4BKSC

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-1-ethanoyl-n-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
137
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 137
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4bksC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4bksC01
4AJYV 4B95C 3ZTDC 5LLIC 1LM8V 4W9GC 4W9JC 4W9FC 4WQOA 3ZRFC 4AWJC 4BKSC 1LQBC 3ZUNC 1VCBC 3ZTCC 4W9LC 3ZRCC 4B9KC 4W9CC 4W9HC 4W9KC 4BKTC 4W9EC 4W9IC 4W9DC
chains in the Genus database with same CATH superfamily
2WCPA 1M7IA 1RMFL 4TLUA 4NPYA 1HHJA 1IBZA 3EHBC 3MBEC 3SYOA 2Z91B 2KH2B 2HXAA 1AQMA 4XCNA 3NVQA 4FNQA 2X2JA 4B97A 3GS7A 3I3DA 4WW1A 2N7AA 4H20H 4EDXB 5HPOA 1GJWA 5A7BA 1IAII 1H15A 1DHKA 1X5FA 5EEXA 3CLFH 3CFMA 4Z7WF 4HU8A 1P7KA 1ES0A 1KB9J 4WW2A 2L8AA 1CICD 1K5NA 4HQQL 1QEWA 2NPLX 3KCWA 4PS8A 5DHVB 2I07A 5FM4A 3B2MA 4G8AC 1Z7JA 1UUNA 5C0IA 2ZWZA 5IESL 1CICB 4JR9L 2A9ML 2Z64C 4HC1H 3CFJB 5L4JA 1CFVH 1GYWA 4UV7H 4TXVB 1A7OH 5EOCH 2CJTA 4NOBA 3BQUD 3TM6A 1LO0H 1WSST 3RGBA 4J3XA 4JL1A 4H26A 3STZB 1EJOH 4ELMB 1D9KA 4FQCH 4OAWA 1KXHA 2PO6A 2FJFB 4HKZB 4OFYA 5F1NA 3TCXA 2KZWA 2B3IA 1KLUA 4IRJC 3LV3A 3ET9F 3BPNB 2WN3A 4P49A 1DQVA 3PWVB 4PJDB 4XBMA 5FO7A 3QCUH 2EDJA 4BKTC 1H3PL 4NQDE 4WI6A 4C56A 2GIXA 2A6JB 3K2IA 4PJHE 4H0HB 3RUGE 5E2WH 4FG6C 3T65A 3HMWL 4N2EA 3HS0C 5HVHB 3HZKA 2XIDA 3HN8A 1BX2B 1WFIA 5I6XB 4PG2A 5GS3A 1Q0YH 2C3GA 5JIKA 3VW3L 1A7PL 2Z8RA 5EC1B 3KAAA 1JNLL 1EJ8A 4I4WA 3VU1A 5IQ7H 1QLRA 1UM5L 1YQVL 3S6CA 5B7MA 4P23B 4FKKA 4J3SA 3FFDB 4Z3HA 1JCKA 3TFKD 3PIQA 1NIBA 1NDMB 2BW5A 4AEIL 1F00I 5D1ZI 1TQBC 3AUWB 4JHAL 2V3FA 1YCSA 4L4TB 4G6AC 4YXHH 4QRQA 1MFEL 1LWRA 3CZJA 4L29B 2ZG3A 1OANA 2FH8A 2ITEA 2C3VA 1KGXA 3REWB 4IBYA 2F68X 4PGCA 1A66A 1T0PB 1X7QA 4GKLA 3V7AE 1NOAA 3TH2T 3VI4E 3W3BA 1MFCH 1N64H 3T4AB 2RALA 1QP1A 3MJ8A 4PJ6A 2FO8A 3KNBA 2BP8A 3NCWA 3ORJA 4J27A 5JHDA 1EANA 3VMNA 1LGVA 1E4KC 2FX9H 4Y1SA 4CBPA 4EI5B 4AEHH 1WYJA 4GEJA 1BFVH 2GTWA 1J8RA 2OX5B 1WITA 2X3CA 3PL6A 4UNVA 2CIIA 4IGBA 2VXQL 3QR2A 5GZOD 1H5BC 3N40F 5BQ7A 5FGRA 3IFNH 2OJEB 2IGLA 3TCLA 1JIBA 4GSDH 4O2FA 3VGEA 5G5DA 5FV2A 3QH3B 3UYRH 5CEZE 2HYMA 1RUMH 4J2XA 1HAUA 4MMXB 1A64A 5DTFA 4OD1H 1H6EA 5G2NA 2SODB 3N5AA 4FLSA 1R46A 4ODWA 4MAYA 2CKBH 2BWQA 3WTTA 1T6WA 4U1JB 5B1JC 4KI5C 2AXWA 2JJSC 1OARH 1XGZA 5AYTA 3TNMB 2P46B 4OR1A 5HJ3B 3DRQA 4QRRA 1FYTD 4L8CA 3QRGL 5JW3H 2R69H 2DTMH 2E27H 3QDAA 1FYTB 3LN4A 1MH5B 3ZSSA 5GRVL 4Z1PA 1RMFH 1RURL 2BSCA 3KPOA 4DN4L 5D7IF 2J5LC 1JWMB 3VACA 1G9ML 1JFQL 1INQB 4NKQB 1QSFA 3LKNB 1E8WA 25C8L 4BK4A 1BEYH 1J5IA 5T1MB 5D2NC 1FFPA 1SJHB 5DMYA 2J44A 2VQ4A 2WLKA 3NABH 3QUMA 1DQJA 2BINA 2E59A 4JG1H 2LR4A 5F3HA 3W82A 3X1EA 5JQIB 5I16A 3WTYA 1XWVA 4HT1L 2WINA 1NGPL 1KGCE 4NFCA 2YC1B 4FEIA 4JREB 4S1DD 1OCZB 2ZSVB 4PREA 2HG0A 1T6BX 2FWUA 5DLMH 3K72B 5GS1A 4U1HA 1E42A 2X4QA 5FHAL 4DGYH 1JRHL 1XO8A 1WZKA 3OWEA 2YA0A 3AU1B 3HUJB 1W8OA 2H2SC 4W6YB 4BZ1A 1DDHB 2VXTL 2YGOA 5TDPB 1UZGA 2ENSA 4M61B 3SIKA 5J12B 5IFAL 3FUDA 5H4ZA 2PTTB 2Z1KA 3NH7L 3ZKMD 3S5LB 1GZHA 1I8KA 2A73A 5INDA 3SYPA 1NCJA 2AS5M 1RJZA 1WIUA 1SLVA 5L88H 2AJZA 1MHCB 3SKNB 1BG9A 4WQOA 3QJHB 1OB1B 5E99H 3O45B 2PKDA 3MO1A 4F7TB 4ZOEA 3IDGB 3VXUA 4M7KH 3EBGA 4PJEE 1JWSB 4NZTL 5EOCJ 3VW3H 3T0EE 4HWZA 4F1ZA 5I82A 3KW7A 1UM5H 1YQVH 3AG2B 1JV2B 1A6AA 4PJCF 4KKQA 2NLJA 5GS2D 1IARB 1E67A 4X6EB 1KTLB 2EDHA 1L7IH 3SODB 3V9FA 1AOZA 3S98A 4JHAH 1HZKA 2FGWH 4KUCD 3DRTA 2UZYB 2EP6A 2JKLA 2MJWA 1FGNL 2QV2A 4JDEB 3VXSE 2WXHA 3GYRA 2VKXA 3WBDA 5ETUB 2VXUH 3ZW3A 3GBNH 3I85A 1JK8B 4YDIL 4CJ1A 4RESB 3UG4A 5A16A 2NW2A 5JA8B 1OLZA 4HGWB 4NENB 4F8PA 3TA3C 2VSDA 3UJTL 2YD8A 1THAA 1NCHA 3V5KA 1F1AA 2ARWA 2BVQB 3LH9A 4GY4A 4QKTA 1MFNA 5K9KB 3NJLA 1KSRA 4ADJA 4U6YB 4XXDB 1U3NA 3W39B 1KB5H 4QXTA 2FJHB 3CVHL 2PWFA 4OY9A 2OYMA 2YIHA 2VXQH 3O3EB 4MB5A 1N67A 1NGQH 2GT9B 5E00A 3JTTA 3QDJA 4MXQC 2WC7A 4E2OA 1G6RL 1E50A 1MW1A 4EKJA 2VLRE 4XPBL 4UB0H 1SOQA 1I8LA 3AREA 1DANT 2XBZA 1IEBB 5DQ9B 5EULV 2X4SA 5EZPA 4DAGH 1DLHB 3ZE0B 1GYUA 4WY7L 3EZ8A 4BKLB 5AYUL 3E8UH 2VSCA 4EUPA 1DVFA 2PETA 3UYPB 3SD2A 4PJ7B 3LRHA 2OL3L 3K74B 4OSUH 3WY4A 1OIOA 1L0QA 1R5IA 2CXGA 4NAQA 5DRWA 5JR1L 1WBZA 3QRGH 4CADB 2ZUYA 4XWOD 3HBGA 4NUJB 1JMZA 2H9GA 5ABZA 2FYYB 3SZKC 2YQ3A 2QDVA 3V4PA 1BZDA 5IUCA 3OKLB 1GZPB 3MV8A 4PWJA 2CHXA 2EDYA 4URTB 4Z23A 2ORBL 4Q6IB 4BINA 4G43B 5HHQB 2VZTA 1UWGH 2QLVB 5I1HH 4YFLI 1T89C 3CH8A 2TRHA 3EDJA 4NN5C 43C9B 4ZD3H 12E8L 7FABL 1U3JA 3KMDA 3PGCB 5DZPA 4TUJA 4TLKA 1Z0MA 2BOLA 3AW5A 5EU6D 4LGSB 1A6VH 5FW7A 3FSZA 4BE5A 3WE6A 3KLHD 4MJ4A 1U8PB 1BF5A 3WIIL 4DZBA 2YS4A 5EU6B 2CG9X 1ZS8A 2QKIB 1JRHH 3B2UC 1XH1A 4H8PA 2A83B 4PRBB 2BHZA 4H13C 1PZ2A 4L0YA 3F7VA 3O6LH 2CRIA 3D06A 4HUCA 3ULUE 4U1IA 5DHYA 3DX8B 4X6FA 5BZZA 5IFAH 4DP0X 5I30L 4DEPC 3F7QA 3NH7H 5AVZB 2N1TE 5KJRH 3VI3F 2VWEE 4FS0A 4FXKA 5GGTA 3E6HA 4H8VA 4IHOA 3T3PB 5L8LB 1OO2A 3GSRB 2WO2B 1SXCA 5J1AA 3APNA 1AS8A 3BIKB 4IKNA 3D69A 1B90A 4U3CA 1VFMA 1OAXL 2O30A 2WSPA 4XBPA 4HS8L 1NAML 2E8ZA 3BKCL 3EYQC 4F58L 3ZT7A 