1GHUA

Nmr solution structure of growth factor receptor-bound protein 2 (grb2) sh2 domain, 24 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
GSWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance solution structure of the growth factor receptor-bound protein 2 Src homology 2 domain.
pubmed doi rcsb
molecule keywords GRB2
molecule tags Src homology 2 domain
source organism Homo sapiens
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1996-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1ghuA00
1UURA 4ROJA 3BUNB 2DM0A 1CJ1A 4FL2A 1O4QA 3CD3A 2HCKA 3VS5A 3GXWA 1G83A 2MRKA 4OHLA 1OO4A 1AYAA 3TKZA 1OPKA 4H34A 1LUNA 1LUIA 3IMDA 2PLDA 1O48A 1AYCA 3IN7A 4OHHA 1SHBA 4E93A 3PJPA 1CSZA 1FHSA 3VRQA 1FBZA 4U1PA 1SHDA 1A09A 2KK6A 2RSYA 1O4PA 1BFJA 2SRCA 5IBMA 1AOUF 2YU7A 1FBVA 3S9KA 1RPYA 2QMSA 4E68A 4K2RA 1JYQA 1TCEA 3T04A 1KSWA 4U17A 2HDVA 2ABLA 5EHPA 1D4TA 4K45A 5EG3B 5HKWA 1A1EA 1O4GA 1BHHA 3TL0A 2DLYA 5EEQA 3VGOA 1A07A 1YVHA 2DLZA 3S8NA 1OO3A 3VS6A 2IUGA 1R1QA 2CI8A 2AOBA 2C0IA 2CI9A 2MRJA 2PTKA 2CIAA 4L1BB 1A1AA 1XA6A 2L3TA 2VIFA 3KFJA 3VS1A 1KA7A 3PQZA 4GL9E 2LNWA 4OHEA 4GWFA 1A1CA 5EHRA 1BLKA 2OQ1A 3QWXX 4M4ZA 1OPLA 1AB2A 2K7AB 2C0TA 1F1WA 1P13A 1FYRA 2C0OA 1A1BA 3PSJA 4A4BA 1O4LA 1LKKA 1O4BA 1KC2A 1AYDA 5GJHA 3S8LA 1KA6A 4OHIA 1O4DA 5EELA 1BF5A 3VRNA 1IS0A 2K79B 4TZIA 1AYBA 2EO3A 2YSXA 3VRPA 4XZ0A 1CSYA 4K11A 1D1ZA 4LUDA 2HMHA 3OB1B 1YVLA 1AD5A 3CXLA 4DGXA 2MC1A 1BFIA 3M7FA 2RORA 1BM2A 1BLJA 1JU5A 3PFVA 3MXCA 3VRRA 2H5KA 4H1OA 1X27A 3MXYA 1HCTB 3N7YA 3VS3A 2CS0A 3VRZA 5DF6A 1LCJA 1R1SA 3IN8A 4K44A 1X6CA 4F5AA 1K9AA 2FO0A 3EAZA 1TZEE 1BHHB 1JYUA 5KAZA 2IUHA 2RMXA 3OV1A 1O4IA 1O41A 3VRYA 3GXXA 5GJIA 1F2FA 1IJRA 1GRIA 2PLEA 4P9VA 2OZOA 5DC0B 4P9ZA 1O45A 3QWYA 2FCIA 2EL8A 1O4FA 2Y1MA 3C7IA 1M27A 2EKXA 2CRHA 1H9OA 4XZ1A 3VS7A 1O46A 1O4CA 3HHMB 1QG1E 2CR4A 1B47A 4X6SA 2EYVA 2L4KA 5AXIA 1X0NA 1FMKA 3OVEA 1O4OA 3VS0A 1SPSA 2LQWA 1BKMA 1M61A 1BG1A 1ZFPE 5I6VA 1HCSB 3BUWB 1RQQC 1A08A 2IUIA 3S8OA 5HKZA 5D0JA 2ETZA 3K2MA 2RVFA 3ZNIA 5DC4A 1NRVA 3CBLA 2AOAA 5CDWA 1MW4A 3UF4A 1R1PA 1CWEA 1O4AA 4JE4A 1LUKA 2EU0A 5J3XA 2BBUA 3UYOA 1GHUA 2LNXA 1UUSA 1FU6A 1BHFA 3GQIB 2LCTA 1LCKA 1O4KA 1AOTF 2DX0A 1D4WA 1CWDL 1FU5A 3N84A 2HDXA 3EACA 4FBNA 1LKLA 1PICA 2DVJA 1O47A 3NHNA 5DC9A 2B3OA 1LUMA 4NWGA 1QADA 2EYYA 5BO4A 3CWGA 