4BKSC

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-1-ethanoyl-n-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
137
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 137
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4bksC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4bksC01
1LQBC 1VCBC 1LM8V 4W9LC 4W9DC 4W9GC 4B9KC 4BKSC 3ZUNC 3ZRCC 3ZRFC 4W9HC 4W9EC 4AWJC 4W9FC 4W9JC 4W9CC 3ZTDC 4B95C 5LLIC 3ZTCC 4AJYV 4BKTC 4WQOA 4W9IC 4W9KC
chains in the Genus database with same CATH superfamily
3RWIB 1N6QL 4DP5X 2NY3C 3CIAA 1U8MA 3HAEH 3WSQL 1WPCA 1PG7L 5DRWA 4ZQTA 1KEGL 2WWNA 5IT2L 5C8JB 1A65A 4K3JH 3ECBA 3LEXA 4ODSL 3U7YH 1KIRB 1V7MH 1F00I 1IC4L 3LSOA 4FZEL 1UXSA 5HDWA 4PJDB 4JM2D 3GM8A 2J6EA 4NQED 4NZ8A 5IOPB 1R5IB 2A83A 2C1OA 4S1DD 1R0AH 3NJMA 1VLXA 4MAYB 5DZOA 5EZLB 5KBPA 1U8LB 4UM8A 4BH8B 5D6CA 1OW0C 3IPBA 4K3HA 5CO1A 2H0EA 5FYLH 1OB1B 3FU8A 5CHNA 1NGWB 5C0ND 3IMUA 1CI3M 1A1OA 3IWUA 5BZWA 3T71A 2H2PD 2Y07H 3V9FA 2GY5A 1NGQH 4XHJC 4XVTL 4DN4L 3K6NA 1F1AA 4JL2A 3O2DH 5FYJH 4PVLA 3RUGF 3FB7A 4MGXA 1JGEA 1VEPA 2CLRA 1YEHH 4BK5C 4PI2A 2AC0A 3S34L 3P73B 4DEWA 2Z92B 4AQ1A 2O5ZH 3U30C 5CR8A 4PR5B 1XZ0A 4YSOA 1MCNA 1QWHA 3CLEH 3Q3GA 4G71B 3RUGB 1ZLVK 5JQ6H 3DROA 3Q43A 2G2PA 2QGEA 1CXEA 3WIAA 3ETBF 5HHPB 5C6PB 1HTYA 1I8MB 2DWDA 3NFNA 4MDIA 5DZPA 5DU7A 1KTKE 4KRMB 4GRLC 1AXIB 1HDMB 4RFOH 3LZLA 4BUQA 2NZIA 2O26U 3BVNB 4ZMZA 3NCJH 4S1SL 1L9QA 2I32A 3MV9E 3VRJA 2DLFL 2VDPB 3BAEL 1YEJH 4PV8A 4TUJB 4P99A 2QHRH 4FQHB 2X2IA 1XX9C 2PO6A 3TJPA 2WMPB 1KGXA 1EFXB 4QTHA 5A7EA 3MLTA 4W4NA 4IOIA 3ME0B 3ZN6A 1BXUA 5DVKA 4CSSA 1CR9L 4BZ2A 4HWBA 1W6LA 4XAKD 4GT0A 4UU9A 5E70A 4G83A 1A7NL 1AZVA 1L3WA 3FCTA 4M8UA 1ZHKA 4BWTA 1I1AC 4N8VG 5I0VA 4P5TB 1WBYB 3QO1B 4Y8AA 3EJTA 5DGQA 5A3ID 1F02I 5F71A 3HAEB 4L3ED 2IFGA 4PSRA 3SO3B 1MPAL 2F08A 3CN3A 3U6XA 1E9OA 1VF5C 4MVBC 2JTYA 1JF5A 4M5ZH 5JPNB 5BV7C 3RPIA 5AZEH 6FABL 2WN3A 4ANKA 1N18A 3FB6A 4XNZB 4NNYA 2ZYSA 2WKLA 3J2PA 2YPLD 3ZYOA 3HBQA 1KJ2L 1TQBC 2FRGP 3VU2A 1CO1A 2N4IA 2HVJA 3IAPA 3NCMA 4PS7A 4YHKL 3U1PA 4QHMA 1AY1H 1O5PA 5TPWH 2WY3B 4QUOA 4NJ9H 2E9IA 4L29A 4HBQA 5DVNA 1T0OA 1A6ZB 5I8KL 3T08A 3JWDH 3VXUE 1JK9B 5A6MA 4U4IA 1X5GA 2E6QA 1QNZL 1AGBA 2VLKE 2BFGA 2YEZA 4PTUA 5TE7H 4LZKA 3UZEA 4IHBA 4C58B 2PWEA 4YXLH 2IXQB 3Q8BA 2DKSA 1L0XA 4UQDA 5DJ0B 3ARFA 5KG9B 2XI9A 2V5RA 3CCHB 4HIEA 3ZKXB 1N64L 3IU4H 2EEAA 1KPRB 2K9FB 1HNFA 4FA6A 4YH6A 5HD8D 2XWTA 4P9HH 4R2GC 1X4XA 1N7MH 4PJEF 3SYCA 1DUZA 2G5BA 5GGSB 4BZ1A 4HK0A 3HB3D 2DQMA 3MV8A 2D3VA 4L1SA 1I7UA 2HT3C 1KENH 2A9MH 4AK2A 2W81C 3QUYA 2W1NA 4J3BA 5FYKD 2Z8RA 1X4ZA 4PJEB 2PO6D 1CD1B 2ZUUA 4W9FC 3KHOA 3VRLE 2VO5A 3W57A 2DEWX 1SMDA 2FEDD 5HGDB 1KXTB 3C2SA 3F58L 3PQYA 3WNIA 4BK8A 4F7CB 4HU8A 5JW3L 2MWCA 2GW5A 2DM7A 2FX7L 3L5IA 4Y5VC 1T0MB 1UT2A 3MNZB 4ZS6D 5AVQB 4WQOA 3DBXB 5CR1A 4PRIB 1CCZA 4Q14A 1TEFA 2ED7A 4OGZA 2E7HA 1U3ZA 4ZTPL 4ZXBB 2JB5H 3WLBA 3H2QA 3VFTA 4JVWA 1VEOA 2OMUA 3KXFA 5F0JB 1ACZA 1BZ7A 2EYTB 4HF5H 3EDJA 2YUZA 3FT3B 3HE7B 4MB5A 2YAHA 4KI5C 4PJFF 1XIWC 2E46A 4G1MB 4H25B 4LARL 3MACL 1WC7B 3OHXA 4UTAH 2W65A 4YFLI 5J1AA 5HPOA 4R0LA 2ATKB 3AXLA 3L4CA 1QSZA 4OFYA 4WEBH 5AQ0A 2I9LB 3NCEB 3AXHA 4NOBA 5B39B 1CDYA 4PJFB 2P52A 4WGWB 2W0KA 1HNYA 3L1OH 3QS3A 5T3ZH 4G9FB 1IIIA 4J3SA 3RKPA 2X2JA 3F2LA 2XZAL 4LSVL 1Z0MA 2B8OT 4FQ1H 2Q1EA 4CMHC 4U31A 5TF0A 5TQ2L 4Z77B 3HG0A 2WCPA 1BVNP 2BVQB 2ZWLT 5AD0A 3BAIA 4G8EB 5D8JH 1B0RA 1FDLL 1BZ9A 2JKIS 2P42B 2FBJH 2VW6A 4XNQB 3H6JA 1FFRA 4AQ8C 4P0DA 4NNXA 3ARFD 1A3ZA 2YR3A 3GSUB 3QC6X 5FO8B 3QCUL 5L2KA 1RSFA 4I2XB 1IBDA 5GHWL 4H4NA 1IVTA 1CDHA 5IMKA 2YZ8A 5E00B 1N0LA 2J88H 5DMJB 2FUTA 5CILH 3RKDD 1RZFH 2FAUA 3LVTA 4RIRB 1M3IA 2BM3A 4A66A 3CV5A 1GGIH 4UZGA 3MV8D 1A4KB 4Q6KA 2JJUA 1ZT4B 3SPCA 2ICCA 1YEDA 4HKZA 5DR5L 1BXAA 3BVXA 3SGEH 3QUYD 2DB8A 4IRZA 4M4RB 5HGAA 1JGDB 2A6JB 1HWGB 4G80B 4JDEB 5I6KA 3U9WA 2P8PA 3PQYD 1YECH 2K8MA 1BD2A 3Q9PA 2DWEA 4I88A 1GVIA 5IBUB 4NUPA 1IGIH 4LCVA 3TBYB 4EUPG 5L6YH 1YN7B 3GRWH 3L7EA 3CQPA 1LWJA 4U05A 1CS6A 2ADJA 2H0PA 1MWAH 2CO3A 4GXFA 4OLZL 2H32H 2GJ6D 4ZUSB 1RV6X 5GSVA 3MA7B 4MVBD 1G43A 2IBBA 3KXFD 4PY7B 3RVVC 4RA3A 5BZZA 5DD1L 5IQ7H 2F7QA 3HPJA 1F1DA 4R84A 2KKQA 1MHHB 4FNUA 1R1CA 1E2VA 2Y3NA 4KJQD 1F6FB 3HNSL 2J6WA 2ZXBA 3Q1EA 5CZRA 5IIEA 4IHOA 1DQJB 1EV2E 3IFNH 5CD5C 3QRGL 4OCRH 1RZPA 3GTNA 2WZPA 2COQA 4I1RA 5JW4N 3FO1A 3PUUA 4L2LA 2VH5H 4G6KH 1OGAB 2HLAB 4GKZB 4P48A 1X5FA 4JPKH 5F88B 1T5XA 1KBGH 4OFYD 5JQHC 3QQ9D 3L7FB 1P2CB 5TQ0H 3ULUL 2BK8A 4S1QL 4NNPL 5E6IC 2A9CA 3KWXA 1IE5A 4ZBJA 4DK5A 5ACZA 4UV7L 2J5WA 1RUQH 1SXZA 3GFUA 1ZXKA 4HV8A 3CSYA 1K8DB 4CJ0A 2ZT9C 1E8WA 4Z7NF 3U0TB 2YOAA 1OTUD 4GMSL 5C0AB 2XPYA 3RGVC 2Q76B 1TYEB 35C8H 3C8KA 2Q8AL 4QXWA 1DTUA 3B7TA 4QYAA 4PJHA 1NCJA 2MCPH 2IV9A 3SGJC 1G7HA 3GEWB 3FHEA 5L2KD 3LKNB 1KV3A 3MODH 4KH2A 4Z7NB 2V2XB 4IIQC 3MXVH 4AXWB 5EEVA 1FFTB 1IEAA 2JK5B 3R7QA 4Q9QH 1HYSD 1D9KA 3A21A 3M07A 3PG2A 4POZC 4MS8D 3HI5H 4D8PB 4Q58C 3FU7B 4LKXA 2DWTA 4Y5YA 1HE8A 3FTUA 3OXSA 1M1XB 1SF3A 1ZMYA 