4BKSC

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-1-ethanoyl-n-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
137
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 137
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4bksC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4bksC01
4BKTC 4B95C 4W9IC 1LM8V 4WQOA 3ZRCC 4W9HC 4W9LC 4W9EC 3ZTCC 4W9FC 4W9KC 1LQBC 4W9JC 4W9CC 3ZRFC 4W9GC 4AWJC 5LLIC 4W9DC 3ZUNC 3ZTDC 4B9KC 4AJYV 1VCBC 4BKSC
chains in the Genus database with same CATH superfamily
2YN5A 1V3LA 1GPOL 5DU7A 3V2AR 1A6UL 2UWEA 4FKHA 4QHLB 3VI3E 1ECYA 1DFXA 2FEEI 4G7YH 4IHOA 4MB5A 5DQJB 5BV7L 4WI7A 3CH8A 4HAKA 1DVXA 5KVMC 4AENA 2DDQH 1AR1D 5BRZD 2UXVA 5BV7B 4GFXA 4NGHH 1G9NH 4DETA 5HHQA 2OR8A 2R0LL 2BO0A 3U2SB 2XQYG 3QUGA 4XOBA 5JHDA 1JERA 2JKRM 5DHVB 1OSPH 3G6JA 5B3JE 5KYNA 2A77H 4ZX5A 1B4LA 1RZJH 1BEXA 4D3CL 4XHQA 2BNRB 3RWJB 1JZIA 4IGBA 5KVDH 1UM4H 2BERA 1GH7A 2BPBA 2ENJA 2X9YA 4JY4A 4P5RA 2FD6L 4XPAH 2CO6A 3KAAA 2KKQA 4KI5F 3V4VH 2CO4A 3C6LC 1G7MA 2VDPB 1ET7A 1JCKA 1NBCA 1SXZA 3R4RA 1IC7L 3E1F1 3RGBA 4J3UA 2PNDA 3I50H 4PRBA 2CBPA 5IFHL 4RFNC 3OB8A 4DW2L 3WFDH 4G1EB 1TEGA 3CHQA 3K4DA 3O4LE 2C8NA 5T33H 5DYFA 1INQB 4Z78A 5LHDA 1CYXA 3RIAK 3QEQE 3QG7H 3QNZB 1K4DA 3JT2A 3JV6A 3T8XA 3TCTA 1S5IH 5CSZB 4GG8A 1ZOXA 3GZQA 4QKTA 4J3WA 4X6CB 4PLJD 4XMLH 3UMNA 4ELKB 3LHPL 4F7MA 3IRCA 4NQDD 3DHJA 2C26A 3LY6A 3AQZA 3LH2H 3P11L 2FLBT 4MYPA 4KQ3L 2IBZY 1FZMB 2KS0A 3HZKB 4JZJB 2X4OB 4MA7L 2X6UA 2OMWA 1NCBH 1OAYH 2EE2A 4JVPA 2E8YA 4RIRA 3U46B 1JZ2A 3GTNA 3CVHA 1IAIH 3ILPA 3DDFA 4XPGL 3ARTA 3DO4A 1JV5B 4L4TA 4Y4FA 4B0MM 5C0NC 3R06A 2CWRA 2OX5A 1CLYH 5JR1L 4HV8A 5EIIB 1XGZA 4PTTB 3SY0B 4MX7A 1SLWA 1B0IA 2UX6A 4JG0H 4CADB 5K9OB 1AXSB 2NNAA 1VCBC 2EDBA 3AW5A 4KWUA 1RH8A 3AITA 5D1XD 2YKLL 1JDAA 3L5IA 3WXVH 5ID1A 4J4PC 5F1OB 4W9IC 4UV4H 2VXSH 1E5BA 2NY7L 3DETD 4PG9A 1X44A 3AWGA 4YE4L 1GIGH 1GTFA 1N19A 5L88L 5F9AC 5JXAH 4G71B 3STLB 5TQ2L 5C8JB 2VDRL 1SY6A 3QFGA 5IBUB 5IEHA 2N1TE 1MWAH 4JZNA 4ODXA 4V33A 1OW0C 4F57H 3V6BR 1CC3A 3MRKB 2HYMA 4M4PA 4RMVA 5BMFL 4K9EC 5DLML 4L29B 2IANE 3OM3B 3G6AA 3KGRA 2F08A 3PWVA 5T3ZH 2VXQA 2CDGA 4GRWH 2H32H 4LOEA 4W4NA 4R3SB 2CALA 3NG5A 4PJBB 3TBCA 4YDMA 1ZLVK 3TCLB 1L9RA 1CXKA 1ZCRA 5BS0E 1MY5A 2XCMC 4NRXA 1R3HA 1YEWA 4MYWB 1AP2A 1BSIA 1FYTB 1RAMA 1U42A 3MOBL 3GLEA 2BOCA 1F3JA 5F7BA 2OSLA 3FU3A 5EO1A 5LDUA 1DYZA 2WO2B 1CMOA 5DS1A 4LLYA 1OP3H 3QBTB 4PJAA 2YGVA 2IALA 3D06A 3MAWA 4S1DD 1ES0A 2X2HA 5IW3A 4GQQA 5AEAA 2OSYA 1FFQA 1S9WA 4B9ZA 3H9HA 3CZUB 1KLGB 4L0ZA 3SDAB 3EHBC 2PYFA 2WV3A 5GGVY 4LDLB 4PJXF 3MRIB 3SPIA 3GF8A 4YGVA 4FGMA 3Q3GA 1JPSL 3P4OB 1T5KA 3MRBA 4GXVL 3SE8H 1BXXA 5C07A 2WUCH 1S7TA 3M8OL 5DK3A 2L4OA 2A1WL 4MAYA 5I74B 1KBKA 4N8CH 4N8UA 4P23B 1U91A 4H4NA 2ZUXA 5IK3B 1A47A 4XE5B 3IGAB 1P7QD 2MOGA 3KPPA 3GNMH 5IQMA 1UM6H 2W59A 5KVGE 3LEVL 2OQJA 3JQOB 2VDOL 4C83A 1BAFH 2EE3A 4NM8L 3NJVA 1DJSA 1S6NA 3PDOA 4JFZL 3UAJD 1XF5A 1EAQA 1V3KA 2VDOB 4KXZI 4ES8A 2G9HB 3O3EB 4RA3A 5EDXA 5KYXA 2YAEA 1U6AH 5D5ME 3I3BA 4Y4KD 5EFIA 2CRIA 4YHIA 4RRPM 1XVSA 3N85H 2QL1A 3NCEB 1A9VA 1B2WH 2KQNA 2GAZB 3NQIA 1BD2A 2BIPA 2DJMA 2EH8H 3MJWA 4PJIA 3TEXA 1D3CA 1KLFB 3U83A 1M3JA 1G7JB 5E56A 2BY3A 2PW1B 3F65A 3LS5H 4DP6X 1O75A 2X3AA 3BN3B 1BYPA 5E9DB 4Z7VF 3VGHA 1BLNA 1XGRA 4HF5L 4CU6A 8FABA 5HP5A 4JQXC 4LT7A 1R3LA 1GGCL 1E7VA 2XWTA 3IK2A 4MVBC 4OGZA 4Z7WE 3LB6C 3RTQB 4UT9H 2JTDA 3WV0A 1J8RA 1SBSL 4KFMA 4LB8A 1MCWM 5LUMA 2ZUWA 5ILTL 4DN4L 1YAZA 4DVRH 4GUQA 2VLJE 4V1DA 4UAOC 4XBGB 2GBVA 2XPZA 5KOVC 1DBMH 3O2VH 3RWCB 2MTPA 2WVVB 1KT2B 3CUPA 4CN6A 1E27B 3SQOH 1R3IH 1HNFA 3BDYH 3DVNB 5K59E 3IJ8A 4PIBA 1H6TA 5GS0C 1DANT 2DIEA 3BD3A 1M53A 1I8LA 2WXJA 3WY2A 3RKDC 1QFWL 5AVRB 1JAEA 1J86A 2GG1A 3GSVB 5H37G 3WLWD 4LLQB 2I9TB 3ZL4L 1OSZB 2QQLH 4LMQE 4YSAA 2Y5EA 4XZUB 1QEWA 1N68A 2X10A 1A7BA 3N44F 3QDJA 4KAQL 1M6OA 4HMEA 5IMMA 1S5HA 2CKBA 4NAMA 3ARSA 4KI5D 2ADFL 1H3WM 3L3JA 4JDEA 3UTTB 3TBBA 5IMKB 1DN0A 2OL3A 1CFNA 3VI4A 3VXUB 2XQYA 4PTUA 5CZRA 4BM7A 4F58L 4J2XA 5KVGH 1I8AA 1IBBA 2ZXDA 4XVUD 3AU1A 1B3JA 3CFKB 3SDCC 3RZCB 2XWDA 2GSGB 3IM1A 3QI9B 4RAHA 5EN2A 4ZS7H 1KPVA 5I18L 4AEIH 2I60H 2XKNB 4NQEB 1XGYH 4X2UA 4BZ1L 5J06A 1AMXA 4IIQA 1MI5A 3RGVA 3QVAA 2ZWSA 4YL4A 3NJIA 1OE1A 3DECA 4UILL 3IT8D 1UB6B 4J8RB 4K3JH 3L95B 1QD0A 5E4EC 2QZ5A 3GB7B 4M62H 4U7KA 1VCAA 5FFGA 3BGFC 1HWGB 5IY5B 1O5DT 3U1SL 1CDJA 1ID5I 3TA3C 5E99H 5BXFA 4OKVA 1T21B 4ODHL 5EEYA 2AXGB 3OC8A 2AV7B 4AYGA 3CHPA 2ZWNA 1FWXA 1V27A 4NJ9L 3MREB 3RILA 2V17L 4N2OA 4R84A 1EXUA 4G42A 3VVVA 2ZCLH 2FATH 3MNWB 4I48B 3AQXA 4S1RH 1I3GL 1KJ2L 3S2AA 5I1KH 1EGJH 4KJYA 1T2QH 3EJPA 3IXAB 1V7MH 1BREA 2Y69B 3U1QA 3VWKB 3II3A 4YDLC 4OM0L 1IJNA 4BKLB 4X7DC 4I4WA 1JNNL 5H35A 2Z4QA 3VA6A 1IO4C 4ZNEA 1GMEA 4WFFD 5DD1H 1TJGH 1QMUA 1M1XB 4ZFGH 3JTTB 3V0IA 3F7VA 3CVBA 4N22A 3V0EA 4AW7A 4D2NA 3NFSL 3WN6A 2OJEB 4N2IA 2H6OA 4YC2C 4LL4A 4BCXA 1T04B 3CZSA 4HHAA 3R7QA 2VDLL 2Y36L 3D0VA 4HUKB 4JFPB 4MA1C 4P2OA 2PMZA 4FD0A 3MYZA 5DWUL 4Z3IA 4IU3A 1MW1A 2ICEA 