5HKYA 2DCRA 1SPRA 2IZVA 2JYQA 1O4MA 4JEGA 1O4HA 1BKLA 1SKJA 1NZLA 2LQNA 2MK2A 2H8HA 2Y1NA 2EYZA 4EIHA 1Y57A 4LUEA 2HUWA 1O43A 2ECDA 4OHDA 1NZVA 1QCFA 1I3ZA 3PS5A 3OB2B 1O49A 3HIZB 4A4CA 4QSYA 2SHPA 1Y1UA 3IMJA 3VS2A 4D8KA 4JGHA 3N8MA 3PSKA 3OP0A 4F5BA 4F59A 2PNBA 1JYRA 4GPLB 1O4NA 2AUGA 4WWQA 3WA4A 1WQUA 3BUXB 3PLFB 2GSBA 3BKBA 4FL3A 3BUOB 3HCKA 1O44A 1O4RA 2C9WA 2PNAA 2CBLA 2XP1A 2KNOA 1O4JA 4EY0A 3MAZA 1A81A 2Y3AB 1Z3KA 2EO6A 1O4EA 2H46E 2MQIA 4NWFA 3VROA 1JWOA 1O42A 4DGPA 1BMBA 5IBSA 5AULA 3VS4A 2GE9A 2EOBA 1MILA 1SHAA 2L6KA 3US4A 3BUMB 1RJAA
chains in the Genus database with same CATH superfamily
1UURA 4ROJA 3BUNB 2DM0A 1CJ1A 4FL2A 1O4QA 3CD3A 2HCKA 3VS5A 3GXWA 1G83A 2MRKA 4OHLA 1OO4A 1AYAA 3TKZA 1OPKA 4H34A 1LUNA 1LUIA 3IMDA 2PLDA 1O48A 1AYCA 3IN7A 4OHHA 1SHBA 4E93A 3PJPA 1CSZA 1FHSA 3VRQA 1FBZA 4U1PA 1SHDA 1A09A 2KK6A 2RSYA 1O4PA 1BFJA 2SRCA 5IBMA 1AOUF 2YU7A 1FBVA 3S9KA 1RPYA 2QMSA 4E68A 4K2RA 1JYQA 1TCEA 3T04A 1KSWA 4U17A 2HDVA 2ABLA 5EHPA 1D4TA 4K45A 5EG3B 5HKWA 1A1EA 1O4GA 1BHHA 3TL0A 2DLYA 5EEQA 3VGOA 1A07A 1YVHA 2DLZA 3S8NA 1OO3A 3VS6A 2IUGA 1R1QA 2CI8A 2AOBA 2C0IA 2CI9A 2MRJA 2PTKA 2CIAA 4L1BB 1A1AA 1XA6A 2L3TA 2VIFA 3KFJA 3VS1A 1KA7A 3PQZA 4GL9E 2LNWA 4OHEA 4GWFA 1A1CA 5EHRA 1BLKA 2OQ1A 3QWXX 4M4ZA 1OPLA 1AB2A 2K7AB 2C0TA 1F1WA 1P13A 1FYRA 2C0OA 1A1BA 3PSJA 4A4BA 1O4LA 1LKKA 1O4BA 1KC2A 1AYDA 5GJHA 3S8LA 1KA6A 4OHIA 3K2TA 1O4DA 5EELA 1BF5A 3VRNA 1IS0A 2K79B 4TZIA 1AYBA 2EO3A 2YSXA 3VRPA 2LRAA 4XZ0A 1CSYA 4K11A 1D1ZA 4LUDA 2HMHA 3OB1B 1YVLA 1AD5A 3CXLA 4DGXA 2MC1A 1BFIA 3M7FA 2RORA 1BM2A 1BLJA 1JU5A 3PFVA 3MXCA 3VRRA 2H5KA 4H1OA 1X27A 3MXYA 1HCTB 3N7YA 3VS3A 2CS0A 3VRZA 5DF6A 1LCJA 1R1SA 3IN8A 4K44A 1X6CA 4F5AA 1K9AA 2FO0A 3EAZA 1TZEE 1BHHB 1JYUA 5KAZA 2IUHA 2RMXA 3OV1A 1O4IA 1O41A 3VRYA 3GXXA 5GJIA 1F2FA 1IJRA 1GRIA 2PLEA 4P9VA 2OZOA 5DC0B 4P9ZA 1O45A 3QWYA 2FCIA 2EL8A 1O4FA 2Y1MA 3C7IA 1M27A 2EKXA 2CRHA 1H9OA 4XZ1A 3VS7A 1O46A 1O4CA 3HHMB 1QG1E 2CR4A 1B47A 4X6SA 2EYVA 2L4KA 5AXIA 2KGYA 1X0NA 1FMKA 3OVEA 1O4OA 3VS0A 1SPSA 2LQWA 1BKMA 1M61A 1BG1A 1ZFPE 5I6VA 1HCSB 3BUWB 1RQQC 1A08A 2IUIA 3S8OA 5HKZA 5D0JA 2ETZA 3K2MA 3LYVA 2RVFA 3ZNIA 5DC4A 1NRVA 3CBLA 2AOAA 5CDWA 1MW4A 3UF4A 1R1PA 1CWEA 1O4AA 4JE4A 1LUKA 2EU0A 5J3XA 2BBUA 3UYOA 1GHUA 2LNXA 1UUSA 1FU6A 1BHFA 3GQIB 2LCTA 1LCKA 1O4KA 1AOTF 2DX0A 1D4WA 1CWDL 