2ZKXA 3OKOB 1EZSA 1BD2D 1DQKA 2EE9A 1UOVA 4FQQA 2NNAA 4PJCF 3DKHA 2VLRB 1YPZF 1A6WH 1D5ZB 3KJ4B 3MBEA 4LLAA 4ZUVA 5FO2A 2R8SL 4BKTC 1EZLA 1L0YA 5DA4A 3EGXA 3BKYH 4AM0Q 1B3JA 4RETB 2F7PA 1L5GA 1I85A 3T8XA 3AVEA 4PJCB 3FDWA 3CVCA 1YPZB 4PVBA 3VH8B 1QZNA 3QNXA 4I3GA 3TCLB 1LL1A 1PZCA 4X0NA 4MJHA 1HHHB 1MWAB 3T6XA 1CT8B 1K4CA 1OSPL 2H32B 2YRLA 3BOVA 4PI0A 5AW0B 3GPSA 4NN6C 3FQTA 4QGYA 1UB5B 4YWGH 2WZPD 1CF8L 4LU5H 4YLCA 4PRHA 4TV3A 4S1RL 4BEIA 5E2VH 5E7BA 3SPGA 4DVRL 3P0VH 3S88L 4WV1A 2DBLL 5DO2D 4F27A 4Q52A 4MMYB 1NDTA 2VQ4A 3A4FA 4TM9A 3GXTA 4GLRI 3D4ZA 2AXWA 1AOZA 2EC9T 3GSXB 1JPFA 2FNBA 3S3SA 1FAIH 1T4WA 4WTZG 2DI8A 4IS6A 4NO5B 1VB9A 1TKWA 2WD0A 2YD4A 5I6LA 5BMFL 4LLUA 4YQXH 1IGTB 2VZOA 4DGYH 2OMNA 1J7VR 2NMSA 1CTMA 2NXYB 2G3ZA 2JB6A 1MIML 3FRUA 5FGRA 2RALA 3B43A 3P11H 4XI5D 3SKMB 2CU9A 4JFFB 1I9RH 1NCBH 3QWOA 4FFYA 1HL5A 3BSZL 3KWWB 1MH5A 3F65A 3HKZA 4U1HA 4WDIB 4QKXB 3CFTA 4NHUA 4UOW1 4YX2H 3BZFA 3IFLH 4IJ3C 4HU2A 3B2MA 1GGBL 2FD6H 4FLOA 1XH0A 5FIEA 5CCHE 3KPSE 4JZOA 4LP5A 5I0YA 4BKSC 1M42A 2APWA 5JDSA 2XTJE 3V0HA 1XDTT 4GY4A 2XKNB 1D9KD 2XV2A 5JMOC 1B2YA 4CW1B 1NCUA 4NJAL 1IL1B 1DBML 4UDTA 3FU5A 2EC9U 2CNYA 2F54E 5DHMC 1ZV5A 1A21A 4NEHB 2A0LC 3QGVA 5CZKA 2ZAGA 2WXNA 3NSYA 1ZLVH 3VGHA 4F9LA 3VI3E 4HIXH 3BGMA 5E8PB 4U6XA 3AWFA 2RMNA 5T5NF 4P2OA 3BRGC 4QY8B 3U25A 4A7UA 2EVIA 5BVPL 2Y1YA 4ZOEA 2WAHA 4GO8A 1ZHLB 2JNZA 4NO3B 4Q0XH 3SDDB 5BS0E 3UAEA 2Z7WA 1IQWL 3FQRB 1IC7H 4QRBA 3WL9A 4JO2H 1I1FA 4RGNE 5B38G 2ITFA 3K4AA 4YXKL 1BIIA 3KR3H 3KNBA 4JB9L 5LHDA 3WS3B 4JG9A 2GQHA 1J9RA 3D30A 3L5WA 4WW2B 1ZJAA 3S8WA 3GSVB 4ZDHB 5HJBA 4PCTA 3LPGA 4I5BA 3P30L 1C5CL 5I2IA 2Z64C 2X2HA 1U8OB 3DOSA 2WNGA 2IADB 2F53A 2YQ2A 3JT0A 5CBEB 4N2OA 1KJMB 2C7FA 1KFAH 4ZOBA 5B1CA 3WYRA 4CILA 4M9OA 4M7KH 4Q9CA 3QJVB 4G3YH 3RGVD 5EOCL 1ZHNA 2FO1A 4B7LA 5F7KC 3U46A 4M4PA 5AW4B 1OAZH 1NLBH 1IKFH 1N70A 1MUJA 3PXJA 3G5YA 4NFCA 4UQAA 1HEHC 4MQ7A 3FTZA 2AV7A 2BDNL 4ZFZA 3NIDE 4FQCH 1VSCA 3SYPA 2WXLA 2OMXB 4TTDD 3HE6C 4LPUA 3WNMA 3QDJA 2R0LH 3KW7A 4HPYL 4N2FA 4AL8H 2XICA 4TUOB 4GIOA 3IVKB 2F6AA 4RWYL 1B4LA 4PB9H 2K6WA 4A39A 3WJMB 1IEHA 1MDAA 3VXMA 3MUHL 3I02B 4L0PB 4E0RB 4LVOB 5CEZL 1D5MB 1DBBH 4JJOA 1GIGH 4KV5E 4N3UA 1E6OL 1KB5L 5DZNA 5IBUG 1J86A 2Q7YA 1IE4A 1TZGL 2YK1L 1TXKA 1FPTL 3KVQA 3REWA 1LO4L 5IJBC 2IPUK 1S7XB 2A38A 1KULA 4JFWA 3SD5A 4JGHA 4MA1B 3VXRA 2C9PA 2PF6A 1IARB 3OLEA 4FQ2L 3DIFB 5EU5A 2GHZA 4M1GL 5EO9B 4JFUA 4U1NB 3H0TA 4XPGH 4CVXA 1HEZA 4DKDC 1LE5B 1A47A 3MYZA 4NQXB 1INDH 1NCDH 5J9PB 4XH2B 3MLVL 2EDYA 5F6IC 3D4YA 4P2OD 5JHLA 1VGEH 2DRUA 3KH4A 4JKWA 1RZJL 5D6DA 4F58H 4GG6E 4M3HA 2Z8SA 1BYNA 3NSDA 5SX4H 2F5BL 1NIFA 3QCVL 1DVQA 4W9GC 3RWIA 4DK6A 3I6LE 3Q01A 4ANXA 5DMKB 1TCMA 5DJYB 5C8JA 5IW1B 2OI9C 5CMAB 5ALBH 3QA3B 3SDAC 3S9DB 3IJSB 5E6ZA 3B2VL 2W9DL 1YEEL 1KIRA 3IYLW 3GO1H 4WWKB 3VD2A 4QTIH 3C8DA 2J12B 2D3JA 4PJDA 3CZSA 1GCFA 4PBDA 5GGRY 1QMUA 4N0UB 3QFJE 5CJQH 2X2YA 5IOPA 1R5IA 3V0DA 2VDNL 5CM1A 3TNNB 4MAYA 3ZX1A 2F53D 4JHWL 5EZLA 1U8LA 2WGNB 1J1XH 4BH8A 2LQRA 4RSYA 1CD9B 4PJ7F 4AMWA 1OB1A 1JXJA 2FWLB 5LNDA 1NGWA 2P49B 1N3NB 4X8XA 5F7DB 3SJVD 1XGYL 3B5TA 4XPHH 2V2WB 1G1CA 3RTLA 5AG8A 1WZ1H 3BCDA 4LSRH 1Q0XH 1SBSH 5IP4A 3VGAB 1EHKB 4D7PA 1CPUA 1P9MC 1EXHA 2Q8BL 3B7RL 3MRPB 4PJ7B 1MVYA 4O4YL 4J3OH 1TEYA 4UINH 4XMUA 4S2SB 2RH0A 3A4EA 3P73A 2Z92A 3QDJD 2EVFA 2DMCA 2FJSA 1LO5B 1XGQB 4PR5A 3DX8B 3EBGA 4JY5L 5L7XH 3RUGA 3I3DA 1ZD6A 2MMXA 4JFSA 3VXMD 3Q2VA 5HHPA 3OJVC 4L8SB 3BGAA 1I8MA 3AM8A 2GI7A 2PP7A 1G4MA 4K5NA 5B3SB 1A14L 3RX9A 1ZSDB 3F7LA 1HDMA 3DX9B 4M5YL 3WAJA 2L0DA 1BLIA 4XCEB 2MPAL 4QXGH 2GAZB 3VXRD 2G60H 1MCIA 2JJSA 3BVNA 3ABGA 3GM0A 2ZWYA 4FLRA 4ZMQA 4B96A 1ADQA 2BY0A 2M8XA 3BIAX 5F3BB 4TUJA 2AAVA 3VH8G 3DX2A 3QQ4B 4FQHA 4J3VA 3CGTA 2BSDA 3D39A 5LBVA 2WMPA 3HJ0A 1EFXA 3N85H 3AW5A 2L8AA 5E1AB 3ME0A 4N6QA 2ZONA 5LB1A 1BAWA 4JFDA 3ZK0A 5BQDA 2BRQA 4IBLT 4Z6AT 1C08B 2VLMD 4F2FA 3A6OA 2HKFH 3N43F 5EUOF 1I8KB 2NY6B 4P5TA 1WBYA 3WD5H 3GNML 4QO1B 3QO1A 3QPXL 3E3QE 5F7FA 3EO0B 4DTGH 2ZUQB 1PVHA 1F42A 3U7WH 5G4MA 1KUMA 1PY0A 3HAEA 2ZXEB 3O6MH 5I1EH 3O3AB 3GI9H 4XVJL 1JXFA 4XCFH 4MB4A 2FQFA 5GGVL 4ES8A 3N43B 1KWGA 5EUOB 4JG1L 4G7YL 1NGZB 1L0PA 4OIIH 4MAYD 3NFSH 3PXHA 5JPNA 3JT2A 1DBKL 4OM0L 1M2VB 3B2UD 5L0QC 1IC5L 4OJYA 4N2LA 2RJMA 1MJ8L 2X4NB 3GKWH 5E99L 4FNRA 5T3XH 3MLXH 3BQVA 3F7VB 4L5FL 1P7BA 1FH2A 3U2IA 4J12A 5EDSA 1C16B 1EAQA 2IDCA 4I18C 3J7HA 4IJTA 2HG5B 4X4XB 1VENA 3NFPB 1A6ZA 1JWMB 4J3OF 4MXWL 1JK9A 2ESVE 4MS6A 2ZUTA 4PREB 3F01A 1NM4A 2GB2A 3ARDC 4XMZA 1MFEL 3O2DA 5F96H 3LDBC 4HSQA 4JN1L 5TFSL 1F90L 5DJ0A 4F7MB 3B8YA 3CHOA 5LG1A 4AYMC 3QDME 1FO0H 2HZHA 5KG9A 3MLWH 4PUBH 2YKKA 3CCHA 4Q74A 2AEIT 1W8NA 1JMZA 1OP3K 1UCBH 5JXAL 5E95B 3ZKMD 3MA9H 3QI9C 4DWHA 1JVLA 3CWGA 4NI3A 3VXOB 1LQSR 2H6PB 5GGSA 4P9MH 1CDIA 3OAUL 5AZ2H 1DQDL 1OZUA 4FFVC 3T2QA 3P69A 3T1FB 1TJGL 4ZFGH 2DTML 3ZE0F 5AAMC 2VERA 4PJEA 5T5NG 3K91A 1MFDL 1WWWX 1CD1A 3D39D 4WFFE 3DI2B 4R90H 4YSRA 4ZUWB 3PAVA 5M94B 1EFXD 4DZBB 3O0LA 5HGDA 4YHLL 1KCRH 1KXTA 3NBNA 