4LOVA 2AJUL 4OBRA 3PJLA 3FTGB 5EEUA 1GGBL 2C9AA 2B59B 3G6JB 4LSTL 2D4DA 1EBPA 5IMLA 4KHTL 2R0KH 1WC7B 2WTPA 2EH7L 1FGNH 2IJ0C 5DJXB 1RAMA 4X80H 5LGJA 4UT6H 2DD8L 2KBGA 4M43L 3LRKA 2DDQL 4L18A 1C5DA 5C0BD 5DD1L 4YXKL 3TPUA 1AIFB 4YDIH 4KKRA 5I1DB 1K8IA 4KAQL 5IGXL 3FN3A 1AYRA 4X5QA 1N9PA 4X8CA 2A4CA 4YPGA 3DGDA 5DYOB 3STBA 1OOWA 3KYMA 4D0DB 5JXEA 2QQLL 3UJTH 4LCWD 1SHSA 4HD9A 4AQAB 3MRPA 1YG9A 4BV1A 2ZXCA 2VTFA 3CMGA 4LCWB 5FWRA 3BUYB 2GBTA 3ZE1B 4JGUA 4KKNA 2GY5A 5HVGB 4GAGL 3FCSA 4KQ3H 1DP0A 4XODA 1AP2B 4JHVA 4IJ3C 3D18A 1XCQB 4R7DA 2EE0A 4K3GA 4LP4A 2AJYH 4X7TB 3UTTA 3CN1A 4AYID 5BVJA 4EXKA 5AZUA 4HA1A 4OF0A 4DPBX 2ZUSA 3V5DA 4UOJA 4WY7H 4MNQA 1XQ4A 4KOBA 4L8BA 4NQXB 2VDOB 3GI9L 4MA1C 2NTFA 4GAYB 3RPBA 4LL9A 5D8JH 3OPUA 2GJZA 2WTOA 4P5TB 1M3IA 5C07E 15C8H 3CH1A 4KWUA 2OL3H 5DSCB 3Q8EA 3ISWA 4XB3A 2BDNL 1X44A 5JZ7C 4JPKH 5F9AC 5BV7C 4AQ1C 4X83A 5GRYA 1JXDA 5KYWA 3EJQA 4KVNL 4N90D 2F5BH 1JXFA 2BERA 5HGHA 1PG7W 1N0XL 2Y6SD 4QJ4B 2J6EA 1EGJH 2VDQL 1LVEA 5C0EB 3NIDB 5E1AA 3TWYA 5FYKU 3D6GA 3MACL 3QQXA 5TE7L 5HSFA 1V55B 5JW5A 1CDCA 3QDMD 3SKOA 2E9WA 2YD2A 5D1ZD 3IXAB 12E8H 4PLJD 2DQGL 4YDVB 3QZWA 3VQLA 1SBSL 1NGWA 3DSNA 3QDMB 4UBDD 1I1AA 5D1ZB 5LG6A 1JZ4A 4DKAA 1JPSL 2B20A 1V05A 2IGFH 3IKCB 3NIFB 3BP5A 5FUOL 1MCPH 4JRXE 5HGDA 1EHLH 4OD2A 3T77B 1HHIB 3FQ4A 3DBXA 1ZGLB 2XWZA 1VZHA 1T1ZB 1T6VN 3DVNA 4M02A 4XCEA 1OM3L 4ZUSB 5AZEL 1U42A 3KPSA 3ULVC 4LCUB 1NCBH 3KYNB 3CDYA 3ESVF 1HSAB 3HZVA 4N5ED 5I30H 4O5LL 4XWGL 2YD3A 3QEGL 3FRPB 1AYOA 4XPAL 1KCVH 3KL5A 4Y4FA 5JDSA 3RIAF 4AQZA 4AEEA 4UT9L 1T04A 1UB5B 3DYOA 3TO4A 2DQJH 3KPRD 4J4PC 4PJIF 3EOYG 3WNOA 3TS8A 2ADIA 5ITFA 2QTEA 1XGTB 2I27N 2VR6A 1MI5B 2DLEA 1K9TA 3V0GA 4J6IA 3KPRB 3HMXH 3OKEB 3EW3B 2YN5A 4JPIB 2YOCA 1R5WB 1W8EA 2ZYRA 3NIGF 3GEWB 4Q2ZB 1HINL 2UZPA 1OAXH 3UAJA 4BDVB 3BT0A 4OZHB 4HS8H 1FNLA 3ZRFC 3BKCH 4F58H 4HIIB 2P45B 2F19L 2J1YA 4AG4L 1H6TA 3IDYB 2DRUA 3OHXA 4LSSL 5CLTA 6FABL 1LE5A 1S9WB 4XN4A 3MKGA 2NX5A 3RDJA 3RX9A 4DZ8B 1FSKC 1FZOB 4LLVA 4AGNA 3BP4A 3LKPA 3MVSA 1R9FA 3WS6C 1PD0A 1PZBA 1BFSA 5MERA 1AC6A 1Z9MA 5GRJH 3JV4B 4PMEA 2F2HA 4WJ5B 3VFMA 3FU9A 2EDKA 2X4TA 3PREA 2DD8H 2BSDA 1T1YB 2DDQH 5EN2A 5DD1H 3MRQA 4NUPA 4KAQH 1UASA 1TZOA 3VQ2C 2NUTA 1JL8A 3H7LA 1SN5A 3MGAA 2DQUL 4KTYA 2JI1A 5TH2B 2EXTA 4LRNL 2QQLH 4QGYA 3MBXH 4LPYA 5B3SB 3JWNE 1J8HD 3MRBB 1A47A 2VMJA 3S48A 1LK2B 2DMKA 4LU5L 4K2UL 3QJXA 4NB7A 2IG2H 1II4E 3O2WL 2CIKA 2R1XB 1TO4A 1J8HB 5I1LB 3ARGA 1KIRB 3L5WA 4OGYL 2QJDA 5TDNA 4WVRA 1GVIA 4JBSA 3OXRA 1EAQA 4LSVH 1LDPH 3T2PA 5KWYC 2Z1PA 5JO5B 4OFQA 3BQUA 3S3JA 2WWOA 1CE6B 2XWJB 5F3BA 4WO0A 4HKZA 5CEXB 3LNFA 1DUYB 1LK3L 4PWIA 5JW4N 1T0NB 4WKZB 4UQ2B 1LTXA 4A04A 3D3VA 3DIVA 4PSRA 5PCYA 2A6JA 4YHZL 3HR5A 1YECL 1EZVY 1F3RB 3I6GB 4QXGL 4YGVB 4S0TD 1DQIA 4R0LB 1FIGH 4NCC2 2BDNH 3PHOB 5DQJA 2NZ1A 4H1LH 5BPPA 3WIHL 1H8NA 5C0FB 1U2HA 3RL1B 2H0FA 5D72L 1SOXA 5CEYA 5D7LB 4KVNH 4L5FL 2JKXA 4PV1C 4Z7VE 4YFDB 2ADGA 2AV1B 2VC2L 4XN2A 1HKFA 4MJID 3LXBA 4GKZA 3QORC 1N0XH 2DAVA 1VGEL 4G80A 4RQQA 2ISDA 3NDZE 4GB9A 4MJIB 2AK4E 3GLZA 2E7CA 2Q3ZA 4MDJA 3M8OH 1J5OH 4L29A 2CO3A 1AHMA 2YQGA 1A9BB 2VT0A 4KNSA 5JPMA 4JRYD 3NCFB 1UJ3A 4OGAC 2HT2C 4KXBA 1F6FB 3PHQB 4YSDA 4OTXL 2A9BA 2NY3D 1WCBA 3O11A 1D5IH 1JPSH 1T5XA 5AAPA 1AGCA 3AG3B 4U6XB 3ECBA 3P9MB 2NY3B 4O51B 5DYFA 1J0YA 4L37A 4KKCD 4N24A 4WFFE 3JYBA 4JFYA 1D6VL 4OCRL 4ORGB 3VSVA 1GGIL 1JZ6A 1IGCL 2MNUA 1D5BB 3CU7A 5H37A 5BO1H 2GUYA 4HW6A 4H40A 2P26A 1EV2E 4O5LH 3QEGH 3ROLB 2HLFD 4XPAH 2OJEA 3W37A 4BSVA 3FH5A 3M07A 5I6KA 4UT9H 4NO2A 3WMQA 3QHTC 3T2NH 5K9OB 4Y1AD 1A8ZA 3L1FA 1QRNE 3DO3A 2XFXA 5GISL 3F01A 2DJ4A 1XTLA 4MMXA 4L4JA 4MCMA 2P5EE 1RULL 4JGJA 5K33A 2Y23A 2EVJA 1HINH 2CLZA 2R2BA 4V2BA 4NQCD 2CJUL 3CDFA 2DWDA 2WNGA 4MD5A 4N6QA 2B1AL 5AW9B 3R1GL 4AG4H 4PJIA 3OKKA 5D7JC 4LSSH 6FABH 2O1AA 3TNMA 4X6BA 4HUUB 4NQCB 3DVFA 5F7KC 3BLPX 5ALBH 1JN6B 1I8AA 5CFAA 4LO9A 3MRGA 3PUCA 3RGVA 3N04A 2XZQH 2FHFA 1UQSA 1M56B 2HMIC 5IFHH 4X5LA 3L9RB 4E41D 4X5XB 5KEZA 3WTVA 2RHEA 3QIBA 4NNPL 2DOCA 2EIEA 4ZDHB 3L17A 3ZUNC 1TYRA 1A0QL 4E41B 1MNUL 1B0GA 4OLEA 5CUSH 5JQ6H 3QB7C 4NRXB 2FNWA 4U0QB 5ACLA 1JPGB 5ENWB 2DQUH 5DI8B 4AQ8A 3SHSA 2I5YL 3F12B 4YLBA 5K1VA 1F58L 2JF1A 5E6ID 2A74C 2C9XA 4F33B 1NTDA 3WKQA 2CO2A 1T20B 4QHUB 3OJMB 1I1YA 4K2UH 2H1PL 2FB4L 3O2DH 2Y07L 5E6IB 4TVUA 5EZOL 4ZAKA 2MNWA 4GUPA 1S7QA 4RMSA 5H94A 3BFOA 1MXDA 4HFWB 3U1QA 1LEGB 4OGYH 2HTKD 3O9WC 3MBWB 3CFUA 4LLUA 3NPZB 4F1SA 2CM6A 4K94L 1H0DA 2YXVA 5KOVC 2ATPA 4B50A 2WNWA 4Y1TA 4AT6A 4NIKB 4O9HL 3B3BA 1PKQA 3L08A 5IB1A 1TQCC 3SSGA 3WJMA 4AIZB 4C57C 7PAZA 3ALPA 3TBSA 2F7IA 1GOHA 1GA2A 2IAMD 3HG3A 1ZMYA 3RY6C 4PJFF 4BFFA 2VDRB 3VWJA 1HHKB 2QTVA 2YD7A 3BSZL 4XO9A 4DTGL 2AAAA 5LB1A 4YHZH 5AVSB 1YECH 4HS3A 4CVZA 4KFMA 1A6TB 1H3WM 3MJWA 1N10A 3FU5A 3JV6A 2UYLB 3US1A 5MEPA 4ZOAA 3VFSA 2Y1AA 1S3KL 1JWSA 1YAZA 3S5YA 3CSPA 3CFEA 3A21A 4POUB 4F9LA 1KIPB 5E8OB 1D5RA 2H6OA 3TESA 4BGDA 3L9EA 2ZKHL 4OFVA 3RNKA 2AK1H 1VGEH 4KRLB 5T3ZL 4X7CC 1BZ7B 3N91A 1ZE3H 2DKMA 2ZSWA 4K7PH 