1FU5A 3N84A 2HDXA 3EACA 4FBNA 1LKLA 1PICA 2DVJA 1O47A 3NHNA 5DC9A 2B3OA 1LUMA 4NWGA 1QADA 2EYYA 5BO4A 3CWGA 5HKYA 2DCRA 1SPRA 2IZVA 2JYQA 1O4MA 4JEGA 1O4HA 1BKLA 1SKJA 1NZLA 2LQNA 2MK2A 2H8HA 2Y1NA 2EYZA 4EIHA 1Y57A 4LUEA 2HUWA 1O43A 2ECDA 4OHDA 1NZVA 1QCFA 1I3ZA 3PS5A 3OB2B 1O49A 3HIZB 4A4CA 4QSYA 2SHPA 1Y1UA 3IMJA 3VS2A 4D8KA 4JGHA 3N8MA 3PSKA 3OP0A 4F5BA 4F59A 2PNBA 1JYRA 4GPLB 1O4NA 2AUGA 4WWQA 3WA4A 1WQUA 3BUXB 3PLFB 2GSBA 3BKBA 4FL3A 3BUOB 3HCKA 1O44A 1O4RA 2C9WA 2PNAA 2CBLA 2XP1A 2KNOA 1O4JA 4EY0A 3MAZA 1A81A 2Y3AB 1Z3KA 2EO6A 1O4EA 2H46E 2MQIA 4NWFA 3VROA 1JWOA 1O42A 4DGPA 1BMBA 5IBSA 5AULA 3VS4A 2GE9A 2EOBA 1MILA 1SHAA 2L6KA 3US4A 3BUMB 1RJAA
chains in the Genus database with same CATH topology
1UURA 4ROJA 3BUNB 2DM0A 1CJ1A 4FL2A 1O4QA 3CD3A 2HCKA 3VS5A 3GXWA 1G83A 2MRKA 4OHLA 1OO4A 1AYAA 3TKZA 1OPKA 4H34A 1LUNA 1LUIA 3IMDA 2PLDA 1O48A 1AYCA 3IN7A 4OHHA 1SHBA 4E93A 3PJPA 1CSZA 1FHSA 3VRQA 1FBZA 4U1PA 1SHDA 1A09A 2KK6A 2RSYA 1O4PA 1BFJA 2SRCA 5IBMA 1AOUF 2YU7A 1FBVA 3S9KA 1RPYA 2QMSA 4E68A 4K2RA 1JYQA 1TCEA 3T04A 1KSWA 4U17A 2HDVA 2ABLA 5EHPA 1D4TA 4K45A 5EG3B 5HKWA 1A1EA 1O4GA 1BHHA 3TL0A 2DLYA 5EEQA 3VGOA 1A07A 1YVHA 2DLZA 3S8NA 1OO3A 3VS6A 2IUGA 1R1QA 2CI8A 2AOBA 2C0IA 2CI9A 2MRJA 2PTKA 2CIAA 4L1BB 1A1AA 1XA6A 2L3TA 2VIFA 3KFJA 3VS1A 1KA7A 3PQZA 4GL9E 2LNWA 4OHEA 4GWFA 1A1CA 5EHRA 1BLKA 2OQ1A 3QWXX 4M4ZA 1OPLA 1AB2A 2K7AB 2C0TA 1F1WA 1P13A 1FYRA 2C0OA 1A1BA 3PSJA 4A4BA 1O4LA 1LKKA 1O4BA 1KC2A 1AYDA 5GJHA 3S8LA 1KA6A 4OHIA 1O4DA 5EELA 1BF5A 3VRNA 1IS0A 2K79B 4TZIA 1AYBA 2EO3A 2YSXA 3VRPA 4XZ0A 1CSYA 4K11A 1D1ZA 4LUDA 2HMHA 3OB1B 1YVLA 1AD5A 3CXLA 4DGXA 2MC1A 1BFIA 3M7FA 2RORA 1BM2A 1BLJA 1JU5A 3PFVA 3MXCA 3VRRA 2H5KA 4H1OA 1X27A 3MXYA 1HCTB 3N7YA 3VS3A 2CS0A 3VRZA 5DF6A 1LCJA 1R1SA 3IN8A 4K44A 1X6CA 4F5AA 1K9AA 2FO0A 3EAZA 1TZEE 1BHHB 1JYUA 5KAZA 2IUHA 2RMXA 3OV1A 1O4IA 1O41A 3VRYA 3GXXA 5GJIA 1F2FA 1IJRA 1GRIA 2PLEA 4P9VA 2OZOA 5DC0B 4P9ZA 1O45A 3QWYA 2FCIA 2EL8A 1O4FA 2Y1MA 3C7IA 1M27A 2EKXA 2CRHA 1H9OA 4XZ1A 3VS7A 1O46A 1O4CA 3HHMB 1QG1E 2CR4A 1B47A 4X6SA 2EYVA 2L4KA 5AXIA 1X0NA 1FMKA 3OVEA 1O4OA 3VS0A 1SPSA 2LQWA 1BKMA 1M61A 1BG1A 1ZFPE 5I6VA 1HCSB 3BUWB 1RQQC 1A08A 2IUIA 3S8OA 5HKZA 5D0JA 2ETZA 3K2MA 2RVFA 3ZNIA 5DC4A 1NRVA 3CBLA 2AOAA 5CDWA 1MW4A 3UF4A 1R1PA 1CWEA 1O4AA 4JE4A 1LUKA 2EU0A 5J3XA 2BBUA 