3US4A

Crystal structure of a sh2 domain of a megakaryocyte-associated tyrosine kinase (matk) from homo sapiens at 1.50 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a SH2 domain of a megakaryocyte-associated tyrosine kinase (MATK) from Homo sapiens at 1.50 A resolution
rcsb
molecule keywords Megakaryocyte-associated tyrosine-protein kinase
molecule tags Transferase
source organism Homo sapiens
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3us4A00
1O4QA 2LNXA 3VRYA 3GXWA 4A4CA 1O4CA 4E93A 1O4DA 3BKBA 1FBVA 3TKZA 1AYBA 1O45A 3S9KA 5D0JA 5EHRA 4K44A 2EU0A 1SHAA 1O4RA 3OP0A 3S8OA 3EACA 4NWFA 3VS4A 1F2FA 1H9OA 5HKYA 2GSBA 2Y1NA 1D4WA 2HCKA 1A81A 2AOAA 5I6VA 4M4ZA 2PLDA 2H8HA 3VS6A 5AULA 3VS1A 3BUOB 2IZVA 2LQNA 3OB1B 2EKXA 3TL0A 2SHPA 1XA6A 1X27A 3ZNIA 1O4AA 1A1AA 5GJHA 2LCTA 1A1CA 4WWQA 4EY0A 4GL9E 1OPKA 3PLFB 1FHSA 1AOUF 3EAZA 4OHLA 1CSYA 4DGPA 3VRNA 1AOTF 2SRCA 1O44A 1QG1E 1CWDL 1TZEE 2EO3A 2DLZA 1AD5A 1O43A 1JWOA 1SKJA 3BUMB 1R1PA 3IN7A 3MXYA 1O4GA 4E68A 3PSKA 1LUKA 2Y1MA 3IMDA 1RPYA 1UURA 1FBZA 1WQUA 1O4OA 4JEGA 1BHFA 3S8NA 2Y3AB 2MC1A 1MW4A 3PS5A 1M61A 1O4HA 1PICA 4K11A 1A1EA 5KAZA 1O46A 5AXIA 2ECDA 2PTKA 1KA6A 4F59A 1A08A 5EELA 4A4BA 3PJPA 1BG1A 2L4KA 2KK6A 2KNOA 1QADA 3CBLA 1HCSB 4OHHA 2DCRA 1Z3KA 4L1BB 1O49A 1O4KA 1R1SA 1IS0A 3K2MA 1OO4A 4U1PA 1O4PA 1SHDA 3KFJA 1FU6A 1NZLA 3GXXA 1RQQC 3CD3A 2FO0A 1BKLA 2QMSA 3S8LA 1OPLA 4H1OA 3BUXB 3CXLA 1A1BA 2CRHA 1B47A 1FYRA 1LUNA 3VROA 1GHUA 5DC9A 4H34A 3HIZB 4K2RA 1JU5A 2EYZA 5DC4A 4OHIA 2C0TA 2FCIA 1LCJA 1MILA 4DGXA 2AUGA 1SPRA 1LKLA 1O4JA 1JYRA 2L6KA 3OVEA 3PQZA 5J3XA 2LNWA 1R1QA 1BKMA 2CBLA 4P9ZA 1BMBA 5IBMA 2EYYA 2CS0A 1OO3A 3HCKA 1I3ZA 2EO6A 2OZOA 1D4TA 2OQ1A 5BO4A 3VRRA 3VRZA 2HDVA 2YSXA 3VGOA 1FU5A 1CJ1A 1F1WA 2IUGA 3BUWB 2ABLA 1SPSA 1O4IA 4FL2A 1QCFA 3GQIB 3OV1A 3VRPA 1K9AA 2ETZA 3IN8A 3VS5A 1RJAA 3N8MA 2CIAA 1O41A 1O4EA 3VRQA 2DVJA 2AOBA 2PNBA 1O42A 2DX0A 4X6SA 2XP1A 4F5AA 1CWEA 2MRJA 2DM0A 2EYVA 2HDXA 3VS0A 1AYAA 3PSJA 3IMJA 4LUDA 2RORA 5CDWA 1LUMA 5HKZA 1X0NA 5EG3B 2H46E 4P9VA 5DC0B 1O4BA 2EL8A 1NRVA 1FMKA 1A07A 3VS7A 3WA4A 1KA7A 2K79B 1Y57A 2PNAA 1KC2A 1NZVA 5EHPA 3N7YA 4JE4A 1BHHA 1LKKA 3UF4A 1LUIA 1TCEA 2MQIA 2MRKA 1YVLA 1O4LA 1ZFPE 3QWXX 2IUHA 2LQWA 3NHNA 5HKWA 1X6CA 3OB2B 2MK2A 1O4MA 3C7IA 5DF6A 4F5BA 4EIHA 4LUEA 4TZIA 1AYCA 1O48A 3T04A 