2IDTA 5CZXD 1FH2A 2UZYA 1CR9L 2Z9TA 3IXTA 4MA3B 3I75A 4KMQA 1LL1A 2ZOKA 5EOTB 3Q5OA 1R4XA 4LQ1A 4NKMA 4WNJA 1UG9A 1MPAL 2XJLA 4QYOA 2F1BA 5HYJD 1AJ7H 4GO9A 5M94B 3K71B 3JBG7 4G8GD 4J2QA 3Q5TA 1GR7A 4MWFA 2NY5C 5HYJB 2XN1A 2JCWA 2DQIL 3TU6A 3N43F 3DJSA 4G8GB 2VMFA 1YEEH 3V6OC 3FOMB 3PV6A 3DV4B 5GRVK 5EFIA 2CZNA 2CBPA 2XPGB 1A6UL 3CHOA 2DJUA 3QUYA 1IGCH 5DJYA 1V10A 3V4UL 4HLZG 2XA8L 4F8QA 1PYWA 1QFWI 3IPBA 1E8XA 3RTQD 1V7MH 4ZODA 3T2OA 1IM3D 1HQRA 3TONA 2VITB 4HAGA 1RXLA 5EOQL 3BZDA 3RTQB 1R3KA 4HOMA 4JNXA 1BPLB 1IM3B 1OTUC 1AAJA 1ZKAA 4WHCA 1N6QL 5GISH 3IGLA 1DLHA 1FN4B 1VDGA 3T09A 3V8CA 4BSJA 2WVVB 4PFEA 1F11A 3V4LA 4IIZA 4KU1A 3GSOB 4HWEL 5FGSA 5F7FA 3ZQXA 2ICWA 2DJMA 2JI3A 4GLRH 3BZEB 4GIOA 4WI2A 2CJUH 5DZVA 3QCTL 2B1AH 2C7UB 3R1GH 1HS6A 2YN3A 1XF2B 3GK8L 3FO1B 3QXTA 2NNCA 4XP1H 5F2FA 4ZTPL 5IHUH 4CADA 2QEJA 5KS9B 2EIBA 1RZGB 4JFXB 4CAGA 3KLKA 4WENB 3C60C 3L6FB 1S9YA 1FV1A 3QYCA 4ODXA 5I8KL 4LF3B 5FPIA 3HG1E 3LB6C 3O6ML 4B0MM 3RBGA 4U7SA 5L2JB 1B2WL 2DEWX 3AY4C 1K4DA 5ICYA 5JHAA 1Y7VA 3MCYA 3QQ4B 4EI0A 3MRDA 5KSBE 4OZFG 1OV8A 4NWUH 2FIRT 3SJVD 1XR8A 3ZL2A 4A39A 1HL9A 4WSKA 1XL4A 3WFEH 5DMGD 3V2AR 3TBYB 3UO1H 3FRUA 3WEBA 3ZQWA 3SJVB 2AFNA 3D09A 2X7LB 4XNXL 4UZGA 2HFEB 4Z7OB 1F58H 1SNRA 2P1YA 3UTPE 2BWDA 2E4TA 3MJ7A 3US0A 1H3GA 1XGRA 3VGDA 2X0UA 2H1PH 2FB4H 2WXLA 2BY3A 3BKYH 4X9IA 5E4AA 2CR0A 5EU6A 5F7DB 1DJXA 3FL7A 4N4YB 4OVUA 4TMPA 3P4LA 1WHPA 3T1WA 3TEZA 1GGCH 4M6OL 2B4CC 2QZQA 1G6VK 1U8LB 3ZDZF 4ZZKA 1FFNB 4K94H 3PP4L 1HAWA 4O9HH 4XC1L 2EJ1A 4I0KA 3U7YL 5JIHA 1L9QA 1S2EA 3CSFA 4PW9A 4ZFZA 2OCCB 2EEXA 4AMKL 5EU5B 3UPAA 3LVEA 3HPJA 3BSZH 4AKPA 3ZT6A 4DTGH 5FW6A 3FB7A 3WLWC 3ETBJ 3CNKA 2A6DA 3BIKA 4JCLA 1LEKB 1SYVA 3SY6A 2ICEC 4NWTL 3OMZA 4DWHA 3DETD 4OCYL 3WKPA 1AO7E 1N0LA 1WBXB 1GMIA 1W72L 3BEVB 5DK3A 5E4EB 4ZNEA 3QWRD 5E08L 4BQCA 3H6JA 3P1VA 1JUFA 5I0YA 4EE2A 4PJFA 1BWWA 1KGJA 4LP5A 4U4BA 5FUZH 1NCCL 2NXZC 3NJGA 3FN9A 2IANE 4XR8C 3TVMD 5JLZA 4YBLB 1ZV9A 5GSVB 4W9FC 2YMXL 2WLIA 3S8WA 4Z7QF 5DVKA 1U8HA 5F71A 1VFOA 2VERA 4ZPVB 4LNRB 4KY2A 1G1KA 4G8FA 2DM2A 3KXFA 4HEMA 4HIEA 2G75A 4F7CB 2ZG1A 3FW6A 3MV11 2IXQB 2XTJD 1L0YA 4I18A 1MPAH 3K2MC 5IV2B 1EEZB 2W9DH 2A6IA 2APXA 5EORL 3NCYS 1TJGL 2XTJB 1M57B 4ICWA 1JVOA 4FERA 3MFFA 2DQIH 4UAOC 5J3HC 5C0BA 4F7PA 3R0NA 2QSTA 1FNSL 4HEPA 4M5YH 4QXUL 5F8QC 4IIQA 2XXGA 1L6ZA 2OULB 3O4OC 5T1LD 1A6UH 1UH2A 1Z0NA 2ZUXA 5ISZD 5ICZB 4RNRB 3QRLA 5MEND 3VMOA 1KN2L 2ITDB 1JZ8A 4AVIA 1I3VA 1PG7H 4LPXA 3CPLB 3BI9X 5T1LB 4R7LA 3QUML 2OV0A 5ISZB 1H3XA 4X5WB 2IFFH 3AWEA 5MENB 3VFVB 2X12A 2YMTA 5IROD 5EOQH 3IJEA 1KIQA 1Z9LA 4JM0A 1KCUH 1EXHA 3FQRB 3TF7C 2FATH 2Q8AL 5K9QG 3OM3B 1N6QH 1ZANL 1BW8A 2PCPB 3EFFA 3HNSL 4MBOA 4PEEA 5CJOL 3U4BL 1U8JB 4MJ5A 2FK9A 2NNXA 3R0MA 5DEFA 4XP5L 2HUHA 1DN0B 1HJCA 2YEQA 2JJTC 4YWGH 4WCYL 5DS8A 3ARSA 3COOA 3FONB 3L3OA 1N2RB 2OR9L 1DEEA 1B4RA 5BXFA 3X1FA 4LLMB 1CF8H 1NFDF 4ZTPH 2VOTA 4F24A 2WLJA 4ZO7A 4P2OC 1PZDA 1WWCA 1AACA 4L4VD 2VDKB 1AZVA 3BVVA 3O6MH 5D5MF 3ZLQC 3C12A 2WY3B 4WU5B 4C56E 4F7MA 4QCIA 1I8UA 4L4VB 3FCGA 3P73A 4Y16A 1U8KB 2KZBA 4HLEA 5E2VL 1ZD6A 4W4OA 3LKOB 4DQOH 4HUWB 1BBDH 3IJ9A 2EDBA 2VR5A 5CLYA 1KT2B 4L1LA 4XNXH 1FHNA 3KBPA 1XFPA 32C2B 4FGMA 4LSUH 1HU8A 4LCIL 5C3LD 1BZEA 5DRZB 5C0JA 2GJ6A 4XNZC 3QAZB 3R4DA 2RR3A 2YAMA 4FQXD 4XNMB 3CIQA 4ENED 2CWRA 5BJTB 1UOLA 1DQLH 2CO6A 1ULVA 4HGMA 1WH0A 1IIKA 1HHIA 4PJ9C 4YUEH 5C0DB 5AW3B 3NGBB 5JIMA 1KNOB 4G7YL 3MRRA 3KJ4C 4M6OH 4KNQA 43CAA 2MOVA 2ZT9C 4M4PA 2GJRA 1NKGA 2I25N 3KYKL 3II2A 5LUMA 2V9QA 1BVZA 1AKJD 4XBEL 3PP4H 4YHPA 1GAFL 1QFPA 2B1OA 3FYEB 5C6WH 1DYZA 3LPWA 5IM7B 1SOSA 4PPTA 2C1OB 3RP1A 1PJWA 5JHDE 2BZ7A 3C08L 4E42A 3H54A 3FO0L 4AMKH 5B8CA 5JORA 3AM8A 1WK0A 3MRHA 4FE9A 1PZ5B 1MJ8H 2W0FB 1V3JA 3C8KA 3QWQB 1LP9F 3LD8B 2V2WB 3PJSA 2R29A 4PH8A 1R5WA 4RISL 4RMRA 2WUCH 4NWTH 1WUNT 2YRBA 3IGAB 2CBTA 2ODHA 4PJCB 3V7MA 4OCYH 2EXYC 3BGMB 5HHOD 3VXTB 2TSBA 3DPBA 1KXQA 1ONQB 1KWKA 1D5MA 1UEYA 1JZ2A 2EICA 2OSWA 5HHOB 3GKWL 3FF7A 4R4BB 3WYRA 1FZOA 2X4NA 3HAEA 5IK3B 2YMXH 3EOBA 5IJCC 3BT2H 1A21A 5G4MA 3BUBA 4OZFB 2ZUTA 3BZ5A 4MMZB 4K3DL 2FT8A 3DX7B 3L7EA 3E9UA 1FA4A 1E9QB 1UENA 4QRRE 1JZ7A 2I60L 1CURA 1CI3M 5F93C 1OPGH 5FFGA 2HVBA 5EORH 4K23L 5DJ8A 1UZ8B 3RWEB 3TNNB 4KI5F 4LGRB 5SWZD 3NZHL 2CCLA 4N9GB 3KHQA 2GTQA 4P4KA 4C4BA 3SN6N 3GUTB 4QIRA 1T03L 4HIJA 3EJJX 3SE4A 5SWZB 2DKUA 5FIEA 2Z31D 4HUMB 1QSFE 2X2UA 2YZ1A 3LJ3A 3CXHK 3UH8A 1IT9L 1KN2H 1MHEB 1TTAA 4M62L 3REVB 2V3DA 2X09A 2A99A 2Z31B 3ZZQA 1XIWB 1A5FL 1IKFL 4ZFFB 3VDCA 3PWPD 2WD0A 1YN7B 4OT1H 2Q8AH 1I53A 3U4BH 4HSQA 3WY2A 4XAWH 4KK9C 4ZXBC 3SPHA 4XP5H 1UJTA 1OGTB 2GEEA 4KXZH 1MLCA 4R2GD 3RNQA 3UTQB 2WLHA 3MBEA 1CU4L 5AUMB 2CGRL 4WCYH 3UBXA 1HL5A 1VPOL 4R2GB 1TZGL 2GBAA 2PTUA 3MLTA 4FNLH 3OR7A 2X87A 1RUPL 2CRYA 2IFGA 3Q9QA 2SEBA 2JLPA 1CLVA 4U6VH 2ENYA 3N0PB 3RL1A 2QSCL 1W0WB 4RAVB 5IF0B 3RA7H 1A2YB 3VWKC 3S4SA 3ATEA 1KLGB 3T8VA 2JB5L 5J13C 5HDWA 2ZCKL 3SKJL 1U93A 5E2VH 4ZMPA 4WWPA 4ZQKB 3VXUE 1NFDA 2I9LB 2F61A 3O6FD 5IVZA 4X0KA 1K8DB 