3UYOA 1GHUA 2LNXA 1UUSA 1FU6A 1BHFA 3GQIB 2LCTA 1LCKA 1O4KA 1AOTF 2DX0A 1D4WA 1CWDL 1FU5A 3N84A 2HDXA 3EACA 4FBNA 1LKLA 1PICA 2DVJA 1O47A 3NHNA 5DC9A 2B3OA 1LUMA 4NWGA 1QADA 2EYYA 5BO4A 3CWGA 5HKYA 2DCRA 1SPRA 2IZVA 2JYQA 1O4MA 4JEGA 1O4HA 1BKLA 1SKJA 1NZLA 2LQNA 2MK2A 2H8HA 2Y1NA 2EYZA 4EIHA 1Y57A 4LUEA 2HUWA 1O43A 2ECDA 4OHDA 1NZVA 1QCFA 1I3ZA 3PS5A 3OB2B 1O49A 3HIZB 4A4CA 4QSYA 2SHPA 1Y1UA 3IMJA 3VS2A 4D8KA 4JGHA 3N8MA 3PSKA 3OP0A 4F5BA 4F59A 2PNBA 1JYRA 4GPLB 1O4NA 2AUGA 4WWQA 3WA4A 1WQUA 3BUXB 3PLFB 2GSBA 3BKBA 4FL3A 3BUOB 3HCKA 1O44A 1O4RA 2C9WA 2PNAA 2CBLA 2XP1A 2KNOA 1O4JA 4EY0A 3MAZA 1A81A 2Y3AB 1Z3KA 2EO6A 1O4EA 2H46E 2MQIA 4NWFA 3VROA 1JWOA 1O42A 4DGPA 1BMBA 5IBSA 5AULA 3VS4A 2GE9A 2EOBA 1MILA 1SHAA 2L6KA 3US4A 3BUMB 1RJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUR A;  4ROJ A;  3BUN B;  2DM0 A;  1CJ1 A;  4FL2 A;  1O4Q A;  3CD3 A;  2HCK A;  3VS5 A;  3GXW A;  1G83 A;  2MRK A;  4OHL A;  1OO4 A;  1AYA A;  3TKZ A;  1OPK A;  4H34 A;  1LUN A;  1LUI A;  3IMD A;  2PLD A;  1O48 A;  1AYC A;  3IN7 A;  4OHH A;  1SHB A;  4E93 A;  3PJP A;  1CSZ A;  1FHS A;  3VRQ A;  1FBZ A;  4U1P A;  1SHD A;  1A09 A;  2KK6 A;  2RSY A;  1O4P A;  1BFJ A;  2SRC A;  5IBM A;  1AOU F;  2YU7 A;  1FBV A;  3S9K A;  1RPY A;  2QMS A;  4E68 A;  4K2R A;  1JYQ A;  1TCE A;  3T04 A;  1KSW A;  4U17 A;  2HDV A;  2ABL A;  5EHP A;  1D4T A;  4K45 A;  5EG3 B;  5HKW A;  1A1E A;  1O4G A;  1BHH A;  3TL0 A;  2DLY A;  5EEQ A;  3VGO A;  1A07 A;  1YVH A;  2DLZ A;  3S8N A;  1OO3 A;  3VS6 A;  2IUG A;  1R1Q A;  2CI8 A;  2AOB A;  2C0I A;  2CI9 A;  2MRJ A;  2PTK A;  2CIA A;  4L1B B;  1A1A A;  1XA6 A;  2L3T A;  2VIF A;  3KFJ A;  3VS1 A;  1KA7 A;  3PQZ A;  4GL9 E;  2LNW A;  4OHE A;  4GWF A;  1A1C A;  5EHR A;  1BLK A;  2OQ1 A;  3QWX X;  4M4Z A;  1OPL A;  1AB2 A;  2K7A B;  2C0T A;  1F1W A;  1P13 A;  1FYR A;  2C0O A;  1A1B A;  3PSJ A;  4A4B A;  1O4L A;  1LKK A;  1O4B A;  1KC2 A;  1AYD A;  5GJH A;  3S8L A;  1KA6 A;  4OHI A;  1O4D A;  5EEL A;  1BF5 A;  3VRN A;  1IS0 A;  2K79 B;  4TZI A;  1AYB A;  2EO3 A;  2YSX A;  3VRP A;  4XZ0 A;  1CSY A;  4K11 A;  1D1Z A;  4LUD A;  2HMH A;  3OB1 B;  1YVL A;  1AD5 A;  3CXL A;  4DGX A;  2MC1 A;  1BFI A;  3M7F A;  2ROR A;  1BM2 A;  1BLJ A;  1JU5 A;  3PFV A;  3MXC A;  3VRR A;  2H5K A;  4H1O A;  1X27 A;  3MXY A;  1HCT B;  3N7Y A;  3VS3 