3MAZA 2RSYA 4U17A 3US4A 2C0OA 4FL3A 1O4FA 1D1ZA 1A09A 2CI8A 2RVFA 5EEQA 2YU7A 2HUWA 3BUNB 1M27A 2H5KA 2L3TA 1Y1UA 2VIFA 1BFIA 1UUSA 4XZ1A 1IJRA 4OHDA 2PLEA 1SHBA 4D8KA 2RMXA 3HHMB 1JYQA 1HCTB 2B3OA 1JYUA 2K7AB 4JGHA 4FBNA 1YVHA 4OHEA 1O47A 5GJIA 3UYOA 1O4NA 2BBUA 1BLJA 2DLYA 1BFJA 2CI9A 2HMHA 4QSYA 1BM2A 4GPLB 3QWYA 3PFVA 4XZ0A 1BHHB 3N84A 2IUIA 1G83A 4ROJA 3VS2A 1BF5A 1CSZA 1AYDA 4K45A 1KSWA 2C9WA 4NWGA 1AB2A 5IBSA 1P13A 3M7FA 3VS3A 1BLKA 3MXCA 2JYQA 2C0IA 2CR4A 4GWFA 2GE9A 1GRIA 3CWGA 2EOBA 1LCKA
chains in the Genus database with same CATH superfamily
1O4QA 2LNXA 3VRYA 3GXWA 4A4CA 1O4CA 4E93A 1O4DA 3BKBA 1FBVA 3TKZA 1AYBA 1O45A 3S9KA 5D0JA 5EHRA 4K44A 2EU0A 1SHAA 1O4RA 3OP0A 3S8OA 3EACA 4NWFA 3VS4A 1F2FA 1H9OA 5HKYA 2GSBA 2Y1NA 1D4WA 2HCKA 1A81A 2AOAA 5I6VA 4M4ZA 2PLDA 2H8HA 3VS6A 5AULA 3VS1A 3BUOB 2IZVA 2LQNA 3OB1B 2EKXA 3TL0A 2SHPA 1XA6A 1X27A 3ZNIA 1O4AA 1A1AA 5GJHA 2LCTA 1A1CA 4WWQA 4EY0A 4GL9E 1OPKA 3PLFB 1FHSA 1AOUF 3EAZA 4OHLA 1CSYA 4DGPA 3VRNA 1AOTF 2SRCA 1O44A 1QG1E 1CWDL 1TZEE 2EO3A 2DLZA 1AD5A 1O43A 1JWOA 1SKJA 3BUMB 1R1PA 3IN7A 3MXYA 1O4GA 4E68A 3PSKA 1LUKA 2Y1MA 3IMDA 1RPYA 1UURA 1FBZA 1WQUA 1O4OA 4JEGA 1BHFA 3S8NA 2Y3AB 2MC1A 1MW4A 3PS5A 1M61A 1O4HA 1PICA 4K11A 1A1EA 5KAZA 1O46A 5AXIA 2ECDA 2PTKA 1KA6A 4F59A 1A08A 5EELA 4A4BA 3PJPA 1BG1A 2L4KA 2KK6A 2KNOA 1QADA 3CBLA 1HCSB 4OHHA 2DCRA 1Z3KA 4L1BB 1O49A 1O4KA 1R1SA 1IS0A 3K2MA 1OO4A 4U1PA 1O4PA 1SHDA 3KFJA 1FU6A 1NZLA 3GXXA 1RQQC 3CD3A 2FO0A 1BKLA 2QMSA 3S8LA 1OPLA 4H1OA 3BUXB 3K2TA 3CXLA 1A1BA 2CRHA 1B47A 1FYRA 1LUNA 3VROA 1GHUA 5DC9A 4H34A 3HIZB 4K2RA 1JU5A 2EYZA 5DC4A 4OHIA 2C0TA 2LRAA 2FCIA 1LCJA 1MILA 4DGXA 2AUGA 1SPRA 1LKLA 1O4JA 1JYRA 2L6KA 3OVEA 3PQZA 3LYVA 5J3XA 2LNWA 1R1QA 1BKMA 2CBLA 4P9ZA 1BMBA 5IBMA 2EYYA 2CS0A 1OO3A 3HCKA 1I3ZA 2EO6A 2OZOA 1D4TA 2OQ1A 5BO4A 3VRRA 3VRZA 2HDVA 2YSXA 3VGOA 1FU5A 1CJ1A 1F1WA 2IUGA 3BUWB 2ABLA 1SPSA 1O4IA 4FL2A 1QCFA 3GQIB 3OV1A 3VRPA 1K9AA 2ETZA 3IN8A 3VS5A 1RJAA 3N8MA 2CIAA 1O41A 1O4EA 3VRQA 2DVJA 2AOBA 2PNBA 1O42A 2DX0A 4X6SA 2XP1A 4F5AA 1CWEA 2MRJA 2DM0A 2EYVA 2HDXA 3VS0A 1AYAA 3PSJA 2KGYA 3IMJA 4LUDA 2RORA 5CDWA 1LUMA 5HKZA 1X0NA 5EG3B 2H46E 4P9VA 5DC0B 1O4BA 2EL8A 1NRVA 1FMKA 1A07A 3VS7A 3WA4A 1KA7A 2K79B 1Y57A 2PNAA 1KC2A 1NZVA 5EHPA 3N7YA 4JE4A 1BHHA 1LKKA 3UF4A 1LUIA 1TCEA 2MQIA 2MRKA 1YVLA 1O4LA 