXW A;  2EYV A;  2VIF A;  4M4Z A;  2EKX A;  1YVL A;  3VS5 A;  3EAC A;  1FBZ A;  3BUX B;  1KA7 A;  1AYC A;  3S8L A;  1A07 A;  5HKW A;  1X0N A;  1JYQ A;  4GPL B;  2IUI A;  1O4K A;  2RVF A;  5DF6 A;  2LCT A;  2XP1 A;  2GE9 A;  1XA6 A;  1AB2 A;  4A4B A;  1O4M A;  4K45 A;  2ECD A;  1BHH A;  1M61 A;  4E93 A;  3T04 A;  4U1P A;  2BBU A;  1O46 A;  2L4K A;  1GRI A;  3BKB A;  3UYO A;  1O4E A;  2Y1N A;  3HHM B;  1RQQ C;  3OP0 A;  1A09 A;  1PIC A;  1QCF A;  3OV1 A;  1FBV A;  2IZV A;  4K11 A;  1JU5 A;  1O4L A;  1CSY A;  3MXY A;  1O49 A;  1I3Z A;  2HCK A;  5DC4 A;  2EYZ A;  3UF4 A;  1OPK A;  3VRY A;  1LUK A;  3PFV A;  2YSX A;  4FL3 A;  2Y3A B;  4L1B B;  1R1S A;  3VRO A;  1KC2 A;  3TKZ A;  1AYB A;  3VRQ A;  3M7F A;  4DGX A;  3US4 A;  4E68 A;  1HCS B;  2ETZ A;  4P9V A;  2MRK A;  1SHA A;  2PTK A;  1BF5 A;  2DX0 A;  2OZO A;  1WQU A;  5EG3 B;  1ZFP E;  3VS0 A;  1O4A A;  2CI9 A;  3VRP A;  1BG1 A;  1M27 A;  1O43 A;  2EU0 A;  2AUG A;  3VS4 A;  4FL2 A;  1MIL A;  4OHI A;  1FHS A;  2K7A B;  1LKL A;  2MC1 A;  2DCR A;  3S8O A;  3BUN B;  3HCK A;  1O4H A;  1BLJ A;  3VS3 A;  1AOU F;  3VRZ A;  1FMK A;  1A1C A;  2L3T A;  3BUM B;  1AYD A;  3QWX X;  2KNO A;  5HKZ A;  1NZL A;  1BM2 A;  1X6C A;  1O4J A;  1UUS A;  1LUN A;  3GQI B;  2AOA A;  1X27 A;  1K9A A;  1BKL A;  2OQ1 A;  1NRV A;  4H34 A;  3IMJ A;  1BFJ A;  4NWG A;  4DGP A;  1FU5 A;  5EHP A;  1O4Q A;  2HDX A;  1A1A A;  3VS2 A;  3N84 A;  1CJ1 A;  2QMS A;  1R1Q A;  3PS5 A;  5GJH A;  2CR4 A;  1F2F A;  2GSB A;  1FU6 A;  2PNB A;  1NZV A;  1LCJ A;  1O4G A;  4P9Z A;  1O47 A;  1F1W A;  1AD5 A;  3GXX A;  1O4N A;  3MAZ A;  1LCK A;  4H1O A;  1CWD L;  3PLF B;  1OO3 A;  4X6S A;  2DVJ A;  4TZI A;  1BHF A;  4F5B A;  1JYU A;  5KAZ A;  3BUW B;  1D1Z A;  1O44 A;  2CBL A;  2RSY A;  2ROR A;  5GJI A;  2LNX A;  3OVE A;  2DLY A;  2HUW A;  1QAD A;  4F59 A;  3PSJ A;  1BKM A;  2SHP A;  5DC0 B;  1OO4 A;  2EL8 A;  5DC9 A;  1HCT B;  4D8K A;  3IN7 A;  1A1E A;  3QWY A;  5IBM A;  3IMD A;  1SPR A;  2C0T A;  4FBN A;  4JE4 A;  4OHL A;  1KSW A;  2IUG A;  2MK2 A;  1Z3K A;  2AOB A;  2YU7 A;  1KA6 A;  1LUM A;  2MRJ A;  1O4O A;  1G83 A;  1SHB A;  4QSY A;  4OHD A;  3MXC A;  1GHU A;  5EEL A;  1TCE A;  2KK6 A;  4K2R A;  3PJP A;  2FO0 A;  4EIH A;  5AXI A;  1JYR A;  3C7I A;  3HIZ B;  5EEQ A;  4LUE A;  1D4T A;  3KFJ A;  1RJA A;  2RMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...