A;  2CS0 A;  3VRZ A;  5DF6 A;  1LCJ A;  1R1S A;  3IN8 A;  4K44 A;  1X6C A;  4F5A A;  1K9A A;  2FO0 A;  3EAZ A;  1TZE E;  1BHH B;  1JYU A;  5KAZ A;  2IUH A;  2RMX A;  3OV1 A;  1O4I A;  1O41 A;  3VRY A;  3GXX A;  5GJI A;  1F2F A;  1IJR A;  1GRI A;  2PLE A;  4P9V A;  2OZO A;  5DC0 B;  4P9Z A;  1O45 A;  3QWY A;  2FCI A;  2EL8 A;  1O4F A;  2Y1M A;  3C7I A;  1M27 A;  2EKX A;  2CRH A;  1H9O A;  4XZ1 A;  3VS7 A;  1O46 A;  1O4C A;  3HHM B;  1QG1 E;  2CR4 A;  1B47 A;  4X6S A;  2EYV A;  2L4K A;  5AXI A;  1X0N A;  1FMK A;  3OVE A;  1O4O A;  3VS0 A;  1SPS A;  2LQW A;  1BKM A;  1M61 A;  1BG1 A;  1ZFP E;  5I6V A;  1HCS B;  3BUW B;  1RQQ C;  1A08 A;  2IUI A;  3S8O A;  5HKZ A;  5D0J A;  2ETZ A;  3K2M A;  2RVF A;  3ZNI A;  5DC4 A;  1NRV A;  3CBL A;  2AOA A;  5CDW A;  1MW4 A;  3UF4 A;  1R1P A;  1CWE A;  1O4A A;  4JE4 A;  1LUK A;  2EU0 A;  5J3X A;  2BBU A;  3UYO A;  1GHU A;  2LNX A;  1UUS A;  1FU6 A;  1BHF A;  3GQI B;  2LCT A;  1LCK A;  1O4K A;  1AOT F;  2DX0 A;  1D4W A;  1CWD L;  1FU5 A;  3N84 A;  2HDX A;  3EAC A;  4FBN A;  1LKL A;  1PIC A;  2DVJ A;  1O47 A;  3NHN A;  5DC9 A;  2B3O A;  1LUM A;  4NWG A;  1QAD A;  2EYY A;  5BO4 A;  3CWG A;  5HKY A;  2DCR A;  1SPR A;  2IZV A;  2JYQ A;  1O4M A;  4JEG A;  1O4H A;  1BKL A;  1SKJ A;  1NZL A;  2LQN A;  2MK2 A;  2H8H A;  2Y1N A;  2EYZ A;  4EIH A;  1Y57 A;  4LUE A;  2HUW A;  1O43 A;  2ECD A;  4OHD A;  1NZV A;  1QCF A;  1I3Z A;  3PS5 A;  3OB2 B;  1O49 A;  3HIZ B;  4A4C A;  4QSY A;  2SHP A;  1Y1U A;  3IMJ A;  3VS2 A;  4D8K A;  4JGH A;  3N8M A;  3PSK A;  3OP0 A;  4F5B A;  4F59 A;  2PNB A;  1JYR A;  4GPL B;  1O4N A;  2AUG A;  4WWQ A;  3WA4 A;  1WQU A;  3BUX B;  3PLF B;  2GSB A;  3BKB A;  4FL3 A;  3BUO B;  3HCK A;  1O44 A;  1O4R A;  2C9W A;  2PNA A;  2CBL A;  2XP1 A;  2KNO A;  1O4J A;  4EY0 A;  3MAZ A;  1A81 A;  2Y3A B;  1Z3K A;  2EO6 A;  1O4E A;  2H46 E;  2MQI A;  4NWF A;  3VRO A;  1JWO A;  1O42 A;  4DGP A;  1BMB A;  5IBS A;  5AUL A;  3VS4 A;  2GE9 A;  2EOB A;  1MIL A;  1SHA A;  2L6K A;  3US4 A;  3BUM B;  1RJA A; 
#chains in the Genus database with same CATH topology