2V9TA 1UKTA 2HJKB 2PPFA 3U6RB 2MHAA 3O6FB 5D5MA 2FNBA 4N8VG 4LCIH 4HX1B 4AJYV 1KTCA 2PYED 4TQEH 4JRYA 2CK0L 4Q7DA 3BP7B 3FB6A 4CN6A 1O7DE 3EDDA 1U8CB 3B9KC 3HHRB 2WOYA 4WUUD 2PYEB 3VXQA 1F8TL 3CZFB 5BRPA 3P9MA 5DF0A 3VU2A 2GFBB 3KJ6L 3DBSA 1T1WA 4TVPD 3SDXF 1HHHB 4WUUB 5K1JA 2KQMA 4LOUD 4N0CD 4KRPC 1KJ2A 1PX8A 1NC4A 4C59B 2ZX8A 3VI3B 3ZNGA 3BPLC 3RDTD 1QATA 1TQUA 3HS0A 4OCMC 3Q1EA 1TEFA 4XBEH 5JHLL 4ZS7L 4F8OA 3DVGB 1EEYB 4QAWA 1G7JB 4GG6B 3CHRA 4JANB 1MIMH 3FFCD 3RDTB 1YEWA 3RVXD 3LSOB 3T0EC 5HY9B 4J28A 1JGVH 1XMEB 3UZQA 4Y5XC 3FFCB 5GRXG 1QPKA 1G7PB 4I1NB 4CGUB 1I3GL 2HX9A 1U3HC 3D85D 5ELIA 3K8MA 3LH2L 1I9JH 4RISH 4Y1AA 2NMSA 2K4AA 3FBQA 2KLSA 1F3JB 3D85B 3QDJE 1PX3A 1U8MB 1PIFA 3GBDA 3TCTA 3F05A 5AW0B 4DEUA 1VRSA 1G9NH 5CIPB 1Q9OB 1TIUA 3OZ9L 2VLJA 4IDLA 4M6NL 2WZ5A 4LDLB 1LP9A 2YLKA 4HWNA 2OZ4A 1HEZB 1E4KA 4ATWA 5KYYB 1PZAA 2N56A 4PVNA 3NDYE 4UF7C 1SVCP 3GJFH 3X14A 2ZWNA 1QABA 2JXMB 3MLWL 2AVFA 2P42B 4X5XA 3TJPA 3Q43A 3QRBA 3HPLA 1BSIA 1XDTT 3VD0A 4MZ2A 3JVFC 1O6TA 2I60H 3DJRA 2P44B 1ADWA 1WEJL 2HG5B 4L8SB 2RBLA 2WIIA 4NRXA 3U2JA 2PNDA 2YAOA 4YNYA 3ZYOA 3MV8E 3F12A 3EFDL 1T03H 4PUBL 4HCRA 4F33A 2AQQA 2B0SH 4N0UA 2J6EL 5DDHA 1L0PA 1T20A 1NWPA 3MRCA 4YFEA 5E6IA 1IT9H 4S1SL 2V2TA 4JFFA 1S7VB 4H44C 4N5UA 1CFTA 1LEGA 2EDLA 5B1JA 3P3RA 3B7YA 4NO5A 2H0PA 2CGYA 3Q2NA 4E5XA 2FLMA 2ROXA 1KDIA 4LVOB 4OW6A 3TYFA 3A6CH 5D7IE 1RD6A 1OWWA 3IS1X 2BOBB 5FA4A 2OSLB 3J7HA 4QHNB 2PR4L 3POCA 3JTBA 4KK6D 3TJHC 4AX3A 1NGYB 3ZU8A 2FIKA 2PF6A 5DRXB 5D6CB 3H9HB 2FEEI 1VA9A 4TYUA 2V2XB 4J3OC 3OVUB 4NLHA 1I8MB 2H5UA 4JQVC 1G9MC 3PABB 2IAMA 4PJBF 4L3CB 5BZDB 3RWJA 1IC1A 1QUNA 2C3WA 4GKOA 2MCPH 3RZCC 2G4GA 3EDFA 1XGYL 4Y2DC 5CJBA 4YDKL 2WYTA 2YRZA 1QSZA 2DLFL 3SO3C 3H6AA 2BVUA 2W07B 4KJPD 3TYGL 3CFDA 1I7ZA 3HR6A 4NKOA 1X9LA 4M8RA 5T1KA 1ERNA 3LS5L 5EO1A 2M26A 4P5KB 3IN0A 1JHTA 1RHHB 1ETZB 4F57L 4IBLT 4H2AA 3TFBA 5IQMA 5KBNC 5FO8B 1KJVB 4N0FB 5I73B 3ZTJH 4PS7A 1JGLL 1AHWC 3B3IA 1CZ8H 2FYVA 3NBNA 5CP7A 4R4NC 2BS8A 4LLQB 3DC0A 5HDQH 3DECA 3FUJA 2R8SL 1MWAB 3WN5B 2E9JA 1I8IA 2Y1YA 4ZYKA 4PY8I 4FXGC 1QR1A 3J07A 3W2DL 3WTSA 3CDZB 1RJYA 4HULB 4UIMA 1BJ1H 1SDDA 3SB3A 5IQ9A 5HJGA 3DX9B 4PJ8C 5AW6B 4GMSH 3IETB 1BEXA 3MX0B 1J8KA 3V6FA 3SGDH 1NLDL 5LCVA 4LXFA 3RTQA 4ZX6A 3S9DB 3SDXA 3QUZD 1UXMA 2CMRL 4QRSB 1TTUA 2P8PB 2VJ0A 4EOWL 3CD4A 4MDIA 2Y06H 1FN4A 4OGXH 4R7NA 4JDVB 4MMYA 3QUZB 3V52H 1XXFC 2J72A 3LOWA 4OLXL 1Y6NR 4QWWC 5E4IA 5K9JL 4MS8C 5DC9B 5HDOA 3DTXA 2CCVA 2H26B 2WLMA 4KPHL 2D3LA 4NGHH 4AQOA 4ETQB 3UTTE 3LKQB 4NN6C 4PWGA 4RRPA 4TUOB 4GJTB 1RIUL 2NY0C 5ITBH 4DCQB 4Y5YB 1RZGA 3GMLA 4KKAC 4MNQE 4MB1A 3JWDL 1DSWA 3MXWL 1RK7A 4PCTA 2BW4A 2A77L 5A6MA 5L2JA 3VJ6B 2ED8A 4YSAA 4QLRA 1D5XB 5AB2A 5T3XD 4IHBA 2EC9T 5IOKA 1WGOA 1JSYA 2HKAA 3FK3A 5INCB 3U1SH 3I02B 3K6OA 1B4JL 5TE6L 5B1CA 1LO2L 1MY5A 2VZVA 1D2OA 3FNKA 1WEJH 3UBXI 5C0AD 3O3BB 4N8VB 5J6HB 1U95B 1ITCA 3MGTB 4OZIF 2WBXA 4JG9A 4MCZA 2NYYD 4NQTA 1GZQB 2X7LA 2O5YL 5HYSA 5C0AB 1NBZB 1NEZG 5DJAA 3VFNB 1AR1D 4HUVB 3T5WA 2NZ9C 3SBQA 1U6AL 4Z6AT 3OKMB 3PG2A 2VJXA 1HX0A 3ROOA 1AR1B 5DR5L 3W11C 2J57A 4Z3IA 1CXEA 2ARJB 3T1FA 1CDJA 3MNVB 1RJLB 1ZIAA 2BPBA 3RWCB 1BMWA 5IW6A 3J8F7 1DBAH 1KIUB 3I6SA 3SYCA 4GQPH 2NY7H 4WTWA 5L7XL 2OJ1A 4PP2B 3VCLA 3QFDA 4TF4A 1SHXA 2GG1A 2GITA 2MWCA 4X8JB 3VXNA 4KZDH 4YSEA 5BS0B 3NK3A 5KANI 1F4YL 1DQML 3SDAB 1S7UB 3CSYA 4FLRA 3FQUB 5CGTA 1DSFL 2NT0A 1AMXA 3KPSE 3KPQA 2FBOJ 5F1KC 3KBHE 1KFAL 1XGYH 5I74C 3ESOA 3UTOA 1MF2L 2EIJB 2JQMA 1T89A 5AOJA 3PGFL 1D7DA 3C8DA 4IS6B 4JM4L 4EDWL 1P6AB 1BQHA 3EG9B 3PNWB 3LKRB 4LLAA 4I3RL 2JQAA 4QT5B 5E5MA 3ULVF 4IBVA 3ASWA 4PJBA 3ILPA 3O6KH 4HWBA 1YN6A 3RAJH 4RLDA 3T3MF 2ZXQA 4EVNA 1P2CA 4OZGB 4BH8B 3D51A 4KNUA 4D7BA 4Z7NF 3TVMA 2BVTA 3X3GL 4F2MA 3H7BB 5CJ8A 3EO0B 2HKHL 2J8OA 3HG4A 2KPWA 4F57H 5DEGA 3K7UA 5SV3A 3BD3A 4E0RB 4B7LA 2VISA 2COQA 4XGZA 4D8PA 1F18A 4FFVD 1AXIB 3NA9L 2NX5E 4LIQL 4JFED 2PYFB 4XI5C 1JGLH 5L4FA 2PXYD 3T6QC 2VLLB 3PQYA 2NY2D 3PPSA 4HZLA 5F8RC 5E8PA 1MSPA 3L2LA 4JFEB 4B9GA 1P5UB 3OC8A 3ZKJA 3WLBB 3OR6B 2H0JA 3U25A 2Q7YA 4RWHA 1ORQA 2P3YA 3D52A 2CDFB 3UZEC 3W2DH 2UY6B 5IR1B 4HOXA 5D9SA 3BO8B 2ESVD 1BDYA 1CT8B 3BMWA 1Z2KA 2BOCA 5E2UH 5I6LA 3FHQA 2IPUK 2XZAL 5ISZA 1PVHA 4UUJA 5IHBA 1ZT4B 1YPZF 5B7EA 5CSZB 4NQVB 4HP5A 2YR3A 2X70A 2AXFA 2CMRH 3WXVL 1E6JL 2PW2B 5DHVH 3PAYA 4GRWF 1GJIA 2NR6C 4WSJA 3A67L 3NJHA 4NQED 2ENJA 2OMWA 4OLXH 3VNZA 1VFBA 2IWFA 4MD0B 3WNKA 5KBKA 4MXWL 2IH1A 5K9JH 1K4CA 2EYTA 1I7UB 5TK4A 4NQEB 2XWCA 4XN1A 5C0CA 4KPHH 1CC3A 9PCYA 4H5SA 5DMIH 2ZUUA 1OOAA 1RIUH 1MKFA 1UACL 2HPOA 2XZZA 3LKSA 2EUWA 4YDLC 1CJYA 3JWDH 1GIGH 1M3JA 3MXWH 1PCXA 2FX8L 4AJWA 4X6CB 1B3JA 3D3VE 1I7TA 1G43A 1IM9D 4BQBA 4DVRH 2HLEB 1D6EA 3KLDA 1BLIA 4C58B 3JWNC 3WD5L 4QD2E 5SX4H 5HHPB 3SOBH 1IM9B 1LO2H 5AVWB 4KK8C 2BY1A 4CDHA 3C5JA 3S36L 1KT2A 4A2GA 1AGFA 5IVXB 1C12A 3EIFA 3O41A 1HIML 2O5YH 4FFZH 4LEEA 1OL0A 1RUKH 3V0DA 1RUAL 5DRZA 3NEOA 1KXTB 1U8NA 3SYQA 1FNEA 4JVUA 1S7SB 2FJSA 1N70A 2R1YA 5DWPA 1REIA 2FZ3A 4FQXA 3UBXG 