2VQ1A 4XX1E 2VDLB 1WS8A 3GHEH 2GTWA 1SOSA 5IHBA 3QG6B 5FKAA 4RISL 4HETA 1NUGA 5KAQF 3ECWA 3EDJA 3OHMB 3DX6A 2OTUB 4XNAA 1MCPH 3C5ZA 4G8FB 3K80A 2YIHA 3TT3L 1OOAA 4HWBL 4EMZA 4OZIE 4MCYA 4ZFOA 2RFXB 2ATPB 3ABLB 4LSVH 3KNBB 5EULV 4XXWC 2J8HA 5BZWA 4I7ZC 3FCBA 3LAFA 5AYTA 5CEYA 5AD0B 3B7YA 2NX5B 3MXVL 2WQSA 1PJ9A 1T89A 3EF4A 4ZTPL 2J1XA 3WS3B 1J1XH 1PJWA 5CUSH 4ODTH 4HK0A 1EJFA 2BOBA 4NO3A 2H2SD 4HJ0C 5D7LD 1T03L 2R0WH 3SDXB 4KKBD 2VO8A 4PJDA 1EZLA 1NGPL 4FNLH 2COVD 1OCZB 4Q14A 3B2UC 3G6DH 4LCUA 4FL4C 4L3FA 2HFFB 1G9HA 4ZXBA 4LLWB 1WK0A 4J28A 3QZLA 4UDUA 3W56A 4YXLL 3F3HA 3U7YH 1JDCA 1Y6MR 4WK4B 4G6FB 3AM8A 3ARZA 2J73A 4MB1A 3Q13A 5FYJD 1QWUA 1KN4H 3OL2A 1S7RA 4P5MA 1J1PL 3S35X 2A83B 3P1VA 1J0YA 4ZW5A 5HVFB 5I6LA 1O6VA 1RPQA 1TG8A 2IPKB 3CC1A 3DVFA 2XWXA 1Z7JA 2AQQA 4PJ8C 1AHWA 2KZBA 5D7JB 4Y5VC 4Y19D 5FLVA 3V6OE 3FN9A 4BJLA 2BVPA 1RP9A 3ABZA 3VD3A 1FNSH 3VD7A 5KS9F 4LF3B 4MJ5A 1IFRA 4K7PY 2JB6A 2NQDA 1DQKA 4L4VB 5D7HA 5B39G 2G5BA 3VNYA 3B9KD 5JZ7C 1BOGA 2IQAB 5I17A 1VPOH 3ZDXE 2IH9A 1SGKA 4FLQA 4J6RL 2Q8AH 1BG1A 3PWUB 4M48L 5FHAH 3MLUH 1DJXA 2V9QA 1P4LB 4S11A 4XGZA 3HG5A 3FB7B 2EO1A 1MG2C 4L8SB 4JN1L 3TJPA 1UXWB 3GRWA 5BVPL 1F6AA 3N41B 2PP9A 3QO1A 2WD0A 4QTIL 3LPPA 2PCFB 4UV7L 5D6DC 4A2FA 4B97A 4ZTEA 3FONA 3SGJC 3ARXA 2ZTBA 1B88A 4O02L 1FH2A 4OCYH 3QWQB 1MAMH 1CI3M 3CFJB 4G6AD 1CXEA 1UD4A 4O02B 1VZHA 1CWVA 3A47A 1OCCB 3DKHA 1HAUA 1MHHB 3S4SB 2FECL 2NCMA 1NBVH 5H37A 2V5SA 3IMUA 4HX1B 3P9MA 3K1KC 5D7SL 3ZKXB 4KITB 4FG6C 1HNYA 4M3HA 3IXTA 4Q8BA 1EANA 3V0VA 2NY6D 4YHOH 4JFQA 3TT1L 4DO5A 1T1WB 5C0GB 3MRMA 1PMYA 3MRRB 1EO5A 4KGLA 1RHFA 1VFMA 3WY4A 2CHNA 1TTCA 4FC3E 5CSGA 1SPDA 3ZE1B 2CDFB 4OLYL 4UYPA 2X4RB 2HKHL 1I8UA 2J72A 5KN5A 2AABH 5DJZA 2FVNA 3T1WA 2IBGA 1TZIA 2E4TA 2G5RA 3AY2A 1FVDB 2YPKB 1T3FA 1WAAF 4RMTA 1A3RL 1JGEA 2Q5BA 3ZE2B 3NGBC 4OF7A 4QXTB 5AVTB 3LKQA 3TA4D 2VM9A 4M8VA 1K3IA 2WWKT 2VDQH 3ZN6A 1ZGLB 3N0PB 4QT5B 2X6VA 3I9GL 3V7AE 5LCVA 2NY0C 2ZKHL 2B15A 1ORQA 1NFIB 3EXJA 1A65A 3TN0D 3TTYA 4O2CA 4KMTH 1IGMH 3L13A 2CPUA 4NWTL 4BK5C 1X6LA 1NANH 2CIKB 2FWOB 4IK6A 2F0CA 3BAYA 1XT5A 4LLUB 3ROOA 1PZBA 4ENED 2ZE0A 4HUXB 3WN5B 3ECUA 3WFCL 3TO4A 1OGTA 4AQAA 4U6VH 2P5WE 4ATTA 3DX1A 4ZMYA 2L7UA 5E70A 4FQLL 4XPBH 2QADD 3BUQA 2B1AL 4D8OA 2NY3B 4P5TA 5JHLL 3C6SA 4HIQA 1LK3H 1IBDA 3QJQB 3N1FC 4XNZC 2IOIA 2WQXA 4HQQL 3RUGA 3RY6C 2A6IA 3F83A 4EI6A 3QDMA 1AJ7H 1N6VA 1XZ0A 2WKOF 1Y18A 3FB5B 3UGEA 1ZWIB 4P3DB 5DLLA 3MLXH 4JHAL 4PLKD 5IGXH 2BP8A 1YEDB 1LO3H 4AYFB 1PD0A 3NJHA 1KWGA 3O8XD 4HCGA 3T3ME 1INDH 3II1A 2GCYA 3Q1SH 4HKJA 2K78A 3L3KA 5CEZH 2CM5A 1KZYA 1J9CT 4B6ZA 4XN7A 2OW7A 3P30L 4BZYA 4LVOC 3VFVB 1G9MC 1MHEA 5A2LH 5IP4A 2C7FA 1ZT4A 4KNTA 2JB5H 2O1AA 1NDMA 2OLDA 2FO8A 2QQNL 3QR1A 4ZX4A 4OV6F 4OV5A 4U3SB 2PCPA 2VLRE 5E6IA 3P73B 4DP2X 3G7TA 4EZKA 2ZJSH 1B4JL 2W60A 3QB7C 4PBXA 1IL1A 3LN4B 3ZXAC 7CGTA 4MJIB 3S3PA 1MH5A 3FF8A 4JFHE 3FTZA 2OMVA 1RUPL 4PRPB 2HFEB 3HUJF 2VMJA 1GY2A 2IDSA 1I1AB 3AACA 5C0DA 5I75C 4OCSL 5G5DA 3HBQA 5D1ZD 2IFGA 4MCZA 3L4ZA 5BQ7B 5JORB 2W81C 3DTUB 4HSAC 3PV6A 4MJ2A 4N5EC 5E6SB 4PY7B 2G2RA 4J5VA 3HHMA 3WS6C 4HJSA 1ZJBA 3LEYH 3FH8A 4QKXB 4Y2LA 1D5ZB 3MLZL 2WMPA 1S3KL 1TLMA 4MBOA 4RQQB 1K5NB 3KYMA 1HEZA 3P3UA 2L04A 5IBLC 4HKXA 2ODIA 2J8UB 1BMZA 1OGAE 4OLUH 15C8L 3SGEH 4FCHA 3VMPA 4AIXA 2XA8L 1GGIH 2R9HC 4H8WC 1T6VN 5JUEH 4RDQF 2EIMB 5C0RH 2IADB 4GXUM 4X6BA 1BZ7B 1HXYB 1MRFH 2C1OA 3NIGF 1XTMA 3P54A 4U7MA 5SX5H 2UUDK 3G6JB 3JYCA 5CLXA 3HG2A 3TBTB 4AGLA 4E5XB 5LAXA 5I66B 4DFIA 4GFTB 2QR0A 3C6LD 5FX3A 4PRAB 2FT7A 3JYBA 4HIJB 2YPLE 5KVFL 3O0RH 4U0QB 1QABA 3BVNB 1XZWA 2MQCA 2GJZA 1B6UA 5IF0A 2C9UA 2FT8A 3TWCL 5CR8A 25C8L 1N3NA 2FO4A 4LCWB 5E2WH 3UBGA 3IDUA 4BELD 1GHFL 5HYQA 3TM6A 2LT9A 5B39A 4XN2A 5DC4B 1AYOA 2BOLA 3IFPB 1QVOB 3MX0B 1F1AA 3PS6A 1BOYA 4KZ0A 3AQDA 3ROLB 3MCKA 4PJ9A 3GSRA 1FH5L 4ZK8A 3BQUD 2DRUA 4X4KA 2AK4E 3BAXA 3OLDA 5F7EH 2AJXH 1UD2A 2B2XH 2D73A 4WU7A 1YNKL 4RIRB 4QRPD 4KZEH 1PX3A 1XF3B 4QRRA 1PVHA 3DOSA 4Y1AE 3WXWH 2X09A 4GO6B 2DBLH 1NDGA 1PKQE 3KXFD 4MCNA 5E6ZA 3GSWA 4NQUA 5GS3A 1A4JB 3U2IA 3KLKA 4TVPL 2RD0A 1GZPB 3FO2A 4FQ2H 2AJUL 4OFDA 3H54A 4J4PD 3QCUL 5DYOB 4UNUA 2P46B 5MHSD 3C9NA 2DQEL 4PG9B 3BPLB 3GKZA 1QBAA 1IC4L 1YMMA 3EOTL 2F1AA 1DBBH 2DYSB 5PAZA 1JPTL 1TKWA 1H8OA 2JCCA 2L3BA 3LVEA 4GW4A 3KPSB 1HQRB 1L4IA 2JQZA 2A4ZA 2EEBA 5FF6B 4JG1H 3QJXA 3VD4A 4IOIA 4LU5L 4NFCA 3BIKA 3IDMB 1H5BA 3QISA 4HS6A 2J6EH 3UH8A 3ARDB 3DI3B 2CDGB 1NBQA 2N56A 3J7HA 1X9UA 1YNTA 4GKOA 5SWZD 4YIQB 4HU8A 2XFXB 4OFQA 2YD2A 5GHWH 4ZFQA 2MCAA 3HE6C 3KM2A 1J8HA 3OAWA 1MAJA 2PO6C 1WIPA 5EBLA 5GGUA 3OGCB 5B22A 3RVXC 1JRHI 1KGIA 3T2OA 3WFHB 4XCNB 3UOAB 3UTSB 4NLHA 1U3HB 2P5ED 1P6AB 3OZ9H 4JKWA 4BUQA 3HC4H 4FQXC 1S7VB 1KCSL 3A21A 5ERWA 3HI6L 1HYSC 2A0LC 3QJHA 4OD3H 4U1JA 2DJSA 1BG9A 3RVTC 4F7CA 2QPSA 1QATA 2I69A 3EG9B 2Y7LA 2VWEC 1M1SA 1CVRA 3HKFA 5B7MA 5IHUL 3EHBD 3H6JA 3P3SA 2FSEA 4JDZA 4RGMC 3MROA 3QRGL 1KYOJ 3CTTA 5FCSH 5C92A 3AB0B 3GSNA 1OL0A 3HG1D 2EDKA 1PZ3A 4PJBE 1NCHA 1Q9KA 1T1YA 1KJVA 4MFHA 5KSAC 