 1UUR A;  4ROJ A;  3BUN B;  2DM0 A;  1CJ1 A;  4FL2 A;  1O4Q A;  3CD3 A;  2HCK A;  3VS5 A;  3GXW A;  1G83 A;  2MRK A;  4OHL A;  1OO4 A;  1AYA A;  3TKZ A;  1OPK A;  4H34 A;  1LUN A;  1LUI A;  3IMD A;  2PLD A;  1O48 A;  1AYC A;  3IN7 A;  4OHH A;  1SHB A;  4E93 A;  3PJP A;  1CSZ A;  1FHS A;  3VRQ A;  1FBZ A;  4U1P A;  1SHD A;  1A09 A;  2KK6 A;  2RSY A;  1O4P A;  1BFJ A;  2SRC A;  5IBM A;  1AOU F;  2YU7 A;  1FBV A;  3S9K A;  1RPY A;  2QMS A;  4E68 A;  4K2R A;  1JYQ A;  1TCE A;  3T04 A;  1KSW A;  4U17 A;  2HDV A;  2ABL A;  5EHP A;  1D4T A;  4K45 A;  5EG3 B;  5HKW A;  1A1E A;  1O4G A;  1BHH A;  3TL0 A;  2DLY A;  5EEQ A;  3VGO A;  1A07 A;  1YVH A;  2DLZ A;  3S8N A;  1OO3 A;  3VS6 A;  2IUG A;  1R1Q A;  2CI8 A;  2AOB A;  2C0I A;  2CI9 A;  2MRJ A;  2PTK A;  2CIA A;  4L1B B;  1A1A A;  1XA6 A;  2L3T A;  2VIF A;  3KFJ A;  3VS1 A;  1KA7 A;  3PQZ A;  4GL9 E;  2LNW A;  4OHE A;  4GWF A;  1A1C A;  5EHR A;  1BLK A;  2OQ1 A;  3QWX X;  4M4Z A;  1OPL A;  1AB2 A;  2K7A B;  2C0T A;  1F1W A;  1P13 A;  1FYR A;  2C0O A;  1A1B A;  3PSJ A;  4A4B A;  1O4L A;  1LKK A;  1O4B A;  1KC2 A;  1AYD A;  5GJH A;  3S8L A;  1KA6 A;  4OHI A;  3K2T A;  1O4D A;  5EEL A;  1BF5 A;  3VRN A;  1IS0 A;  2K79 B;  4TZI A;  1AYB A;  2EO3 A;  2YSX A;  3VRP A;  2LRA A;  4XZ0 A;  1CSY A;  4K11 A;  1D1Z A;  4LUD A;  2HMH A;  3OB1 B;  1YVL A;  1AD5 A;  3CXL A;  4DGX A;  2MC1 A;  1BFI A;  3M7F A;  2ROR A;  1BM2 A;  1BLJ A;  1JU5 A;  3PFV A;  3MXC A;  3VRR A;  2H5K A;  4H1O A;  1X27 A;  3MXY A;  1HCT B;  3N7Y A;  3VS3 A;  2CS0 A;  3VRZ A;  5DF6 A;  1LCJ A;  1R1S A;  3IN8 A;  4K44 A;  1X6C A;  4F5A A;  1K9A A;  2FO0 A;  3EAZ A;  1TZE E;  1BHH B;  1JYU A;  5KAZ A;  2IUH A;  2RMX A;  3OV1 A;  1O4I A;  1O41 A;  3VRY A;  3GXX A;  5GJI A;  1F2F A;  1IJR A;  1GRI A;  2PLE A;  4P9V A;  2OZO A;  5DC0 B;  4P9Z A;  1O45 A;  3QWY A;  2FCI A;  2EL8 A;  1O4F A;  2Y1M A;  3C7I A;  1M27 A;  2EKX A;  2CRH A;  1H9O A;  4XZ1 A;  3VS7 A;  1O46 A;  1O4C A;  3HHM B;  1QG1 E;  2CR4 A;  1B47 A;  4X6S A;  2EYV A;  2L4K A;  5AXI A;  2KGY A;  1X0N A;  1FMK A;  3OVE A;  1O4O A;  3VS0 A;  1SPS A;  2LQW A;  1BKM A;  1M61 A;  1BG1 A;  1ZFP E;  5I6V A;  1HCS B;  3BUW B;  1RQQ C;  1A08 A;  2IUI A;  3S8O A;  5HKZ A;  5D0J A;  2ETZ A;  3K2M A;  3LYV A;  2RVF A;  3ZNI A;  5DC4 A;  1NRV A;  3CBL A;  2AOA A;  5CDW A;  1MW4 A;  3UF4 A;  1R1P A;  1CWE A;  1O4A A;  4JE4 A;  1LUK A;  2EU0 A;  5J3X A;  2BBU A;  3UYO A;  1GHU A;  2LNX A;  1UUS A;  1FU6 A;  1BHF A;  3GQI B;  2LCT A;  1LCK A;  1O4K A;  1AOT F;  2DX0 A;  1D4W A;  1CWD L;  1FU5 A;  3N84 