1FNHA 4F7CA 2ZWKA 4Z0XB 4JFDD 3GXMA 4FG6D 1T0MA 3DBXA 3ZE0B 5FYKU 4PRIA 5D7IE 1MJ7H 3Q06A 1GA2A 5CJ5A 4P5TD 3NN8B 1AVAA 2OQJB 5AW6B 4YLQT 3Q6FB 4HZLB 4ZXBA 4YK4C 3LB6C 4KDTA 3DHMA 3M45A 2EYTA 2ITEA 1Z66A 5F7EH 4A55A 3SE8L 2VL5B 2Q3AA 3HE7A 5EWIH 4M6ML 2XWRA 4FXGB 3VX0A 15C8H 3AQYA 4G1MA 1BBDL 4H25A 5C07E 1WC7A 1YNLL 3FFOA 4RRPM 1EXUB 3NCWA 4LDOB 3Q1SH 3T3PE 1MCOL 2ATKA 1A7BA 5J3HC 5JW4M 5F1IB 2OP4L 2I9LA 3W9DB 5B39A 3KMDA 4K7FB 4IKIA 4F15B 4PJFA 5I24A 5E5UB 2FSDA 3WKYA 4POYA 3TX4A 3O4OB 7TAAA 2QV4A 2XKSA 5J1TC 4G9FA 4LHJB 5DD3H 5I6NA 1M1SA 4G6JL 5FYLD 1UACH 2EKJA 3GMNB 1CVRA 2GT9B 1SOXA 4Z77A 2BVQA 5JMRA 4ODWB 1CD0A 3VM5A 5TE6L 4G8EA 4YHNB 2B16A 5FYJD 4RZKA 4XNQA 2R2HA 2Y06L 1JGIA 3GSUA 5FO8A 5F7LB 4I2XA 3BAJA 2NY1B 1KIUB 2WP3T 5E00A 4UQEA 4K94H 2HB0A 2Y2WA 2QTVA 5IFJB 1ZHBB 3AADB 4RIRA 1UH2A 4XWGH 4XNDA 1FO0B 3BQUC 5ABDE 1WAEA 2XTLA 1GW0A 4UAOB 1A4KA 4X8GA 1ZT4A 2EXWC 4TULH 4U3SB 4OZFG 3TV8A 1ZRUA 1DN0B 4M4RA 2EDOA 1JGDA 1OLLA 2A6JA 2PYEE 4G80A 4JDEA 1KCSH 3NCYS 5JOFB 3BZ5A 2XBDA 1Z5YD 3MV9B 3FUNA 4OBSA 2IDSA 3V4LA 3NGBB 3MTRA 2OYMA 3VX1A 2E7CA 3TBYA 1YN7A 5CLWA 1IAMA 1WEJH 3RVUD 4XNUH 3RIAK 4YPGB 1RJLB 4XAWH 3RILA 5TE4L 3IMWA 1QATA 4XX5A 4LF3B 3RGHA 4ZXBD 3HNTH 1OGSA 3MA7A 4JAMB 2ZP0T 4PY7A 3FUMA 1GGCH 4C8XA 1IRAY 3L5JA 4C56D 1U8PB 5LBSH 1F2XK 3WELA 4UAHA 3QS2A 5IJKC 3UBHA 1F4YH 5D96B 1DQJA 4IU3B 4DKEL 3LPWA 5DRNB 1C9SA 1UXLA 3OGCB 2ZNWA 1OGAA 2HLAA 4GKZA 1MF2L 2A4EA 5F9JB 4JBSA 1YJDC 4MJJA 4BWUA 5F88A 1OAKH 2R39A 1IILE 1ACYH 2MRYA 1P2CA 5DWUH 2ZWZA 1ET8A 4M5SA 3DX7B 1OPGH 1TVHB 1PG7W 3AG4B 2CIKB 3OC5A 4NYLA 4UTAA 1TFPA 4AM0B 1DJGA 1TQCB 4G7QB 5IR1B 4N2KA 3S7GA 1PSKL 4OGYL 3HVNA 2EDXA 1QFOA 1K8DA 1LGVA 2CHDA 4WHTB 3CQFA 5ADOH 3U0TA 3FU0A 1MQ8A 1YNKL 3MSPA 5C0AA 2AXHA 1DVFD 2Z8VC 5DTFB 3BEVB 3UADA 4IIZA 4KITB 2H1XA 1MREH 2ISDA 1U8CB 1V3JA 1CIUA 4HC1H 2K8QA 4R4FL 3VXUB 3D4CA 5DLLA 3VFGL 3LKNA 3ULVC 3X1NA 2VLKB 2XRAL 2C7UB 5F7YC 2NSMA 4YDZA 4AXWA 5LXVA 2J25A 4JW3A 4HIQA 4DKAA 3VFSB 1RJCA 3PAUA 3ROOA 2DWXA 5JOEA 5E8DL 1D5XB 2JK5A 4YE0A 5AYQA 1R75A 3PV6B 5HHOE 3EJZC 3UBXI 5F7MC 4D8PA 1QEXA 4UTBH 4HCIA 5FX3A 3PNRB 1EK3A 3FU7A 4QJ3B 4MJIE 2Q3XA 4IOFD 4U6YB 1M1XA 3UERA 2YPVH 1EJ8A 3UMNA 3HI6H 3OKOA 3DX1A 4LRIC 2EVGA 3CFCL 5AG9A 3WTVA 2DMHA 2X3CA 1X9RA 2VLRA 1GMEA 1D5ZA 1KSRA 1J8SA 4OR1A 3QWRA 4YDKL 2O72A 2D7TH 1CWVA 2VR7A 3EGDB 3KYKH 2QLYA 3L6FA 3B5GA 4GXUN 1FIGL 4JE0A 4PJCA 5F1OB 5IROA 5ADPH 3GRWA 5KBNC 1PU0A 1YPZA 1AHWC 1KBBA 2B5IC 1XGTB 4K73A 4Y2DB 5DUPL 3TCLA 3VH8A 2KPNA 1HHHA 3E2HB 5EB9A 1CT8A 2H32A 4YXHL 1NIAA 2NY0D 1UB5A 3AB0C 5LXGH 1WISA 3VD4A 1OGAD 2DMGA 2FWUA 4P59L 3VFNB 1XD0A 2B08A 2NUPB 4OFIA 5F7UA 1KTCA 5HYJB 1BBJA 4LOFA 5PAZA 4MMYA 2ADFH 4IEFB 2QTEA 3GSXA 1C7TA 1HCYA 4I48B 2EIDA 2Z31C 3QSKB 1N6QH 4A67A 3RTQC 3WSQH 4NO5A 1PG7H 1Y18B 2LOEA 1KEGH 1B0IA 4AQZA 5IT2H 1IGTA 1JI2A 3IJHB 4ODSH 1IC4H 2LABA 4FZEH 3APCA 3O8XB 2VR9A 3SKMA 4GO9A 4JFFA 1U36A 2WLKA 1MG3C 4NFDA 3P4NB 5C0AD 3RX5A 5F3FA 4Z95L 3KWWA 3WUWB 4LDEB 1M53A 4WDIA 4XMPL 1JD9A 4BFEA 4J7RA 3O3BB 3LN9A 5ICYB 1TTGA 3S98A 2VZ3A 4EZJA 3QEQB 3U82B 2F1AA 4LRNL 1IZJA 2XA3A 2XOTA 4NKMB 3APFA 4N2DA 2EXWD 2WB7A 2Q3ZA 4XZ4A 5EV7A 4AYEC 3PCYA 4L5FE 1PLCA 3E80A 4R7DB 3VWKB 4XVTH 4DN4H 2AI0L 4CW1A 2F9BT 1IL1A 3V6ZA 4C55A 2H45A 3JV4B 4Y4FB 3SCMC 1UC6A 4RGOL 3S34H 3VWJB 3K7UA 4PCKA 3GXPA 1K8IB 2VLRD 3RDTB 2X4QB 5E8PA 1F3JB 3QWRD 4KX7A 3ZDXE 4AMXA 2R7EB 4QY8A 3X1BA 3FZUC 4FFTA 3UMTA 2NQ3A 1W0VB 2OSLB 2AS5M 4NO3A 1BGXL 1ZHLA 3SDDA 3SY0B 3ASNB 3FQRA 2IDTA 2A4CA 4PJXE 1OHZA 1V05A 3OJDB 3JWOC 3P1VA 5D2NB 1MFNA 3BPCB 4S1SH 1A1NB 3T2NH 3CU7A 1D3CA 3WS3A 1QPKA 4K8RH 2GEEA 4ODTL 1KXVC 3BAEH 4XT1C 3CVHL 4PW9A 4WW2A 3I2CL 4E9QA 3GSVA 3QXAB 3P9WB 4ZDHA 3BC9A 1OTTD 3HC3L 2EXSA 2R9HD 2XWXA 1G6VK 1CR9H 2FHBA 4QKTA 1U8OA 3HRZC 4WUUE 4KJWD 5T1MB 1A7NH 5CBEA 3UTOA 1D6EB 1KJMA 4K23L 4ZW6A 1EHLL 3QE5A 2M26A 2NXYD 4S0HA 2R1WB 5ICXA 3TM6A 3IDGB 1MPAH 2V9UA 4ICXA 1S9KC 3K5SA 5CCGE 4IU2A 4A7QA 4NN7B 3PFQA 4MRBA 6FABH 2OMXA 4RAVB 2EUXA 2GY7B 2CHNA 4YGVB 1PDKB 2F8IA 4MNGE 2OMVA 4FQLL 1TZ8A 4HK3N 5E8EB 3IVKA 1KJ2H 1OF2B 2R69L 3WJMA 3I02A 4X50A 4E0RA 1YEFL 1D5MA 4ZRGA 5IHLB 3T1WA 3V6OA 5GS1B 1UA7A 4HETA 1A6VL 5I8KH 1PYWB 2VQTA 1S7XA 3D1MC 1C12B 5AVUB 1QNZH 2LLNA 5FUOL 3DIFA 3FT2B 5D5ME 5EO9A 1MCEA 1A8ZA 4U1NA 1LE5A 4FERA 2VZUA 1NFDE 4NQXA 3HRPA 4IGBD 1OQOA 5J9PA 4XH2A 3CUPB 5DF0A 1JZ7A 1BZQK 1OP3H 4PJ9C 4IRJA 1N64H 4J4PC 3GMLB 2G5UA 3QPQC 4HUXA 3DI3B 4LL9A 3TWCL 3SDDD 2AERT 4KZ0A 5D1ZD 4BINA 2VM3A 3EF7A 1LO2L 1LK2B 5DMKA 3K1KC 4JPVL 5DJYA 3PDGA 5IW1A 2X1OA 5CMAA 3QA3A 5FAAA 3IJSA 2FWSA 3ZTJH 1JRHI 4WWKA 2J4WL 2CRMA 2J2ZB 1P4IL 4RH4A 5E08L 4A68A 4N0UA 2R0WL 3BYTA 3F58H 3OBAA 5JW3H 1ZGLP 1JIBA 4L4VE 3TNNA 2FX7H 4FOMA 5JIPA 3VB8A 4UWQB 5DEZA 3VQ1C 4LL4A 3AJ7A 4B9ZA 4DZ8A 4FL4C 3AITA 4KKAD 2BOCB 2CKNA 5H37H 3I84A 1DQML 3L3OC 4Z23A 1UWXK 1MELA 4LKCB 1JGLL 3G9VA 3LTVA 4ZTPH 2WWOA 3SGDI 4AKOA 1N3NA 3PY9A 5F7DA 2YC1B 5HGBB 4DPRA 4A2FA 3ALPA 5E6SB 4ZMOA 4H8WL 3S3PA 4KZDL 4OFKA 1P5VB 