3V4PL 1C8PA 3QAZB 5JLZA 3GK8H 4AITA 3U9UA 1BZQK 5DFVC 1UCBH 1IKNA 1CZ8H 1R24B 2W0FA 3NIDB 1FYTE 2OMYA 1VEPA 5I5JA 2CLVB 3KPPB 3QC5X 2WCSA 4XH2A 3PWPB 4FXKB 1MOEA 1KIPB 2VN5A 3QZWB 3ASNB 2XSKA 1WFJA 5K9KB 4OJAA 3WSQL 4B7LA 2BSCA 1TZGH 4ONFL 2IXQA 1DBAH 1N4XH 1YZZA 5LGHL 3O8XA 4J3OC 1HXKA 1AE6L 3IDXH 3PCYA 3B5HA 4U6HB 3V5DA 5I71C 5T1MA 3UABA 1TJMA 2NMSA 4FA8A 5E8DH 4OZHE 2L8AA 4N25A 1KFAL 2E46A 5HXMA 3RJQB 3S36L 3UBHA 2XV2A 3BP7A 1Y7VA 4GINA 2ADIB 4H88L 4E42A 1E5ZA 1FAKT 1L7IH 1N6QL 4Y16B 3IAPA 4LSUH 2FNWA 3RBGA 1OPGL 3QYCA 5B1AB 1F13A 1OKEA 3MOAL 3MDJA 2FZ3B 3L16A 2A9NL 1W0YT 4P8QA 4E9XA 4MVBD 4NNXA 1I9JH 1TQSA 4G7RB 3LB6D 1KLUA 4XMXA 3LQAH 1G1YA 3MLVL 4PJFB 3U36A 1TYRA 4JVWA 1WTGT 4I2XA 2DMCA 1XIWB 1ASQA 2EDJA 2VOTA 4GW1B 1WEJH 2V9RA 4X5LA 2NXYC 3SO5A 2X6BA 4G7VH 3D39A 3P0VH 5IWLA 3CUPB 4E9QA 2NTFB 5GS0D 32C2A 5I0DA 1KCBA 1KCKA 1UGNA 5AZUA 3RKDD 2RR3A 1ZE3H 4F33A 4I18A 1VJSA 3NZUA 4WKZB 1F4XL 2D7OA 3OAUH 3FB6A 4QRQA 5ICYB 4JJ5B 1JHKH 5E9DE 4F7EB 4BCZA 1AR1B 5K39B 2CRYA 2RA1A 2MOVA 4W6WB 4QNPE 2CHXA 3CBRA 1PG7L 2CBQA 3WBDA 4CA4A 1SVCP 1UJ3C 1YN7B 2N1KA 2DV6A 3TO2B 3D3VA 1CFNB 4TSCH 4LKCB 1NCTA 3D30A 4ZDHB 2MH4A 1BECA 1ZT7B 3QJSB 4ZG1A 3LDBB 2CR0A 4YH6A 3SDCD 3M1BB 1ZANL 1G1CA 2WAHA 1GGYA 2FT6A 1AGDA 4WUUD 3PLYA 4POYA 2QVKA 5T3XD 1EVUA 3RZWA 1ZD6A 1CXIA 4PJEE 4XOEA 3MOQA 2Z7ZA 4CGUB 4KRPC 3O3UN 3DNKA 4C4KO 4EE2A 1EHLH 4OJEH 1XB8A 1NL0H 2AGJH 3H3KA 4ZAKA 3DK0A 1BQHG 3UTTE 5CD3A 1U2HA 4NQDB 1Q72H 4L3ED 3VD2A 1ZEAL 3VXUE 3VXRE 2AQ3A 2FX8L 3TA3D 4PUBL 3QQ9C 3A4FA 3U0PB 2R29H 3O2DH 3V5KB 4JY5L 2ZWKA 5AVWB 1DVTA 2BSTB 1A1MA 3JWNC 4M6ML 3UPCA 4EKXA 2ICWI 5KJRL 2ITDA 3FQTA 2PP7A 4ZT1A 2VZOA 3QQNA 1MLCA 4M3KB 3V0JA 5HGHB 1CDIA 3E38A 3HZVA 4YLBA 3WD5H 1OM9A 4NQEE 3BZFB 4HCFA 5DUPL 5GGTH 4L9LB 1WWAX 1BMWA 2ZYIA 5ID0A 4NQVA 5D1XB 4HHGA 3VXPB 3GM0A 3K72B 4PJ7A 3LKRA 1NGXB 1O7DE 3T3PB 2NZ1A 1E9QA 1QZNA 1HL4A 5FIEA 2BIIA 4GIAA 4PS4H 1FNLA 1XEUA 3R7RA 2N59A 4OB5H 1LP9F 5CP7B 2RH0A 3JWOL 4H20H 2Y2YA 4EIBA 1WAAA 3SQBA 2X05A 1FC2D 5HTSA 3SE4C 1OHZA 4DHLA 2EXWC 2V7NA 4DK6A 4WI5A 1XGTA 4W9GC 3AMKA 3P9WB 2F7OA 5D2LB 5CEXA 1HINL 2R1WA 3E3QC 3MBXL 2PYEE 1G9NC 4HFWB 3FC8A 3GS4A 5DZAA 3AS1A 2XLLA 2V5MA 1CE6B 1RZJC 1I7UA 5CD5C 2OK0H 1GA2A 3JWDH 5DS8B 4PY8J 3U4AA 1DBJH 1A7RL 3L3IB 4NDMA 1OLZA 3UBXG 4JFSA 4QHMA 1ZHKB 3UTZA 1U8IB 3FYIB 4PS3A 5DJ6B 3PHOA 4AUJA 2DM3A 2PWEA 2Y5TB 1VFUA 4WSKA 4N0FA 5H2BA 4ABVA 4EDWL 5FXCH 5DUBB 1N7ML 3A4AA 3L4TA 3TVMC 3WNIA 5IEKA 2WN3A 3IS0X 3ECBA 3MLPA 2H0FA 3WTSA 4H8HA 5CEYB 2Y1AA 1Q0YH 2NUTB 1HVXA 3EH1A 2APTA 3LZRA 1EK3A 4CAGA 1KY6A 5AAMC 3AABA 1TO5A 4HJ0D 4HK0B 3VRIB 4A7UA 3SBPA 5JTWA 2Y1VA 3B2UD 3CLEL 3QXAA 4HSCX 4MQ7B 3EJSA 3C09C 1P7QB 1T1ZA 1R3KA 2W5PA 1EVTC 4FRWA 1C8QA 1K9TA 3EJQA 4X5XB 3UO1H 4O9HH 2FB4H 1RK0A 3BT2H 5HHVH 4H8UA 2Z35B 2VQTA 2C5DC 1WA0X 1T22A 5TJWK 4PGEA 5HI4C 1AFVH 3U30B 1I4FA 4WZ9A 4NOBA 4Y4KB 5FEBA 4PJ8D 3FU5A 5I1HH 2VJXA 1A0QL 3EYQC 2DWDA 4Y7MA 4HJUA 4DPBX 5L4FA 1B0GB 4Y5YA 4APXA 3SE3A 4UTBL 3O3DB 2G30A 4YK4C 1J0KA 3JV5A 4KDVA 4UQCA 3SDXE 3RPIA 3HUJA 4CC4A 3L17A 2QLVB 3BWZA 1HI6A 3FN3A 4U49A 4LLVA 2VL4A 4PWGA 5JZ7D 3AT0A 4LKXA 3GZOA 2ZD0A 4JRYA 1UZ8A 3RL2A 5E8OA 1XGPB 2L7JA 3EDFA 4R0LA 4LSSL 1JK9A 5EZOL 1LDPL 4HU2A 3VX0A 4FEIA 3TASA 3TNNA 4ZUWB 1PG7X 2F7IA 1HQ4A 3ZQXA 2BDNH 1H3PH 1U8QB 2FH8A 5DK2A 1KIUB 1NCCL 4R90H 1CFSA 1NFDB 1MCBA 2BWIA 2NW2A 3FQ2A 3ARYA 4EI5C 5J6HA 1QTYT 2XN1A 3DURA 1MW2A 5IR1A 4RRPG 5IQ7H 4WEBL 1FRGH 4LSPH 3BYTA 3WNJA 3MV7A 2GC7C 2LU4A 2VZSA 3WUZA 2ZOOA 3IFOB 4NKIL 3FUFA 1KBWA 3DRTB 1NGYB 4L4VE 4IMLA 3IPEA 4RMBA 2WTRB 1YMHB 4GI9A 4XP9H 4Y9CA 4Z77B 3ESNA 4FG6D 4YR6A 2BP3A 1EHKB 2IAMA 3BKML 2AJYL 3ZKSD 1AGBB 4HFUL 3QO0B 5AKTA 3HVNA 3DC0A 5J56B 3N50A 4DZ8A 2FQFA 4F7TB 2VDKL 5I0VA 4N20A 3B8YA 4O58L 5DRZA 3MUHL 1P84K 2WP3O 1YY9C 2VDKB 3SE9L 1W8OA 5LGJB 4P49A 1AXTL 4O2EB 1V05A 1Y07A 5BQDA 1X7TA 4XCCL 4U1NA 3VNZA 1R47A 2WZ0A 1LO5A 1KGJA 4OBSA 1JGEB 1A66A 3NABL 3LIZA 2NCEA 3T0VA 1VF5C 1RIHL 4KXCA 3GUTA 1JVKA 5LBSA 1C1EL 2D7TL 4HWEH 1NCJA 4S0SD 5ABZA 2Z91B 4JW3A 3S48A 4CVXB 2W0LA 2NY0D 3OAYK 1WCBB 2BC4B 3M6DA 5SWSA 4B9JA 1MXGA 4PVBA 3L1OL 2Y1YA 3F85A 2X6CA 4XNQA 3VFOA 5FGCE 2BVYA 1BQHA 5LDSA 1MQ8A 5TPWL 3ZE1E 5BPPA 1F90H 3GBDA 4JAMA 5DF0A 1UWGH 2AJ3A 5EEUA 1KV7A 4ADGA 3QC6X 2WGXA 3LNGA 1AO7D 2FTAA 4GUOA 4JM2A 3GC3A 4NZDA 5ETUA 1VGEL 2EVGA 4GPVA 3ZE2E 2P8MB 1NCDL 3IRZA 3RWIA 3MBEA 2BW5A 4FI7A 4FZ8L 1QSZA 4P59H 5B38B 4I9WD 4E0RB 1MFCH 1TJIH 2EP6A 4Q52A 3TBWA 3N42B 4NI6A 5LBGA 1ADQA 2DMHA 3G9VA 4PRID 5J1AB 4RETB 1I7TB 5IKCA 1FNHA 1URIA 1NC2A 2F5BL 4WHYG 1TQVA 1SEQH 3RWFA 1PSKH 1FL5A 5ICXA 4PJ5A 2DJ4A 1AANA 1CB4A 1AQDB 1ZSHA 3FAWA 3UMTA 4P2RA 4FABL 4H1LG 5FUOL 3B4NA 4N8VB 4AYID 2JLLA 3LHAA 5JO5A 2A9AA 4J3OF 5ADOH 1DJZA 4XXCC 1CLOH 1I1FA 3CZEA 2VSKB 3N43F 4ACPA 3V6ZB 1BJ1J 3BLBA 3V0FA 3MRJB 3P9LA 3WIHL 4MKTA 4YPGA 4F20A 2UZIL 4B96A 3TF4A 4ZFFB 3F04A 1BGXH 3MVSA 5E8NB 1K85A 3PPSA 1X4ZA 2YQGA 2N7BA 4M8UA 1LK2B 1Z5HA 5EU3A 4X4ME 3UBXA 2XX1A 4PJXB 3CZKA 4WI6A 4YDIH 