4W9HC

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 37
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9hC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9hC01
3ZTCC 4BKTC 4W9CC 5LLIC 4W9DC 4AWJC 4W9JC 3ZTDC 4W9IC 4WQOA 4W9HC 3ZRFC 3ZUNC 4B9KC 4W9EC 4AJYV 4BKSC 4W9FC 1LQBC 1VCBC 3ZRCC 4B95C 1LM8V 4W9GC 4W9KC 4W9LC
chains in the Genus database with same CATH superfamily
5K59E 2CBQA 1EEUA 3VFWA 4HWEL 3ULUL 3V4VH 4PV8A 2OL3H 4Q56A 1NIFA 4OIFA 2C3VB 1WZ1L 2C4FT 1YPZB 3EGDB 3L54A 1CCZA 3KPRE 2ID5A 4HKXA 5HGGS 1FFTB 3IKCB 3PLYA 2NYYD 5BUAA 1VFUA 5DJXA 3DTUB 1MRCH 4F1SA 4GW4A 1TITA 1T2QH 4JFYA 3TJHD 5IVZB 3SGJC 1ASQA 5L2KA 3ZE0B 3QO0A 4X6DA 5ES4B 3DYMA 3MAWA 5ITBL 4Z0XB 3LEVH 1WA0X 4CMHC 3GJFH 4L3EB 3RWIA 1TTCA 4IOSD 4YFEA 5FB8A 4NKDB 4M7LT 5C0EA 1LK3H 1AGBB 1WWCA 3E1ZA 3T0VA 4XCCL 3C08H 3EYFB 2G2PA 1MHPH 4TXVB 5K39A 3ABMB 2VISB 3BIAX 4ATWA 1YMMB 4YLBA 4G82A 1R33A 3LEXA 2PTTB 2CKBH 4IDJH 2IMNA 2K9FB 2YQGA 1ZHBB 2X1OA 1MAML 3I2CH 5GJSH 5EIIA 4XRCA 5JDSB 3CDGA 2IXQB 5HGAA 2HVKA 4A2DA 3HJEA 4DVBA 2OXGB 5IMMA 1OCWL 3STLB 4U2ZA 5HYSG 3DVFA 4JJ5A 1G9NH 2ZUVA 3L3DA 4O9HH 4ZOBA 3T0AA 5I16A 2AQ1A 2CZNA 2WYZA 2YXVA 1GYVA 1WQVT 3ARFB 4ODUA 3HA0A 4M3JA 4PV9A 2OMXA 3NDZE 5G2NA 3RUGF 1OTTD 1XGYL 4PJHA 3WSQL 1FNHA 4QYAA 4ZTPL 1AQKH 2BZ7A 1W80A 3DUSB 4LDCA 4NZUL 5HVHB 3GMLB 4LAQH 4YVNA 4U6XB 3UJTL 3NOIA 4PJ9D 4XP1L 5AZ2H 5DRWA 2NUTB 4BZ2A 1FZMA 2BSCA 3KGUA 2ZUQC 3SKJH 3RDJA 3GXDA 4TLTA 3SGEI 2WCSA 3WJLC 3TBTB 1S7QA 1F42A 1LMIA 3KWWB 3VXUD 2W9EH 1JPSH 4JHWH 4MJ2A 2DIJA 4FRWA 4H5SA 1BQHB 2DRUA 3JV5A 4NN7B 5BW7C 2GJZA 2XIDA 4LLWB 1TZGL 3IFPB 4G7VH 2KKQA 1DJGA 3S36H 4CC0A 2Q0ZX 5D1QA 4KAQL 2MCG1 3UCQA 2PYFB 3RWGB 1R3KA 4XPBL 3V0HA 5CBEB 3QBTB 3U30B 4L4TD 4PJFA 5DJAA 4I85A 4UTBA 5EB9A 3IGLA 1AGEA 5E6IC 4I1PA 1VPOH 2CDEA 4MKTA 5IJVB 3CX5J 1CVSC 4N0CD 2XYCA 3KLAB 2EKSB 2ZXEB 3QA3A 5DS1A 3VFSA 4KJPD 3MV9E 5FCUL 1N10A 3FTGB 4GKZB 1SJVA 1R3HB 1NCCL 1NIEA 4WEBL 1HCVA 1IAMA 2PR9A 2ARJA 4DH2A 1JN6B 5GGTL 3ZMEA 1URLA 3DX0A 1P6WA 5T1DL 1RJYA 3DBSA 5JHLL 2E27H 4HH9B 5F1NB 1XFPA 4HK0A 4FTVE 3QSKB 4AT6B 3APMA 3LRMA 3QWQB 4KKRA 2EDQA 3V5HA 5B1CA 4BKLB 3U0PA 3RGHA 3JVGA 3ATEA 2DQ6A 3MREA 5MERB 4AYGA 1A9BA 2YAEA 4LLQA 5ESQB 1YAZA 5AVYB 5ABZA 1G7MA 2VLMD 2XVLA 1T6BX 5I15H 4V2CB 1PF3A 4QGTA 2UX6A 1BFVL 3VM5A 3W0WE 3WLBA 1OT2A 1N68A 2XN1A 1Z3RA 3GSNA 3S3CB 4CBZA 1F2QA 3K4AA 4M5SA 3UTPD 4YAQB 2W92A 4OD2B 3UZEC 3NACH 4HUXB 4UT7L 2NOYA 4LP5A 3MRRB 1GRWA 1MJ7H 5LG6A 3T3PF 5ID1B 3FTVA 1I1YA 3GIVA 4WUKH 1U0QA 1C08B 3LKRB 4OTXH 1JZ5A 3BPCB 15C8H 4IBLT 3BH4A 2JB5H 3TT3L 4F15C 5HHQA 1E4HA 2CPCA 3T65B 4AYID 1QHOA 3UG4A 2W8CA 2LVCA 4FQLH 3JBG7 1EPFA 2GUOA 3JUZA 5LDSA 3GRBA 5ITFB 1SOQA 4UZGA 4Y4KD 3WJJC 3MLSH 4P23B 2AEOA 4ZW8A 