1UM4L 4CVZB 3DBSA 3MRFB 9CGTA 3EJYD 1MCFA 5DRZB 4LARH 4PJ7A 3MACH 1QFWL 3MRPA 4KJYB 4LLYB 2VL4A 2C9XA 3FT4B 4S2SA 5JPMB 2P8LB 2WBXA 2EO1A 5CCJA 2I7SA 3Q5TA 5IVXE 3B2PA 4PLKD 1LO5A 3CD4A 1XGQA 3DX8A 3ILQD 3R0NA 1R5WB 1AR2A 2V7HB 3SCMD 5D1XE 2NY4C 3RBSA 4R97B 4F8PA 2XA8H 3KPSB 5E2WL 2XZAH 4L8SA 2PABA 4LSVH 3S96B 1CXFA 3AQZA 4V2CB 2VDKL 1ZSDA 4PV1C 4TPRL 3DX9A 5TQ2H 4BQCA 4XCEA 2WUBL 4H0HB 2XTJB 1BOYA 1KJ2B 4DQOL 4ESKA 4JZJB 2GAZA 1B9ZA 4P5RA 3NESA 4Z3EA 1D5IH 3I3EA 4OI7A 3FZUD 1FDLH 3AMKA 3FFCE 4OI9A 5F3BA 1T4KB 2VT0A 4XE5B 3QIBC 3T2PA 1RY7B 3QQ4A 2FR4B 2F54B 3KCPB 1S3KL 3QCUH 3CQQA 5GHWH 1BLNB 4IRJD 3C09C 4D9QD 5E1AA 1OD7A 1BJ8A 1R33A 3V0FA 4AGLA 2WQUA 2CO1A 3OXRB 1C7SA 5A7BA 4H0IA 5C09D 1C08A 4PGJA 1N0XL 3GZOA 4D9RD 3B9DA 1I8KA 4W1TA 5HY9B 2IBGA 4QO1A 5DR5H 4H2CA 4WWKD 3EFFB 2VR6A 3EO0A 4L2YA 5BS0B 3FB5B 1F4XL 3OR7B 1E8YA 4U6TA 4RGNB 3O3AA 2Q5BA 1SLUA 3UTPD 4KMQA 2WUCL 3ALXA 5EUOA 3QG7L 3O11B 5K69A 1NGZA 5I71B 3VXNB 5CJOL 2N7BA 4JANB 1M2VA 2E4TA 3QUKB 3T6QC 4HISA 4OLZH 1LHZA 2X4NA 4ZFQA 4LLMA 3RE0A 4QOKE 3JVFC 5AW8B 1P53A 4QHNB 5DD1H 3F7VA 1S7RB 1OT4A 2WSPA 4NZUL 2EXYC 1VA9A 1TENA 1C16A 2J1XA 2N7AA 3HNSH 2HG5A 3NIDF 3QRGH 2YEVB 4X4XA 3LEYL 3LNIA 4KK9D 3NFPA 1JWMA 5TH2B 3ZT6A 4R7VA 1OCWL 5ELIA 1JG9A 2UX6A 4NM8L 3HC4H 4PM1A 2AGJL 4PREA 2NNRA 4KXDA 3U9UB 3FF8A 4S1QH 1DFXA 4NNPH 3NIDB 2ZP9A 3KS0J 4LLDB 4F7MA 4ZS7L 4K55A 2RCSL 4UV7H 5DT1L 4RGMC 4Z7UE 1OM3L 3PL6B 3NZUA 2C9VA 1JRHL 4JGNA 4MHHI 4JKPL 5HI4C 4PGZA 3VXOA 2H6PA 4GMSH 1AIFB 1ZVYA 1BQRA 1FSKB 4JFXB 1U2HA 3TN0B 3HG2A 7PAZA 3GMRB 3T1FA 3X13B 5C0BB 4UT6L 5FYKL 1CLZL 1G9EA 4GG6F 4HJ0D 4ZUWA 4PLJD 4DZBA 4E5XG 3EOYG 5IHHA 4GQPH 4DF9A 4N90D 1JF1B 1REIA 4Z0XA 1NMBL 3U83A 1PNDA 4ODXB 5D7EA 3NPSC 1HILB 4GG6B 3G08B 1ECYA 2X44D 2NY6D 5DURB 3NN8A 2GC4C 1BPLB 2OQJA 1F3DJ 3Q6FA 3SE4A 4HZLA 2DYPD 2H26B 3MX0B 1TQTA 1OTSD 3H6AA 4QNPE 2VL5A 1U21A 4FXGA 1LMKA 3UPCA 3BDYL 3RIAF 3KGTA 4ANUA 4NRYB 1EXUA 2R8SH 2CBOA 2P5PA 3EJSA 5K9KB 3Q5OA 3MBXL 3QFJB 1AHMA 3GIVB 3GBDA 5F1IA 4JO1L 4O5LL 4XC1L 1G94A 3OKDB 3W9DA 3X11B 4LIQE 4K7FA 4I3RL 2DQFB 5EO0B 3E0GA 3NJXA 4L1BA 3UZVB 2FUQA 4IDJL 4KPHL 4WFEE 4FLQA 1OSPH 3T0EC 5FUCE 4HALA 3ZZQA 3GMNA 2GT9A 1FYTE 4Q56A 1CF8H 3OPUA 4S1RH 1TTCA 3U1SL 4ODWA 4DVRH 3S88H 1XGPB 3QXDB 2DBLH 4N1CA 3ULUF 3IBOA 4YHNA 4P4KB 2CSPA 5IHZB 4I87A 5JXEC 4Y4HC 1TNMA 4J3OD 5FDWB 4KXZI 2FECI 2HUEA 5BMFH 3NRPA 3PHAA 1KIUA 4O02L 5IEHB 5IFJA 1MIMH 1ZHBA 5FYJU 2OW6A 3MNMA 3FOMB 4RFNC 3N1PC 5SWSB 3RNKB 4GKSB 3BSZH 5JHDE 4OLYL 4U3SA 4JPWL 3SDYL 3PREA 2G30A 3NH7L 1DN0A 2DLTA 1GGBH 4WI2A 1JTTA 5GS3A 1O5DT 3GINA 5JOFA 2QSVA 3MV9A 3ZRFC 5K9OB 4IMKA 1RP9A 4ONHB 5F0PB 3RWHB 1X5ZA 2RACA 3CSBA 3P54A 4FZ8L 1LE9B 1PLGL 1RJLA 4YPGA 3ZTCC 2EO9A 5D1QC 5J12C 4LF3A 4NJAH 4NO0D 1DBMH 4JAMA 3L3KB 3KLAB 1U8PA 4M6OL 1E65A 3D3VB 1AGEB 1FQ9C 4YFLF 3UJJL 3W0WE 3WS6C 5BV7L 1J05B 4ZT1A 4GXUM 2VJ8A 4DO6A 2NT1A 5HHME 5F97E 2JCCE 2CHZA 4IU3A 5BOZG 4HJTA 5DRNA 3OGCA 3LRLA 3II2A 5F9JA 1UEYA 2V33A 3MLPA 3L8QA 3PXLA 3UBFA 2CHXA 3PIQB 1Q0YL 3DX7A 5BVPH 5J11C 3T4AB 5IEKB 4JMNA 1TVHA 3CFDB 1IQWH 3SGKA 2CIKA 4AGMA 4AM0A 5TK4A 5D93B 4YXKH 5IR1A 5F9WB 5JIQA 3B9EA 2NXZC 4TUKL 4B97A 4JB9H 3QAZB 1OCZB 1TFHA 4X9GA 5T3XD 5HXMA 1XVSA 2XQBL 5D9SB 4WHTA 2VE6B 4ZUTB 3VMNA 4ORGB 4NBYB 3K71B 4LLVB 3P30H 4O9HL 1C5CH 1O7DC 5DTFA 3BEVA 4Z8FL 5MI0C 2ZX7A 1AD0B 3B56A 2N56A 2LFGA 2VDOL 4FNQA 4Y9BA 3C5SB 1BXVA 1U8CA 3B5HA 4H0LC 3VXUA 1BVLB 1UM5L 4NZJA 4BGDA 2MTPA 2ESVB 1QPXA 2NY1D 4E9RA 5B8CB 2VLKA 3MV7D 25C8L 2C7UA 2EDJA 2G2NA 2IVFC 1NOFA 3QNZB 1LQBC 3EOTL 5EOCH 4AIEA 4C59B 3VFSA 2DIJA 4F33B 5MHSE 1D5XA 5HVHB 3QDMB 3PV6A 1V7NL 2FB4L 1XEUA 3OSVA 1OY3B 4NCDA 3MOAL 3OPZL 4WCYL 1AJ7L 3WFDL 1LWRA 2WXGA 2BDNH 3UCRA 3AUVA 2B1OA 3VXTB 5A2AA 3TEXA 4LSTL 1OIOA 4U6YA 4A38A 2NY7L 4UZUA 4CC4A 5EA0L 2E9GA 4HPYH 1EAPB 4GS7B 2Y6SD 3HLKA 4X5LA 1DDTA 4HFUL 3ES6B 1AGFB 4RWYH 3A6BL 3QUXB 4LP4A 5D7IF 3IGAB 5C6WH 1TOXA 3U0PB 2OKMA 1EZUA 3V4PL 5BUGA 5JLZB 3CPLB 1GHFL 2X10A 1LP9E 3SKUD 2WZ6A 1DQLL 3DJTA 1E6OH 3EGDA 3MRRA 4LPVA 1TZGH 2EDHA 2YK1H 1OP9A 1FPTH 3B6SB 3E6HB 1LO4H 2VDML 3HR5B 4NLHA 4YSCA 3CZFB 4JREB 3MV01 1XB8A 4XPFL 5D7IB 1I3UA 2B59B 4FQ2H 1XGTA 5ES4B 3LIZL 4M1GH 2H3KA 1CLCA 3R0MA 2V5TA 3IE4A 4GLRH 4AV5A 1YDPB 3T3PF 3MLVH 1A9VA 4K71C 3VFNA 4NPJA 2NUPA 5HYJA 1RZJH 2BZCA 1MCDA 2ZKHL 3FTVA 2FECL 1ACXA 4IEFA 1L4IA 1FG2B 2F5BH 1OZTG 1P7QB 4I48A 5C07B 3QCVH 1IC0A 4XAKE 3GLDA 1QRKA 1SLVA 1J88A 1Q90A 3MRBB 3T3PB 1GR7A 1Y18A 3F04A 3B2VH 2W9DH 1CGTA 1FG9C 2LGNA 3W37A 3C5ZD 4KNUA 2ATPB 3MCG1 1PZ3A 1SXAA 2ZNXA 3GHPA 3O8XA 3H7LA 2CJ3A 4UMSA 3M8OL 1OCOB 2PPEA 4L3EE 2AK4D 1I8LA 3WUWA 5EDXA 3ARTA 2AF2A 2VDNH 3FQ1A 3VD1A 1YVLA 4LSPL 8CGTA 5ICYA 1IBGL 1TTRA 3KAAA 4JHWH 4OBRA 1CFVL 1DJSA 1T1YB 1UWXH 3QEQA 4QYOB 1HCFX 3LXAA 1J0YA 2VLKD 4H1LG 5DVOA 2PR4L 1RZIB 3JUZA 2F68X 1J8HD 4NKMA 4XMLL 3JWNH 4N0CD 2MCMA 4GEJA 1PAZA 3ZIMA 1XGYH 2DPKA 2YPLE 1HH6B 4NC1E 4HC1A 3ZYIA 5E2UH 2FCBA 4Q89A 3VD3A 5BUAA 2HMIC 3QYCA 2OCJA 4R7DA 5FUZL 3S36L 3VWKA 5J56B 