3EZJB 4N5ED 2J2ZA 2F1EA 2H9GA 5CBAB 2R7EB 4QRTA 4TRPH 4L3CA 5AW8B 1HH6A 4P2QA 5AVQB 5E5MB 3WTVA 1I8MB 5F0PB 4L1LA 3IPBA 1YDPA 4ABQA 3MCLL 4ZUTB 4H13C 5D7LB 5CGTA 2D3JA 5F6HJ 5IBLD 3OKOA 5IHZA 2R56H 2VERA 4P9HC 3MRGB 1XCXA 3E6FA 3QE5A 2L7EA 1TETH 2R9HD 4JUTA 4F3FB 3QPXL 2DS4A 4HCIA 5AYQA 3BX7C 5IM7B 4N68A 3RIKA 4PRPE 1U8MB 2F19L 5FYJL 3VW3L 1AKJD 1C5CL 4GKSB 4AQ1B 1H3TA 4GMSH 2W0PA 1ACZA 3K2UH 5EU6A 2X4QB 5ANMA 5EZLA 3ASOB 5C08E 1HXMA 3DX4A 1Q94B 1XV8A 4K2UH 3HNSH 2YO3A 3I6SA 4FTVD 4GRLA 1M3IA 3D9AH 2NNFA 3S8FB 4PJ6A 4A66A 4XP6L 2PTTA 2F53A 1KTDA 3N0AA 5E03A 5TFSL 1DVYA 3QORC 5A6IA 4YHPB 5FOJA 4AW4A 1H3XA 4Y19B 3IN2A 3AWFA 1M7DA 3RIFK 1UACL 3NEEA 2VYRE 2AXFA 4K3DH 4J3TA 4Z7VB 3QULA 4BQCA 3WL9A 2HJKA 2EAEA 2IIJA 5E1AA 3PNRB 4ZJ9A 3CZFA 2CJ3A 3HMWH 2FJSA 4Y0GA 1XH3A 5LNEA 1S9XB 3B9KB 4PHZA 1F97A 1NCGA 4JKMA 2YEVB 2DQTH 3QUKA 3GS7A 1ILSA 2B1HL 3HHRB 3WJJA 1TQCC 1JF1A 3G6JE 3BPOB 1RZIA 3HRPA 2AQPA 4RFOL 4AVKA 4R96A 3LKPB 3LMJH 3RAJH 2E6QA 1WZ1H 4J3SA 1UH2A 3MC0A 4UQ2A 3WIFA 2IF7A 3F7QA 4QRRB 1DVFA 3PWLA 4XP5H 1P4IH 3KLAA 4RRPA 5T8IA 3GRBA 3N44B 1R3JB 3GSWB 3HN3A 3I3EA 5C7XL 4AWJC 5A40E 2BSRA 2QQKH 3CWGA 5TDOB 5KBMA 3CDFA 4M43H 3FT0A 5CIPA 2HG0A 3GHPA 5AG9A 1KULA 2YXMA 4AZ8A 2ZSVB 2IPUK 1BIHA 3FRUA 5JNYA 5ABAA 3QWNA 4EN3A 2NY6B 3VD9A 3T8MA 1OSYA 1S8DA 2YPVH 2WB1A 3MRNA 4IOFC 3ARBC 4M7LL 1BJ8A 1N0LA 3L5XL 2IFFH 2FJHB 4JPSA 5EBMA 4CL7A 2ROXA 2WLIB 3QEHB 4YSCA 1KTKE 3VWJA 2X89D 4JJOA 1DSYA 2YA1A 1PL3A 3KLQA 2W9DH 2Q86B 1M2OA 5AYUH 4L18A 4KJQC 5EHFA 5ADPH 3HE6D 3PWNA 2O5YL 5E51A 4L37A 4LGRB 4YHML 2VTFA 2HFGL 2AQRA 2NY5L 1ZVSB 4PP1C 3RVXD 5HVHB 3QK0A 4DKDC 3A6CL 3RWEA 5A16A 1I9RL 4IDJH 1VACB 1KOAA 4IKLA 3BAJA 4KTEH 4FQXD 4TSAH 1QRND 3CSFA 3DUHA 3BPCA 1EX0A 3MLWL 3SN6N 1HYSD 5KANI 2A0LD 3L3OA 3HA0A 3RVTD 3EKCA 3TN0B 3TS8A 3KPSE 4PW3A 5I1JL 3F5WB 4F7CB 3JVFC 2VERN 2OPCA 2VDNH 3KGTA 1IKFL 4IIZA 3Q8BA 1A6ZA 2X7LB 4X7EC 3D2UD 1N8OE 5CINH 2QADB 4H25B 3C75A 5KSAD 1H15B 1SDDA 4YE0A 5DFVD 1J1OL 1LD9B 1E8WA 1H6UA 4ZUSB 3U9UB 2P49B 1MJ8H 3UTSE 4Z7AA 3DJ9A 2X9WA 1JPGB 3EOBB 4N6RB 2ZYRA 1CLVA 2Q7YB 3BFWA 4F80A 4UQEA 2XZQL 4LRNL 3W39A 1YN6A 2FLRT 3QUML 4I0CC 5AVXB 3BVUA 2IBBA 2ZX7A 4PJAE 4IBZA 3QUMB 4U2ZA 2YEZB 4J3OD 4JBSA 3O8XB 1RIVL 3H42L 4S1SL 2EH7L 4PV8A 2FX9L 4JHUA 2JXMB 1QLFA 1MZZA 4OR1A 5H94B 3FQUA 3S6CA 1TR7A 3AROA 4KOCA 3RDTC 1QO3B 4PSPA 3CE1A 3S34H 4H1LA 1CDBA 1IZKA 1A4KB 4B9PA 4NQSA 4PCSA 2VN6A 2WLMA 5FO7A 1E28B 1KBGL 3PGCA 1CGSL 3ETBJ 1RUAL 3GGWA 4ZPTB 3NIDE 2CH8A 3CVHH 1ZVHA 4Y5XA 4XCYB 3RL1A 3GBNH 4DJMA 2YFOA 4GBXC 1CLZL 3VXNB 5EU7E 1QR1A 1PD6A 1U4EA 3EFDH 4JNXA 1J0IA 3OKNB 4M1DH 1JGUL 5E00A 3VACA 5T1KD 3W9EB 2CO2A 1JZFA 1YYCA 4HUWB 3FT2B 3ZQ9A 4YS4A 3EO0B 1DVSA 2R27A 5D1ZB 3WENA 4A7QA 1WISA 1AACA 3OXSB 4J12A 1IEAA 4PGBA 2NXYD 4L8CB 4EAEA 4OIIH 4RAUA 1NSNH 3BVXA 1E6JH 2GK0A 4YNYB 2YAQA 4HUUB 3B7SA 4GRWF 4HISA 2CJUH 2Q9OA 3P69A 4L8DA 4FYQA 1OY3B 2FLMA 2VLKD 3V6OC 3OSVA 3RWDA 1MNNA 3N91A 1NAKH 1QW8A 1BD2E 3AS0A 1SY6H 2YC1A 1HIML 3L4VA 1NCAL 2F15A 4LEBA 4BQBA 4HKBB 2F9BT 1XCQA 2Z4TA 3F58H 3MBWB 5GGQH 2F5AH 4L0YA 2X9ZA 5D6CB 1X5MA 2AJSH 2ZG2A 4HUCA 2VXQH 5IJCC 1LM8V 1BJMA 2XU9A 4KRNA 3SQRA 5LXGH 3P0GB 3S2CA 5EEWA 2WSPA 4HC1A 3NJMA 4M56A 2WZPA 3STZA 2UX7A 1X9RA 1KXVC 4V1DE 2VDML 5KS9B 2ATKB 2DI8A 3WKMH 2CMRH 2VH5L 3C6LB 3GLDA 5CLYA 5GRYA 3GEWB 2X3CA 3NA4A 5C0IB 1UHVA 4BUGA 5DMYA 4KZDL 2A9BA 3BP6B 4Q6IC 4RFNB 1NGZB 1MHPL 5I73C 1KDIA 2N0MA 1WUZA 1CBJA 3PQYD 2I9LB 4G9FA 3SJVA 4KRPD 1JGVH 2OYKA 1ZDSA 4W9KC 5IFAL 1IGCH 3VE0B 3L1EA 5EUOA 2ZUQC 1IC5H 1ZHLB 1PDKB 4V2BA 5HI3C 3K3QA 3VUAA 1GYWA 1R5VB 5FM4A 5J1TC 4HDIB 3QIBA 2CO3A 1LGVA 4JKKA 2AJVH 5DK0B 5T1DH 1E4WH 4MA8H 1CIUA 2BXYA 5T5FA 1UXMA 3K6SB 3QQ9D 5DRWA 1UKTA 3CVDA 2L7QA 1YSOA 3UZQB 4QRPB 5TH2A 5AZEL 4DPCX 3MNVB 2PWFA 5DUMH 3KJ6H 3KXFB 2NOYA 1GS8A 1YEGL 3CFCH 1U92B 3O9WA 4OI8A 3VXSD 1OIOA 3L9EA 1MI5E 2BNQA 2X2IA 5T5NF 4W68A 4QJ3B 2PABA 3FT9A 1DQIA 1MJ7H 3WAKA 3ZKQD 4X0NA 4JPVH 5K9JL 1U8JA 2LVEA 4B7IA 2JQAA 4FG4A 4I5BB 5MEQB 4GW5A 2ADYA 2EYTB 2YA0A 1GY1A 4K9EL 1MDAA 5HJGA 3KCWA 1G1OA 2EXWD 2A6KA 3DROA 3GYRA 2YEQA 4JQIA 1E3XA 5HGAB 1QPPA 1V54B 1M7UA 4GSDH 5HDQL 4JDTH 3GWJA 1ZHNA 4TNEA 5FECA 3LTVA 1F41A 1L0PA 4XMKL 5SWZB 5GIRB 2YSTA 5JDSA 5EUKA 2AEPH 1QR4A 4I89A 5D55A 2PO6A 3EDDA 4M7ZC 5CD5D 4P9MH 3LKSB 2EDMA 4R7DB 1QUNB 4R4NC 1J88A 3QFDA 2P5EB 3WHXA 3IFLL 5D7IA 3CH1A 1MNUL 4CSZA 2LTQC 3QNXA 2R0KH 3EFOB 3PHOB 5KSUB 2ILLA 3GMNB 4Q4EA 4YXHL 1QRKA 3TVMD 2JKJA 4UQAA 3UYPA 2J71A 4ZNEE 5DJAB 2QSTA 5GRJL 1VEMA 3ECBB 3WFEH 3EHBB 4QYAA 2CKBH 3AG2B 4ANUA 5D2LE 1TZOA 2LR4A 4V2CB 3AT8A 1CLCA 3HBGA 3POHA 2IGTA 3HG1B 3PWJA 2AQNA 3F7LA 2ZX9A 1A6VH 4EZJA 5J12C 2OL3H 1W0WB 5D5MF 2P3YA 5CJ5A 4Q6YA 1UM5L 2Z9TA 1Z2KA 4MQSB 1WS7A 1YC8A 2BY1A 5LAPA 3IGLA 2OSWA 1QA9A 3IDJA 1MFEL 4OZGF 4OSUH 5HPOA 2QV2A 2KMWA 3BWAA 1LMIA 2F68X 4ISVB 1ZA6B 3X1FA 3DV6A 5HI4D 5FYKL 4GP5B 1JK8A 1MCOH 3EYQD 4Z7WF 4LFHG 4NCC1 4QOKA 2YUVA 3FAXA 1CUOA 1ODUA 3MRFA 2YZ1A 4J7RA 3UP1A 4CBPA 1KJMB 5I8OL 4YDVB 4Y4HC 