1ZFPE 3QWXX 2IUHA 2LQWA 3NHNA 5HKWA 1X6CA 3OB2B 2MK2A 1O4MA 3C7IA 5DF6A 4F5BA 4EIHA 4LUEA 4TZIA 1AYCA 1O48A 3T04A 3MAZA 2RSYA 4U17A 3US4A 2C0OA 4FL3A 1O4FA 1D1ZA 1A09A 2CI8A 2RVFA 5EEQA 2YU7A 2HUWA 3BUNB 1M27A 2H5KA 2L3TA 1Y1UA 2VIFA 1BFIA 1UUSA 4XZ1A 1IJRA 4OHDA 2PLEA 1SHBA 4D8KA 2RMXA 3HHMB 1JYQA 1HCTB 2B3OA 1JYUA 2K7AB 4JGHA 4FBNA 1YVHA 4OHEA 1O47A 5GJIA 3UYOA 1O4NA 2BBUA 1BLJA 2DLYA 1BFJA 2CI9A 2HMHA 4QSYA 1BM2A 4GPLB 3QWYA 3PFVA 4XZ0A 1BHHB 3N84A 2IUIA 1G83A 4ROJA 3VS2A 1BF5A 1CSZA 1AYDA 4K45A 1KSWA 2C9WA 4NWGA 1AB2A 5IBSA 1P13A 3M7FA 3VS3A 1BLKA 3MXCA 2JYQA 2C0IA 2CR4A 4GWFA 2GE9A 1GRIA 3CWGA 2EOBA 1LCKA
chains in the Genus database with same CATH topology
1O4QA 2LNXA 3VRYA 3GXWA 4A4CA 1O4CA 4E93A 1O4DA 3BKBA 1FBVA 3TKZA 1AYBA 1O45A 3S9KA 5D0JA 5EHRA 4K44A 2EU0A 1SHAA 1O4RA 3OP0A 3S8OA 3EACA 4NWFA 3VS4A 1F2FA 1H9OA 5HKYA 2GSBA 2Y1NA 1D4WA 2HCKA 1A81A 2AOAA 5I6VA 4M4ZA 2PLDA 2H8HA 3VS6A 5AULA 3VS1A 3BUOB 2IZVA 2LQNA 3OB1B 2EKXA 3TL0A 2SHPA 1XA6A 1X27A 3ZNIA 1O4AA 1A1AA 5GJHA 2LCTA 1A1CA 4WWQA 4EY0A 4GL9E 1OPKA 3PLFB 1FHSA 1AOUF 3EAZA 4OHLA 1CSYA 4DGPA 3VRNA 1AOTF 2SRCA 1O44A 1QG1E 1CWDL 1TZEE 2EO3A 2DLZA 1AD5A 1O43A 1JWOA 1SKJA 3BUMB 1R1PA 3IN7A 3MXYA 1O4GA 4E68A 3PSKA 1LUKA 2Y1MA 3IMDA 1RPYA 1UURA 1FBZA 1WQUA 1O4OA 4JEGA 1BHFA 3S8NA 2Y3AB 2MC1A 1MW4A 3PS5A 1M61A 1O4HA 1PICA 4K11A 1A1EA 5KAZA 1O46A 5AXIA 2ECDA 2PTKA 1KA6A 4F59A 1A08A 5EELA 4A4BA 3PJPA 1BG1A 2L4KA 2KK6A 2KNOA 1QADA 3CBLA 1HCSB 4OHHA 2DCRA 1Z3KA 4L1BB 1O49A 1O4KA 1R1SA 1IS0A 3K2MA 1OO4A 4U1PA 1O4PA 1SHDA 3KFJA 1FU6A 1NZLA 3GXXA 1RQQC 3CD3A 2FO0A 1BKLA 2QMSA 3S8LA 1OPLA 4H1OA 3BUXB 3CXLA 1A1BA 2CRHA 1B47A 1FYRA 1LUNA 3VROA 1GHUA 5DC9A 4H34A 3HIZB 4K2RA 1JU5A 2EYZA 5DC4A 4OHIA 2C0TA 2FCIA 1LCJA 1MILA 4DGXA 2AUGA 1SPRA 1LKLA 1O4JA 1JYRA 2L6KA 3OVEA 3PQZA 5J3XA 2LNWA 1R1QA 1BKMA 2CBLA 4P9ZA 1BMBA 5IBMA 2EYYA 2CS0A 1OO3A 3HCKA 1I3ZA 2EO6A 2OZOA 1D4TA 2OQ1A 5BO4A 3VRRA 3VRZA 2HDVA 2YSXA 3VGOA 1FU5A 1CJ1A 1F1WA 2IUGA 3BUWB 2ABLA 1SPSA 1O4IA 4FL2A 1QCFA 3GQIB 3OV1A 3VRPA 1K9AA 2ETZA 3IN8A 3VS5A 1RJAA 3N8MA 2CIAA 1O41A 1O4EA 3VRQA 2DVJA 2AOBA 2PNBA 1O42A 2DX0A 4X6SA 2XP1A 4F5AA 1CWEA 2MRJA 2DM0A 2EYVA 2HDXA 3VS0A 1AYAA 3PSJA 3IMJA 4LUDA 2RORA 5CDWA 1LUMA 5HKZA 1X0NA 5EG3B 2H46E 4P9VA 5DC0B 1O4BA 2EL8A 1NRVA 1FMKA 1A07A 3VS7A 3WA4A 1KA7A 2K79B 