2H32H 1RZFH 4YHLH 1CFQB 1RZIB 5JUEL 4OZIA 1NQBA 3Q8CA 4WV1C 5F44A 4F3FB 3O8XC 2YARA 1RK0B 4NNXA 2D4FA 2H1XA 4N1CA 2NQDA 3Q6FB 4KZCA 4OJFH 1T4KA 2IQAA 4OZ4B 4TQ8A 2XZCL 4RAUA 3EADA 1AKJA 1BD2A 2QQNL 1WHOA 2Q1EA 2QADD 4KOCA 5DJCB 4ZS6D 5H35A 5AEAA 3DX6B 1DQMH 4PJAF 2YD4A 2QADB 3FT3B 4JHWH 5FYJE 5MI0C 3DTDA 1QWHA 1Q72H 1HXKA 4LNVA 5F0MB 3K91A 4ZFGH 4WTXA 2AITA 1LQSR 5ECGA 2DIBA 2FR4B 3PGFH 2YAQA 5ECJE 4BA8A 2K6ZA 2ILLA 4PGZA 3QR1A 4IOFC 4OKDA 4OVVA 5I75B 2HA1A 5KANG 2YPVA 4B9PA 1PQZA 1AD9A 3MJ9L 1Q1JH 2FSEA 4N22A 5AKVA 1MRCL 3LEYL 1XF4A 4CVXA 1OK0A 3HN3A 4MMZA 3X3GH 2G2RA 2X4UB 2HKHH 2ENQA 2XKUA 3PWJB 3L8QA 4PJIE 1JXJA 4IBWA 5C9KA 1E9QA 2DI9A 5DO2C 2X9WA 4JE0A 1M1XB 4YZWA 1BXUA 5CD5D 4JAMB 3RVTD 1YA5A 3DX2A 4GQZA 3VYNA 2JKNA 1HNFA 1M71B 2FEDD 3NIGE 3OAZH 4J4PA 5KYNA 2AVGA 2CQVA 3VVWA 4EJ1C 2YEZB 4CNIA 3P4NA 4P57B 1BQLH 3Q3GA 4AIEA 4JQIA 3SE3A 4JJ5A 1ZOXA 1VIWA 2BC4A 2IH8A 3K8LA 5DFVD 3OLGA 2K7QA 4CJ0A 2BSRA 4DK3A 3B56A 4JFZH 3ULSB 5CJQL 5EZJB 3D0AA 4FZEL 3GRWL 3HI6L 3OSKA 1FFRA 1E4JA 2GSGA 1Z9PA 1ZHNB 1T7VA 5EG6C 3WXVH 1WD9A 3KM2A 3PWPA 3QO1B 1FQ9C 4KDTC 3GSNA 4WNQB 2HAZA 3A67H 3FQWB 3GZPA 4FMFA 5TPWL 3WS6A 1OGTA 6PAZA 3DXAB 2K1MA 4MYPA 1CLZL 3V4VB 4GKNB 1EMTL 5MEQB 1XB3A 1YPZA 2V5RA 4DP4X 2QVFB 4AVJA 1I9RL 5KUMA 5I1GH 2N01B 3TN0B 4HXAH 1PKQE 1MZYA 3AMLA 3EGDB 1ROCA 2OZNA 4I5BB 1MCNA 2WXOA 4NDMB 4OLVL 2YKLL 4RVBA 1NCGA 5GRUH 4D0BB 2AQPA 1LO3H 4NC1C 3UTSD 1QUPA 3WD5H 1S78D 3TBVA 3UTSB 3OKDA 2P4AB 2FEJA 4CC4A 3S36H 4FD0A 2EEBA 2HJKA 1TEGA 3IFOB 4PI2A 4CU6A 1ZLSL 1U30A 4P4RB 1TITA 4HX1A 4NO0A 4BXVA 2HFFB 1RUAH 5F1IA 2W5PA 4NP9A 2B14A 3ZTDC 1S7RB 4D9LH 1S3RA 2PYEA 3ZDZB 3PRZA 3ARDD 5GS2H 2CSPA 2AABL 4ENZA 3LXCA 2R2HA 3S88H 1IQDB 4ZUUA 5LXGH 1E4XL 4UOQA 1MJJA 1J1OH 2HX8A 4FFYL 2MCMA 3US9A 3ARDB 5IMMA 3DIFB 3IDIA 4HOZA 3L2MA 5J0BA 4OI9A 3GJFK 2YXWA 5DZ9A 3X17A 1BFOA 2EVIA 3N44B 2P80A 2XCMC 4UMGA 3G08A 5D7KD 4KKBC 3AXLB 3LSOA 5HY9A 1J48A 2XWBB 1XHHA 2IF7A 3QP3A 2WBWB 1WUZA 5CJXC 4FQHB 5EBGA 1FLRL 3QHFH 3QORA 1U8OB 5E1QA 1F2XK 2R15A 4FQIL 5F7EH 4AENB 3MNZA 3NCXA 1CXFA 5BVPH 4GAAA 3WFBH 1INDL 3L7FA 1PTZA 3FCBA 3C87A 4I48A 2DMBA 3RWHA 2A4EA 1WO2A 1IAIL 1YSOA 3ISRA 3OZLA 4G1EA 3H42L 4PV8A 5BRQA 1YC8A 1MCQA 1F3JA 3BW9B 5EUOB 1U8MA 1AKPA 4UTBA 4ODVL 1KPVA 4P9HL 5CIPA 4YC2C 1EHNA 5AD0A 5BOJA 3M1OA 1J1PH 4PJAA 1CGSH 1F45A 4HH9B 1IVLA 5IHZA 3NFPA 2Z0UA 4ZQTA 1A7QL 1BJ8A 1Q0XL 1PZ3A 1JTTA 1BOGA 1R33A 2QGEA 1HEZA 3KBEA 2VDOL 3QZPA 3H9ZA 4XPFL 1R3LB 4E9YA 4IBQA 2UXGA 1IUZA 3UTZB 1DBML 3LN5B 1FAIL 2W65B 2XN0A 2Y0SA 2WVUA 4L23A 5J1TC 4QPEA 2OXHA 1FZMA 1VSCA 5FV1L 4PRDA 2XOTA 3VFOB 3VSTA 3DV6A 4FHJA 4WWKD 3MRFA 1AE6L 3O4LA 3QFJA 5EB9A 1L3NA 1JHLH 3L3IA 4H0LC 4PS4H 2XJKA 2Y2WA 1MCOH 4WWKB 4JG5A 3GB7A 4OBSA 2XN9D 1ZWIB 4MJJA 5AVYB 3F04A 3KVDD 4P05A 4ZMNA 3VH8A 1ETA1 4NHCL 3EYUL 3PYCA 1ND0A 2XN9B 1F56A 3OG4B 3DO7B 5GGSB 1S7VA 4FZEH 1KELL 3GRWH 5KSAD 2JNZA 2BNUB 2D7PA 5BO0D 2NW3B 1GGTA 3EYVA 5KSAB 5EIIA 5IP4A 1J1XL 1FC2D 4Y5VB 3OKOB 5TPWH 2OS7A 3H9HA 5EU6E 5EZLA 1CLZH 4KO6A 4PWEA 1EMTH 4MSWB 1A9EA 2PCXA 1OLLA 5FLVA 1EH9A 5FKAA 1LXMA 3VTMA 4QF1B 1ZCRA 5TGBB 3SGEI 2D73A 3GTNA 1A4JB 1A65A 3BGAA 2BHUA 3KEDA 2WCGA 4Y4KC 5IB3A 1E8YA 3VE0A 4P2QD 4OLUL 5HYSG 5JIPA 4JE4B 4PQXA 3PWUA 1LILA 4MD4B 1JOIA 1PPIA 3FPXA 2YPLD 2A74A 4UQDA 2NY6C 1QG3A 5E2TL 5HDBF 1CGVA 3CQQA 3LXAA 4F37K 3DO4A 1P84J 2YPLB 4XVJH 5E0QA 2ZAGA 3FT4B 4JFPB 2QMKA 4O02A 4ZNEE 1NBYA 4MAUH 4NQSB 4P46D 1JGEB 4RRPM 3QDGD 1ZLSH 5KBMA 1G7QA 4PJFE 1J0IA 5EBLA 1BQKA 4P46B 4LPCA 4HJGB 1M05A 4KMLB 3QDGB 2DYSB 2H2PD 1YNKL 1KTRL 5CSGA 5F7BA 1KGIA 2QQKH 4EKXA 4IRSC 3S34H 3RY6A 4CW1B 4WKXA 1TQBB 3DI2B 2WB1A 2AABH 3BEWA 5L9DL 1UWFA 3K1KC 1LMIA 4HEME 4UT7H 2DQDL 3KXFE 2ZAHA 1YNTF 1QHQA 1H3UA 2WJ7A 4C4KO 3ELQA 7TAAA 2P7TB 5HGBA 1SYSA 2MQGA 4LEBA 4JDZB 5E56A 5C0BE 4MQ7A 3NRPA 3FH7A 1IGIH 1M7XA 2PW1A 5AAMC 2MQ0A 1YLBB 2BRRH 4G2AA 1H9VA 1B0RB 2BIOA 3PS6A 1OAZL 1N4XL 1YEKL 4FQIH 4JMNA 1O75A 4IKKA 3NMEA 1INDH 1CDIA 5ACZB 4WLCA 5D2LF 4GSUA 4PI0A 5I2IB 5CR8A 3QULB 5ID0A 1G7IA 2IPKB 1H5BB 5MP6L 2J55A 4ODVH 5FF6B 3NJIA 2EE2A 1IKNA 1EFQA 2H6PB 2MQCA 4WU7B 2KT6A 2NSQA 2HKFL 5E8NB 3VFGL 1ZGLM 2ROYA 3WSQH 4ELKB 4Y5YA 3GUFA 5FECA 3ILQD 1U58B 4IDJL 1BIHA 5F7UA 3G6DH 3L5JA 3B9DA 1UA3A 2XFGB 4XPFH 5TJWK 1DBMH 3LDBC 4Z7UF 4ZRGA 1FAIH 3NSJA 2HX7A 3P3TA 3GSXA 3WS3B 1RZKL 2G3ZA 1MY7A 4NCDA 3RB5A 4ZJ9A 1RL1A 2B08A 3QEUB 3SEPA 2X1XR 1FRGL 3U30B 3F5WB 3I74A 3J2PA 1VF5C 4YEFA 3JTSB 2CLVA 3Q01A 5C09D 2X44D 2MPAH 4YN3A 5FXCH 4CN4A 3GC3A 2DWEB 4AL8H 2BNQD 4NHCH 1KBPA 3EYUH 5FUCC 1O0VA 4EZKA 4JCMA 4UILH 4OQTA 2AEQL 4K7PX 4JFOA 2ARJA 5D2NB 4AJVA 4G82A 3G5VA 2ICWJ 3DHMA 3ARBC 4JFTA 5IIEA 1CDYA 1RIVL 4AY0A 2K9FB 4IKLA 4B27A 5CCJA 1FVDB 2CLRB 5I19H 2XU9A 2GJ6E 5AVUB 5FOBB 4Z77B 1BBJA 3KPPB 4MJ6A 1OZTG 3GXTA 3C60A 3HE6D 3UAEA 2BSSB 1Y18A 1DANU 3V6ZA 4JEGB 4ZUTB 4Y88A 4AGOA 4P06A 2EIZA 2H4EA 2IH3B 1J18A 3H3PH 2J8UF 3HE6B 3MI6A 3IJ8A 2BHYA 3BH9A 3UACA 4A6YB 4OJEH 4F8TA 1SXBA 1FFQA 2DW5A 3FQTB 5H2BB 1I3UA 2IPTL 1WA2X 4OLUH 