3HS0A 4R8WL 2KZ1B 2VE6B 4JANB 3MLRL 3G5XA 5I2IA 4TSBH 5DRNB 1LWRA 1LHZA 3ATBA 1P7KA 2NY4B 2F6AA 1UVQB 2VQ1A 3H2QA 2YIHA 2F74A 1G9MH 1JNHB 3KLQA 3S35X 4G8IA 3ZYZA 2AK4D 1UYWL 2XNAA 4L9LA 4JFXA 2DQDL 2QBWA 4NQDD 3APFA 5A2FA 2EC9U 3EO0A 2CWRA 1G7HA 2MQ3A 4GUPA 2A9DA 5IF0B 1H15A 4PW4A 2GIMA 5C0NC 2OMZA 1GYUA 1KELL 1UB5A 4ZXBA 5DJ8A 3WELA 5AD0B 3GB7B 4H8VA 1O7DE 2AFNA 3EFDL 4MDRA 1OD7A 2XI9A 1AY1H 1T04A 4RMTA 5L2JA 4V1DB 5EG6C 1SVZA 1AKJA 2Y1AA 3M86A 1NEZA 1OOAA 2PUQT 4TKWA 1DVFC 2P3YA 2JH2A 1W8NA 2SODB 2J1YA 5GS0C 3B9AA 4JMNA 2CM6A 4M5ZL 4QEGA 3ZT5A 2D7QA 4FA6A 4P2OA 1TKWB 4B7IA 1YQVH 2ILLA 2XKUA 6PCYA 3MUGB 3RUGB 1AXSB 1NANH 4K7PX 1AXIB 2ZUWA 2PCPB 3BP7A 4PJDE 4QHKJ 4PJ8D 4XMLH 1QUNB 3BDYL 4KZEL 2DQHH 4F80A 1PZ5B 3GSQA 1M05A 3TN0A 1M6OB 2W59A 4HDIB 5C0AB 2WWKT 2BVQB 4CN4A 1SDYA 1N12A 1GGCL 3RGVC 1LEGB 4NQXB 1DO5A 1USZA 2RIKA 5EHFA 2VLRA 2QHRL 4H1LA 3JWOH 1J0JA 3CV5A 1IGTB 3NIDF 1E6JH 3DO7B 5HXMA 2NT1A 4FG4A 1GOFA 2XZAL 3CFKA 4YIQB 4AXWB 3UERA 5IMLA 2EXWD 1S4IA 1FYTB 2ZUSA 2VWEE 3SBQA 1HS6A 3B83A 4UYPA 3QRFM 3OKYA 1CXHA 3FPYA 4BUQA 4BZ2H 1SHMA 2CIKB 1ZLSL 3P3TA 5IVZA 2WZPD 1S7TB 1TSHA 3ILQD 4Y1AE 1W8EA 4KZCA 1KY6A 4HEME 4PJAA 4JDVA 1UWGH 1SLUA 4I4WB 4A7VA 4XI5D 2HJKB 5KSVA 1CLVA 1UFGA 4NKDA 3QUZC 4DIXA 1DBBL 1PAMA 1YDPB 1C5CL 1KCSH 2P1YA 4YN3A 3DGDA 2NY2B 3I02B 1OW0C 3EYFA 3HNVH 1PEZA 1RFDL 5D9SB 1P7QA 4R4FL 3HFFA 4UTBH 4YE0A 2GUYA 3AQYA 2FEEI 3KJ6L 4U4IA 5MP6H 4ZMZA 3ZTJG 3BUDA 2ZG2A 4ISVB 4KX8A 4BDVB 3TO4D 1W72L 1ZHBA 1MLBB 2Y72A 3WKPA 4KKZA 3CFBB 1CLZL 3GXFA 3VG9C 4R7DB 3LQAC 1O5DT 2VR4A 4N8CL 2ICWA 2L3BA 3WEAA 2H8PB 2YGOA 1MAJA 1QMUA 5DD0H 3EAKA 3OGOE 4NGHL 4P5TB 5DZJA 5AYUH 5FS5A 5CZVL 4FFVC 3ARFA 4X9HA 3VMPA 2G5BA 2DJUA 4UIKH 4ERSH 3OMNB 3EYUH 4PGCB 4AIZB 4ODHL 4JFHD 1I8MB 4C8XA 1DBJL 4GMTH 3JT0A 4PREA 2VO5A 3F84A 3SGDI 2GCYB 3ATDA 3CH1B 2KLTA 3DUSA 1OXYA 1BLIA 4YDNA 5JXAH 4QRRB 4LZKA 3PABB 1QRND 3KLKA 4U6XA 2UWEA 4DERA 4ETQB 3GSNH 1KT2B 2CA4A 1EXUB 1HHIB 1GGIL 2Y5QA 3BO8A 2OR9L 3UPCA 1AZNA 4WDIB 1CO1A 3KWWA 4M5TA 2AGJL 4JHUA 4U7SA 3E6HB 1T6VN 2YJQA 3HUJA 3MJ8A 5D2LF 1JNLL 3OXRA 2VABA 1VERA 2EDRA 4LLWA 2KYIA 3IFPA 5L88H 1UOLA 2H0FA 2WKOF 3Q5YA 3WFDH 2PXYC 2FEEL 5J3HC 3KPQA 4NWUH 2CRZA 2PYFA 2YQ3A 1VEMA 3RWGA 5I6XC 3W5NA 1MRDL 4PP2A 5CBEA 3SDYL 3UAJC 2QVKA 2JI1A 2Y06H 2VJXA 1MFCH 3IPBA 4KRPD 1FIEA 4MB5A 5IBTH 1F8TH 2ZWZA 3KLAA 1B0RA 4BK5A 3PWLA 1DL7L 1HL8A 2F8XC 4KTEL 4Z7WF 5SWZA 4JW3A 4UANA 4GKZA 2Q3XA 1RZIA 2A6IB 4YH6A 3GSWA 1QO3B 2V8MA 4FHJA 1QFWI 2JFCA 2O5ZH 1K6QH 2XTJB 3FF8A 4RFEA 4NFBA 3IMVA 4TUUA 5KANG 1FFQA 3IDJB 3QC5X 4HH9A 2OYPA 2M26A 2WC7A 3QULB 1KWKA 4KI5F 4AT6A 5EFIB 3LKQA 5LCVL 3NN8B 2XTLA 1S46A 3NFNB 3INUL 3POCA 2Y5EA 4TNEA 1MZZA 2WZ6A 3G9AB 3IDIB 3LD8B 3PYCA 5DK2B 1RK0A 2A77H 