1Y57A 2PNAA 1KC2A 1NZVA 5EHPA 3N7YA 4JE4A 1BHHA 1LKKA 3UF4A 1LUIA 1TCEA 2MQIA 2MRKA 1YVLA 1O4LA 1ZFPE 3QWXX 2IUHA 2LQWA 3NHNA 5HKWA 1X6CA 3OB2B 2MK2A 1O4MA 3C7IA 5DF6A 4F5BA 4EIHA 4LUEA 4TZIA 1AYCA 1O48A 3T04A 3MAZA 2RSYA 4U17A 3US4A 2C0OA 4FL3A 1O4FA 1D1ZA 1A09A 2CI8A 2RVFA 5EEQA 2YU7A 2HUWA 3BUNB 1M27A 2H5KA 2L3TA 1Y1UA 2VIFA 1BFIA 1UUSA 4XZ1A 1IJRA 4OHDA 2PLEA 1SHBA 4D8KA 2RMXA 3HHMB 1JYQA 1HCTB 2B3OA 1JYUA 2K7AB 4JGHA 4FBNA 1YVHA 4OHEA 1O47A 5GJIA 3UYOA 1O4NA 2BBUA 1BLJA 2DLYA 1BFJA 2CI9A 2HMHA 4QSYA 1BM2A 4GPLB 3QWYA 3PFVA 4XZ0A 1BHHB 3N84A 2IUIA 1G83A 4ROJA 3VS2A 1BF5A 1CSZA 1AYDA 4K45A 1KSWA 2C9WA 4NWGA 1AB2A 5IBSA 1P13A 3M7FA 3VS3A 1BLKA 3MXCA 2JYQA 2C0IA 2CR4A 4GWFA 2GE9A 1GRIA 3CWGA 2EOBA 1LCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O4Q A;  2LNX A;  3VRY A;  3GXW A;  4A4C A;  1O4C A;  4E93 A;  1O4D A;  3BKB A;  1FBV A;  3TKZ A;  1AYB A;  1O45 A;  3S9K A;  5D0J A;  5EHR A;  4K44 A;  2EU0 A;  1SHA A;  1O4R A;  3OP0 A;  3S8O A;  3EAC A;  4NWF A;  3VS4 A;  1F2F A;  1H9O A;  5HKY A;  2GSB A;  2Y1N A;  1D4W A;  2HCK A;  1A81 A;  2AOA A;  5I6V A;  4M4Z A;  2PLD A;  2H8H A;  3VS6 A;  5AUL A;  3VS1 A;  3BUO B;  2IZV A;  2LQN A;  3OB1 B;  2EKX A;  3TL0 A;  2SHP A;  1XA6 A;  1X27 A;  3ZNI A;  1O4A A;  1A1A A;  5GJH A;  2LCT A;  1A1C A;  4WWQ A;  4EY0 A;  4GL9 E;  1OPK A;  3PLF B;  1FHS A;  1AOU F;  3EAZ A;  4OHL A;  1CSY A;  4DGP A;  3VRN A;  1AOT F;  2SRC A;  1O44 A;  1QG1 E;  1CWD L;  1TZE E;  2EO3 A;  2DLZ A;  1AD5 A;  1O43 A;  1JWO A;  1SKJ A;  3BUM B;  1R1P A;  3IN7 A;  3MXY A;  1O4G A;  4E68 A;  3PSK A;  1LUK A;  2Y1M A;  3IMD A;  1RPY A;  1UUR A;  1FBZ A;  1WQU A;  1O4O A;  4JEG A;  1BHF A;  3S8N A;  2Y3A B;  2MC1 A;  1MW4 A;  3PS5 A;  1M61 A;  1O4H A;  1PIC A;  4K11 A;  1A1E A;  5KAZ A;  1O46 A;  5AXI A;  2ECD A;  2PTK A;  1KA6 A;  4F59 A;  1A08 A;  5EEL A;  4A4B A;  3PJP A;  1BG1 A;  2L4K A;  2KK6 A;  2KNO A;  1QAD A;  3CBL A;  1HCS B;  4OHH A;  2DCR A;  1Z3K A;  4L1B B;  1O49 A;  1O4K A;  1R1S A;  1IS0 A;  3K2M A;  1OO4 A;  4U1P A;  1O4P A;  1SHD A;  3KFJ A;  1FU6 A;  1NZL A;  3GXX A;  1RQQ C;  3CD3 A;  2FO0 A;  1BKL A;  2QMS A;  3S8L A;  1OPL A;  4H1O A;  3BUX B;  3CXL A;  1A1B A;  2CRH A;  1B47 A;  1FYR A;  1LUN A;  3VRO A;  1GHU A;  5DC9 A;  4H34 A;  3HIZ B;  4K2R A;  1JU5 A;  2EYZ A;  5DC4 