4R9HA 5F7YC 3MTRA 1CDUA 4RSVA 4EIBA 3IJSB 4GLRI 2OA9A 3MLZL 2F54B 5E2TH 4UQEA 5FYLD 5DD6B 2AJXL 4HAFA 1MUJA 4ZMXA 1EK3A 1X5MA 1HJBC 3QI9D 4IOIB 4FA6A 4FZ8L 1H6FA 3P4OB 5LNDA 2F1AA 3L3DB 4DKFH 1T0MB 3ATBA 4EQ2A 1KXQE 1TKWB 4RIRB 1XB8A 2YLHA 4ZI8A 4MA7L 4BE6A 2ZPKH 3TOPA 4GW5A 1EPFA 2YOAA 2K6WA 4G7VH 3AQDA 4XTRD 2CUHA 3ABZA 2PXYA 4WI9A 4YSPA 4GINA 4PLOB 3VI4F 2GHWB 3HZMA 1M6OA 4N2FA 5D4QA 4IMKC 3BLKA 5C8JA 3PL6C 2ICEA 4WHTB 4IGBC 2KLRA 3DOIA 4N2MA 4OIIL 5IEKA 3LEXB 3IVKB 5C71A 4N6RB 4Z7QE 5E8DL 4PB0H 2ESVA 2WXNA 5F9WC 2QHRL 3T9WA 4N8UA 1OAZH 3QS2A 3UJJL 4P2CG 1YNTA 1N4XH 4PJXF 4RMTA 2PW2A 2YRLA 1YEKH 3TA3B 3TV3L 4DOHB 5KYXB 5K1NA 2ZCLH 3WNJA 1LEIB 1Q9WB 1YUKB 1IGJA 4JKKA 4HH8A 4AGMA 1KV3A 2D7OA 5MP6H 3TTYA 5GGSY 4XNBA 3T0BA 3WFDH 5AW8B 4D0CA 2G5BB 4ANVA 3VFGH 1E9PB 4PP1D 5E6UB 5TDOB 4U6HA 4P5MA 1KOAA 3IMTA 5IW1B 5A2CA 5D2LA 1AXTH 1TQTA 3FQXB 3CZNA 4PJGB 3CBKB 1S9VB 3HG0A 1USQA 4HPYH 2H41A 3JSSA 1GTFA 3OAYH 3MRNB 5A2BA 1RZKH 2XT1B 5L4MA 5FOJA 3CFKB 2KMWA 3SQBB 2JKWA 1OT2A 1TEYA 2NSXA 1JYWA 1VADA 4R26L 3GXFA 4Z8FH 4Z3EA 1JJUA 5I8CB 5IMOB 2AJVL 4Z7UA 1DTUA 4WNSA 5BNXD 3LRLA 5GS1C 3MMEA 1ZS2A 1SM3L 2YUXA 1NFDE 4XNDA 4MLSA 2AEQH 2P24A 4MJHA 2JJTA 3Q48A 3BRFA 2UWEF 3ESPA 5J89A 3KW8A 4NN5B 5D5ME 4WDIB 1YEDA 3CMOL 1FDLH 4JRYE 1S5IL 2R2CA 3LPOA 1HI6B 4OCSL 2J73A 5E9DB 2AXHA 3DROB 4OZ4A 4PR5A 3U0PB 1OALA 3KS0J 3MUUA 3PV7A 4NS0A 1MLBA 2Z4QB 3X1NA 2XXMB 3MJ6A 5DK2B 1RK1A 4Q6KA 4J7RA 4QXVA 4NUGL 5I71C 3HS8A 5D4HA 2HZHA 4RH4A 3OAZK 4IJTA 2RAMA 2Q7AA 1EWHA 1LLAA 5T5NF 4TKWA 6TAAA 1CL7I 3WEXA 1K3IA 1AGBA 4HC1A 2LHAA 1QRKA 2IPTH 1PG7X 2ZX9A 4YDMA 3LNDA 4X9YA 4RMWA 2CJSA 1NAKL 5LJYH 3CZEA 4YE4H 1MNNA 4FHBD 3H55A 3VTTA 1BGXL 4M1GL 1QFOA 4AGLA 2ZP0T 4FDWA 2JK5A 5I8OL 3CAFA 2AJ3B 3V5HB 3DMMA 2J8UA 4GNKB 1RZ8A 4H25A 4X4XA 4Y1AE 4JJHA 3C6LD 1FL5B 2AHIA 1W0YT 2CH8A 4MVBC 4U49A 4PJ9A 5CILH 2V33A 1P84K 3C6LB 3W38A 1WS8A 4OFIA 4MA7H 3N85L 4HUNB 2W9EH 4TTDD 2VLJE 4H1LB 3K4ZA 4EBQL 1LP9E 1P1ZB 5E51A 4NIYE 4LCYB 1AZRA 1OM9A 5I5JA 3R06B 4F7EB 1T66D 2X2HA 5G4OA 3QC6X 1ACZA 1Z5YD 1IGYA 2V5YA 3EYFA 5GS0C 3CLEL 3MV9B 1F3DJ 4P07A 3WG7B 1SXSA 1VFAA 4O58L 1V7NL 4ZSOA 3HB3D 4GIPD 3ULSA 2J1WA 1PZUB 2J3SA 3ZE2F 4Y9EA 1WFUA 1NC2D 1IBHA 5KVFE 3HB3B 4N87A 1ZHNA 1HKLL 4M8QA 1NC2B 3HE7D 1I8LC 3AAZA 3AREC 4FN0A 3TV3H 2EKSA 2AAVA 4N0UE 1VKXA 1IC0A 4ZUVA 1R34A 2HTLD 5MEOB 3BDYH 3DOSB 4JFFE 1UD2A 5LGYA 3CVBA 4GKNA 2VDLB 1I9IL 1SMAA 2P49B 3IE4A 3SDYH 3FTSA 5B3JF 4IJ3B 5D96C 1QVOA 2OMVB 4H7VA 4HZAA 3DX3A 1WAEA 4PJXA 3H53A 4JMXA 2VB5A 3U4AA 1IGFL 4JGHA 2CKNA 1EERB 4F92B 4D0BA 1WWWX 4LAQL 3HC4L 5C1MB 3KBFA 2VDRH 3UBGA 4GQ9L 1CD9B 2ADJB 1E2ZA 3GMRB 2PPAA 4XE0A 5IBLC 2Q8BL 3ZDXB 4J3OF 2NCEA 4RDBA 4TPRL 3TX4A 2CKBA 1BJMA 3FUHA 4AQ1B 4BUHA 4YVNA 2XI9A 3U79A 4K5PA 2OM5A 1VCBC 2F5AL 1T7WA 4R26H 4AKQA 1SXAA 1N5YL 1QA9A 1SBBA 2C3XA 4Z0BH 5F6HI 4XOBA 1U21A 5EIIG 4QRBA 3THMH 5TD4A 4NKDA 2R69A 4DO4A 3S3BB 1NCIA 2D3JA 3N41B 4BH7B 4KVCH 5HYIA 1HHGA 2WQAA 3NTCL 5KSUA 4G9DB 1CYXA 3J27A 3V0EA 3IMUA 3GFUA 3O3UN 1KBGH 3CMOH 5AZ2L 2CDGB 4JLRB 2X53A 3EJSA 4AXWB 1S5IH 5ERWB 3L95B 4JY5H 1C7SA 4RGOH 4E9XA 4XO4A 3HC2A 1FBIH 2QVIA 5A43C 1ZEAH 2EDRA 3GTTA 3EOTH 1QBML 3EJTA 5GIRB 1DUZA 3VWKA 4FQJH 2CHNA 4GI8A 1P5VA 4ETYA 5MHSE 2DM3A 2DQHL 1EO5A 1JS4A 5C08D 2BIIA 4XVTH 1QW9A 1ACYL 2UZXB 2UWEA 2X4RA 4AENA 2A9CA 1C5BL 1HH6B 3Q8FA 1JZ3A 4MFHA 4HKBB 4YHOH 1OSPH 3L5XH 1X5JA 2Q86A 5DJ2A 1IL1A 1BGXH 3JQOB 1BVLB 2ZOOA 3U46B 2I69A 5LGHH 1G7MA 3OB8A 3SDXE 3AZUA 1KCWA 1G7LB 3B9KA 3GXDA 4GAJH 1EO8H 4QY8B 3BPOC 4ODUB 3Q2LA 4PGDB 4I9WD 3N1GC 3IMSA 1ZHKA 1J9SA 1JZDC 1TJHL 1R3HA 5D7EA 1RKRA 3B9EA 5DJDA 1HYSD 4P3CL 3SE6A 3N85H 1VESA 4PBDA 5BRZB 1KG0A 4GRMB 4P2YA 3QWOB 5EU4B 1FSKB 3KPNB 2DQ6A 4B9ZA 1ZDQA 3JUZA 4WGKA 4KZEH 3PCYA 1AS6A 3LNGA 1W0VB 5DK0A 2VDKL 4YEEA 3KGRA 5B38B 1MFAH 2XBTA 2WSKA 4FF9A 2AJSH 2V3EA 4OM1L 3CLEH 1N59B 1YZZA 1A6ZB 4O58H 1DFBH 3EYSL 4BZ1H 2XN9A 3ZDYB 3BH8A 2M1KA 2R4SL 5CBEA 1MFVA 2FX7H 2GQHA 4QMEA 2NUPB 4JM2C 5EO0B 5BZWA 2MSPA 5DWUL 2X5PA 3GZQA 4M7JL 5IKCA 3MROB 4RX4A 5D1QC 3NSFA 1IEAB 2YBRB 4Y5VA 3OX8A 2DPKA 4AE0A 1FCCA 1NEUA 3GSUA 4LL4A 3BGFC 1I1FB 4NN7B 5IHLB 3L3JA 3CQPA 5SWSA 4DHLA 4R84A 2HT3C 2OTWA 1IFRA 2UY7A 2OTUB 4LLWB 5TGBA 4Y2NA 3ME0B 1KB5A 1NPUA 4HV8B 3RVUC 5JMRA 5KSVB 3UPRA 2VXQA 4OJCA 5E95B 3QVAA 1IGFH 3VYOA 4L2YA 4FXTA 3QG6A 3QPQD 3LIZH 1PD6A 4LAQH 3OXSB 1A7NL 4GUCA 4V33A 5D7SL 4LCCA 4P2QA 1QEXA 2AMUA 4FADA 1NCAH 3G6AB 3IJYB 4NBXB 2GUOA 1AG6A 1QQDB 1XZ0B 2ZKMX 4PWHA 4JFQA 3MLVL 4TQIA 2XPYA 4YR6B 1PLBA 3C09C 3OLIA 1ASOA 4TPRH 2VIRB 5KG9B 5KBPA 3TC9A 2APBA 3M17A 2FBJL 2JCCB 1S7TB 4OF5A 2XBDA 2BP5M 3BXNA 4FNSA 4PJBE 4PGEA 2WXFA 3CXDH 4BJLA 4KXCA 2XV3A 1O9VA 3EJYC 4PLKD 3WN6A 1LDSA 2MEJB 4XN7A 3RY5A 4F2ME 5EPMB 1FL6A 4FI7A 4JQVA 1TXKA 3DVIA 2NSMA 2CA4A 4DNLA 5K59F 1ESOA 1UT2A 4KJWC 4Y2DA 3PQYE 1ZY9A 5DEZA 5ID1A 3TO4C 35C8H 3NCCB 3SDCC 4IRZL 1AD0B 3WGVB 1ACYH 2IBGA 3BN9D 5AL0A 1NIEA 1C5BH 1ZTXE 4JQIL 3VGAB 4NNYB 3ALXA 3RI5K 2N7SA 3WNMA 3L1GA 3V0FA 4O2EA 5C0RL 