1F18A 3WE6A 3GJEA 1BYOA 1KBGL 2P5PA 3PWNA 3CSFA 4A7GA 3P3YA 5DZAA 1OGSA 2ENPA 2V5SA 4K7PY 4FQ2L 1JXKA 3CDCA 1ZT4A 1BZ9A 1JGLL 5E6ID 3CU1A 2PR4H 2ORBL 5KSAA 3G5YB 1T22A 3JTTA 5ID1A 1EAPA 4AQ1C 3LHAA 5DD6B 3VGAC 3O2DA 4B41A 4B0MM 1EHKB 1PJ9A 2HX8A 2Y22A 3EUUA 4HD5A 4KRNA 1J1PL 3BPCA 2ZXQA 3BW9B 4TTDD 4UT9L 4Y16C 3UMNA 5D6CA 2X09A 3VXQB 2A5UA 5FYJE 3T65A 5I0DA 3EIFA 3PE9A 3K2IA 1FAIH 4Y7OC 3U7WH 1NBYA 2Q20A 2UZXB 5B38G 5ITFA 3D2UD 3VUAA 3X13A 1NIAA 1PY9A 4QLWA 4NZRH 2VE6A 5HDLA 4JANA 4KHTL 5IB5B 2EICA 2FATL 4H1LH 3VQ1C 4LRNH 1KIUA 1BOGA 3T8VA 4BFEA 4NXKA 3MKKA 4X8GA 1UVQA 5DK3A 5BRQA 1QFWL 5FGRA 3HKFA 5D6DC 1UXMA 3NSFA 4Y2DA 5IFAL 4PRPE 4YHOL 3FT2A 2PO6C 1PAZA 2N3JA 1QI4A 1CZ8H 3X1FA 3WCYA 1A4KB 4FNUA 2F08A 1J1OL 1TR7A 2X6MA 5IF0A 1QR4A 1XCTA 1NEPA 3MCKB 2XWEA 3RWFA 2DZEA 2W65B 1NMCB 3GB7A 4FFYA 2YOCA 2K8MA 1N5YH 3VACA 2YPLA 2OP4L 5D4QA 4LP4A 4PCYA 1NMAH 1BAWA 4PJ9B 1T2JA 3FU0A 2BVYA 4OLUL 4F91B 1OP4A 2DWYA 5E7FA 5B7FA 2F53D 1G0XA 5DHVA 3QZNA 4LSPL 4OKVB 3IWVA 3MFFB 3BKJH 4NSKA 3VXUB 1UADC 3GSVA 2A73B 3MTRA 1U4EA 4P3DA 1TKWA 3UBHA 4AQ8C 4CSSA 2A6JA 1CFBA 3FT4A 1TYJA 4KJWD 1BWMA 3H8NA 3L5JA 2W88A 2I25N 2XQBH 3WE1A 3P9MA 2KLSA 4Z3GA 4AK2A 1AQHA 1PZ5A 3RWEB 4L4TB 4HDIA 4LVOB 5C0AA 4X5LA 3QGVA 1OE2A 3HIZA 3QUXD 5BCAA 1AE6L 2VW7A 5C0ND 4NQXA 4Y5VA 4XHJD 1FA4A 3WHXB 1U36A 1KPUB 4K94L 2XY2A 1V7NL 5T3ZH 1FQ9C 1OP9A 5L0QB 3UTTE 3GPEA 4CDGC 5D2LB 3PNRB 1ZTXH 4AENA 4YIQA 1DSFL 4AXWA 2JSFA 1XGZA 1P4BL 5DZ9A 5HY9A 2VDRB 3V8OA 3GSOA 2QTEA 3JTSB 4DN4H 3RX9A 1BYNA 4QHNB 4JREB 2CIKA 4JRYE 1JDCA 2QSCH 1JGIA 4NP4L 5FHBL 5TE6L 5DEGB 1S7TA 4EIGB 4YOKA 1UJ3C 4GP5B 1A6WH 3ET9F 4ZS6C 1NC4D 2I26N 5HYEA 4NJAL 4ZPTA 1I7TB 1NDTA 4PGEB 1ODAA 4QJ5B 1JP5A 1IAIM 2P80A 4APQC 4Z7WB 2WXQA 3MRLA 1L3WA 1ET7A 1FFRA 4MD0B 5GRYA 4O00A 1D5ZB 4C59B 1A4BA 2LVEA 1A5FL 3GMQB 1V3LA 2OZNA 2GFBB 4TUOB 4ZUSB 2Y3NA 1RVFH 1JGUH 3MGOB 1LE5B 4XMXA 1SOXA 3LZFL 2FECI 3TVMD 1YN6A 3FQ2A 1JOIA 1RJZB 1NDGB 2VDRL 4ISVA 4Y2OA 5CLZA 2VR8A 2WK2A 3K6IA 4YHKH 4M8QB 4H2AA 3CFBA 3VCLA 1DDTA 3KGTA 1XAKA 5D70L 5GZND 1G6RB 4X7SL 4ALAL 5KBKA 5E2TL 3CIAA 3I50L 2ESVB 4HH8A 5C0RH 2WVSA 4Y4KB 3HHSB 4P5TA 5FYKD 5KSBE 3HN3A 2EDDA 3JUYA 5I71B 1MCWM 4OM1H 1SMOA 5HHNB 3WN5C 4JHBA 5CGMA 4D3CL 2AJ3B 3QWRD 1UA6L 5JTWA 4BQ9A 5EBMB 4I2XB 5IJCC 1I8MA 3ALPA 1BJMA 1FFNB 1FGNH 3QUZD 4HGKC 3DRQB 4B9KC 3CH1A 4JE0A 4ZSOB 2DLEA 2XKSA 3L2LA 3O9WA 4M6NH 2YAQA 4NQDB 3ULAB 3TWCL 1LVEA 5F7YC 4E9WA 4QRRA 3PABA 5FXCH 5EF2A 5IVNA 4ETQA 4ZMNA 3OXSA 1P53A 1WPCA 3V79C 1NBQA 3TO2B 3VWKC 1HHIA 2O5XH 2F58L 4CU8A 3MI6A 2V6HA 4AITA 5K9OA 3WDHA 3IAQA 1RZJC 4NO2A 1ECZA 4O5LL 4UM9D 2W9DL 4EZLA 3MNVB 2VZVA 3LRLA 4XNDA 2D3NA 4J3OG 4RIRA 4P05A 2ZWNA 3HG1E 1SEQH 3R1GH 1ZT7A 1LNUB 3QQNA 4I7ZC 2OK0H 1LO2L 