2Y7SA 2UXTA 3MV9A 5DRXA 1JF6A 3ZYZA 3NN8B 4I1RA 4OIAA 1S9YA 4PJDE 3O4OC 2GEQA 1WA2X 4XP1H 4ODWA 1BEYL 4K3GA 1KCVH 4NKDB 3RIFF 3SCMA 2VGLM 2WWOA 3ZDZF 4FXTA 4NB7A 4U31A 2E5EA 3MUY1 4XCFH 2CAKA 1KELH 5I8CA 1J9QA 4BFRA 2CDEA 1FZJA 4MMXB 3V0AC 3LSOA 2AP2A 4BRVA 1G7PA 2XX0A 5C09D 5T3ZD 3SPGA 5I76B 1FGNH 4JREC 3VFWA 3PP4H 4E9TA 1CIDA 5AOIA 1OAQH 4UAOB 1E67A 2Z1PA 5FGBA 4EI5D 3BH8A 5GS0L 1ACYL 2ZSWA 5HYJA 3PXJA 3QRLA 1W16A 3JTSA 4OD2A 5J6HB 4E68A 2QDVA 3HE7C 3V6FA 3BXNB 4J6IA 3U4BH 3C2AH 3SKNA 1ACXA 1MW3A 3LYRA 2VZUA 3QEUA 4BWUA 1EMTL 6TAAA 4WV1A 1E6OL 3NIGB 4LPCA 1Y1DA 3VU2A 1CE1H 3BSZH 5IB1B 3OHXC 3O4LD 2I5YL 3PNWB 2HVJA 4LMQI 3NDZE 3ZE0E 4PS8A 2OMNA 1DDHB 3QEQD 5HYSB 3AMLA 1RZPA 3QEGL 5DZVA 1C5BH 2YRZA 1HHJB 3C5SB 4OLZH 1GGTA 5F96L 3EO9L 1WAEA 2VXVH 3FU0A 3I84A 4YPJA 3P0YH 4PB9H 1S7QA 3FCTB 3TEWA 1NFDE 1YEHH 4TNGA 2OMXB 4AVHA 2C3GA 5IT2L 5I1GH 1YY9D 3U0WL 1CG9A 1IGFH 4MMZC 2EKSA 2IDTA 2FWSA 4EDXB 3SDCB 2IWFA 5EORH 3LZQA 4LSRL 4NPYA 3MJ9H 2F8XC 1NC4D 4WUUB 1QQDA 1IBGL 1LILA 3WFBL 4MQXC 4XPTL 5T1LD 4R7LA 3KWXA 4G3YL 3T0XA 1JWMA 1JNLH 1SEBB 1ZMYA 1PLCA 2HTLC 2MRYA 1CICA 5HPMA 3GFUA 3QARA 1GXEA 1B6DA 4RESB 4WY7L 2XWRA 5IG7A 2V2TA 1SQMA 1FFNA 4FNUA 4GAYB 1N70A 1BJ1H 1JZGA 5E4EB 1EEQA 3ZZSA 3BGFB 4KUCF 1P7KA 4L3EB 3G5WA 2ZG1A 3EYSL 4Q0XH 1V7NL 5DZ9A 3TA3B 1FVEB 1EAJA 3W0WA 4QHKI 2JKTM 2IAND 5EU4A 1EIBA 5J13C 1TEFA 4I3SH 1DVZA 1J5OH 3SY6A 4YBLC 1BBJA 3GMLA 2BHFA 2XWJA 5D2NA 4YOKA 4C58B 4ZYKA 4QXVA 3SPVB 3ESVF 3LQAC 3THML 4WU5A 4LPWA 2OA9A 3LS4H 4Y7OC 2Y2TA 2ZICA 1K8DA 1G7LA 3X12B 3IAQA 5J6SA 3T0EC 4RZCA 4YDLB 3VA2C 1JWUB 1W72L 3FFDB 4LEXL 3B2VL 1JZ7A 2O61A 3BVWA 1J0HA 1FO0B 3HC3H 1KIRA 1ZE3C 1MRDL 1W72B 3BHBB 4M61A 5IIEB 1SN2A 1R34A 1CFVH 1J5IA 4PJHF 4ORGB 8PAZA 5LWYH 2YK1L 4YX2L 4OZIF 3C60A 3APFA 1SHXA 4XCEA 4YC2B 2K9FB 1D7FA 3WKNA 2J4WH 4MA1B 3GRWH 4LHUD 2Y07H 4GP8B 1KGXA 3B7TA 1OAXL 4UYQA 1ZTXL 4NZUL 2MCMA 3DWTA 4LASH 1WT5A 2KC0A 3MA7B 3KR3L 3OF6A 3NA9H 1W8NA 3US1A 4DAGL 2HRPL 1D7BA 3KPMB 4NRZA 4Q4IA 3VFSA 3GO1L 1OANA 1NPNA 5JIHA 1D5XA 1NLBL 2F2HA 5FHBL 5BNXD 5HDOA 2I07B 5H37H 2B59A 4IJ3C 1Z3GH 5DVMA 3HPLA 1J0JA 2WIIA 2XG4B 2XQBL 2C3WA 2DM7A 3G3LA 3BWUC 4KKAC 1ZIAA 1MFBH 3UEZA 3AREA 4A68A 2AEWA 1IGTA 3QXWA 1NGQH 4ANKA 3KPOA 1KN2H 3US9A 4JFEA 3IU4L 1MZYA 3O41B 4Z3GA 3QWOA 1DQJB 2ZOWA 4FL4B 3LRKA 2D03L 4AYEC 3FOLB 3F7YA 4UT7H 4WAFA 2PWDA 3N55A 1KG0A 1U2YA 4U3XA 3ZY7A 5EU6B 2P8LB 4Y89A 4PJXE 3FBKA 1MCRA 2YUWA 4KV5F 3BMVA 3KVDD 5KSVB 1IQWL 4N0CC 4PJ8B 1Z1WA 4XAKE 3QORD 3SKMB 5LCVH 1KTDB 1M57B 4XMTA 1NCWH 3LQZB 3RG1C 4MJ6B 4Y5VB 2ZP8A 1N59A 5IB4A 2F58L 5IOPA 3V79C 3S9DB 5DJXA 2XA3A 4IEFB 3ZR5A 3W3BA 5MEPB 1NAML 3NJGA 5JW5B 4N1HB 4JCMA 1S7XA 2EEAA 5AVSB 4GXUN 1U3YA 1YQVL 3T2QA 5I1CL 1NAMB 1TCRB 3N1QC 3UJTL 5C0AA 3IKCA 3L6FB 5L2KA 5CZVL 3FO1A 3U7WL 4TPRL 2O6CA 5I24A 4JGMA 4IRJC 2QSQA 4YSOA 2LFGA 5CKGA 5F7AA 1KB5L 4G8EB 4L1BA 3S8WA 2XXGA 2XBTA 4Y19E 3GXPA 1KEGH 1G0YR 1PAZA 2AITA 3J8F7 3KS0J 1KB5B 2OMTA 4NCDA 2E75C 3JWDC 4Z7VE 3X1BA 5IBTL 1L6XA 1M4KA 3CXFA 2VNCA 4MS6A 2JI1A 4WCYH 4M6OH 3D08A 2W38A 2X4PA 2CA4A 3X1GA 1FDLL 3IDNB 3SDDA 5DZLA 4DKEH 1OQXA 1E4XH 2Z31C 1SZNA 1KPUB 3P2BA 4WHCA 1IJ9A 1PNDA 3FSZA 3OWEA 4YQXL 2Y0SA 2AKRB 3O6MH 3ARGA 4IOFD 3ARBD 3KPLA 4IS6B 4EXPX 1ZRUA 3DI2B 3BRFA 5IROA 1KCUL 5I30L 4JE0A 4HXAH 1YPZB 2BINA 3UGUA 3WMQA 3SGKC 2VXTH 1T7YA 4TULH 4XMZA 4QRRE 2R1XB 1EJ8A 5D7KE 3CLWA 4KTDL 4ONHB 4UQDA 5BO1H 3M17A 5JHMA 1EAPA 4WI0A 1E9PA 1MPAH 3GSOA 4KJQD 1R5WA 1WAPA 5EF0A 2OI9C 2ZWZA 1A7OL 3NGBB 5KOMC 3VGAC 4DKTA 2Z7UA 3GXIA 4PP1D 4CMHB 4FQIH 3RA7L 2O5XL 4KUCD 3CC5A 3VGGA 1RHHB 1RIUH 1MEXL 3NSJA 3S5YA 4HIEB 4TXVB 1FN4B 1ORSA 2P28B 5KSBA 3QHFL 2NY0B 3N6YA 2KDYA 4PP2A 3DPDA 3H9SA 2IOOA 4N2BA 2SEBB 3VGBA 2MPAH 2JCCE 3PIQA 4UQ3B 2XC8A 1T5WB 2VZVA 5D7EA 1K4CB 3IMBA 4TOYL 1HILA 1JWSB 1EEYB 4DQAA 1ND0B 3SKJL 4P46A 5EG6C 1OM3H 1T5XB 2EDFA 1AO7B 1WHOA 4DTGL 3HNVH 5JQ6L 2HB0A 5F9OH 5HGGS 2NW3A 3T3MF 2QPEB 3ET9F 4UT9A 4XNUL 4A7TA 4AKOA 4DN3L 4CVUA 1OZTG 3VH8G 3ULVE 4OLXH 5CAYB 4GKZB 5HHXL 1IC0A 3H3PH 4XNZB 3GT6A 4JR9H 1LP9B 3CMOL 2APSA 2JIXD 4P5KB 3BVTA 4KRLB 3L3DB 3VFPA 4CJ0A 2CLRB 2VDPH 1UD3A 5FO9B 1UZGA 2XWBB 3DSNA 1PLGL 1YY8B 4LBEA 1JNJA 2PN5A 1IX2A 4QXUH 1NFKA 4ERSH 4ZMAT 1U8LA 4AH2A 2DLFL 4LGPB 1G9ML 4DH2A 1QLFB 3Q5TA 3RDTD 4HBCH 1JHLL 4DW2H 4KRMB 3NCMA 1T1XA 3WLBA 1CD9B 3C5JB 1PGRB 4ZX3A 1UWEL 2H1PL 1BX2B 4W9HC 1XF4B 3O11A 3KJ4C 3FT4B 2GJRA 1FNAA 4NKOA 1PZDA 4FQ1H 4YHKL 5EPMB 4OTXH 3TPUB 1FQ9C 1NOFA 1I9EA 2XFGB 3IU3A 3V52L 4UM8A 1AGFB 5LLIC 1FNEB 3ZIMA 2DQJL 3QT2A 5SV4A 2WZAA 3GHBL 5ICUA 2Z92A 1JV2B 1RUKL 5LB1A 4OUOA 3WNKA 1TZHB 2LQRA 1LO4H 5I75B 1HZKA 4XP4L 2N3JA 3DBXB 3FCSB 4NNPH 1OCWL 4NRYB 2ZUTA 4F9LA 2XQ0A 4HIHA 1E4XI 5TE6L 1PYWA 3LNHA 5EC1A 4MAUL 2A6DA 2WQUA 1BYNA 1COBA 1F4YL 1D9KC 1WH0A 5I19L 4YEEA 4YDJB 4N0RA 3B83A 5GSVA 5I6MA 3A4DA 3IWUA 2RB8A 3N5AA 4PBDA 1OE3A 4OZGA 4UDTA 2ZWYA 1IGJB 3HI1A 2E56A 4H8WL 3UC2A 4DGVH 3QYMA 4X7FC 5TDPA 2E3VA 2JJSC 3OJDB 4W6XB 5K5YA 1P9MA 2NXZC 4TNVF 4DZBA 3ABGA 1D6VL 