2R59A 3PP3H 5ISZE 3TBWA 3BVWA 4KROC 2A9AA 3WKNA 4D9QE 4ZX3A 5KYUA 3HC3L 1K3ZA 4XVSL 3OHXC 5FGCB 3RX5A 3VB9A 3GIVA 3OF6A 1UVQA 4K9EH 4FCAA 4ELKA 5IMKB 1C08B 2JE8A 2QMJA 3ARFC 3C2SA 1BQ5A 5E2JA 5K39B 2DH3A 3BLBA 5LBGA 1N5AB 3HI5L 1BAFH 1G0XA 5CJ5A 4FXGA 4JZNB 5C0CE 4HDIA 4HK3N 1MAML 5D7JB 4P3CH 2N0KA 5DQDH 2OMUA 2VAAA 5I28A 5GZND 2VQ1A 2XWTA 1F0LA 3HCVA 1EQWA 2VDMB 2Z93A 5LNGA 1HWHB 2EABA 2VLKD 2VDKH 4WUKH 5FYKE 2ZYHA 4ACPA 5KN5B 1F86A 4Z5RB 1LYQA 4PJ5A 2VLKB 5L2KD 3CDGB 4UQ3A 5C09A 5AAWC 1WAAF 1QACA 2TRYA 2BNQA 5L2KB 4WF7A 2P47B 5FWQA 4Q9RL 2WV3A 2P5WA 4DKEH 3MRMB 2KQNA 1QZNA 5J56B 1EAJA 4UT6A 3EZJB 5D71L 4G8IA 3TBCA 2ODIA 1FVDA 2CLRA 1X5YA 4M7JH 4F20A 3KPPA 4WIQA 5D93B 3BQUC 4XCFH 4U1NB 2QGCA 1USZA 4PB9L 2BSSA 4QRPD 2P8MA 3BPNC 3K4DA 5T5FH 1LNUA 2XA3A 2ZF9A 4YHYC 2BHFA 4K5OA 4UYQA 1I75A 4OZIE 4QRPB 1P6WA 9CGTA 4HS6B 2XVKA 4TVPL 1JPFB 2DB8A 4GBXA 1RZJC 4JDTL 3QIWD 4X5RA 3NESA 5JA9A 4KJQD 5I6XC 1ADQL 1G6RA 1BD2E 2NNAA 2ED9A 3DURA 2KC0A 1XH2A 2DJSA 1A7NH 2UVEA 5D7SH 2VL5B 3CUPA 2Z7YA 3AROA 4HKXB 1EDHA 2WQVA 3HRZA 1ZHLB 1QFWL 5J9PA 4RA3A 3MLVH 2IADB 3UX9B 1A14L 1YMMD 3FZUD 5JPMC 4UTBL 4XMLL 1TKWA 3QI9A 2BY2A 4NRYB 2OL3A 1UJ3C 4OV5A 5E0FA 1YMMB 1I4FA 2XIIA 1IGTB 3P4MA 3UJIL 3EYOB 1ID5I 3UGUA 3PNRB 3MOBL 3MUGA 3WJJA 1FFTB 2B1HL 4PRID 4M9OA 2IDUA 3UPCA 1WCQA 4X4KA 1QYGH 4HHAB 4G9FD 4HMCA 4OZFH 3KLSA 4PRIB 2F74B 1UGNA 4G9FB 1UB6B 4LSPL 1PNCA 2B9AA 2Y1VA 1ZVHA 1TLMA 2Y5TA 2LU4A 4LASH 3OAYK 3W0WD 2EEAA 3T3ME 3IMWA 2WM0A 3U36B 3PJNA 4Z0XB 1KCRH 1QLFB 4K07A 4Z7NE 5GZOC 4QOKD 4IRZH 3TIEA 3W0WB 4Z95L 4AM0B 4M5ZL 4PGBA 3G5XA 1F4WH 4U3XA 4QOKB 4MMXC 3QARA 3CVIL 1WF5A 4FG4A 3OKNB 3LZOA 2VXVL 4L05A 3GINA 1U8IB 4LQFL 4UDTB 3PDOA 4LGPB 1V3KA 4JRWA 2J21A 2R23B 4K7PY 2FBRA 2XY2A 2WLLB 4HBCH 3TH4T 1M2VA 1MW2A 3HC3H 1EHXA 5HYQB 5JW4Q 2XTSA 3VFTA 1U91B 5AENA 1IFGA 1QFUH 3PWPE 4GO6B 4AWJC 4HU2A 4OCNC 5IEHB 3ZO9A 2R7EB 3NAAH 4QO1A 3RGVC 3U2IA 2HN7A 1EJ6A 1O6SA 3MYJA 3AG4B 4APQD 1IC7L 3IS0X 3E1F1 2E7DA 2D3VA 3DPDA 4G70B 2ERJB 1VZIA 1YPZE 4APQB 3IBEA 2BSED 1MAMH 3HMXA 4G3YH 3SY0A 4WHYG 3B6SA 1YC7A 4JO3L 2Z92A 2VJ8A 3KH3A 4GMTL 4PRNB 4PRPD 4PRHA 4AYSA 4GRWE 4GW1A 3F7YA 1NAMA 1DE4B 3BKJL 4IMLA 3IJ7A 4HCIA 2D7NA 3P54A 4PRPB 4AQ8C 4RZKA 4X4MA 4DVBA 3VXRA 4AJ0A 2WZ6A 2P8LA 3INUL 2ZWSA 2BVPA 2EC8A 2NR6A 4KVPA 1CGTA 1S8DB 3NYKA 3BESR 4ZAKC 4CC0A 3ZTCC 4S1DC 3EO1A 5C9JB 3VXMD 3C6SB 4Y19A 1Z5HA 2DIAA 2O5XL 3P9LB 3P77A 3ZMEA 5CWSA 2RJMA 3ETBF 4I7ZC 4AQEB 3VXMB 2RCSL 1MIEH 4X99B 3QQDA 1BWMA 4EN3D 4FJZA 5CAYB 1P6FA 5ADOH 4ISVA 3U9UB 2AEWA 2PYEE 1YUHB 4MCNA 3HVNA 1WAAA 4S2SB 3SYAA 4X98A 2OPCA 4EN3B 4UMSA 1P1VA 1MWAL 3V0VB 3FT2B 5AWNL 2Y7MA 3ZKMC 2EYRB 4D2NA 1UCBL 1FNGB 4NM8H 3ZGHA 4G7RB 4TVPH 3S8FB 5I1IH 1BXXA 1TZHB 1AQKH 2I32A 3OGCB 1KBKA 2C5DC 1T2QH 4DFHA 2Y72A 2ZOLA 1ADQH 4FP8L 4KY1L 4BRVA 3Q7JA 1SXNA 2K3TA 5I6OA 3WXWL 4XPGH 1FH5H 1JCVA 2L7EA 1V54B 1FI8C 3CBJB 3HLKA 1KC5H 1X3DA 3CWGA 4FTVA 5T1JA 2X2YA 2A9NH 4NO3A 1KCSL 3HKFA 1A4KA 2AKRB 1A14H 1BAGA 4C55A 3GO1H 2JB6B 1ZSDB 4WV1A 4W93A 3RWFB 1JTPA 3W9DB 3N9GL 4FLOA 1BIIA 1ID2A 4P0DA 4N8PA 3MR9B 4PJAE 1M4KA 2LU5A 2ZF8A 2CBQA 4YJZL 4OUOA 1OP5H 5CLZA 5GSRA 3MA7A 4LCYA 1MQKH 1VZGA 3QQ3A 1AIZA 3GMOA 4WI0B 1AY1L 2HFGL 5AG9A 1S7WB 2BP0A 4GW4B 2Y36H 1X4ZA 1WA0X 2H47C 2VABA 3D05A 4LSPH 5AOKA 3QUYC 3FU7B 5T3XL 8FABA 1UXWB 2GTZB 1DQTA 2Y25A 3O4LE 2GC4C 3QFJE 3FYIB 3S35L 4JS7A 2X0WA 1G1YA 1R5VB 2CHWA 5FO2A 4GP5B 4NUQA 3AQZA 4CMMA 5DU7A 3FN0H 3QIUD 4AUYA 1JNHB 4L1DA 1U4FA 5DVOA 2XQYA 5PAZA 4NJAL 3UL4A 3HE7A 3BAIA 1T5WA 4PD4J 3QIUB 3JWOL 1GCYA 1TT6A 4OQTL 5KAQF 1OGAD 3G5YA 4LQFH 5KVGL 1QSEA 3FO2A 3QEQA 4GSQA 2AI0H 3U0TB 2VMDA 1J05A 1OGAB 3HLAA 4XRCA 3FBKA 4AZ8B 4X6DF 2OMTA 4F91B 2E0PA 2GC7C 3ZMNA 4K5NA 1MEXL 1YEFH 3TO2B 4BFJA 4OU3A 3TZVD 3BRDA 3U0WL 1OCWH 1RPKA 4UT9A 2L7UA 3WHXA 1QW8A 3SZ6A 3ZZ1A 1CG9B 1H19A 2VGLM 4A7SA 2FWOA 2KS0A 1P4LA 4R6UA 1FE8H 4Q6IC 3II1A 4HK0B 3GMRA 5CP3H 3K6SB 2DEXX 3G5ZB 4LHUD 2YD5A 1HILB 4WGWB 3MUZ1 5B39A 1V5JA 2Y2TA 3BKJH 2IDCA 4P2OB 1MCIA 3CV5A 5FKPB 5EBWA 4LHUB 4WO4D 3K0WA 5A6LA 2DI8A 1AFVL 3O3DB 3T08A 2ZOTA 4WO4B 4FRWA 2EACA 3LQAH 4POZD 1F90L 3KLHC 2QKIC 1LE9A 5LQBL 2HCZX 3KYAA 3X1GA 5CCKH 1FZJB 3BH4A 3VFUB 5I9QC 4XMZA 2EDOA 3G04A 4BD4A 2RCSH 1C5CL 1A22B 1EVUA 5I26A 1NGZA 4KX7A 4MKTA 3RVWD 4JFDA 3V9EA 1I31A 4N1HB 1ZVSB 2IBZX 1TFPA 1QWUA 1U8QB 4NQDD 3MRIB 1MWAH 5C7XL 3CC5B 5C6TL 3D2TA 3KWWA 5D6DC 1UYWL 3AT9A 5LBSH 3RWDA 4P5RA 4XBGB 5ALCH 5F88A 3KJ4B 4NQDB 2C1PA 1E3FA 4PJHB 4HKBA 3O2DA 5AVQB 5C08A 3RUGB 1H3VA 4AW7A 1QNIA 3UBHA 4WTZA 3RX8A 3QUKB 2X3AA 4FP8H 2W91A 4KY1H 1DBJH 1GHFH 2X1QA 1BVLA 3D87B 5ES4B 1YY9D 1OB0A 1CXHA 4XP4L 2EUXA 4N28A 3ATAA 5E6SB 3SQOH 3NG5A 3H8NA 5EV7A 1F6AB 5GGUA 3RU8L 3VRIA 3ZTEA 4F9PA 1T22B 4J3OG 2EXYD 2YD0A 3BAYA 1LD9A 5J6GB 2WTRB 3FS9A 2FJGA 5GJTL 1FORL 1JGDB 3N9GH 1SY6L 3GPEA 3NSYA 4X2UA 2J7LA 4N25A 2OMNA 2GEQA 1EFXD 1TZ8A 2R0WL 3VI4B 3WIHA 3ZQ9A 1E9OA 1TSRA 2R2EA 5I1JL 4JQXA 3M7OA 3D48R 3TJEH 1A3RL 2X4OA 1AY1H 3LZPA 3S3PA 4RMQA 1Q9LB 2VZ1A 