2R39A 5EUKA 5FHAH 5E99L 4JNXA 4MJIE 1Q0XH 1QFUH 4F27A 1ZWIB 2XKNB 5BNXD 2YQBA 3BMVA 5MHSE 2IDUA 2VCOA 2UX7A 4GH7B 4PJ8B 2Y7NA 1KJ2B 1MRFL 3V10A 5H35B 1K4CB 2J1ZA 3ULVC 2ICEA 1MY7A 1IZJA 3UIYA 4GKSA 4QXTB 5F8QC 4DGYH 4S2SA 1KPRB 1AHMA 3AROA 4NAJA 3IDJA 1CIDA 1MCHA 2RTTA 4BA8A 2F15A 3MXVH 5KVFE 4B9IA 1AC6A 4LL4A 3IJYB 4FXGC 4BXVA 4KVCL 1I7RA 3NN8A 3NFNA 1CYWA 4ZMOA 3L7EA 4KFMA 3FO1B 5FDYA 5GGRB 1RU9L 3HAEB 4MCNA 5F21B 4ABQA 4AZUA 4FFYH 2IIJA 4RAUA 4AV5A 5I1HL 4GFTB 4PBDA 4OD3H 1QLRA 4WLCA 1BLNB 4Q9CA 1HSBA 5EDXA 5D2NB 1VEOA 2OZ4H 4HISA 1NUGA 1A6PA 2WXMA 4IS6B 3JWDH 5GHWL 2Q87A 3FN0L 4KXBA 4RGNB 2OJZL 4XAWL 5DHVH 2VDPL 3JYCA 4AGMA 2Z65C 1ID2A 3G5YA 1AS8A 3RIFF 2DH3A 3P2TA 3IDGA 5LDUA 2ZF8A 4HPOL 3ZMRA 5AENA 3Q05A 2VN5A 3CZEA 4UTAA 4IOSA 1UD3A 4YDJB 2O5YH 4MWFB 1AXTL 3TS8A 1KLFB 4IW4C 2YK1H 4LSUH 3VXQA 3WXWL 1G7IB 1QNZL 3IVKB 3D48R 3FU3A 3ARGC 3K6DA 3P4OB 3D69B 4BFNA 4AY0A 4XPAL 4KY1H 2LLGA 4LDOB 2UZXA 4FDWA 1AD0B 2VZSA 3IXAB 4X80H 2AZUA 1MFEH 3BWAB 3O8XC 3ZDZF 3SGKC 4YLCA 2OL3L 5B1BB 3PGCB 4JBSA 3ULUE 3TO4B 2R0KL 5B1JA 5IB5A 3POHA 5HHME 1NKRA 1X5LA 2FLRT 4EMZA 3VD4A 3B5HA 2AKRA 3U4AA 1VADA 1YEGH 1EHAA 2PYED 3TNNB 1CQYA 1SMDA 4XXDA 5FM8A 4GRLC 4P48A 2DQIL 2F2HA 2HJFB 5HYQB 4OF0A 4LKXB 4LU5H 3O4LD 3LN5B 2OYLA 4KKNA 4ZUUB 2XV0A 4BRJA 4DKFH 5BUGA 3MCKA 4G6FD 4M48L 3IRCA 5C0IB 2ZYHA 3GRWL 4FCAA 4YHMH 5F3FA 4NZTH 1NGZA 2P24A 4G6ML 3ZX1A 5FW8A 3S96A 2FE0A 3MACL 4UOZA 1X3DA 5JPMC 1TTAA 2JI2A 4ELKB 5CD3A 3KLHD 3TBYB 1DQVA 1JZGA 1QRNB 1OZTG 5DGQA 1KB3A 5E5LA 5DJCB 2YBGA 3ARTA 1RV6X 2PWDA 1HDMA 1WVZA 3FQUA 4P2QB 2C3HA 4OKVA 2E3VA 1SLWA 5AW9B 3VXUA 3QJUB 3SO5A 2A73A 4IOFD 4ZOCA 3N44F 1JYVA 5PAZA 3ZE0E 4O9HL 5JORB 1QI3A 2YZ8A 4N1EA 5CLYA 1H3PL 1MCPL 1E43A 2ENQA 3QNFA 3IJHA 4XBPB 5AAMC 3RDTC 1RZGB 3EJPA 1TQCC 4AYBA 3AT8A 2VMFA 4QHPA 2Y1YA 5AKVA 4Z77B 5MEND 5C0BD 4L4TA 1EHXA 1B0IA 3EOTH 3OAWA 1QBLH 4ZQTA 4KQ3H 3IF1A 4KRPB 3NZ8B 4L4JA 4YSEA 2CO1A 1HQRA 3OR7A 3SJVD 3VU1A 5LNEA 3QIUB 4M4PA 4Y4FD 5I75C 5HGDB 3OKMB 1CFNB 3A24A 1E5YA 3L1EA 2G3ZA 2VXUH 3H3KA 3SKJL 4F2ME 4MRBA 5I1EL 4XNYL 2CG9X 2APXA 4QJ3B 2HTLD 2WKOA 3VFPB 2AABL 5L9DH 4NX0A 3D39A 3OWEA 4ZDHB 3W3BA 4QHNA 5BJTB 4MZIA 1S5HA 3PAVA 1GH7A 3ZDWA 2FQEA 2NY3D 3DOSB 4QTIH 5T5FH 1T5WA 4GP8B 1WHOA 4PRAB 4UBDD 1YCSA 1Z5LB 2X70B 4NO3B 4D0BA 4Z7WA 5JOFB 5HYFA 1D6EA 2IH3A 4J3VA 4NI3A 5I9QC 1C1EH 3HFMH 4PRID 3FTZA 3B9DA 4XNQB 5K9JH 2HRGA 3N1MC 3GMQA 2XICA 3FZUC 4JPWH 5DUMH 1T80A 4TUOA 2MQCA 8FABB 4ZS7L 3X11B 2DIBA 1LE5A 2F5BL 1TNMA 2GBUA 5E8EA 4F7EB 2CJ3A 2VLJE 3H9SD 1RJZA 4BSVB 1NDGA 2CKNA 4TVUA 2R29L 5FM5M 2EO9A 4YWGL 3N6YA 4J8RA 4AGQA 1U58B 2ENSA 5F96H 4ZFOB 1WK0A 3F12B 5F7NC 1OAUH 4O02A 2E9GA 1G6RA 3S97C 4CU7A 5JW4Q 2Z8SA 3FUEA 4ODTH 3M45A 4EE2A 5K9KB 5DLLA 3SCMA 