4JM4L 3BPLB 1TITA 1W8EA 1G7QB 1WV7T 3IRPX 1YUKB 2YO3A 2Q8BH 4O4YH 3JV4A 4Y4FA 4YBLC 3EH2A 4YEFA 3U4BH 3LXBA 2JWYA 1OARL 2HUHA 1EGJL 4YIQB 3VWJA 3KYMB 4PJ8B 2R23B 3DJZA 4FA7B 4UTBA 4JY5H 1K8IA 3RDTA 2XT1B 4JHBA 1OV8A 2PYEB 5FCUL 3RZCC 2Y2YA 5HVFB 3GB7B 1F3JA 1M7XA 5EIIB 5T8IA 1WWCA 2R7EA 3C8HA 3NSXA 4EE2A 2YPVA 4NUJB 1UZ6E 1SJMA 1A14H 2OSLA 3HMWL 4M5YH 4NIKB 4E42A 4F8NA 5D6DC 3SY0A 3KVPA 2MPAH 4Y19E 3UPAA 3TA3B 2QVMA 2WVUA 5DS1A 1XCXA 1EEYB 3OJDA 4TSAL 5D2NA 3HMXL 3BPCA 5FGBC 1A1NA 2AQRA 4HLZH 3CFJB 2GSMB 1KZYA 1U33A 5E2JA 1FNLA 3NZSA 5EBGA 5FYKE 5ISZE 3HZYB 3QXAA 5K59E 5HYJD 1U3HC 2AEPH 2DJ4A 3GIZL 4BFNA 4J28A 3H4HA 3EDEA 4KXCA 2ZICA 1NINA 3QJRB 5T1MA 2ICWJ 1D6EA 2HX8A 4W9IC 2JF1A 5AKSA 3HFML 4WGVB 3GNMH 3GSOB 3QPXH 1UD3A 3TXAA 2O5XL 4PW3A 4Y7MA 5CJXC 2LT9A 3O8XD 2EACA 1UXMA 3D0AA 2J72A 3IDGA 3ZE1E 4XVJH 5A2KH 1JPSL 2J56A 1QFUL 2PXYB 4MMXB 3GHEL 5GGVH 2CK0L 5JNYB 4JG1H 4G7YH 1OPOA 3F6LA 4OM0H 3QEQD 4U2ZA 2EYSB 3OJMB 1IC5H 4NC2B 4RAVA 1EQWA 4ODUB 1PDKA 4YGVA 1MJ8H 3BD3A 2VDNB 3MCKB 3PHSA 4ICWA 1OF2A 3BPOB 4L5FH 1A1MB 2YAOA 1NC2B 3VWKD 2EZ0C 4W4OA 4ELME 5EBMB 3UJTL 4BD4A 4G6ML 5I5RA 5GS1A 3T04D 2EABA 3EG9B 2VXSL 3QR2A 4Y4FD 1PYWA 3D0LB 4MXWH 3BE1L 4MA8L 3ZDWA 1C12A 4JO4H 5HHOB 3FT2A 1U42A 3VWJD 5GZNC 1MFEH 3S8GB 3M7OA 3ROLB 1RVFL 3I9IA 4K5LA 4JN1H 1SY6L 5TFSH 2WBKA 1SGKA 2JJTA 2WIMA 4KAQL 3RDTD 4MA7L 4MJIB 1OSYA 3CUPA 2YD8A 3FRPB 4B6ZA 2K4WA 3TBCA 3QZWG 3V0WH 3GMLA 1AD9B 1P7HL 1QBML 2VM9A 2FT7A 3NP4A 5JXAH 2Y24A 3M1CA 4HK3J 3BD5A 2NW3B 3FUIA 4QRRB 4ZQKB 3VRIA 3O9WC 1JVKA 4OCSL 2AJUL 1LK2A 5FGSA 4CKVX 2TAAA 3FQ4A 4GEIA 4JO8A 1UCTA 3E1ZA 3OAUH 4GKNB 1DQDH 1BIHA 1FCCA 2CR6A 1TJGH 3HG1E 3DX6B 3BUPA 2DTMH 2BOLA 2J2ZA 1MFDH 1B3IA 5ESVB 1WP6A 3ZKQD 4W6YB 5EEUA 4YHLH 2QEJA 3ZHDA 1T20B 3PQYE 2WZ5A 4GI8A 3HZ3A 4AEHL 2X6BA 1KGUA 3CHXA 5G4NA 1XH3B 4UQIM 2Y7MA 1D7CA 2WTPA 3D25A 4N8PA 5BVJB 2Y25A 4WKXA 2BOCA 1IBFA 1ECZA 3FQXB 3U9PL 2APTA 3WENA 2QR0B 4LKCA 4PG9B 4KUCF 4F92B 2GJ6E 3ET9F 2X3BA 2FIRT 3S5LB 4XNZC 5HGBA 2YC1A 1RU9L 4KNSA 4F7EA 3JQOB 2HJLB 4NFBA 2B77A 3SE8H 5DQ9B 1NSNL 1P5VA 5EC1B 5HDBE 4CVZA 4M6MH 3MRFA 4JUSA 5C0DB 1BBDH 3GQFA 5DRZA 4KJYA 2VMEA 1YNLH 3FL7A 4LLYA 1R4XA 3FT4A 3WE6B 5JPMA 2P8LA 1I75A 1MCOH 2N1KA 2ITDB 2OP4H 3WXVL 3ILDA 1SM3L 2HYMA 4M03A 1SVBA 1NGXB 1R5WA 2DH2A 1U3YA 2V7HA 4LCCA 2PNDA 1EX0A 1BVZA 5SX5K 2Z35B 4JCWA 2NPLX 2IOOA 4QGTA 3KPSA 4GUOA 1NLDL 5AAPA 3S96A 4G6JH 3BXNB 1C8PA 1MCJA 3QJHB 4AOFA 1CLOL 2B1HL 2LFEA 3K2IA 3EHBB 1KJ2A 4JZJA 4X6DE 3RZCD 2JI2A 1IGFL 1KEML 3TONA 4CDGC 4Q9RL 2ZUSA 3ELQA 5TE6H 3OLIA 3HBGA 4FCHA 4HDIB 4MJ6B 4Z7QF 1AHKA 1T4KA 2FJHB 2ZXQA 3TH2T 2Y06H 2YAEA 3ZLQC 1A2YB 1EDYA 2NNCA 3F7QA 2FR4A 3ZDXF 2F54A 3KCPA 5L2KE 5A2LH 1BLNA 3DX4A 3QK0A 1CFBA 2COVD 1HZKA 3FJTA 1H9DA 3NACL 3V95A 2XBTA 1OXYA 1B4RA 3BGFC 3KZ8A 3VXSA 2ZOWA 3OXRA 4I0PB 4HMDA 5AOKA 4Y2NA 4WK0B 5KSBE 1NEUA 4OM1L 4PJXF 5AVRB 3WIIL 3ZHLA 1FFOB 4RMUA 3ZDXB 1L6PA 4P46C 3MGOB 5HY9A 5KOMC 1KB9J 3UJIL 3EFFA 5BS0A 2J8HA 3CH8A 4H44C 3FB5A 1P6WA 2P47B 5B22A 4PJIE 3OR7A 2QQKL 4X6BB 1I7RB 4HEPA 4PJXB 2BHZA 1UXWB 4XWOC 1AMYA 3W11C 2AK1L 5ECJE 4KO6A 4BRJA 1BD2E 3O11A 3VXNA 2QVFB 4PGDB 4LVNC 2EIZB 5F7WC 2PCXA 4JANA 1N9PA 4ZMYA 3VGGA 5TE4H 3AS1A 1RFDH 3V0VB 1E9QB 1EHNA 4IMLB 3SB3A 4KI5E 4DW2L 1DE4B 1U8HA 4WUUB 4QHNA 1S7RA 1T83C 2VAJA 2WLMA 2ROYA 4HD5A 5H37A 3UACA 5K1NA 4DKEH 1KCWA 4FMFA 2FLRT 3NSFA 4U1GB 5TH2A 3FW6A 2AJVL 1XB6A 3ISRA 1MF2H 4E9WA 2XXCB 1JERA 2CGYA 2X87A 2D31A 1QKZL 1NCHA 4X5XB 1FE8L 3LEVL 4Y5XB 3N1FC 2I26N 4NHCL 5CIPH 5HYSG 3HHRB 1G6RL 1EEZB 4LLDA 3A0OA 2AQTA 4EZMA 1PEZA 1UADC 1KDJA 3INUL 1SEQL 2AZAA 2W9LA 5CXPA 4JQXA 3H8NA 1PSKH 4MNGB 1D7FA 3MBWB 3OV6A 3HN8A 3PL6A 4OGYH 4P23B 3V52L 3ZU8A 2XTJD 2YZ1A 3BIBX 3VGDA 1YNKH 1AIFA 2UY6B 4LEOB 3D2UB 5D5MF 2XZQL 1TZHB 3M1OA 4JFXA 3TN0A 3GMRA 1NFDF 1H15B 3X13A 5C0BA 1J18A 2FJGB 3L1FA 3IGLA 1ZT7B 4R4FH 2VKWA 3VFGH 4L3CB 4G59C 2A4ZA 2XRAH 3ULAB 5D5MB 1E8XA 5C86A 1ZEAL 3OG6B 4U7KA 1JF1A 2R56L 5E8DH 3VXSD 4LCIL 1NFDB 1T0NB 4OCYL 1BZ8A 5L9DL 4ODXA 2CK2A 4NZTL 4AG4L 4GG6A 3G08A 3EYVB 1F97A 2ADIB 5AVZB 3BMWA 5DC0A 1RP8A 5BS0D 1XF2B 4AGQA 5HHNB 1HOEA 2H26A 3MRMB 3MX0A 4UOZA 2Z3FA 1L9PA 2EKSB 1GKEA 2VXVL 3BISA 2X38A 4JO3L 3GLZA 5C3TA 3ATFA 4NRYA 3M1BB 4FQIL 4QHLB 5K9KA 4YDKH 2YOCA 4UBDD 2WTRB 3QFJA 2E9BA 3GIVA 5IF0B 2DH3A 3OKDA 3X11A 4L4VB 1RH8A 1QWNA 2DQFA 1FIGH 5EO0A 2BSCA 4CNIB 3D48R 2PWGA 5H35B 2CKBL 4JCMA 3BUDA 1SJVA 1OAXL 4OD1H 3UZVA 4YL4A 5DUPH 3UBGA 3DVGB 2UYLB 1ULVA 3D87B 4OSUH 1KLUB 2R0ZL 4JFYB 5IJDC 3PV7A 4X42A 4YXHH 5C0EB 1TTFA 3GBML 1FZMB 1HSAB 1JNHB 1AS7A 1NMCB 2E7LA 1F45A 2QJDA 5JW4Q 4GW1B 1F4WL 3L3GB 4P59H 1J10A 4BJLA 1XGPA 3IKKA 1VAHA 3QXDA 4Y4KC 5IVXF 2VJ0A 5AVYB 1E7UA 5BJTB 2ICWI 2BSRB 2X4RB 4P4KA 2BMKA 4OD3L 5IHZA 1KPUB 3L2NA 4EBQL 1S9YB 4GNKB 1YMME 5HDLA 4X7TA 5C2BL 1BFSA 5IVXB 5T1LB 4MYPA 2DMBA 1W80A 3PL6D 5IEHA 2DF3A 3BJLA 5GGSY 5CIPB 1KNOB 2BCMA 4MAUL 5MP6L 3LZNA 2QHLA 4CSZA 5D1XB 1NM9A 5IW3A 1MLCB 3FOMA 4MNQE 1J9SA 5SWSA 1T04B 4FCAA 4GKSA 4Z95H 1J5DA 