3K3QA 4GI6A 1JAEA 1JTOA 2BSTA 2LLNA 1B4TA 1A6ZA 3IU3B 3ZZLA 4XE5B 3K81A 1U92B 3KVQA 4GXUM 5KOMC 4I2XA 3DUSA 3HW7A 1YJDL 1ZT7B 4GRLD 1WIOA 1IC5H 4LLYB 2B2XH 4TS6A 1MG2C 2A6KB 3GHEL 1IB5A 4P9HC 4XX1E 1RUQL 4GRLB 4ZUWB 2E6QA 2K7PA 4ZTEA 3GNML 2DI7A 3WGUB 2ZUWA 1IEAA 2HJFA 4B9IA 4G71B 1IC4H 4UWQB 4BFBD 1O6VA 3SBWC 3V10A 5DJ0B 5KVGE 3GRGA 4WEEA 1CTNA 1BV8A 3L3OC 1P7QA 1KYFA 4FQQB 3F3HA 3D39A 3BUIA 4P2RA 5KTEL 5IFJA 4H20L 5JPNB 4XZUB 5I66A 1UM4H 2QPSA 4NZDA 4JPVH 5FGBA 2CUAA 3X1BA 4OV6F 5IJVB 2HVJB 4LKXB 1CGWA 1IAKA 4IQHA 3WUWB 2Q20A 2XDHA 5LHDA 4P59H 4TUUA 1EAPA 3DGGB 1FUNA 3L4VA 4W4OC 3VRLE 4X6DA 4N2OA 4QTFA 3H4FA 2Y6SC 4L9LA 2NY1D 5D1XD 1CFVL 4UV7L 5CU5A 4AK2A 1A7OL 1KGCD 1UD8A 1CQYA 2ALAA 3H0TB 4BZYA 1LO0L 1XBRA 2NY1B 3PP3K 2DWYA 4PBVC 3QDHA 5D1ZC 1EJOL 4FQCL 3M1BA 4PLJC 1QFHA 3BFWA 4FX5A 3ERXA 2EDDA 2JMRA 3QXAB 4CA4A 2OLDA 5JIIA 1OPOA 2X4PA 4UBDC 3WIFB 3V0HA 1F90H 3RTLA 1XV8A 3JZ7A 4IKIA 3RWIA 2IMMA 3RHWF 4CUCA 4FEMA 3IF1A 1PW3A 4TN9A 3RFZB 3ARUA 2Q76A 5D55A 1C5CH 4K3JH 1KGUA 5E2WL 4K9JA 2F8OA 4UM9A 5DLLA 4Y4KA 3FQ2A 1FJ1A 5HDBE 3K0YA 4DW2H 5IBUG 3MAWA 2H3NB 3IGUA 4J8QA 1D7BA 4JKWA 1FGVH 1S9XB 3FB8A 3HI1B 4WFEE 4PTUB 1M9SA 5HHXH 5IQ7L 5B8CC 4GI9A 1UYWH 1AQDB 1S7XB 2R1WB 4HPOH 4NAMA 2ZYSA 2WXJA 3IRCA 3S3DB 3UEQA 5IB2B 4YDJA 4HETA 1HXYB 1RVFH 3BPLB 3EGSB 2AEPH 1AH1A 2FSDA 4RMVA 4U3SB 1K5WA 3TBTB 1XGPB 1TVBA 4BRJA 1X5IA 4PJEB 1I7RB 1UKQA 1AGDB 1IILE 3ZHNA 1MZZA 2ESVE 1HTYA 3T0EB 3PU7A 4Y5XB 4XP4H 1HXMA 4GXUN 1MFCL 2J2ZA 3HS9A 1GL4B 1N64L 2OMZA 3L3HA 3QWNA 4TNFA 5I15L 3HJEA 1E5CA 1U3HB 3ABKB 3KPMA 5D70L 3NZ8B 2FX9L 3BSZA 3VXSD 2O6CA 1GS6X 2RACA 3D9AL 4ALAL 1FFOB 1K2DA 2FHBA 1RH8A 1SY6H 4LVNB 3VXSB 1ZT1B 2O6PA 2R0WH 2AQ1A 2FEEL 3IKKA 1CFSA 1ET7A 3NP3A 5D2LE 5C3TA 1TETH 5AAMA 3VNYA 2O93L 3M6DA 2Y5EA 5GZNA 1IVTA 3UOAB 3SPGA 1XH0A 3L5HA 4ODSL 5AVTB 3UYRL 3FAWA 4RA0C 1JPST 3RWGA 1RUML 3MLSL 5TK2A 5LAXB 1OTTD 1XH3B 3D4CA 1J9QA 2XRAH 1T83A 2VLRD 1QI3A 1PLAA 1CUOA 1YJDH 2FWLB 2D7TL 4PVMA 1GYCA 3CQFA 2MTAA 1TZIB 2VLRB 2G9HB 3U9PL 4BHUI 4Z7UE 3D07A 4TTGA 5JW3L 2R69L 3L48A 4EI6B 3ZRCC 2DTML 3Q44A 2E27L 3K46A 2VE6B 3VXOA 1NANI 2HWZH 4YHIA 2D31A 2X05A 2XVBA 4FA8A 3C5ZD 2KKQA 4PD4K 3SD5A 3LRGA 1IGML 4W68A 3FOLB 2GAZB 3IDNA 4OF8A 1IX2A 1OD9A 1RZKC 4D94A 4AYFB 3C5ZB 4R0LC 2BMKB 2BIMA 1BEYL 3AT0A 3CZKA 1JERA 1XCTB 2RMNA 5KTEH 3NABL 4Q97A 4V1DA 4JG1L 3L1EA 3VD2A 3UBFA 3ZO0A 4RDQG 3QIWA 2VL5A 4N86A 2CO7A 3GHBH 1WJ3A 3CZUB 4IU2B 4J6RH 4NT6A 1WPCA 1G7HB 3WU1A 3BWAA 3MNWA 4W9KC 1NFIB 2Z3FA 5DLML 1KN4H 2HLAB 4XH2A 2VZUA 4DGYL 4S1RH 3K2KA 1DJHA 2EC9U 4U3HA 5I6NA 4ZMTA 4GXVH 2JQZA 3HC0A 4Z76A 3ARBA 5FDWA 3IFPA 4UU9A 3DJZA 3C5SA 3H3BC 2FO4B 3IBOA 4RZCB 4QXWA 2VQTA 1KYOJ 3N2JA 5A40E 2N7BA 2J8UE 3OB0H 1YEIH 2EXWD 2I26N 2R27A 3FPYA 3RL2A 1YMHB 5L88L 1NLBH 1W15A 3UCRA 4YIQA 3JWNG 3JVGA 1X5KA 3ULUD 4G9FA 4YSQA 5E8EA 4DGUA 1HDMB 5E99L 4KKCC 4YH6A 1KTDB 4CKVX 4M7KL 5EA0H 3RIKA 3HNVL 4O4YH 4P23D 5ESAB 3GS0A 1D5ZA 2NY4C 1Z66A 3D08A 4ZOCA 5AVVB 2HLFC 4P3DA 4ONHB 1WFOA 1Z3GH 4L4TD 3WCYA 3FT0A 3TPKA 3BHBA 1JZJA 2V17H 2F53A 1L7IL 3MLUH 4FHKA 4QOKA 4PV9B 4Q14A 4WJG3 1NL0L 1JYXA 3HNTH 2FGWL 4ZSOE 2H32B 1ILSA 4UDTA 5I17A 3ASOB 3FC8A 1OSZB 1OF0A 1BZ9A 1KGYE 2WLLA 1RLWA 3W9EB 4BBWA 1B3IA 4OLYH 1F1GA 1BF8A 2VXUL 5I15H 3GBNL 4U1LA 3TIDB 4K15A 1HOCB 1JGUH 1ZXKA 2GCYA 3QXDA 4EI5D 3FO9B 4XVUD 2BZDA 4UAHA 1BYPA 3D0LA 5D70H 1ZLVH 3WNNA 5ESQB 3WFZA 2Z35B 4I0PA 3V4VH 2BFVH 3ML8A 3SCMD 1P4IL 3D9AH 4IMKA 5HJBA 3WNIA 4W9LC 4ALAH 4DUWA 1UWEH 2WAQA 2ATKA 4JO5A 3CZLA 1KB5L 4KXDA 3SCMB 4NN6B 4PJXE 4DO6A 2CDEB 3ES6B 1NGQL 3OHMB 1XF3A 2VN7A 3VA6A 3GMNA 5HJDA 1W72A 3ZTNH 4UB0L 3IGFA 3KL3A 5A6IA 1L0XA 4ODSH 4RGND 3VFPB 4MCYA 2XQYG 4DAGL 2FAUA 4I3GA 3MLSH 1H9DA 2ZP8A 1N8OE 4RGNB 4EZLA 5E6IC 4BSWA 2XXCB 1G4MA 3E8UL 1NCWL 2WSDA 3CVHB 3QO0A 3HVDA 3C6SA 5C9JA 4E68A 1NMCB 2D7TH 3ZYIA 3FCTB 4JKMA 5ESVB 1BFTA 4OSUL 3VXMA 2WLZA 3U9PH 4QRTA 1HQ4B 3JUYA 4GG8A 5DD5H 2IALA 1C1EL 4UOW1 4K3EH 1ZGLP 1IAOA 2HTKC 3C5XA 3QUXD 3W11D 3LRSA 1N8ZB 2BH0A 2Y7QA 4EN3A 1FVEA 5C07D 2CJ3A 3PWNB 3KDMB 3QUXB 1OP5K 1RZQA 1MFDH 1VGKB 4LARH 3PAVA 1IGMH 2UUDH 5C07B 4A2EA 2IAMC 3GHPA 4QHLB 4IU3A 1Q1PA 1AXSA 1D2PA 1B2YA 4RBPH 1UWGL 5EBMA 5G4NA 5B39G 3UG3A 1A1NB 3OGCA 5I1HL 2RFXA 5DZLA 2YSTA 5FHBL 4A1RA 2HT4D 2JIXD 3LY6A 4K5MA 1YQ2A 4ZD3L 2XTLA 3N42F 3RKDD 4NM4H 4LEOA 5TTRA 4LLDA 2JIXB 4WRLA 4LHJB 1A6VL 2UWEE 3HZYB 4ZO6A 3IDXH 3WENA 5G55A 2AKRA 3MTXA 1SRDA 3OV6A 4Q9BA 2LAGB 2DYPA 4FNUA 3X11A 5JYMA 1M7DB 5C0GB 4MX7B 5T33H 4ZFQA 3O6LL 3EH5B 5CZXC 2OW7A 1T3FB 2L7JA 4XP9L 4PY7B 5CKGA 1CD1A 2P48B 4WFGE 4A7GA 3L4XA 5CSBA 5F89B 4JRXD 5I8EB 4KKLD 1YO4A 4A55A 5B3NA 4GYBA 4FABH 4MS6A 1ZDSA 5KJRL 3B9AA 1NMBH 1E5ZA 1QI5A 4JRXB 3GJEB 4GW4A 5EU3A 5IB5B 3BPCA 1L5GB 1GC1L 2Z8VC 3QJTB 2RQEA 3EJZD 3RYMA 3IFLL 2W92A 2RGSA 3ZIYA 2RB8A 3HNVH 3F7RA 5DA4A 4G42A 4TNVK 1P4UA 2L3BA 4K8RH 2YSSA 4IBZA 4JY4A 4P48A 2DLHA 4F15C 3RTQC 4O2CA 4S0SD 4PRAB 4Z78B 2BK8A 4W9DC 2IQ9L 3L3GA 1Z9SB 3S2CA 2X6AA 1NIDA 1W6LA 1OQXA 3GSWB 3WFHA 2XN9E