A;  4OHI A;  2C0T A;  2FCI A;  1LCJ A;  1MIL A;  4DGX A;  2AUG A;  1SPR A;  1LKL A;  1O4J A;  1JYR A;  2L6K A;  3OVE A;  3PQZ A;  5J3X A;  2LNW A;  1R1Q A;  1BKM A;  2CBL A;  4P9Z A;  1BMB A;  5IBM A;  2EYY A;  2CS0 A;  1OO3 A;  3HCK A;  1I3Z A;  2EO6 A;  2OZO A;  1D4T A;  2OQ1 A;  5BO4 A;  3VRR A;  3VRZ A;  2HDV A;  2YSX A;  3VGO A;  1FU5 A;  1CJ1 A;  1F1W A;  2IUG A;  3BUW B;  2ABL A;  1SPS A;  1O4I A;  4FL2 A;  1QCF A;  3GQI B;  3OV1 A;  3VRP A;  1K9A A;  2ETZ A;  3IN8 A;  3VS5 A;  1RJA A;  3N8M A;  2CIA A;  1O41 A;  1O4E A;  3VRQ A;  2DVJ A;  2AOB A;  2PNB A;  1O42 A;  2DX0 A;  4X6S A;  2XP1 A;  4F5A A;  1CWE A;  2MRJ A;  2DM0 A;  2EYV A;  2HDX A;  3VS0 A;  1AYA A;  3PSJ A;  3IMJ A;  4LUD A;  2ROR A;  5CDW A;  1LUM A;  5HKZ A;  1X0N A;  5EG3 B;  2H46 E;  4P9V A;  5DC0 B;  1O4B A;  2EL8 A;  1NRV A;  1FMK A;  1A07 A;  3VS7 A;  3WA4 A;  1KA7 A;  2K79 B;  1Y57 A;  2PNA A;  1KC2 A;  1NZV A;  5EHP A;  3N7Y A;  4JE4 A;  1BHH A;  1LKK A;  3UF4 A;  1LUI A;  1TCE A;  2MQI A;  2MRK A;  1YVL A;  1O4L A;  1ZFP E;  3QWX X;  2IUH A;  2LQW A;  3NHN A;  5HKW A;  1X6C A;  3OB2 B;  2MK2 A;  1O4M A;  3C7I A;  5DF6 A;  4F5B A;  4EIH A;  4LUE A;  4TZI A;  1AYC A;  1O48 A;  3T04 A;  3MAZ A;  2RSY A;  4U17 A;  3US4 A;  2C0O A;  4FL3 A;  1O4F A;  1D1Z A;  1A09 A;  2CI8 A;  2RVF A;  5EEQ A;  2YU7 A;  2HUW A;  3BUN B;  1M27 A;  2H5K A;  2L3T A;  1Y1U A;  2VIF A;  1BFI A;  1UUS A;  4XZ1 A;  1IJR A;  4OHD A;  2PLE A;  1SHB A;  4D8K A;  2RMX A;  3HHM B;  1JYQ A;  1HCT B;  2B3O A;  1JYU A;  2K7A B;  4JGH A;  4FBN A;  1YVH A;  4OHE A;  1O47 A;  5GJI A;  3UYO A;  1O4N A;  2BBU A;  1BLJ A;  2DLY A;  1BFJ A;  2CI9 A;  2HMH A;  4QSY A;  1BM2 A;  4GPL B;  3QWY A;  3PFV A;  4XZ0 A;  1BHH B;  3N84 A;  2IUI A;  1G83 A;  4ROJ A;  3VS2 A;  1BF5 A;  1CSZ A;  1AYD A;  4K45 A;  1KSW A;  2C9W A;  4NWG A;  1AB2 A;  5IBS A;  1P13 A;  3M7F A;  3VS3 A;  1BLK A;  3MXC A;  2JYQ A;  2C0I A;  2CR4 A;  4GWF A;  2GE9 A;  1GRI A;  3CWG A;  2EOB A;  1LCK A; 
#chains in the Genus database with same CATH topology