3RNKA 4AC4A 5L2JB 5JIKA 4XMPH 3TN0D 4DO5A 5DC9B 5C0BD 1DO5A 2ZYIA 1BFOB 3S0PA 1CXHA 2J8UE 4JG0L 3HC2A 1UWEL 3WNPA 1OVZA 4LRNH 2HFGL 3AAZB 4L0YA 3MRLB 3GBNL 2VLLB 1X5HA 5K9OA 3FFCB 4ONHA 4GSUA 5DQDL 3NK4A 1WFIA 3NTCL 1G1KA 3EJPA 1LE9A 5JYMA 2I5YL 4HLZG 4HAGA 4N3TA 2AI0H 5DFWH 3KJ4C 3OZKA 4Q9BA 2OPCA 4KROC 4AENB 1OAQL 3L3KA 3V5HB 3I6LD 1SXNA 3CC1A 3KLAA 2YAFA 3D3VA 4RGOH 1AGEA 2Q7AA 1J05A 2NYYC 4GRWF 1JMXA 1ZTXL 5IROC 1T2QH 3JV0A 4UT9L 4LOVA 4G6AD 4AKPA 1A9EA 1EWHA 4JO5A 1H5BC 2AKRB 3DIVA 3A6CL 2VXTL 2XNAB 3QFJD 3C60C 4XRCB 3PIQA 4LIQH 3T4AA 1BGXH 1G7MB 1J1PL 5IEKA 3CFDA 5I30L 4QRTB 3IDXL 4R5XA 1OCRB 2BHFA 5DCCA 4EN3B 4UOJA 4AKQA 3FONB 4GAGL 2HXAA 3CVHH 4QOKB 3I2CH 5D9SA 2VE6A 3QHTC 4NP4L 4ZUTA 4ORGA 5C92A 4LLVA 3K71A 2LTQC 3B1UA 2QL1A 3HC3H 1QACA 5JORB 4J5VA 3WE1A 2HT2D 4BDVA 4P4KD 4H20L 1AD0A 3IJ9A 2O6EA 2WK2A 3C5SA 2F53E 3MGTB 3FYIB 1BVLA 4K23H 1WH0A 4RDQG 2P1YA 1B90A 2ESVA 3CXHJ 3NQIA 4XP5L 4JQVC 4BA8A 5B8CA 2QKIC 3QNZA 4AYBA 3ULUD 1EHLH 3MGAA 4LDCA 4U0RB 1NPUA 3ATAA 1A0QL 3WNNA 1NCGA 4F33A 2VRQA 4J8RA 3SJVE 2WANA 3QDMA 3GMQB 3UAFA 2BH0A 5SWSD 1MCPL 2ZKWA 4A7GF 1YQ2A 2BZDA 4Z7UB 3NP3A 3WXWL 4HIIB 4NXSA 2P80D 5F1NB 3VXTA 1AZNA 2D2OA 2WWMC 1JBJA 3WFHB 4WENB 2O6CA 4JRXD 3U79A 4EI6B 3BSZA 3RPBA 1EAPA 3FO2B 2MOVA 1X44A 4EQ3A 3II3A 3NRFA 4BQ6A 2EIEA 4HUMB 3HR6A 1A4JB 3ES6A 1AGFA 1YEKL 3QUXA 1CFNA 2R69H 5IB5B 1K2DB 2A9AA 3IGAA 4N28A 3U0PA 1YEFH 3S3CB 3MNDA 5JLZA 4H8VA 3CPLA 4XXWA 2BIIA 2WNWA 4CRPA 2VRKA 4BGLA 5IZ7A 1A6VH 4HS8L 3E6HA 4L0ZA 5EZOL 5DHXB 2M2DA 1V5JA 4GAJL 3CZFA 3D3VD 4QNPF 5FECB 5D7IA 1FNGB 2B59A 1EEQA 2D03L 3H2PA 4G42B 5FUOH 1PGRB 3NCFB 1MRDL 1X5XA 4HKBB 4JRWA 4QRFA 3OD3A 1N6VA 5AALA 2E7BA 3MROB 4EPSA 1JI1A 2A2QT 4OLXL 3E9TA 3MUZ1 4XVOA 1YDPA 2FVNA 3S2CA 3TVMB 1F41A 2D7NA 2VR5A 4WW2C 2C3VB 4JVPA 4YSQA 2WWKT 2FQGA 2WQWA 4I9XA 1FG2A 2G3XA 3TWCH 3TBWB 1P7QA 5C07A 3EH4B 3AROA 3S6CA 1KCBA 4K7PY 1LO2H 3MRBA 2IGTA 1E4JA 4JPVH 4AVKA 1T66C 3AREC 1Q9OB 4E2OA 2ZXDA 5D1ZI 2J4WH 5G2NA 2ATPA 4R3SB 1PD0A 2WXKA 4PJDE 2Q20A 5E08H 1WLHA 2R0WH 3LMJL 4D94A 2CXKA 4Z7IA 1QVOB 1UOLA 1HU8A 3ZE2E 1RUML 4APQD 3CVHB 1FYTB 2EVHA 4YDMA 2IAND 2R29L 1T1YA 4QYOA 2ESVD 3OX8B 3RURA 5I18L 1RZIA 4UUJB 3WY3A 1JGLH 1BCIA 1MRCL 5AOIA 1SN5A 2YGOA 2EIJB 1AC6A 4F7TB 1HH6A 3QDMD 3FTSA 4H8WH 5I6PA 3WN5B 4CVUA 3HPLB 4KZDH 1UM4H 2C3XA 1JHTB 5G5DB 4IRSB 1G7QA 2H5UA 5T5FL 2D4DA 4WWNA 3UBXB 3QZLA 1JTOA 3DPBA 4UB0L 5JUEL 1TZOA 2V4LA 4YIQA 4NQUA 5E8OB 1R3LB 3KYMA 4PJ8A 5JHDB 2AJZB 2R23A 3MOQA 4HIPA 3TNMB 5SX5H 4Y9CA 3QUXD 1Z9NA 1PCSA 3MKGA 1WRFA 3OL2A 5BQ7B 2PYEA 2BVUA 2DOCA 2MHAB 1JNLL 3GB7A 4TL4A 5E2WH 5EIIA 1WA1X 3OM3B 2LU5A 4NUJA 4B9GA 5FDYA 3CHRA 4ZTEA 1RL1A 5GS0C 5ANME 2VO8A 2VDKH 2WUBH 4DQOH 2WBJB 3CAFA 1WFNA 3TA3A 3PWLB 3BEWB 5DWPA 2DQEL 4DKTA 1U8QB 3IKCB 2XHNA 1YJDL 3O3EB 2JCCF 3CSTA 5BRPA 1AH1A 1KB5A 1NAML 3CFJA 3T65A 2XZCL 4LGRB 1R34A 1T80A 2B15A 2H2SC 3GLAA 1S3KH 3HZYA 3D39E 3V0JA 3W0WB 1NUDA 3Q2LA 1JFQL 1UA3A 4F8TA 2V9TA 3M17B 5HHMB 5AB1A 2JCCB 3H42L 4Z7WF 4HJ1A 5TF1L 4JFDE 2ZUXA 3UTSE 3LS4L 1G84A 2WO3B 4ELDA 5FB8B 1AR1C 1N0XH 2XC8A 4HQQL 3BIKB 2W9EL 2ADGB 4A7TA 3GSOA 1NCAL 1MFUA 4A63A 4D0CA 1J8RA 3N40P 4Z7WB 4JM2F 4QHPA 5JIHA 3VD5A 1SDYA 1IAKB 5BZDB 1PX8A 3LKQB 3N04A 5DZVA 3ULVL 2PXYA 3SODB 4MMXA 3ZMNA 5JNYA 4LL1A 3QG7H 2FIKB 1EIBA 4FFWD 5KSUB 2HVBA 4RAHA 2BERA 4XMXA 3DO7B 5CJOH 1Q1JL 4JM2B 3VGAC 4XBGA 3QR0A 2EYSA 1DVZA 3FTWA 4ODUA 2LU7A 2WO4A 3MCKA 1U9KA 1BEYL 3C12A 4H26B 4N2BA 1N12A 4N2IA 4XVUC 2YJQA 3PRZA 4NZUH 3UDWC 2UWEE 1A1MA 2AXFB 2WWMD 4HOWA 1NC2A 3COOA 1JZ8A 5EBMA 4X7CC 5SV3A 2VWEE 2OBGA 3LEYH 5I1LA 5LWYL 3EG9A 3D0LA 4Q4EA 1UJTA 4H8QA 2UXVA 1OCWH 4OCNC 4NM8H 5HHOA 2AGJH 3OLDA 4DP4X 2ZX9A 4PJ8D 5JO5B 1RERA 2CJUL 3ROLA 2IAMC 3LNDA 3V5KB 3C6LB 4DP8X 5BO0D 2ZOLB 4LVHC 2PYED 4FXTA 4YMPA 3FCGA 3G5ZB 4LPXA 4ZS7H 4NOFA 1NWPA 4KTGA 3FRPA 2RCSH 5HHXL 1CVSC 1LP9F 3OKLA 2Y36L 3AT8A 5DT1H 4ZAKC 1AD9A 3TBTB 5LQBH 3LPFA 4OF3A 1OM3H 2ODIA 3SDCB 2NW3A 2XVBA 1JRHH 4QRRA 2GK0B 3GSWB 4JKPH 4ZQKA 4X80L 5ITFB 1KYUA 5CEZD 2H0JA 1JS4A 2WLJA 3WJJC 1JZ2A 3KM1A 1LP9B 1TTAA 1ZY9A 1WFMA 2ROXA 3AQDA 3O41A 1SXSA 2VDKB 4WJ5B 3DX6A 4UT6H 5EBWB 5C0IB 3DC0A 5FYKH 1CLZH 5ESVA 2BP3A 2IJ0C 2ORBL 4N6RB 3M7FB 2XACC 2KYIA 2A73B 4KK6D 1T20A 4JPIB 3T77B 5KUKA 1HH9B 1P5UC 4QXUL 5KJ7E 4EOWH 3SGDH 4PB0L 1XH3A 4HWBH 1JZEA 5BVJA 3BW9B 1Y1UA 4N86A 3FQXA 2IDUA 4V2BA 2QR0A 5ALCL 4PG9A 1HQ4B 2XWZA 5JOPE 3TZVD 3ESPA 1IM3D 3S5LA 3TC9A 5D7JB 4C56E 1LD9B 1N8ZB 2HJLA 1TZAA 5D7SL 3APDA 1TDQA 5DQ9A 5GXBB 2PXYD 2X1XR 5EC1A 3G5WA 1ZTXE 3X14B 1URZA 5LGHL 4J27A 3BDYH 2PN5A 1R9FA 4XMKL 3VFWB 3QIUC 1OOAA 5DLML 2NCEA 3SPVB 4L3EB 3WE6A 4BFFA 3MBXH 1SHMA 2ITDA 4HHAB 3MRNB 4RISL 2VSCA 4JO1H 4O5LH 4HT1L 4YSPA 3WNKA 4I3RH 5GRJL 2OYLA 3QARA 5HBBA 1NGXA 2NUTB 2YMXL 2XYBA 2Z35A 4HXAL 4IDJH 3GXUB 3HG3A 1NC2D 2HA1A 2BC4B 4EI5C 2WLYA 3BXNA 1CBVL 4TQIA 1N19A 3QJHA 3JTSB 1GRWA 2YBRA 3T6VA 2YPLB 3ECWA 5J06A 3U1SH 2JKWA 3IDIB 4DPAX 5HHOD 5F7AA 4U1LB 4GUQA 1URLA 3QJQB 3RA7L 3SIKA 1JSYA 4JG5A 