4U3HA 3LEXB 1AKJB 2B1OA 3PP3H 4LP5A 4E9SA 5A6LA 4QHUB 4IMKC 1R75A 2BIMA 5E2VH 4E41A 3ULVH 5D9SA 1HCFX 2GC4C 2HVKA 3E6HB 4JKLA 1OQOA 4QO1B 1A5FH 3QR0A 4FTVB 4WNJA 5DJCB 2ORBL 4ZTOL 1UYWH 3COOA 5BO4A 4O4YH 5CLWA 1ZDQA 4KMQA 5AW4B 4OKDA 4D9LL 1DSFL 1FE8L 1KDJA 4Y2DC 3ESOA 2AFNA 1EGJA 1WUNT 2EIBA 4FQHB 2TSAA 4X5PA 1WSST 2A6JA 5DD0L 5E8EA 3ETSA 1F11A 1EEZA 2NNCA 3IN0A 3GMOB 4G8GA 3U2JA 5CEZD 3EFFA 1I9IH 2P7TA 1D5BA 5FK9B 1N5AA 2ALAA 2VKXA 4L1TA 1W0VB 4F1ZA 1SJVA 1VSCA 2GITA 2W92A 4AGQA 4BFEA 2XI9A 1RJLB 3QQ4A 1WDAA 2PW2A 5I8KH 1RZFH 3S5LG 1KB9K 3VTMA 4KQ4H 5ESVB 1H6EA 3PABA 1P5UA 1NLDL 3CX5K 1U8NA 3MA9H 1NEZG 2HRGA 2FNBA 2YGOA 2JELL 2ZX6A 1IAOA 4RFEA 1XD1A 1IGIH 4FLRA 1FG2B 3FUNA 3BUDA 2CXKA 2X53A 4FULA 4NUJA 5KTEL 4YVUA 1WWWX 4NM8H 1IMHC 2VAAA 3IMRA 4A2GA 5CILL 1HHIB 1FGVH 2VIRB 1ED3B 4KDTC 4N2CA 5HY9A 1AD9B 2Q8BH 4U1LA 5ITFA 1CYGA 1FIEA 3M45A 4P4KC 1EDQA 3W57A 4N0UA 5KYUA 4OZFB 5SV3A 4YHZL 4JQIL 4M93C 4WW1B 3K91A 3ISRA 1A9EA 1MF2H 3OKLA 5CJQH 4ELMF 2B0SH 2DYPD 2X4SB 5IQOA 1HC1A 4D8PB 2DIBA 4QRPE 2MHAA 4DQOH 3BESR 4KDWA 4D0BA 5C6TL 2P5WD 3KXFE 5IHWA 3NBNA 4OFKA 1NKOA 5KYYB 2ICES 3FO9B 5INCA 5E5RB 5K1NA 5L8KB 2HKFL 3HE6B 1S7SB 2GHWB 1E0OB 2FYYA 5DJ2B 1CL7L 3V10A 2B3IA 3F00A 4G9DB 2Z7WA 3FQRA 1ICTA 2QHRL 3MLTB 4NC2B 4FQXB 1QRNB 4DKFL 5B3SB 5EF1A 4UM9D 4TUJA 2YAOA 3VXQA 3X13B 2FBJH 2OMUA 4WWKC 1EXHA 1O0VA 4GAJL 5DD5L 2WLNA 3D1MC 4HJGB 4DOHB 2QZQA 4UINL 2QMKA 4JFVA 1WAAE 1IFHH 3AZUA 2QTEA 5TF1H 3FB8A 4H5SB 5AAPA 3MU3A 4YWGL 4RBPK 4S2SA 3FQWB 1BAGA 4HIPA 4AIZA 4RGMB 4CDGC 4I3RH 4LQFH 5PCYA 4F2MB 5DT1H 3WDJA 2CUIA 4PRDB 3Q06A 3D2UB 1AMYA 2D8KA 3CQQA 4OCWH 5IW6B 1NEUA 5H8DA 2ED8A 5KSAB 2VR3A 2W07B 2DEXX 3RWHA 1JYVA 1X7QA 5DD3H 2Q76A 3GSQA 5D8JH 4M7JL 2X9XA 3BWUF 5I6PA 2ITEA 2WTPA 3VH8A 4JO2L 2BIOA 2IGFL 2DICA 1J5HA 3ARWA 4OFIA 2VE6A 4KY1L 1NGWA 1L5GB 5CCKH 3I6GA 4PJHA 3VD0A 4MNGA 1XCTA 1JUFA 1DQQA 4HPHA 4OD1H 4ODUA 5CN1A 1GC1H 3RNKA 4IBVA 2P8PA 2JJUA 5I71B 1FL6A 1T20A 3A67L 1A7PL 3N43B 4ZUVA 3BDXA 3KL3A 3SPHA 2DKSA 4J8QA 1A6PA 4JFXB 4KC3B 1L7TL 4Y4HD 3HG1E 4K5MA 4Z18A 5DQ9B 5C0BD 4I1NB 3DVGB 3D85A 1BQUA 4Y9BA 4AC4A 2KHAA 3QQDB 1OGAD 1IB5A 2NQCA 3ELAT 5DC2A 3S5ZA 3BP4A 4GBXA 4NYLB 1ZV5A 4U2YA 5LGKA 3REWB 2JWYA 5T1KB 1AZUA 3DK2A 4TUKL 3Q9QA 1OCRB 5EWIL 4KVNH 2Y7QA 1IIKA 2IVFC 3CBJB 4BFIB 2NXYB 5AVVB 5DMIH 4HKZB 5FYKE 4EKJA 3T5WA 5C0EB 3DMMC 3HE7D 4IRSA 4XRCB 4YFLI 3Q48A 4QNPF 4PG2C 1P4UA 2YPLD 3GMQA 4X0KB 2VLKB 4JFYA 3CPUA 1J05A 3ARFA 1PZSA 1N64H 1BXUA 3CFEB 3EXLA 1C5DA 1I8IA 3HUJE 3GEFA 2BW4A 2H5UA 2R4SH 1TU2B 5DJ8B 2DQDL 3L3GB 1XTLA 4JRYE 3FQNB 2F1BA 4QTFA 4DCQA 1V55B 1U3JA 3RGHA 4QRSA 2OJZH 4YZFE 3RB5A 4O2FA 3TYGH 3CSBA 4QWWC 7FABH 1CTNA 3L5WB 4NWUH 3MHZA 4UWQB 3ZTJG 2VABB 5I15H 1KUMA 4MDIB 4FP8H 4CVZB 1UJ3B 3DOHA 3Q2LA 4FQPA 2R2HA 3CVIL 3IF1A 2AK4D 3V5HA 2NY2C 3ELQA 4A7GF 4F7PA 3AFLA 4IGBC 1EUTA 4JFWA 1JG9A 1V5JA 3WIIH 4AK1A 5J9PB 3B6SB 1BVKB 4HD5A 2CO7A 2OZNA 4FXGA 2P80D 5F1IA 4Y1AD 4Q97A 1XQ4A 4Z23A 4Q2ZA 1FA4A 3AG1B 4MQXD 2UY6B 1JYWA 3NIGE 2XN9A 4ZQKA 5DUJA 4G6KH 3S88L 1QFWI 1DUYA 1MHCB 3D12B 5IB5A 3PQYB 4KRPB 3BGMB 3EOAB 4B50A 4XVSH 2BNUB 1XGQA 3O45B 4GQZA 2XNAA 4LEOB 5DURD 1ETZA 5TDNA 1M2VA 5BVJB 3EO1A 5DRNA 2WWKO 4NKMB 3D8MA 4PD4J 4AXWA 2R0ZH 4HJEA 3UJJH 1MQKL 5C9JB 2N7AA 3UG5A 5GQBA 4ESKA 3ECQA 1E2VA 4IBWA 5K69A 3GJEA 1DO5A 1ZLSH 1OXYA 2YWYA 3W0WB 2NYKA 3QZMA 3ZGHA 4LGSB 2AV1B 4PREB 1PQZA 3S5LA 4FLOA 4Y4FC 2WK2A 1WBZA 2W95A 4QRAA 3TURA 3F64A 2MCPL 4A55A 4Z0BL 4LNRA 3BCDA 1GJUA 1NEZA 4X4ZA 3PGFH 3VXSB 1UZ6F 4JEGB 3FYEB 4FNPA 4GUPB 4APQA 4KKZA 5AZ2H 3K2KA 4XMUA 4QRUA 3T0ED 3L9RB 4PI0A 3WDHA 5CR1A 1CU4H 2LAGB 4G7YL 4X7SH 2R69H 5A7BA 3RYMA 3NPSC 1DEEA 1MJUH 2DDQL 4JFDD 5D72H 2DOCA 5C1MB 1A1OA 3QXTA 4NGHL 2DD8H 1G9NL 2A9CA 2B9BA 3KYOB 5AOZA 4NN6C 4UBDD 3SYOA 3AT9A 5C97A 1OSPL 2WLLB 1D7DA 1B2YA 2A77L 1RZJL 3APDA 3ZVVA 2PPFA 2C4FU 4W81A 5KVDL 1UM4L 4XPAL 1BWWA 3QDAA 3I2CH 4Q9CA 3V4VL 4JLRB 3BKJH 4YSPA 5D4IA 2LABA 2Y2WA 2EO7A 3V4VB 3I50L 2EIKB 2EYRA 4UTAA 1BVLB 1YEKH 2CA3A 3VFNB 1XBRA 1CDUA 3WFDL 1QSFD 2VL5B 3BLPX 3TVMB 1L6ZA 1MLBA 4PJ5E 5TK4A 2AVFA 3PF2A 4OM1H 5BJTB 4DUXA 5T33L 2JKSA 3QIWA 4NQCA 1JDDA 4P2RE 5LBVA 4F8LA 5D4JA 3QG7L 4RGNC 2HAZA 2MSPA 3VQMA 5F88B 3GINA 3ARRA 1UVQA 3QUYA 4KKAD 1S5IL 4Z8FH 1F58H 1KENH 1OB0A 2VR5A 4XMLL 1H19A 2GK2A 4G7SB 1CD1A 3LH2L 2K8QA 3SODB 2A73B 4YHLH 2JK5A 4MAYC 1WRFA 3VQ2C 3KS0H 5IMOA 1NCBL 1OAYL 3C09B 3CQFA 3QNYA 4A2MA 5FB8A 2WQRA 3G04B 1FVCB 1ZTXE 1MCWW 1IAIL 4Z5RA 3PL6A 3W9DA 4AYDC 5MEOA 2AHIA 3IDYC 3NRQA 4Z7NE 2AEOA 2YQ3A 3KG5A 4R26H 3L1FA 1A3LH 1CLYL 4OFYA 4JRWA 4FEMA 3LIZH 4JG0L 4GQRA 1CN4A 4OT1H 2C1PB 4JRXA 1GS6X 1WZAA 2VISB 1A7QH 2BHYA 3LN9A 5LBSH 2H3XC 3AQYA 3MJ7A 4N0CD 3WXVL 4PRNA 5E5LA 1Q9OA 4BUHA 4RAVB 4FCAA 2VXSL 3G9AB 5MEND 3TF7C 2WNWA 1UEMA 3L54A 4MMYA 3KHQA 3TBSA 4GRMB 2OS7A 1XR9B 1RU9H 4NN7C 1U9KA 4YK4B 43C9B 1GIGL 3O6LH 3QJOA 5CLZA 5MI0C 3FT3A 1HFUA 5JXAL 4AJYV 2HJFB 4M4RA 3VI3B 3O2WH 4JFFA 4PBWD 4A04A 1MWAL 1NZRA 2A74A 3ZHFA 4F57L 4ZBJA 1B0RB 1JPFB 