 1O4Q A;  2LNX A;  3VRY A;  3GXW A;  4A4C A;  1O4C A;  4E93 A;  1O4D A;  3BKB A;  1FBV A;  3TKZ A;  1AYB A;  1O45 A;  3S9K A;  5D0J A;  5EHR A;  4K44 A;  2EU0 A;  1SHA A;  1O4R A;  3OP0 A;  3S8O A;  3EAC A;  4NWF A;  3VS4 A;  1F2F A;  1H9O A;  5HKY A;  2GSB A;  2Y1N A;  1D4W A;  2HCK A;  1A81 A;  2AOA A;  5I6V A;  4M4Z A;  2PLD A;  2H8H A;  3VS6 A;  5AUL A;  3VS1 A;  3BUO B;  2IZV A;  2LQN A;  3OB1 B;  2EKX A;  3TL0 A;  2SHP A;  1XA6 A;  1X27 A;  3ZNI A;  1O4A A;  1A1A A;  5GJH A;  2LCT A;  1A1C A;  4WWQ A;  4EY0 A;  4GL9 E;  1OPK A;  3PLF B;  1FHS A;  1AOU F;  3EAZ A;  4OHL A;  1CSY A;  4DGP A;  3VRN A;  1AOT F;  2SRC A;  1O44 A;  1QG1 E;  1CWD L;  1TZE E;  2EO3 A;  2DLZ A;  1AD5 A;  1O43 A;  1JWO A;  1SKJ A;  3BUM B;  1R1P A;  3IN7 A;  3MXY A;  1O4G A;  4E68 A;  3PSK A;  1LUK A;  2Y1M A;  3IMD A;  1RPY A;  1UUR A;  1FBZ A;  1WQU A;  1O4O A;  4JEG A;  1BHF A;  3S8N A;  2Y3A B;  2MC1 A;  1MW4 A;  3PS5 A;  1M61 A;  1O4H A;  1PIC A;  4K11 A;  1A1E A;  5KAZ A;  1O46 A;  5AXI A;  2ECD A;  2PTK A;  1KA6 A;  4F59 A;  1A08 A;  5EEL A;  4A4B A;  3PJP A;  1BG1 A;  2L4K A;  2KK6 A;  2KNO A;  1QAD A;  3CBL A;  1HCS B;  4OHH A;  2DCR A;  1Z3K A;  4L1B B;  1O49 A;  1O4K A;  1R1S A;  1IS0 A;  3K2M A;  1OO4 A;  4U1P A;  1O4P A;  1SHD A;  3KFJ A;  1FU6 A;  1NZL A;  3GXX A;  1RQQ C;  3CD3 A;  2FO0 A;  1BKL A;  2QMS A;  3S8L A;  1OPL A;  4H1O A;  3BUX B;  3K2T A;  3CXL A;  1A1B A;  2CRH A;  1B47 A;  1FYR A;  1LUN A;  3VRO A;  1GHU A;  5DC9 A;  4H34 A;  3HIZ B;  4K2R A;  1JU5 A;  2EYZ A;  5DC4 A;  4OHI A;  2C0T A;  2LRA A;  2FCI A;  1LCJ A;  1MIL A;  4DGX A;  2AUG A;  1SPR A;  1LKL A;  1O4J A;  1JYR A;  2L6K A;  3OVE A;  3PQZ A;  3LYV A;  5J3X A;  2LNW A;  1R1Q A;  1BKM A;  2CBL A;  4P9Z A;  1BMB A;  5IBM A;  2EYY A;  2CS0 A;  1OO3 A;  3HCK A;  1I3Z A;  2EO6 A;  2OZO A;  1D4T A;  2OQ1 A;  5BO4 A;  3VRR A;  3VRZ A;  2HDV A;  2YSX A;  3VGO A;  1FU5 A;  1CJ1 A;  1F1W A;  2IUG A;  3BUW B;  2ABL A;  1SPS A;  1O4I A;  4FL2 A;  1QCF A;  3GQI B;  3OV1 A;  3VRP A;  1K9A A;  2ETZ A;  3IN8 A;  3VS5 A;  1RJA A;  3N8M A;  2CIA A;  1O41 A;  1O4E A;  3VRQ A;  2DVJ A;  2AOB A;  2PNB A;  1O42 A;  2DX0 A;  4X6S A;  2XP1 A;  4F5A A;  1CWE A;  2MRJ A;  2DM0 A;  2EYV A;  2HDX A;  3VS0 A;  1AYA A;  3PSJ A;  2KGY A;  3IMJ A;  4LUD A;  2ROR A;  5CDW A;  1LUM A;  5HKZ A;  1X0N A;  5EG3 B;  2H46 E;  4P9V A;  5DC0 B;  1O4B A;  2EL8 A;  1NRV A;  1FMK A;  1A07 A;  3VS7 A;  3WA4 A;  1KA7 A;  2K79 B;  1Y57 A;  2PNA A;  1KC2 A;  1NZV A;  5EHP A;  3N7Y A;  4JE4 A;  1BHH A;  1LKK A;  3UF4 A;  1LUI A;  1TCE A;  