1GYUA 3S37X 4HDIA 4MJ6A 3UZQB 2FJHA 3DO3A 1A2YA 4N0FB 2AVFA 1RK1B 3DDGA 3QNYB 1UZ6F 4O02H 3JWOL 3TJEL 3MJ9L 1P4LB 1NUNB 4QRRD 4I0PA 3DROB 3K6IA 1FFOA 2H2SD 2PPFA 4JNXA 4JQIL 1M9SA 4ETQB 2DWDB 1UD6A 3MGOA 4G11A 4OLYH 3VE0B 3WKPA 1E8ZA 4JPWH 3SDYH 4JFZL 4HEME 5LN4A 4GKOA 2H9GB 1UKQA 3NH7H 4FXLA 5E94B 1CQYA 4Y19B 4BFGA 1XTMA 5K59F 2CGRL 4P05A 2PPDA 1EJ6A 3HB3B 1I7RA 1KOAA 4PJXA 4X6BA 1UXWA 3VYOA 5A16B 4Z3IA 1AR1D 1L9TA 1N10A 1HI6B 4WU5B 3WMQA 4DGWC 2HRPL 4PGDA 3RB7A 2EIZA 4IBTA 5FO9B 4FZ8H 5ISZB 1PLGH 1PQZB 1UGNA 1W6WA 3V0VA 4OCXL 3QP3A 3BUQA 4F57L 1E9QA 3Q13A 3CG8A 4XODA 3FT9A 1A6UL 1OALA 4IMLA 1LVEA 5E9AA 1SVCP 4QXVA 1DE4A 4YN3A 2QGBA 3JZ7A 4WUUA 4M6OH 1ZT1B 4XGZB 5F2FA 3TTSA 3ZE1F 3UJJH 5T1DL 4F15C 5BV7H 3SY6A 4WI3A 4FS0A 1U3NA 4OF6A 4KZEH 2BNUB 1P7KB 2QLVB 4KUCD 4L23A 2KBGA 4TLKA 5I0ZA 1NOLA 5FEBA 4XVUD 2GEQA 3RP1A 1F3RB 4Z9KB 1KT2B 3EYQD 5I1AB 3ZE1B 4GW5A 4KMTL 4X5XA 3TFKD 1Q0YH 4HUUA 2C9RA 2LE9A 4Y5XA 5EH1A 3UBXG 4X83A 3W2DL 1EEZA 2VNCA 1T2XA 1UZGA 4P5KB 5DS2A 3RY5A 2W95A 5IQNA 4KH9A 4NS0A 4ELMF 4TUKH 4PVMA 5JUEH 3O0RL 4M8QB 4MNGA 4P23A 3MBWA 3GXDA 4Q6YA 3L5HA 3QQ3B 2XQBH 4ORZC 5KYYB 5DHVH 2BNRE 1I8IB 3JYCA 3CN2A 2UY6A 3R19A 2P5WB 3D2UA 4LEOA 1TZHA 3DDFA 5I8OL 4O9HH 1VFAB 4ELMB 1WCQA 5AVTB 5KBMA 1W9XA 3U30B 2K7PA 1H15A 2VDOH 3ZTNL 2FJGA 2JJVA 1VACB 3NIFF 1UM5H 1ZT7A 4L3CA 2JV6A 4KKZA 25C8H 4HXBL 5FHBL 5D5MA 4K9EL 4KVCL 1LK3H 3EOTH 3BCFA 3DYOA 4BCZA 4GRLB 4I0PD 1NFDA 1T0NA 2Q7NA 3QG6B 2D7PA 3NIFB 5CKGA 1V7NH 2FB4H 4F2EA 3SPJA 3MOAH 3OPZH 1AJ7H 3EO9L 3WFDH 4O02B 3EYVA 4YGAB 4RMTA 2ADIA 5AVSB 4ZMAT 1BYOA 1XF2A 1HL9A 4OIAA 4PJ6A 5HHNA 3MRMA 1MJJB 5CGBA 2EKSA 3EBIA 4LSTH 4BWWA 2NY7H 5EA0H 4NC0B 2CRZA 4R4NC 2JI3A 1QUNB 3HBZA 1SQ2N 3HG1B 4HFUH 4R96B 3A6BH 1B6UA 3M1BA 2UZYA 4QHLA 4DP6X 1JZ5A 4IQHA 5DZ9A 2WTRA 4Q2ZB 3V4PH 4BXVA 1GHFH 1NCIA 5IF0A 1I1AB 3BT2L 3DX3A 3O2WL 4UV4L 4L4VA 4U1JB 5C3LD 2JELL 1CU4L 2VDMH 3DV4B 4U1MB 4ERSL 3WEMA 5H35A 4WI9A 4QRUB 5HDBF 4YZWA 3LIZH 2J1YA 2UYLA 1AS8A 1KLUA 4JFYA 4R7LA 2GJ6B 5GS2H 5E4EC 2BP0B 1FZMA 1JNHA 1HSAA 3VFTB 4UIMB 4GP5B 4GW1A 3L3GA 4YR6B 2YGQA 4OLWL 3GUTA 5BV7B 4KXZH 2LAGB 5HDBB 1NUFA 2X40A 5FWRA 5I6MA 1KBPA 4NKQB 5BJTA 5BCAA 2JH2A 3DJSA 3KLSA 2BSRA 2X4RA 1GYCA 1KPUA 4GFXA 1WO2A 2E6JA 3DNKA 1S9YA 1TQBB 3FCBA 4M43L 4FXKC 3AC0A 3CE1A 4V33A 3PDOB 3VXQB 4NBZB 5IVXA 3QJZA 4XOAA 5T1LA 2FQDA 4P23D 1ZLWK 5CIPA 5D4IA 5FA4B 4X6DF 3M8OH 5D1XA 2Y0SA 4TF4A 3GSQB 3D2UD 3ULVE 5KJRL 1T04A 5L2JA 1BJ1J 5CLYA 3ARWA 2VUOA 4LSPH 2GSGB 2QADC 1IBGH 1BFOA 1CFVH 5DHVB 4XC3L 5LO7A 4X6DB 4KVNL 2AQSA 2PR4H 1ILSA 3AAZA 4Z3HA 4XMLH 1KWKA 3MRLA 3L81A 2VLLA 2ZX6A 3FFCA 4N5ED 2VDOB 3K2UL 5KSBF 4FI6A 3KYOB 4JHZA 3ARGA 1BFVL 4F1ZA 5I76B 4PGEB 3S36H 2I7OA 1KY6A 5FUZH 3SBWA 1RJYB 2CLZB 4JM4H 3MJ6A 5EOTA 2PP9A 2VMDA 4Y1SA 1RZQA 4FQJL 4AENA 4JY4B 4PJIF 5JHBA 2ERJC 3V5HA 5KSBB 4U1SB 2EAEA 1ETB1 1OARH 1EGJH 4E9LA 5CN1A 1JOIA 2HRGA 2D4FA 2Z91B 4O58L 4OV5B 3B9KD 2B20A 3IJEB 4P4RB 4Y2DC 3N9GL 3LRSB 1KCUL 3UAJC 5FCUH 4Y5VB 2AKRA 3VU1A 4PJIB 5AB9A 1KGCE 2AFNA 5A2BA 1FFPA 4JN2B 4WHYG 2P8PB 4XRCA 2BW5A 4KI5F 1Z3RA 3HMWH 2R0KH 3KBEA 1G7MA 5D4JA 1WD9A 2PTVA 3CFKB 4CA4A 1QASA 3EADA 5FOBB 4QRTA 4EN3A 4TSAH 3TIEB 2BLFA 3V4PB 3HMXH 3FONA 2VN3A 3B9AA 3AGWA 3WIFB 4QHKJ 1XIWB 2VDMB 5H8DA 3ARBC 3WY1A 3IAQA 2WJ5A 1U93B 5LDSA 1BZOA 5JORA 3GIZH 1SFDA 1WIOA 1SYVB 3UEQA 1QPPA 4JFTA 1NOAA 5HP5A 3RWEB 2AMGA 3CMOL 1I8LC 3MGTA 3S3BB 2ZUVA 1BFTA 1PG7X 4FMVA 5DJAB 3HFMH 1MAKA 5T1LD 5GRXG 2R2BB 2O5XH 3V7AG 4CMHB 4J6IA 5LGJB 2VR3A 3P77B 3SQBB 5D1XD 3GMQA 3B2DC 1SMOA 1AQDB 1JPSH 1WTGT 2FYYB 2X70B 1QFUH 5EMYA 2YD9A 1GS8A 5T1JA 3GHEH 1M7IB 2CK0H 2YMOA 3QO0B 4MA3B 4NKOB 2GJJA 4HIIA 3DTDA 1PL3A 1CGUA 3WO3B 4DEPC 4HMCA 4TUUA 3V79C 5F1NA 5ICZB 3GYRA 3B2XA 4YL9A 1MAJA 2YUWA 3ESNA 1YMHB 4EI6A 2GFBB 4ZW7A 3FO2A 1NIEA 4A7GA 3FFCD 1A4JA 3FQ2A 4X8JB 4N4YB 5IB5A 5KSVB 3WDIA 3ARGD 1K2DA 1MCCA 1CDJA 2WQRA 3UJTH 2OMBA 4BE6A 1KN2L 3C6EA 4G6MH 1VIWA 4XP4L 1HESA 1QI5A 2VXSH 1RLWA 3G04B 4P5MB 5DGRA 1IVLA 3BE1H 4LSQL 4MA8H 4HLJA 5FECA 5FKPB 3QC5X 2VXUL 1FNGA 4OH2A 3LQAC 4G42A 2ZPKL 3UZQA 4HKBA 5I1KL 3CHSA 1UKSA 1FHGA 1CG9B 1RVFH 4OZ4B 3UC2A 1SY6H 1UJ3C 2BIHA 1C5BL 4EN2A 4MA7H 1BSIA 3LZPA 2A99A 4X4ZA 3TVMA 4WI8A 3ZO0A 2BXZA 3LN4B 1QBMH 2C3VA 1TYJA 5BW7C 3TBWA 2NNAB 1GAFL 3WNLA 1IBZA 4OCSH 2AJUH 4FHJA 1J0HA 5C09E 4EN3D 1YAIA 4JLRB 1JZ3A 4D9RE 1MFAL 5EZIL 3E9UA 1Q9OA 2ZF8A 4WEMB 4R3SA 1WIPA 4RMQA 3OMNB 1MWOA 4N0UE 4LGSB 3QIWC 4PPTA 5DMGC 4D2NA 3OZLA 1QVOA 4B9KC 4AEHH 5I1CL 1JE6A 4GAFB 3CVHA 1FYTA 4FYRA 2D73A 5E6IB 1XF5B 3U9PH 3OX8A 4PD4J 3MDJA 4JCLA 2DW5A 2E8ZA 2YWYA 3PAYA 4KQ4L 4UUJA 2BVTA 4I77L 1ADWA 1BV8A 4PJGE 2EE2A 4UQCA 2YGVA 1ZA6B 1RU9H 4F7TA 2BIMA 2QSQA 4DHLA 6TAAA 3WN5A 1YMMB 1D6VL 3HPLA 1NSNH 4MXQC 4JY6B 1JHTA 4YHIB 4IRSA 3V6BR 3RGVB 1XR8B 1XB3A 3KS0H 2JB6B 2J8UF 3UBXA 4IOSA 3LKSB 3WO4C 1YG9A 3IF1B 4I4WB 4MNQB 4ODBD 1JPEA 3PPSA 4IIQB 4WWPA 1R3LA 3WXVH 1BECA 1ZLUK 5JHDA 3QXWA 2AJZA 3LRGA 3L3HB 1SM3H 2V3DA 3TNMA 4UNVA 3WEAA 2RIKA 1Q72L 2J8UB 