2YKLH 3CVHL 4DQOH 2FNWA 3D2UB 4JX0A 2BRQA 4Y4KA 4UU9A 2RCSL 1J5OL 1IC7H 2KL6A 2R0ZL 5E1AA 3ELAT 4GFXA 4ZS6D 5C08D 3ZE1E 1W6WA 1E4KC 3QDAA 1YZZA 1DFBL 2ZUUA 3B2VL 3K6NA 1XH0A 2D73A 1E28B 1LP9E 4H44C 1CGWA 5EBMA 5F7DA 1AQMA 1U8QB 4APQD 1WJ3A 4W9JC 3T6WA 1A64A 2AK4A 1VFAB 2X4NB 2EP6A 3DRQA 3MV8A 1ERNA 4ZSOA 3QEGL 3F2LA 4HJJL 1QSZA 4HWUA 1NBZB 2JQZA 3FUMA 2QR0A 2E7BA 2YRZA 1C5BL 1LMKA 4HJ0C 5D1XA 4BFKA 4Z7UF 4OI7A 1UWXH 3TU6A 4YX2L 3ZZQA 1AO7E 3SPIA 2EVIA 15C8L 1NOLA 1GJWA 2VXSL 1IKNC 2ITDB 2V7HB 4QF1A 4R3SB 2YZ1A 1A22B 3E0GA 5EO9B 3W9EB 2NY0B 4NNXA 3Q43A 3ZL4H 4KVNH 1NANI 2QVMA 4X8CA 2Q8BH 4C55A 4UTAH 2FL5A 3BHBB 4K9EH 5I73B 1OCRB 3NVQA 4QHLA 1RUML 2LOEA 3CHSA 5FDWB 5KVEH 5E8DL 4LARH 2F53B 4GO6B 4EZJA 4X9FA 3TJEL 4I89A 3QCTH 4AMWA 2OQJB 1MAKA 1ZIBA 4X42A 1V55B 4MS6A 4NENB 2BFGA 2BIQA 3TBSB 3RNKA 4FABL 2AXGA 3L9RB 1U6AL 1OB1A 4AGLA 1G7LB 1IJ9A 4PJ8A 1ZGLM 4D7BA 1KJ2A 3VGGA 2YBRA 5HVFB 4WFGD 3W1ZA 2DV6A 1UB6A 2NCEA 5KVGL 3SKOA 2JJTA 3QUXB 2A38A 1HZHH 3T6XA 2OMVB 4FQXD 1MDAA 3C6LD 3MPCA 4HP5A 2HCZX 3ESVF 3OVUB 3IJYA 3QDME 2FHBA 4WI3A 5EBWB 2IEPA 2DD8L 5I19L 1KN2H 6PAZA 4OGYL 3SZ6A 3HMXA 2WIMA 3I9GH 4DTGL 2FIKA 2JK5B 3M7FB 3RZCA 4O2EB 2WSDA 1D5MB 1YEJH 2WCPA 3N44B 1O9WA 3M6DA 2BM3A 2QKIB 4HFWB 3BXNA 4CNIB 2BNQD 5A7BA 3U6RB 4F20A 4CGTA 3GNML 1NA8A 1MN4A 1R24B 2AAVA 3U7AA 1KXHA 4P46B 2QQLH 3IRZA 4TRPL 4LPCA 4NHCH 1VF5C 3STZA 2HZHA 2X38A 2ATPB 3AM8C 1GJUA 4UNVA 3O45A 4XXWA 1DVSA 1Y1DA 3Q8AA 4I3RH 3TTSA 4DQAA 4TQPA 1EHLH 2ARJQ 3GM0A 4MWFA 4RMSA 1KLFA 1NGYA 3AY2A 3FCSB 2BLFA 1Z9PA 5TPWL 3VXMD 1OSPL 1EEQA 3KVDD 4E9RA 4GRWF 3QRGH 3HCVA 1K5NA 2X28A 3Q0HA 2H3NA 1A3ZA 2VERA 4FKKA 4NO5B 4Z76A 4FL4C 5LXGH 3BWAA 4GSQA 1CD1B 3UZVA 2NR6D 5F9WC 3TVMB 2W81C 3TO4A 3D5OF 3C9NB 4ODVH 1A7OL 3F62A 3VDBA 1FLRH 4OQ1A 4Y1TA 1BQKA 1BECA 4ZAKD 3QPKA 1K9TA 4APXB 2BMKB 4OV6F 4PTTB 5HYQA 1AOZA 3ILPB 4QXGL 2ZCKH 1VKXB 4LKXA 4PWFA 1TPXB 3OSVA 4YBQC 3BSGA 5TF1H 3RL1A 2IBBA 4G71B 4WTXA 3SGJA 4CDHA 1E4XH 1IAOA 2JKSA 2DWEA 4ZUUA 5C09E 3NH7H 1NAMA 3LH9A 3PP4H 4PG9A 3RVWC 2RFXB 5C0IA 3MJGX 4BQ6A 2X0WA 4Q8BA 1KIRB 4NM4L 1U8LB 4IEFB 4QIRA 3KDPB 2FX9L 2FCBA 1I3RB 1YNKH 1DBKH 2YSSB 3QUZB 2YUXA 4M43H 2R2HB 3ARGD 5I0XA 4ELKA 3QXTA 2X4SB 1RMFH 2CUIA 4WHTB 4ABWA 5DJCA 5JXEC 1INEH 2HG5B 4A2MA 1JI1A 2FT7A 3VM7A 4FG6C 5C0FA 1JF1B 2MH4A 4M02A 2D9CA 3JV4B 1KGJA 1CK0L 5LLIC 4L5FL 3KXFE 1RJLB 2KLRA 2ZWYA 3O3BA 1UQSB 2MTPA 1I8AA 1X5HA 4DFHA 1CDIA 4Q6KA 1LD9B 3N1FC 2FGWL 3V0EA 3US9A 5JORA 1JZ7A 3SQRA 1H6UA 2JJSC 2WXIA 3KS0J 1MF2H 4ZUWB 5AW5B 1QR1B 1KF9B 4K3GA 1UOWA 4O02H 1G6RH 1IT9L 4Z77A 2ICES 4GINA 4JRFA 4ERSL 3BVWA 4EDWH 2WWNA 5F6IC 3QPXH 1HSAB 4Z7UB 1T83C 3LNEA 1H3UA 5AUMA 5FUZL 4PJBA 3GKWL 4LHUG 1KG0B 4MJJA 4IBVA 2WGNB 4G5AA 3R19A 5DI8B 5KAQG 