2MQI A;  2MRK A;  1YVL A;  1O4L A;  1ZFP E;  3QWX X;  2IUH A;  2LQW A;  3NHN A;  5HKW A;  1X6C A;  3OB2 B;  2MK2 A;  1O4M A;  3C7I A;  5DF6 A;  4F5B A;  4EIH A;  4LUE A;  4TZI A;  1AYC A;  1O48 A;  3T04 A;  3MAZ A;  2RSY A;  4U17 A;  3US4 A;  2C0O A;  4FL3 A;  1O4F A;  1D1Z A;  1A09 A;  2CI8 A;  2RVF A;  5EEQ A;  2YU7 A;  2HUW A;  3BUN B;  1M27 A;  2H5K A;  2L3T A;  1Y1U A;  2VIF A;  1BFI A;  1UUS A;  4XZ1 A;  1IJR A;  4OHD A;  2PLE A;  1SHB A;  4D8K A;  2RMX A;  3HHM B;  1JYQ A;  1HCT B;  2B3O A;  1JYU A;  2K7A B;  4JGH A;  4FBN A;  1YVH A;  4OHE A;  1O47 A;  5GJI A;  3UYO A;  1O4N A;  2BBU A;  1BLJ A;  2DLY A;  1BFJ A;  2CI9 A;  2HMH A;  4QSY A;  1BM2 A;  4GPL B;  3QWY A;  3PFV A;  4XZ0 A;  1BHH B;  3N84 A;  2IUI A;  1G83 A;  4ROJ A;  3VS2 A;  1BF5 A;  1CSZ A;  1AYD A;  4K45 A;  1KSW A;  2C9W A;  4NWG A;  1AB2 A;  5IBS A;  1P13 A;  3M7F A;  3VS3 A;  1BLK A;  3MXC A;  2JYQ A;  2C0I A;  2CR4 A;  4GWF A;  2GE9 A;  1GRI A;  3CWG A;  2EOB A;  1LCK A; 
#chains in the Genus database with same CATH homology
 1O4Q A;  2LNX A;  3VRY A;  3GXW A;  4A4C A;  1O4C A;  4E93 A;  1O4D A;  3BKB A;  1FBV A;  3TKZ A;  1AYB A;  1O45 A;  3S9K A;  5D0J A;  5EHR A;  4K44 A;  2EU0 A;  1SHA A;  1O4R A;  3OP0 A;  3S8O A;  3EAC A;  4NWF A;  3VS4 A;  1F2F A;  1H9O A;  5HKY A;  2GSB A;  2Y1N A;  1D4W A;  2HCK A;  1A81 A;  2AOA A;  5I6V A;  4M4Z A;  2PLD A;  2H8H A;  3VS6 A;  5AUL A;  3VS1 A;  3BUO B;  2IZV A;  2LQN A;  3OB1 B;  2EKX A;  3TL0 A;  2SHP A;  1XA6 A;  1X27 A;  3ZNI A;  1O4A A;  1A1A A;  5GJH A;  2LCT A;  1A1C A;  4WWQ A;  4EY0 A;  4GL9 E;  1OPK A;  3PLF B;  1FHS A;  1AOU F;  3EAZ A;  4OHL A;  1CSY A;  4DGP A;  3VRN A;  1AOT F;  2SRC A;  1O44 A;  1QG1 E;  1CWD L;  1TZE E;  2EO3 A;  2DLZ A;  1AD5 A;  1O43 A;  1JWO A;  1SKJ A;  3BUM B;  1R1P A;  3IN7 A;  3MXY A;  1O4G A;  4E68 A;  3PSK A;  1LUK A;  2Y1M A;  3IMD A;  1RPY A;  1UUR A;  1FBZ A;  1WQU A;  1O4O A;  4JEG A;  1BHF A;  3S8N A;  2Y3A B;  2MC1 A;  1MW4 A;  3PS5 A;  1M61 A;  1O4H A;  1PIC A;  4K11 A;  1A1E A;  5KAZ A;  1O46 A;  5AXI A;  2ECD A;  2PTK A;  1KA6 A;  4F59 A;  1A08 A;  5EEL A;  4A4B A;  3PJP A;  1BG1 A;  2L4K A;  2KK6 A;  2KNO A;  1QAD A;  3CBL A;  1HCS B;  4OHH A;  2DCR A;  1Z3K A;  4L1B B;  1O49 A;  1O4K A;  1R1S A;  1IS0 A;  3K2M A;  1OO4 A;  4U1P A;  1O4P