5BQ7A 4A37A 3CLFL 2MHAA 2J44A 1NLDH 2DEXX 2Y7SA 2Z7YA 4XNYH 1FVDB 4OW6A 3GSRB 3GS4A 5AFAA 1CLOH 2B1HH 4S0SD 2YS4A 2R69A 3NJKA 2WBJA 8PAZA 3ML8A 4JKMA 3UAJD 3PWLA 1IGFH 1KEMH 3BEWA 1FHNA 3M86A 2I27N 4Q9RH 3IKCA 3O3EA 4ENEC 2OS7A 4PGBB 3K6FA 1OL0A 4M1CC 1IIKA 4W9JC 3LX9A 4LP8A 2WYZA 4F93B 2CHWA 1BAGA 5B1KA 3W0WA 4J2XA 3OWRA 1F3DH 2SEBB 3M17A 3NACH 2JCCA 1SVZA 2Y4SA 1J5IA 1WZAA 1ZE3C 1Z0NA 4OM1H 4U49A 3SE9L 3WIIH 3C5JB 1MY5A 4K8RC 4LO9A 2BINA 3NCXA 5FB8A 3NT0A 1E4KC 3MN8A 4L8CB 3KDMB 2J5LC 4QRPE 3BIKA 2VGLM 2ADGA 4FNPA 5DD0L 2LLGA 3UJIH 1FA4A 3H55A 2AQ2A 4Z7WA 4CN6A 4NN6B 3IN2A 4XO9A 2MFNA 2EEFA 2JLLA 3C6SB 2QQKH 5BZDA 1IAKA 2QDVA 3LKQA 1IT9L 1PZAA 1S7VB 4Z76B 2AK1H 5KSUA 2FIKA 5HYIA 2YLKA 1ZA3B 1FYTD 2H8PB 3DO7A 4JM2A 2P7TB 5GGRB 4Z7AA 1QSFE 1IJNA 3DXAD 3JV6B 5C0RL 2HSIA 4Y9FA 5JPMC 4OF7A 4ISVB 1MQKL 2EINB 4H26A 4DW2H 3DOSB 2F53B 2HTKD 1FFNB 1INEL 3BO8B 3G7TA 4DOHE 5AAWC 1GJWA 1QO3B 3WLWC 2D0HA 4IRSD 5TK2A 3F3HA 3HOGA 2DIEA 2WLZA 4IOSD 4P5SA 3SJVB 2AJVH 1QD0A 4IJ3B 2WSKA 3NRQA 1Q0EA 2N59A 1R3IL 2QMKA 4MKMA 4WNJA 2HRLA 1N2RB 1FE8H 4C47A 4YHZL 3LEVH 5JHDD 3LKOB 4YC2C 5JO5A 4JFVA 3BN9D 4NHCH 4UZSA 1IKNA 2JLPA 1G6RH 3C6LA 2ZOLA 1X7QB 2XPZA 3GHBL 3G5ZA 3K0YA 1Q9WB 4FAAB 5K1VA 3INUH 4U6HB 1SEQH 5GZOC 4FTVE 2VXQL 3TBTA 3QRLA 1K3ZA 4GBXC 3V52H 4P04A 5ITBH 3SDCA 1KB9K 5C08E 5A6IA 1JZJA 2GK0A 3GSWA 1T7XA 2WBJD 4PHXA 4Y89A 3L13A 1ZPLA 3EGSB 5ITFA 1WDAA 1ZCRA 4JHVA 2KLSA 2EECA 1ASOA 1U4FA 1LP9A 2H0FA 2X9XA 4RVBA 4LCWE 1XHHA 1F4AA 3MRDB 4EDWL 3L4YA 2WTOA 5EBWA 5C0IA 1A3LL 4P2RE 1Q4NX 1FNSL 2HKAA 1CFTB 1U8KB 4N6RA 2A73A 1HHKB 3N5AA 3MUY1 5HHMD 1ZEAH 2DLGA 4JPIA 3T77A 3H9HB 4CVXB 1NFIB 1FGNL 1HH9A 2R56H 4LCIH 4BCYA 4OCYH 3BWSA 1PLAA 2JMRA 5L9DH 3BW9A 3ZE0E 4NZTH 1XBDA 4AG4H 1ET5A 5T33L 3FUKA 3QIWD 5DMGD 1UUNA 4HS3B 1HQ4A 2AAAA 2V2TB 1QLRB 2ZOTA 3UCQA 2GTWB 5D7JA 1LD9A 2IGFL 3LH2L 2MNUA 1N8ZA 2MOQA 2YHGA 3MKKA 2IH3B 3ZE2F 4NKDB 3X14A 3ZHKA 2VXVH 2DYRB 5LDUA 5LAXB 4JO3H 3VFWA 1BG9A 3G9AB 4FQIH 3SPVA 4L3EA 3TO4C 4XX1E 4HHAA 3JVGA 3MRNA 2WC7A 3ZE2B 3FS9A 3RB5A 1X7TA 3OMAB 3TBBA 3QZNA 2CKBH 2NUTA 4H5SB 1OAXH 1YEGL 2PCFB 3NSCA 3I9PA 4QHKI 4ONFL 2BC4A 5FLUA 3Q2WA 3GBMH 2NYKA 1F2QA 3DHJA 3JTSA 5T3XE 5MHSD 3BZ4A 1F4WH 2YPLA 1RUKL 3IDIA 4U1LA 4F8LA 4JGMA 2MIZA 1ASPA 3HE6B 4E9XA 2ICEC 3DYPA 3NCBB 3BFWA 4NCC1 1XSOA 3C6LD 3ZTDC 2A74C 4EBQH 5DEFB 4N0FA 4JHUA 5E5LA 2QMJA 1RK1A 4YO0B 5C2BH 2V5YA 3MV7E 3QNYA 4NO2B 2X1PA 3SDCD 3OKKB 4HJSA 1P4LA 1LM8V 1XTLA 2XYCA 4M1CD 4MAUH 5MP6H 5JZ7D 1G6RB 4ELKB 2DWSA 1DJHA 1S9VA 2A6KB 3H3KA 4WO4C 4E9VA 1E4HA 2KI6A 4G7SB 4N0YL 4WGKA 5F7NC 4ETQA 3DMMC 3VE0A 4HJGB 1FL6B 5ANMB 2H9GA 3LRKA 2EDWA 5CU9A 5E94A 3DVFA 4Y19A 4BM7A 1F11B 4JG0H 1UWEH 1BREA 2VZ1A 2HFGH 3QJTB 1O6SB 1L9SA 5F6IB 1PIGA 5A16A 3FUHA 4GB9A 2GJPA 2AQNA 3GBNH 5KYXB 1HI6A 4WU5A 4GP8B 5DQDH 5CZXC 2EH8H 4UT6A 4QLWA 3NTCH 2HJKB 3LHPL 5FO9A 2ZE0A 5ISZA 3FMGL 3D39B 3TBVB 1PQZA 3RYMA 1CXIA 1RPKA 1RUAL 2GJZB 2OI9B 3SDAB 3X12B 3ZL4L 4CBZA 2WIIB 1OAQH 3FKUS 4JFDB 3KPOB 3MLYL 4XGZA 5D7JD 1ZT1A 3UTSB 5I75C 5SWZA 1ZTXH 1CDGA 4UT9H 2BNUA 1P7KA 3KGRA 3DOHA 5H94B 5JIDA 3A6CH 3ZR5A 4DH2A 1KT2A 4A2HA 2A1WL 5I1AA 4MQXC 1F13A 1JNNL 2E7LC 1OW0A 4LFHD 3WLWD 3FN9A 1EDHA 1WCBB 4BE5A 4Q97A 1J1PH 2D7OA 3LZRA 3D12B 5I30H 4J8QA 2UWEF 4HCFA 4JMXA 4P5KA 3IDXH 1UB6B 3LKRB 3PHOA 3AUWB 4B7IA 3CZUB 2G9KA 1G1OA 5AEAA 4GAGH 1PS3A 4M8QA 4QLRA 4NZDA 3EDFA 3QQ3A 2CKBB 2FDBP 5A2IH 5KYYA 5HI3C 2UWEB 1QYGL 1I8IA 4BK5A 1T89C 2P5WA 4RRPA 5HJDA 2AK4E 4AZ8B 2W91A 3TF7C 1I7TB 2Y5EA 3STBA 1VFAA 4ELMA 1VRSA 2E4FA 5EOQH 4LHQB 1NCCL 3N91A 1VACA 4KJPC 1J8KA 1ERNA 2NTSP 2VMFA 2WJ7A 3CZGA 4KK8D 2E5EA 5IV2B 1JGUL 2X9YA 2IDFA 1J8HE 4KKCC 4X7SL 4PLOB 1A0QH 5B1AB 2XETA 5DMIL 5AL0A 4YE4L 4GRLA 3RVTD 5KYUB 5J1SC 3QG6A 1PY4A 2UXGA 3FTXA 1F8TL 1MCPH 4OJFL 4NP9A 3WFEH 4TYUA 1MEXL 2HTLC 3IT8D 3QUZC 4O02A 4Y16D 5AW1B 5EN2B 3WXWH 5ABAA 4TVPL 3B37A 1DYZA 4QMEA 3ZZ1A 3CPUA 4Y19D 2P43B 2C5DC 4KXAA 1MJJA 3TP4A 1FN4B 4AQEB 1F6LL 1NJ9A 1QUNA 3J8F7 3X3FL 5D1QE 2GUOA 3HG1A 3MCYA 1YEKH 4R96A 3DVNB 4QRAA 3WFCL 4ZMTA 5ISZD 3E3QC 2NY3D 4GP4B 4Q2ZA 1HIML 3TESA 5I28A 1J12A 1I1AA 2PETA 3BKCL 4HS8H 4U1JA 5EZOH 3DV4A 1RCYA 1W0YT 4U1MA 4GAJH 1KYAA 2UXTA 3RWCB 4QRUA 2D03H 3L3IA 5EORL 5SWZD 3T4AC 2VMCA 2ZCZA 4NSKA 1MRDH 4AEIH 2ENQA 2WINB 3BN3B 2DQ6A 2PUQT 4CADB 4OLXH 2GJ6A 4LCUB 4DVBA 2BP0A 5F9WC 5CZVL 2Y07L 4UIMA 4C56B 2DM4A 4YR6A 2HVKB 1WUNT 5A2JH 2XBZA 3POCA 5HYJE 2NX5E 4DERA 3CXHK 3AY4C 2KLTA 4YNYA 5M7QA 5L0QB 4E41B 3TEWA 1YEHL 5DK3A 3IDYC 4AW4A 2F8XC 4KKQA 1XMEB 3IMBA 4KHXH 1VDGA 5A2CA 1FH5L 1E28B 3DRQB 2QVKA 3VXQA 3PDOA 1P4BL 1BQHB 4QWWC 1BPVA 4PSPA 2YA0A 4XHJD 3X1FA 5JQ6L 1O7DE 4I18B 3BAWA 1I53A 5FA4A 5C0CE 5I16B 5E4IA 1EZVY 3GSQA 2P5WD 3LMJH 3R7RA 1SOSA 2YQ3A 4RA0C 5TGBB 3GC3A 4LT7A 3P3RA 3ARDB 1RUMH 3ARPA 3BLBA 2GSGA 4CC1A 4ZW5A 3TLRA 3LDBB 2R29H 5DHVA 3G3LA 1G9MH 3I6SA 1LO3L 3QEQE 4X6DA 4WO4D 1KFGA 1UT1A 5I18H 1DVFB 3MRGA 1BQ5A 1MRCH 4F5CA 5KVGL 5IESL 4HAKA 4GRLD 2R2HB 1NBVL 4YAQB 3ASWA 3KYOA 3QI9B 4GS7C 5EEXA