1H8OA 2HUHA 3OKMA 4JR9H 4W9ZA 2CRMA 1E50A 3QEHA 1ROWA 1EQWA 5H4ZA 3K8LA 3V6OC 1IC5L 2GABA 3C8DA 1QSFE 5J13C 2AV7A 4AL8H 1HOCA 3B8SA 3ZKMC 2YPVA 3RI5K 4LEBA 4HZLA 5FFGA 1AJ7H 3LNGA 5TQ2L 4UNUA 2DI8A 3VD5A 1CG9A 2AQPA 3ERXA 4R97C 5IBLC 3DOSA 4N8VB 3WFHA 3F83A 4H8PA 1YEWA 2WXLA 2L04A 1DVTA 2D9QB 3WFDL 1KJVA 2E46A 4E5XG 5A2CA 3JT2A 2Z34A 4RNRA 4UQEA 2JF1A 4N2BA 1AIFB 4PRAA 5CINH 1Z5LA 4NO3A 3CK0H 1IFHL 4NKIH 2NSMA 4ZJ9A 3BWUC 5GGVL 1PX8A 4XNQA 5DEJA 4CMMB 1SXNA 3OKNB 2B5IB 1F8TL 5E6IA 3NJMA 3AAZB 5CWSB 4D0CB 1XSKA 1IVTA 3HZYA 3FSAA 4FAAB 1QACA 4OGXH 4F7EA 1DQQA 1E8XA 3QZPA 3TBVA 1T6WA 3WLWD 5F88B 4AGNA 1VSCA 4B5ZA 5IHUL 4E9QA 1GTNA 3FB6A 1WC7A 1Z9NA 4RDBA 4KHXL 4X7EC 4HCGA 1E3ZA 4ZFOA 5BO0D 4TNWK 3CE1A 3ULSB 1AIZA 5IQ9A 3SKMB 1KJ2H 1SQMA 4OB5H 12E8H 1FVEB 4IIZA 1JXFA 3HZMA 8PAZA 4ICWA 3D2UA 3QDGA 1WD8A 3WNKA 2X7LA 1E42A 2VC2H 5TFSL 5CD5C 3D18B 1DANU 5D96B 4AC4A 4MNGB 4NAQA 2DL2A 2EYRB 1I3GL 3CFJB 1RUAH 3GUFA 1LEIA 3RIKA 1DVYA 4V2BA 3RWDB 3HMXH 2WBJC 1BX2B 3REVB 1GHFH 2PYEB 1J7VR 3QJOA 4JKPH 5I8EA 3S35L 2E9IA 3HAEH 1VFAA 2LTQC 3NRPA 4G9FD 4PRBA 1A47A 3VGDA 4R7LA 1CGVA 5DRZB 2W0LA 3A4AA 3O4LB 3PJSB 3UZEA 2X4UB 2YMOA 2WB1A 5D7LA 4GRWB 3K81A 2MEJB 4JPQA 4Z7QE 4G6FB 2FLMA 3UTZB 3SE8L 2B9BA 4RA3A 4UOW0 2RALA 1G1OA 3J07A 4DK6A 4KGJA 3WMPA 1I1CA 1TQTA 2WNGA 3BISA 3IAGC 1ITCA 1DZ0A 1LWHA 3HE6C 3H4FA 1K8DB 2MJWA 3LKSA 5DJ2B 5CLTA 3NEEA 3NIGE 2KZKA 4ZMTA 2CK0H 3KPNB 5FDWA 1IGYA 2ICWI 4JS7A 4Q97A 3QR2A 4OW6A 2F53A 3PWUB 5IQMA 2WMPB 3WJJA 3MA7B 1T5XA 1TYEB 3FU8A 3VXNB 3WXVH 1QBBA 3FO0L 3S8GB 4KUZL 1SJXA 1IBGL 4NNPH 1PX4A 4D9LH 2A1WL 2OQJA 5D7KD 3SBRA 2ADIA 1RL1A 3B9KD 4OLEA 4NENA 1J9TA 5L7XH 4K7PL 1YEEH 4A68A 1JMZA 3TBSA 1ORSA 1CZ8L 1PZDA 3OAZH 1A7QL 1G7LA 1LO0H 5DMGD 3L3JB 1MG2C 2WLHA 2LR4A 3DX8A 3O6KL 4HJ0D 3O2VL 4Z18A 4I18C 4WJKB 3QUXA 1JPGB 4M3HA 5DTFA 1MIEH 4OLWH 3SJVB 4MDIB 3HVDA 4Y4FB 5DJ6B 1N5YL 3LZPA 2VMDA 4S1QL 3IDMB 3QDJB 3UXFA 2AW2A 2XU9A 2IGLA 2J8UF 5I6LA 4NHUB 2CHWA 2QGBA 4XMKH 3KBPA 1GAFH 5JMRA 4N86A 2VSMB 3BWSA 1TOXA 2EIZA 2CO6A 1KJ3H 2IQ9L 1FL6A 2X2JA 4IRJC 1W8OA 3BKJL 2OXHA 4QRUB 3ZKSD 1DVFA 5KS9A 3NCEB 1E27B 3I75A 4PJCA 2OSLB 4UAHA 4OZGE 2N0MA 2NY3B 5BVJB 1NC4A 2F7RA 3ORJA 4TYUA 3CUPB 3VXSA 3DTXB 2ATPA 5DHYB 1X9QA 5AWNH 3CPLB 4YBHA 1BP3B 3CDZA 5CUSH 1PJWA 3FCSA 5AKRA 2X4OA 3BD4A 4PGDA 3CLWA 3LS5H 1EJ6A 3F05A 5HJBA 3CSYA 4ZFQA 3S9DB 5DVLA 4G8GE 5IG7B 1ZHLA 3VRLF 5IBUB 5LQBL 4JO5A 3H9SB 3ARBC 4I13B 2NY1C 5CJBA 2YA1A 2XPGB 1UXWA 1XMEB 4WFFD 1UM4H 4QPEA 3EDDA 1A8ZA 2J20A 3BRDA 2OTWB 5KJRH 1F11B 3BP4A 3OAUH 1HX0A 1N59A 1HHJB 2QQNL 2QSCL 2YHGA 1ADQL 2KI6A 3GM8A 3OZLA 2ODIA 1VKXA 2X9ZA 1A6WL 2TSBA 3SOBH 2YPVH 3TBWA 5A16A 1AG6A 3HS8A 3KDMB 2NDGA 4LPVA 1M53A 1QHPA 2GPZA 4GKNB 4P06A 5DCCA 5C08B 1KNOA 