5C0FB 4AI7A 5HJBA 3AAZA 1MWAB 4NEHB 3DGGB 5ISZA 3D18A 2W9EH 4BDVA 4F37K 4PJGF 5T3ZL 5F7FA 3PFQA 3LPWA 2DLGA 5EU6E 2GTZB 4KK9C 5ANME 5C09B 4CNIB 1LNUA 2OMZB 3IJ7A 4GRWB 2H32B 4IRJD 1YEIH 5HJDA 4H8QA 2WWMC 3O3AB 2ZUYA 4MSWB 5I1LB 4EI5B 1XX9C 3KBFA 4CC0A 1ADQH 4J23A 2JKLA 4JPKH 4UIMA 2EADA 1ONQA 5TE4H 3BO8A 3WGVB 4Z0XB 5IFJB 5FKPB 2VRQA 3RFZA 3ME0A 1HSBB 1I8LC 1XSOA 3KPRD 5JDJA 1BFVH 1CFMA 2LU7A 3D09A 2V33A 5DQDH 3UTOA 1PZ5B 2A4CA 2AJZA 2GJ6A 3GDBA 4NNYA 3T65A 1FFOB 1I7RB 2BHZA 3O4LB 3B8SA 3WO3B 2Z31D 2Q6WA 5I1EH 3R1GL 4CN4A 1SXBA 3QEQB 3IVKA 3L7FB 5A2JH 1BF5A 3MGOA 3WJMA 2Q7AA 3R8BB 3SE8L 5GS1A 2WUCL 1PFCA 3KH3A 4PH8A 1M7IA 3E8UH 3T71A 1QHOA 4N8CL 4AJVA 4ZODA 3SYPA 2WOYA 2AXJA 4IOSD 4R7XA 3VXRD 4K15A 4HGMA 3FCGA 3GNML 3T4YB 4MMZA 1UM6L 2XQYK 1IM3D 3D48R 5GZOA 3MMEA 4HLZG 1BAFL 3EJJX 3GI8H 4RGOH 2YGQA 1KWKA 3UP6A 1E9PB 1U33A 5FO8B 1NC4B 1NCUA 1U93A 2YD7A 3MV8A 1BQSA 1QTSA 4CBZA 1U6AL 5T1LB 1PD1A 2EDEA 1OWWA 4JGNA 1SLVA 4IIQC 3RGVC 2ICWA 3QFJD 1E50A 3N85L 4CU8A 5SWQB 3UGXA 2FECI 1B2WL 2DJUA 2PTUA 4IBSA 2EH8L 4OGYH 3KDPB 4G80B 1CPUA 1WLHA 4K23H 2X4NB 5B7FA 3LS5L 4ZMLA 1DE4B 1HILB 1QFUH 3ZL2A 2HJLA 4MD4B 4TVUA 5HJ3A 4JN2A 3K6OA 3RVVC 1F6LL 3GIVB 1JD7A 3T77A 2IANB 2JI3A 4ZW7A 4UT9L 3ZDYF 3CFBA 5F89B 2PYED 4OFVA 3IJYA 1U36A 4YSRA 3LNDA 2GVYA 2H47C 4DVRL 4Z7UA 4K0OA 1DBML 3O2VL 4MD0A 2YAPA 5L8LB 3SQOL 4ALAH 2D9CA 1R3IL 2H8PB 1MIMH 2W9LA 3BDYL 3CXDH 3S97C 3P4MB 5JMOC 3MLSH 1A21A 1JFQL 4AX3A 4YUEL 4MKMA 4X50A 5CCJA 4M29A 3DX7A 1EXGA 4ONOA 2QQLL 1TTAA 3T2PA 5F1SA 1K2DB 3TBVA 4QTHB 3HZMB 1QAWA 4G43B 1A1NA 4X7CC 2Q87A 2A3TA 3N06B 3NIFF 4HWZB 3D51A 5BUAA 3AJ7A 2HWZH 4NQXB 2EVJA 3TWCH 3BUTA 3MRHB 4M9OA 5DJDB 3KWVA 3RJDA 3HPJA 4LHUB 4P2OC 5HHOA 3LKNB 5BOPA 2ICEC 1SLXA 3K81A 4BSVA 3K8MA 4X7TA 4I9WE 5KVGL 1LP9E 4EBQH 4GI8A 2WCPA 4FNRA 3CG8A 1UUNA 1BPVA 3LKOB 5F9DC 4KX9A 2DF3A 4XN4A 3C5ZC 4NT6B 4ZS7L 4YDKH 3SGDI 5FM5O 3VXTB 3LIUA 1SJMA 4AEIL 2I60L 4FFVC 1XGYL 5CIPH 4DO4A 5DVPA 5D5MB 1E8XA 2A6DB 1D9KD 1F42A 2F54A 2VN7A 1M9WA 1VB9A 3ZRSA 4ETQB 4AJ0A 3VCLB 2ADGA 4K3JL 1HHGB 3UAAA 1LEIB 1T89C 4M62L 3Q6FA 2DQUH 5DTFA 4M7KH 3FPXA 2PWGA 3H7BB 3CN1A 4PJCA 2XPGA 3OKEA 5BRPA 5E0QA 2DQEH 1YEFH 5E99L 4Z9KB 2R2BA 3FTGA 5MERB 3PJSB 1LE9B 2B4CH 3MACH 4WFGE 4YSDA 1TVBA 2NXZD 4Q9BA 4ZXBC 2EUXA 4JFOB 3X14B 2UWEF 4BGLA 4KX8A 2R29A 3WG7B 2D2OA 3O2DA 4Z7WB 4E41B 3AM8C 1FL3B 1EFQA 2LAAA 2AS5M 1EHXA 1DUZB 3DTXB 1HH9A 4CSSA 3EAKA 5I9QB 5CGBA 3QDGA 4ONGH 3K71B 2ZCLL 7TAAA 2FATL 3ESMA 1TZ8A 3QORB 4S1RL 5G4NA 1Q9LB 1AHWC 5C0JA 4BWWA 5I1KL 1EGJL 1H8SA 1T2QL 1CGVA 3S0PA 1V7ML 5K9QI 1ZT1A 4ZOEA 2OCJA 4NIYE 5GS2H 4QMEA 4KI1A 3LN5B 4GH7B 5EO0B 2WXMA 2KLSA 2DQHH 1DANU 5DD1L 1TJGL 3VFTB 4ZFGL 4BFJA 4O51A 2EDNA 2XBZA 1MG3C 1CQKA 1SM3H 1CDYA 2P7TB 4TUOA 4D0CB 2X1OA 9CGTA 3FQ4A 5E8PA 1CF1A 1TQCB 2C9AA 4FFYA 4R5XA 4OZ4B 2D31B 4FTVE 1AGCB 3GHEL 3GXNA 4PRHA 2G60H 1L9MA 4K8RH 2HH0H 1JXDA 4BEIA 4Z3TA 2H0EA 1AIFB 5AOMA 1X6NA 5JPMA 5E9NA 3BT0A 1MCPL 1S4IA 3PABB 1CFTB 4A6YA 4GS7C 2EABA 3L5JA 4NJAL 3U1PA 3ZU8A 2QVTA 3FUEA 2EO9A 1JTOA 5K1VA 3EIFA 4LSVL 1NBYA 4WHYH 1HN1A 1N5YH 4G6MH 1FNFA 3KPQA 4XO5A 4OBRA 3FSAA 1HU8A 3L7EA 3GMRA 2E27H 3DJSA 4FJZA 3QWRA 4H1LH 4LPXA 5EOTB 3GS0A 5HHNA 1J1XL 2X6AA 2ZP0T 3IB4A 4ODTL 2OSXA 5CUSL 3VXOB 3D69A 4NO5A 5FDWA 1BVOA 2R0WL 2WPGA 4P4KD 4PVNA 4RMWA 4U1LB 4XI5C 3ARBB 4HEPG 1L9SA 1P6FA 1T4KB 4FNLL 5DGQA 3G6DL 2OXGB 3C6EA 5KANG 1X5XA 2P1YA 4ZSOA 2ARWA 4M00A 5CCHE 4OFPA 1TOXA 3QJFA 2XTJC 1U4FA 3V7MA 3U7YL 1G9EA 1UQSB 4UNTA 2XWCA 3D25A 4NSKA 5EV7A 2ZUUA 1FYHB 1R46A 4HWNA 4UT6A 1KN4L 1MJJA 1SYSA 2LLLA 2Y5QA 3S3SA 3ZOAA 1U8CB 4Z76A 4KTYA 5IW1B 4BSWB 2ZCHH 2WNKA 2BFVH 5E2UH 5F3HB 1K72A 1DLFH 1WBXA 3L9BA 3K4ZA 3VG0H 5L2JB 4Q7DA 4XR8C 5INDA 1WP6A 3ZTDC 3TESA 1FNSL 4JS7A 4WWKD 2J8OA 3DXAA 3IGUA 3OKDA 3VFMB 1VGKA 5ESAA 2E76C 3LRGA 1VPOL 1RKRA 2VR7A 2KPWA 2NR6A 3OPUA 2Q8AL 4IBQA 2OKMA 4ZD3H 2CCLA 5FHAL 3MLUL 4IKNA 1RK1A 1K3ZA 4PJAF 4XVTH 1RJYB 1ZLWH 4MZ3A 1S2EA 2RQEA 3TO4C 4HC1H 3N40F 1YYMH 3BKCH 2Z34A 3KDMA 35C8H 1JS4A 3F12B 2V37A 4X6DF 2ARJB 4P5TC 4A2EA 5CO1A 3BAEH 4HAFA 1LE5A 1NTDA 2VB5A 4FHKA 2XV0A 3N40P 1I3UA 4X8XA 4YJZL 4DGYH 5I28A 3KYKH 2F74B 1WO2A 3KCPA 4OCYL 2JIXB 1MAML 5D7IE 3PYCA 3WMPA 2C7UB 4RNRA 2X3BA 1JCVA 3F7KA 4DVBA 5IV2B 5ACZB 3LD8C 3ARUA 4UMGA 5C0CA 2UXGA 1BFSA 3BPNC 1JZ5A 4EOWH 4MNGB 1E3FA 4OZIB 4DOHE 1JUFB 4G83A 1G6RA 3BEWA 2IG2H 2VWEE 1NBVL 4N28A 1IEBB 3CFIC 3RDTB 2EDOA 4F2ME 1RI8A 2WQWA 4U1IA 4YHOL 3S96B 4U6YB 3TJEH 5ANHA 8CGTA 3ZYJA 3MGTA 3QRBA 1JNHA 2ZCKH 4ZUUB 5HYFA 5T5FH 1TLKA 5I1DB 3JUZA 4R83A 1OARH 1Y0LA 2IH1A 3WMSA 5E6IC 3GRGA 5AVYB 2AABL 1QFWM 4PJIF 1IRAY 1X3DA 1LEKB 2Y9RT 4JE4B 3EGSB 4PR5B 4X4YB 5TGBA 4F37F 1LO0H 2VITA 5C08D 1RZ8A 2WYZA 1ZA3B 3I02A 3MLRH 3D4YA 5CZKA 2VDQL 4R9HA 1UOVA 3DMMD 3RB7A 4OAWB 4AQEA 4QOKE 4HCRA 2V3FA 2X4UB 4LLDB 1Z6JT 2VDQB 2XXMB 3DVIA 3DIFB 2XJKA 4FQQA 4OF0A 4X80H 3MV9E 2CGZA 4R2GC 3P77A 4KMTL 4TNWK 1IGML 5I0XA 3NZSA 3T0BA 2VZTA 3QJVB 5DHMC 3MUUA 1C9SA 2IO5A 3SKOB 1NINA 4BH8A 4QRSB 