A;  2HDX A;  3EAC A;  4FBN A;  1LKL A;  1PIC A;  2DVJ A;  1O47 A;  3NHN A;  5DC9 A;  2B3O A;  1LUM A;  4NWG A;  1QAD A;  2EYY A;  5BO4 A;  3CWG A;  5HKY A;  2DCR A;  1SPR A;  2IZV A;  2JYQ A;  1O4M A;  4JEG A;  1O4H A;  1BKL A;  1SKJ A;  1NZL A;  2LQN A;  2MK2 A;  2H8H A;  2Y1N A;  2EYZ A;  4EIH A;  1Y57 A;  4LUE A;  2HUW A;  1O43 A;  2ECD A;  4OHD A;  1NZV A;  1QCF A;  1I3Z A;  3PS5 A;  3OB2 B;  1O49 A;  3HIZ B;  4A4C A;  4QSY A;  2SHP A;  1Y1U A;  3IMJ A;  3VS2 A;  4D8K A;  4JGH A;  3N8M A;  3PSK A;  3OP0 A;  4F5B A;  4F59 A;  2PNB A;  1JYR A;  4GPL B;  1O4N A;  2AUG A;  4WWQ A;  3WA4 A;  1WQU A;  3BUX B;  3PLF B;  2GSB A;  3BKB A;  4FL3 A;  3BUO B;  3HCK A;  1O44 A;  1O4R A;  2C9W A;  2PNA A;  2CBL A;  2XP1 A;  2KNO A;  1O4J A;  4EY0 A;  3MAZ A;  1A81 A;  2Y3A B;  1Z3K A;  2EO6 A;  1O4E A;  2H46 E;  2MQI A;  4NWF A;  3VRO A;  1JWO A;  1O42 A;  4DGP A;  1BMB A;  5IBS A;  5AUL A;  3VS4 A;  2GE9 A;  2EOB A;  1MIL A;  1SHA A;  2L6K A;  3US4 A;  3BUM B;  1RJA A; 
#chains in the Genus database with same CATH homology
 1UUR A;  4ROJ A;  3BUN B;  2DM0 A;  1CJ1 A;  4FL2 A;  1O4Q A;  3CD3 A;  2HCK A;  3VS5 A;  3GXW A;  1G83 A;  2MRK A;  4OHL A;  1OO4 A;  1AYA A;  3TKZ A;  1OPK A;  4H34 A;  1LUN A;  1LUI A;  3IMD A;  2PLD A;  1O48 A;  1AYC A;  3IN7 A;  4OHH A;  1SHB A;  4E93 A;  3PJP A;  1CSZ A;  1FHS A;  3VRQ A;  1FBZ A;  4U1P A;  1SHD A;  1A09 A;  2KK6 A;  2RSY A;  1O4P A;  1BFJ A;  2SRC A;  5IBM A;  1AOU F;  2YU7 A;  1FBV A;  3S9K A;  1RPY A;  2QMS A;  4E68 A;  4K2R A;  1JYQ A;  1TCE A;  3T04 A;  1KSW A;  4U17 A;  2HDV A;  2ABL A;  5EHP A;  1D4T A;  4K45 A;  5EG3 B;  5HKW A;  1A1E A;  1O4G A;  1BHH A;  3TL0 A;  2DLY A;  5EEQ A;  3VGO A;  1A07 A;  1YVH A;  2DLZ A;  3S8N A;  1OO3 A;  3VS6 A;  2IUG A;  1R1Q A;  2CI8 A;  2AOB A;  2C0I A;  2CI9 A;  2MRJ A;  2PTK A;  2CIA A;  4L1B B;  1A1A A;  1XA6 A;  2L3T A;  2VIF A;  3KFJ A;  3VS1 A;  1KA7 A;  3PQZ A;  4GL9 E;  2LNW A;  4OHE A;  4GWF A;  1A1C A;  5EHR A;  1BLK A;  2OQ1 A;  3QWX X;  4M4Z A;  1OPL A;  1AB2 A;  2K7A B;  2C0T A;  1F1W A;  1P13 A;  1FYR A;  2C0O A;  1A1B A;  3PSJ A;  4A4B A;  1O4L A;  1LKK A;  1O4B A;  1KC2 A;  1AYD A;  5GJH A;  3S8L A;  1KA6 A;  4OHI A;  1O4D A;  5EEL A;  1BF5 A;  3VRN A;  1IS0 A;  2K79 B;  4TZI A;  1AYB A;  2EO3 A;  2YSX A;  3VRP A;  4XZ0 A;  