3QWRA 1C7TA 1NCBL 4XVSL 5E1HB 4YE4H 1FG2A 5EMYA 1YA5A 4MZ3A 2L7QA 4JFFE 1U8LA 2NCMA 3TV3L 2QDWA 1WG3A 3WKNA 4GSXA 3QUZA 1IKFH 1A7NH 4JO8A 2X2HA 1AMYA 2APFA 2R2HA 4KTGA 3Q8BA 1JZ3A 3KW7A 2IQAA 4F33A 1S9XA 2D3LA 3Q2CA 4QOKD 1MIML 2ENYA 1XHHA 4AJYV 2HG5A 3LKPA 4AKOA 1UD2A 3IXTA 2VSKB 2Y6SC 4ZO7A 1CE1L 4L3CB 4JM2F 4U3HA 5EPMA 1Z3GH 5LGKA 1RJLA 2EIKB 3LPPA 1XX9C 1UQSA 3RVVC 3HLAB 4UM9A 2Y2TA 1GTFA 3PL6C 1LD9A 1F02I 5DFWH 1BDYA 5C0RL 2R4RH 1FNAA 1X5JA 3E8UL 5FM4A 2W91A 1QR1A 5LAXB 3QRLA 2NMSA 4HLZH 4YBQD 3WFBH 3U48A 3QYNA 3QZMA 2NY6D 2ZCHH 3UAEA 1EGJA 4PM1A 3B56A 4L05A 1T4WA 4IBZA 1EHNA 1HSAA 1IARB 3SYAA 3QFJE 4JQXC 4J1UB 3PHAA 1VB9A 1IFRA 2GTZB 4LNVA 3ZL2A 1O7SA 4TNFA 4P4KB 5KUMA 5IIEA 1IGJB 4X50A 2QQQA 4Y19E 3N5AA 3T9WA 4IKKA 5A2LH 3K6SB 4U1NB 5JXED 2KC0A 2Z31C 1UEYA 2XWCA 1RUPH 2X89D 4A55A 4FQXB 1U8CB 3C6LB 4WI5A 2Q6WB 3O2DL 4LIQE 2CHDA 5A7EA 2XLLA 3DX9B 3KR3H 4E9SA 5DJDB 1XSIA 1J9SA 1OTUD 5D8JL 2BXZA 3MRDB 4X6CA 4UQ3A 4N8VA 4GQ9L 4TVPE 3WIFB 4CU6A 1ZS8A 5CU9A 1RPQA 2W5PA 4HIXH 4IRSC 1BM3L 2QSVA 1AIFA 3MOAH 4YUEL 5JUEH 2PXYA 2BNQB 4PJ5D 3H56A 3LB6D 3K0WA 3QYMA 3FPXA 1UWEH 3DA0A 3QIBC 3UAJA 4CMMA 4FMKA 1O9ZA 1RHFA 1TJMA 1QI5A 4PU2A 3FU6A 1PZCA 1GKEA 3VRIB 5I1KH 2YMTA 1C5DA 4IHOA 5TK4A 4NDMA 2AXHA 2OMUB 4JMXA 5F88A 1WWBX 1C16B 5ESVA 4PBVC 5CGYD 35C8L 4AEHH 2J8UB 2GIYA 4MNHB 1FORH 4OZIF 2CU9A 2FD6H 3HI1B 3VXMB 2UYLB 1P4LA 3NCJL 5I1CH 3LHPH 3T2LA 3ZKMD 3SKMA 5G5DB 1ZJBA 5F7EL 1TZAA 3DI2B 3QXAA 4JLRB 2CAKA 4F2EA 2C3GA 3D18A 5I6KA 2XWRA 3U36B 3HBPA 1QAWA 3MBXH 5J4MA 2CLRB 2Q7AA 2VL5A 1JCKA 3BAWA 3NCYS 3PU7A 2V9UA 5EZLB 4EZMA 3IE9A 2DQGH 4ZAKB 5BV7L 5F3BB 2A9AA 1VCBC 4TQIA 1MHCA 3RKDC 3F6JA 1QKZH 5IROC 1Q1PA 4YHNB 2EUXA 2VTFA 2A74C 2F8VA 2BSBA 5K5YA 2NX5B 3KPLA 3Q2WA 3L5XH 3O4LA 2H32B 2P9RA 4X4XB 4J6RH 5C07E 1NMBH 3SE9L 2VZ3A 3NA4A 4ONHB 4DCQA 2YD3A 4JJOA 4AQ1A 2AJXH 3UTZA 2WZ0A 3X1EA 4ZI8A 4HXBH 4NRZA 1OF2B 4H25B 3GMMB 3AWGA 2PP7A 3UJIL 1HH9A 5DJ2A 2FZ3A 3IJ9A 2RMNA 5IESL 1MFEL 1ZLDA 2GAZB 3KPNA 1RPKA 2HRLA 4HVBA 2Z1KA 4GSDH 4XPGL 3L1FA 2RHEA 3F7PC 3D85B 4K3DH 1OAKL 2H9GB 1WDAA 3MA7A 1KZYA 4G8FB 3VXNA 4PGJA 1P4IL 2VAAA 5CD5D 3GI9H 3EXJA 4PCSA 1NC2D 1EVTC 5DZNA 5F71A 4RGNE 5F7WC 2WBJD 4G7YH 4HETA 1XIWB 4P5MB 1SN5A 5DJZB 5E0QA 3LYRA 4LEXH 2MCPL 1MJJA 3WFCL 4ZO6A 4OIIH 2OX5B 2DQEL 1DQKA 1MPAL 5MENA 5IWLC 5C0BA 2DEYX 3NFSL 4LSTL 5DJ0B 4Z3EA 2ARWA 3GMOB 5FYKH 5KBNC 2QTVA 4J3OD 4WTQA 5HGBB 3DBXB 3SJVA 4XBGA 4JM2B 3ME0B 4WK2B 2CMRL 3SIKA 5H37G 1N2RB 1UCBH 3VFOA 3IDMA 2PW2A 3C5ZC 5E5MB 3WL9B 3HE6D 3FOMB 4NHUA 3UBXB 5CJ5A 3VWJD 3PGDB 2X4QA 3FAXA 3RHWK 5J12B 3TPKA 5JLZB 5TDPB 4TSAH 4KO7A 4KRLB 5E5UB 5AOKA 4OU3A 4A37A 1CR9H 2F54E 1G1CA 1WIUA 3GI8L 1YN7B 4RETB 4EI5B 3CMOL 1TU2B 3ESMA 3BJ91 1OSEA 3MXWL 3SZKC 