A;  1SHD A;  3KFJ A;  1FU6 A;  1NZL A;  3GXX A;  1RQQ C;  3CD3 A;  2FO0 A;  1BKL A;  2QMS A;  3S8L A;  1OPL A;  4H1O A;  3BUX B;  3CXL A;  1A1B A;  2CRH A;  1B47 A;  1FYR A;  1LUN A;  3VRO A;  1GHU A;  5DC9 A;  4H34 A;  3HIZ B;  4K2R A;  1JU5 A;  2EYZ A;  5DC4 A;  4OHI A;  2C0T A;  2FCI A;  1LCJ A;  1MIL A;  4DGX A;  2AUG A;  1SPR A;  1LKL A;  1O4J A;  1JYR A;  2L6K A;  3OVE A;  3PQZ A;  5J3X A;  2LNW A;  1R1Q A;  1BKM A;  2CBL A;  4P9Z A;  1BMB A;  5IBM A;  2EYY A;  2CS0 A;  1OO3 A;  3HCK A;  1I3Z A;  2EO6 A;  2OZO A;  1D4T A;  2OQ1 A;  5BO4 A;  3VRR A;  3VRZ A;  2HDV A;  2YSX A;  3VGO A;  1FU5 A;  1CJ1 A;  1F1W A;  2IUG A;  3BUW B;  2ABL A;  1SPS A;  1O4I A;  4FL2 A;  1QCF A;  3GQI B;  3OV1 A;  3VRP A;  1K9A A;  2ETZ A;  3IN8 A;  3VS5 A;  1RJA A;  3N8M A;  2CIA A;  1O41 A;  1O4E A;  3VRQ A;  2DVJ A;  2AOB A;  2PNB A;  1O42 A;  2DX0 A;  4X6S A;  2XP1 A;  4F5A A;  1CWE A;  2MRJ A;  2DM0 A;  2EYV A;  2HDX A;  3VS0 A;  1AYA A;  3PSJ A;  3IMJ A;  4LUD A;  2ROR A;  5CDW A;  1LUM A;  5HKZ A;  1X0N A;  5EG3 B;  2H46 E;  4P9V A;  5DC0 B;  1O4B A;  2EL8 A;  1NRV A;  1FMK A;  1A07 A;  3VS7 A;  3WA4 A;  1KA7 A;  2K79 B;  1Y57 A;  2PNA A;  1KC2 A;  1NZV A;  5EHP A;  3N7Y A;  4JE4 A;  1BHH A;  1LKK A;  3UF4 A;  1LUI A;  1TCE A;  2MQI A;  2MRK A;  1YVL A;  1O4L A;  1ZFP E;  3QWX X;  2IUH A;  2LQW A;  3NHN A;  5HKW A;  1X6C A;  3OB2 B;  2MK2 A;  1O4M A;  3C7I A;  5DF6 A;  4F5B A;  4EIH A;  4LUE A;  4TZI A;  1AYC A;  1O48 A;  3T04 A;  3MAZ A;  2RSY A;  4U17 A;  3US4 A;  2C0O A;  4FL3 A;  1O4F A;  1D1Z A;  1A09 A;  2CI8 A;  2RVF A;  5EEQ A;  2YU7 A;  2HUW A;  3BUN B;  1M27 A;  2H5K A;  2L3T A;  1Y1U A;  2VIF A;  1BFI A;  1UUS A;  4XZ1 A;  1IJR A;  4OHD A;  2PLE A;  1SHB A;  4D8K A;  2RMX A;  3HHM B;  1JYQ A;  1HCT B;  2B3O A;  1JYU A;  2K7A B;  4JGH A;  4FBN A;  1YVH A;  4OHE A;  1O47 A;  5GJI A;  3UYO A;  1O4N A;  2BBU A;  1BLJ A;  2DLY A;  1BFJ A;  2CI9 A;  2HMH A;  4QSY A;  1BM2 A;  4GPL B;  3QWY A;  3PFV A;  4XZ0 A;  1BHH B;  3N84 A;  2IUI A;  1G83 A;  4ROJ A;  3VS2 A;  1BF5 A;  1CSZ A;  1AYD A;  4K45 A;  1KSW A;  2C9W A;  4NWG A;  1AB2 A;  5IBS A;  1P13 A;  3M7F A;  3VS3 A;  1BLK A;  3MXC A;  2JYQ A;  2C0I A;  2CR4 A;  4GWF A;  2GE9 A;  1GRI A;  3CWG A;  2EOB A;  1LCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...