4QWWD 5AENA 4U6VL 3NFNA 1DFBH 1R5IB 1TTUA 2Y3NA 4XPBL 3CPLB 4NQQA 2HUEA 3B5GA 2WVTA 3BZ4B 5JHDD 1FV1A 3SD5A 5EC2B 4WENB 4X99A 3N1GC 2NY2D 5FOBB 1LK3L 3QS2A 4IGBD 3PE9A 4WO4A 1I8KA 4EIZC 1BIIA 3IETB 2XZCH 5AFAA 5JPNA 4K71C 3VJ6A 5SX4I 1M71A 2CO7B 3OPZH 4Y2DA 5F1IB 2AEQH 1WITA 3NPZB 3PXLA 4Q6IB 3MLXL 5IGXL 4PJGA 5C3TA 3VI4F 3IMWA 1ZHBA 2IJ0C 1LO3L 3BI9X 3MYJA 4J3XA 4G1MB 4UU9A 4EVNB 1MVFA 4HUVB 5I73B 1INDL 4BINA 3ZDWA 3Q1SL 3U4EA 2DQ6A 1FLRH 5CEZL 4RWYH 3X11B 4NENB 1VKXA 4C54A 5IJBC 3GIZH 4NO2B 4JPWH 2ZUQB 4XBPB 2NUPA 3W2DH 4X6FB 5DD6A 3HB3C 5F1KC 3MO1A 1P2CA 5GGSB 2GIMA 2ZOLA 2JB5L 4ANWA 1O6SB 1NBZB 5IVXA 4PYHA 2DWEA 2BVOB 3HAEG 4PJ9C 4FFZA 3UCRA 2C9XA 3ZYIA 1S7WB 4RA0C 2BP5M 1IQDA 2ZJSL 2WSKA 4CW1B 1A9BA 3OR7A 2DW5A 1Z9SA 3DUSA 5I1IH 2AI0H 5E7FA 2BWDA 3IYLW 1TVDA 3B2MA 1X5AA 4L4TD 4Y4FD 5ENWB 1AC6A 4MWFA 3G5XA 1YJDC 5F7DA 3QR2A 4AC2A 3H8NA 3MRQB 3RWGB 2GUOA 1AI1H 3LEYL 4I0KA 2AEIT 3TBYA 3QUZA 5E6YA 4GXFA 4S1QH 4NC1C 1U95A 1XH0A 2E7HA 2V6HA 1SJHB 3ZHNA 4X5WA 2IV9A 4KK8C 4ODSH 4OLUL 5GSRB 2QELA 5JOFA 2ZAIA 1T0MB 1GGIL 2CLZB 3ORJA 4HEPA 4HOXA 5JUEL 3U82B 5A43C 4Y8AA 2J56A 2DYPB 5C0RL 5IOKA 3W0WE 5HGDA 1MRFL 1H5BC 3JWNE 3BEVB 4JMNA 1KIQB 5D2NE 5LVEA 1W8EA 3REVA 2Z93A 2J43A 5IVZB 3TNMA 4OCXH 4F8TA 3MJ6A 3ULVC 2XIBA 4LHUG 2ZYSA 3NFPB 3VXSE 2BLFA 1HHKA 4LESA 4M7ZB 3OQ3B 3FQXA 1P5VA 4LLMB 4QXGH 5EZPA 3Q43A 1BF2A 3O0RL 4R7NA 1X5JA 1MXDA 1RQ5A 3E9UA 1XF2A 2LTQB 4FJ6A 4TS6A 3AVEA 3KEHA 5IB2A 4UM9B 1GW6A 2WC7A 2R2EA 5DHYA 5F3BB 1BBDH 1XGUB 3FH5A 5G4MA 1DJYA 3T3MB 5FW8A 5E2WL 3EH4B 4QLWA 1MVYA 5J6GA 4GG6A 2FR4A 3P4LA 3SKUD 4KXDA 4RGND 3E0GA 1NIEA 3T1FB 3BVVA 1AY1H 2AQ1A 3OXRB 3V0DA 3OKKB 2G3NA 4WGKA 3KZ8A 1PIFA 3E3QE 1JGLL 3HHSA 1E30A 3WNOA 1SYVA 5J12B 5C07D 5GGVH 4MAYD 5F7EL 2AJXL 3F6IA 4TQEH 4DT2A 2B2XL 5IMOB 4EO5A 4C4BA 2AJYH 4JO3H 4AYSA 4KZEL 5KVDE 1J7VR 5FC9A 1IKNC 3QA3A 4J1UA 2VSCA 1RZKH 2ZONA 3WXWL 4PJDF 2DBLL 3ES6A 1S3RA 3MRPA 3H0TA 3FFCA 3FU7A 3OAZH 3CX2A 1ML0A 4FQ2L 4CN1A 1A14H 3SE9H 1VFBA 3U79A 1IAKA 5KZCD 1FJ1B 5DJYA 5GRWA 2CR6A 5BZDA 6CGTA 3NJJA 3B1TA 4H7VA 2IH3A 3CN2A 4XOCA 5IMLA 1LEGB 1QNZH 3QIUA 4MMYB 4N86A 1ILUA 2XKUA 1NKGA 2DEYX 2YD1A 1DBBL 4RMSA 4Y4HB 3NCBB 2EC9U 1BD2D 5C0BB 1RZGB 1RIHH 1QLEH 2CK0H 3O4OB 1Z0MA 4L5FH 4JFEE 5C2BH 3DIDA 4JG1L 5KBNC 1OGAB 1TITA 3RU8H 1MVUB 5FA3A 2W65B 3WUWB 1T0PB 2J6EL 3CDZB 1GS7A 2DQGH 3ERXA 2ADJA 1UXSB 5G4OA 3S3JA 4KK9D 3TZVA 4U1GC 5GHWL 4C59B 2WWMD 1C16B 4JY6B 3G08B 3ZE0F 3KWUA 1M05B 4V1DD 3QXDA 4KHTH 4DGIH 3TFKC 1G7IB 1R19A 3HKZA 4U6XB 6FABH 2FBOJ 4ZPVA 3HE7B 4HD9A 5IWLC 4JDVB 3OZ9L 4HP5A 3HC4L 3NOIA 2GFBA 4S0HA 2WLZA 2H45A 5DEFA 1LDSA 2FEDC 3MI6A 3UC0H 1J18A 1KTJA 4Z7QE 4OD3L 4K7FA 3UTQB 1E4JA 3MRLB 4I18C 2ESVA 3OHXB 4KGJA 2H26A 5KYWB 4DEPC 4HJIA 2MEJB 3GJFH 3QDJD 5ECGA 5L2KE 5DZNA 1XMEB 5CWSB 1CYWA 2V2WB 5C09E 5T3ZE 4GRWE 3EYVB 5ACMA 3US0A 3GK8L 1UUSA 2BWQA 4YHYC 2AK4B 1UCBL 1CZ8L 2FL5A 4XNMA 1I1YB 1S78C 3DJZA 1TUPA 3FNKA 5F70A 4PW4A 3BZEB 4Y1AB 3IJSB 3JTBA 1TZGL 2DIAA 1DBAL 1PKQB 2HX7A 3QQ3A 3QXUA 1N4XL 1SJEB 3IDXL 1Z5LB 4FNQA 3RGVD 1MI5D 4KJPC 2X40A 4KXZH 2J57A 2P5PA 2BVQA 5E8DL 3TL5A 1OHQA 3TIEA 1VZIA 2DQCH 1PCXA 3BOVA 5DURB 3QCTH 4WDIB 4Z1PA 1TVHB 1L7IL 4X6EB 1GOHA 4ZAKC 1LL1A 4LSUL 2UZXB 1DL7H 3I9IA 1CGYA 1Q9WA 4LCYB 3GMPB 2PXYA 5FW6A 3HAEA 4C56A 3RVVD 1A4BA 1X4XA 4CSPA 5EH1A 3MCLH 4LAQH 5IHHA 1I9JL 3V4PB 2EECA 5J13B 3AGWA 3OMNB 4LPYA 3N1PC 4PGCB 4YBLB 4TTGA 1N18A 4CRPA 3LQAL 1GSMA 5HHPB 5HHMD 2EUVA 1WEJL 4G7VL 3P0VL 4X4XB 2G2NA 1D5IH 4MJHA 4XX1G 3RURA 1KTLA 1OP4A 4L0PB 1O9ZA 1U21A 4ELMB 5BS0A 1F2QA 4AK2A 4ZFZB 3T0EB 2H3NB 5AB9A 3H9SE 3O6FC 2FHFA 4MA3B 2HT4C 5IB3B 3RUGF 1AXIB 3HBZA 2TSBA 2VR6A 3OAUL 1NM9A 4QYOB 5F6IC 2NYYC 2VDRB 3P4NA 2FDBP 3IE4A 1PPIA 4JFDB 3TH4T 1UB5A 1N2RA 1BXVA 1WFUA 4KNSA 4FHJA 1D6EA 4EUPB 4ZMZA 1AD0B 2CUAA 3ZNGA 3TYFA 4P2OD 1NIAA 1OB1A 1JZHA 2V7HB 4I87A 1F5WA 4TSCL 3S3CB 5JW4R 4MNQA 4HK3J 1OAZH 3CSYA 1ROWA 4WNQB 3V8CA 1CDGA 3QUXA 1XR8B 2X70A 4JZOB 1DZBA 3C5ZD 3DGDA 4ZS6C 1WBYA 1K8IB 1JYNA 5CHNA 1QSFB 5JW3H 3OBAA 4NM4H 4FFVD 2OYLA 2K6YA 4JO4L 1C12A 4FXLA 4IJ3B 1RZ7H 4AT6B 4NBZB 3WTUA 1WGVA 1G4RA 4X6DA 3EYOA 3FSWA 1JN6A 1EHLL 4YO0A 1NL0L 2AGJL 4OZHB 2ADGB 3BP5B 3FPYA 2GQHA 4H0LC 3BW9A 3F6JA 4W1TA 5ICZA 4KO7A 1Q72L 3ZTNH 3VFRA 2XPGB 2XG5B 2X41A 3EGXB 3VGDA 1NCIA 4GLRI 4PWFA 2AZUA 2R29L 4ZXBD 3ESPA 1HSAA 3O2DL 3O81A 4TNWF 4LPUA 2OTWA 3ETBF 2X5PA 3KEDA 4KVCH 3CZGA 3F2LA 4GT7A 1SDYA 3V9CA 1JGDA 1RUMH 1CGXA 2VMFA 3CDGB 4HS3B 1ODAA 2AK1H 1I3RA 3WD5L 1HOCA 4KMLB 4N2DA 5GGTL 2UY7B 4MHHI 4RMQA 4YHNA 4IKKA 1ET5A 4LO9A 4E9WA 1U0QA 3OJ2C 3QH3A 4WFEE 1CT8B 1FFPA 1MCEA 4H8PA 5MENB 4XNXH 5B3NA 4QCIA 4Y5YC 1PNCA 1SBBA 3SE3C 2VLJA 2KZKA 4LL9A 1ZS8B 3DSFH 4WNSA 4X9YA 2JI2A 3CVCA 3DUUA 3U9PH 4HPYL 3MV11 4ICWA 4PS4L 3T08A 4OZGE 4OB5L 4H20L 4CC4C 4Q89A 3QS3A 4OGAC 5IJKA 1RJZB 2NQ3A 2CIIA 3LRHA 2ITCA 4KUZH 1NEPA 4R0LC 5EOCJ 4K7PH 4X8JA 3K8KA 2H6PB 4H8VA 3CHXA 1ZSDB 1NJ9B 3AXLB 2X42A 4TUOB 4E41E 1HZLA 4XXDB 3EGDA 2QKIA 1G4MA 4JHWH 5F1NA 4CILA 3NAAH 4IRJB