1CSY A;  4K11 A;  1D1Z A;  4LUD A;  2HMH A;  3OB1 B;  1YVL A;  1AD5 A;  3CXL A;  4DGX A;  2MC1 A;  1BFI A;  3M7F A;  2ROR A;  1BM2 A;  1BLJ A;  1JU5 A;  3PFV A;  3MXC A;  3VRR A;  2H5K A;  4H1O A;  1X27 A;  3MXY A;  1HCT B;  3N7Y A;  3VS3 A;  2CS0 A;  3VRZ A;  5DF6 A;  1LCJ A;  1R1S A;  3IN8 A;  4K44 A;  1X6C A;  4F5A A;  1K9A A;  2FO0 A;  3EAZ A;  1TZE E;  1BHH B;  1JYU A;  5KAZ A;  2IUH A;  2RMX A;  3OV1 A;  1O4I A;  1O41 A;  3VRY A;  3GXX A;  5GJI A;  1F2F A;  1IJR A;  1GRI A;  2PLE A;  4P9V A;  2OZO A;  5DC0 B;  4P9Z A;  1O45 A;  3QWY A;  2FCI A;  2EL8 A;  1O4F A;  2Y1M A;  3C7I A;  1M27 A;  2EKX A;  2CRH A;  1H9O A;  4XZ1 A;  3VS7 A;  1O46 A;  1O4C A;  3HHM B;  1QG1 E;  2CR4 A;  1B47 A;  4X6S A;  2EYV A;  2L4K A;  5AXI A;  1X0N A;  1FMK A;  3OVE A;  1O4O A;  3VS0 A;  1SPS A;  2LQW A;  1BKM A;  1M61 A;  1BG1 A;  1ZFP E;  5I6V A;  1HCS B;  3BUW B;  1RQQ C;  1A08 A;  2IUI A;  3S8O A;  5HKZ A;  5D0J A;  2ETZ A;  3K2M A;  2RVF A;  3ZNI A;  5DC4 A;  1NRV A;  3CBL A;  2AOA A;  5CDW A;  1MW4 A;  3UF4 A;  1R1P A;  1CWE A;  1O4A A;  4JE4 A;  1LUK A;  2EU0 A;  5J3X A;  2BBU A;  3UYO A;  1GHU A;  2LNX A;  1UUS A;  1FU6 A;  1BHF A;  3GQI B;  2LCT A;  1LCK A;  1O4K A;  1AOT F;  2DX0 A;  1D4W A;  1CWD L;  1FU5 A;  3N84 A;  2HDX A;  3EAC A;  4FBN A;  1LKL A;  1PIC A;  2DVJ A;  1O47 A;  3NHN A;  5DC9 A;  2B3O A;  1LUM A;  4NWG A;  1QAD A;  2EYY A;  5BO4 A;  3CWG A;  5HKY A;  2DCR A;  1SPR A;  2IZV A;  2JYQ A;  1O4M A;  4JEG A;  1O4H A;  1BKL A;  1SKJ A;  1NZL A;  2LQN A;  2MK2 A;  2H8H A;  2Y1N A;  2EYZ A;  4EIH A;  1Y57 A;  4LUE A;  2HUW A;  1O43 A;  2ECD A;  4OHD A;  1NZV A;  1QCF A;  1I3Z A;  3PS5 A;  3OB2 B;  1O49 A;  3HIZ B;  4A4C A;  4QSY A;  2SHP A;  1Y1U A;  3IMJ A;  3VS2 A;  4D8K A;  4JGH A;  3N8M A;  3PSK A;  3OP0 A;  4F5B A;  4F59 A;  2PNB A;  1JYR A;  4GPL B;  1O4N A;  2AUG A;  4WWQ A;  3WA4 A;  1WQU A;  3BUX B;  3PLF B;  2GSB A;  3BKB A;  4FL3 A;  3BUO B;  3HCK A;  1O44 A;  1O4R A;  2C9W A;  2PNA A;  2CBL A;  2XP1 A;  2KNO A;  1O4J A;  4EY0 A;  3MAZ A;  1A81 A;  2Y3A B;  1Z3K A;  2EO6 A;  1O4E A;  2H46 E;  2MQI A;  4NWF A;  3VRO A;  1JWO A;  1O42 A;  4DGP A;  1BMB A;  5IBS A;  5AUL A;  3VS4 A;  2GE9 A;  2EOB A;  1MIL A;  1SHA A;  2L6K A;  3US4 A;  3BUM B;  1RJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...