2HFGL 3KL0A 5CJQL 1CS6A 1NAKH 5E9DD 2MOQA 3U4EB 3FB5B 4OT1H 4AQ8A 1QUPA 5F3HB 4NRXB 2FRGP 1AC0A 2G75A 2L7EA 2KQNA 3X2QB 5JOPD 5GS1C 1UGKA 3GDCA 2NNRA 2ZICA 1JPTL 3QZWB 3B5GA 5CEYA 4PRIA 3KYKL 1BBJB 2YARA 1CLOL 2FSDA 5F9JB 5JIDA 1TJHL 4WW2B 3QUYB 5DUJA 1Q72L 2P5ED 2WXKA 3H9YA 2CBOA 3X3GH 3ISWA 1PG7H 4L8BB 5F9OH 2XRAL 3PIQA 4NN5C 2MPVA 2XPGA 2IAMC 3WJMA 1WRFA 1DLHA 2D7TH 4POYA 5JPNC 1CC3A 3BH8B 2OTWA 1F11A 2A83B 2O61B 2V9TA 2WVUA 1HHJA 4IRJD 1T7WA 3CFUA 2PTVA 5AB1A 1AD9A 3KYOB 1SY6L 1YMHA 4F58L 4X5XB 5BZXA 3KDMA 1UJ3A 3RFZC 3ZZSA 2W0FA 4GKNA 3HVNA 1IE4A 3PQYE 4G7SB 3PFUA 1ZA3B 3VH8G 2EDLA 1EO5A 1XGQA 4APQA 5JR1L 3DV6B 3AB0C 1NCDL 2IBZX 1HXMB 4G9FB 4OZIB 4POUB 4KXDA 2UZYB 4XWGL 5DYOA 2ZP8A 5ACZB 4LOEA 1WAAE 4W1TA 2WWKO 5FOJA 3B4NA 4XE5B 1WZAA 3BGFC 4GAAA 4XMTA 1A9EA 2D03H 4WK0B 3N42F 3HLAA 4FQJL 2EC8A 3WEMA 1XF3B 2IWGA 1GZHC 2YKLL 2APVA 3VGEA 2CIIB 3U79A 3ZL1A 2EXYD 4JQIL 5LAXA 2IANB 2VKXA 3D4GA 5C6TH 4BYHA 3VFRB 2XY1A 2BIMA 3DMMC 5AYQA 4Q6IC 4G8EB 5JQ6L 3MFGB 1DVZA 1KTJA 4H8WC 3WN5A 1SF3A 4UB0H 5HJDA 4WUUE 3QYCA 4D9QE 3B9KB 3AWFA 4J1UA 3EFFA 4J3WA 5E7BA 1EJ8A 3UIZA 4JDEB 5LBSA 4MXQC 3QI9D 3CFDB 3AACA 4IGBC 1TVHA 3NEXA 2BNUB 2Z93B 3QZOA 2MQGA 1UA7A 1M4KA 2CPUA 2P45B 1NGWA 5D7JC 1R0AH 3CVDA 3VWKA 2Y6SD 1LO4H 2BNRB 4FI7A 4FQXA 2N7SA 2YUZA 4FQIL 3C6LA 4P2RD 4CJ1A 4KVNL 2Q8BL 1EO8H 2VL4A 3F7LA 3MNZB 2HG0A 2JCWA 4WKZA 2EIJB 4RMUA 3SSGA 3WIFA 4JFWA 3S48A 4CJ0A 4P9ML 5KVEL 3KMDA 2NZIA 3NIFF 4PBWD 2PKDA 2K3TA 4WWID 4AEEA 2BNQA 3GEWB 1Q0YH 5IQNA 2H45A 4U6HA 4HJTA 4Z7NE 5A2IH 3QCTL 4ONGH 2AQSA 5F0JB 4ACPA 2C9RA 3C5SA 3KNBB 3MTXA 3P0YL 4K7FB 4KK9C 5DD1H 1JWUB 1VLXA 5EU6D 1Q9WB 4FQQB 2GTQA 3P9LA 1R3JB 5H4YA 3ZPDA 1JFQH 4FNSA 1K72A 4UAOB 2OMUA 4JM4L 1AR1C 3IFOB 2J8UA 4OV5B 1T7VA 3GZKA 3VXMA 5FF6B 4P99A 4DP9X 3U1QA 2VM3A 5CCHE 1WBXB 2J5LC 4XNXH 4AV0A 5CEZL 3KL5A 5D71L 1U91B 5FGCE 4NOBA 3JWNE 4BH8A 5CF3A 1H8LA 2Y36L 1J8HD 1QYGH 2CXKA 4LDLB 4XTRC 1OAZL 4TLKA 1KGIA 2CHXA 4J23A 5EBLB 5I0WA 1KCVL 1SHWA 2CLRA 3T8XA 1L7IL 4XCEB 4ZAKA 5F3BA 2EO1A 5G4MA 25C8H 3SDCB 4YHNA 3EJJX 1PQZA 4HOWA 3QIBD 3CZJA 3I3BA 3RIAK 1TFPA 3T0WA 3QXUA 2BVTA 4IRZL 3F04A 3GYRA 4IMKC 1LK2B 3BH9B 5E4AA 5I8CA 4NQSB 4A2FA 4YK4B 3G08B 3QR0A 4KMLB 1S7UB 1NCWL 1QTPA 3MJ9L 5B38B 1MELA 3TEYA 1YY9C 1MNUL 4QCIB 4QHKI 1OGPA 1OF2A 1QLEL 5E23A 1MLCB 3MODL 2P8LA 3W81A 4YFLF 5FUOL 3ARGA 4HX1B 3JSSA 3O11A 4CN1A 2GAZA 2V2WB 2F7PA 2JKJA 4QOKB 1TCRA 2YQ2A 1N64H 4U6VL 5SWSD 3T04D 4FL4B 3IETA 4J3OF 2H9GA 1R47A 4K71C 3UO1H 2DTML 3SGKA 2XN9E 3ATAA 4BH7B 1M1XA 3WUZA 1GGUA 1PSKL 5EC1B 2EDXA 4ZD3L 1VGKB 2NY7H 4FNLH 3FH7A 2BDNL 5DR5H 1CBVH 1L9PA 1EVUA 3VI3F 3HE7C 4X7DC 3AITA 1BD2B 3RKDD 5DJZA 2ZE0A 2KERA 3FO9A 5TF1L 1EJOH 5IJKC 4Z0BH 4OSUH 5EWIH 2OX5A 4LBAA 3NA9H 4H8HA 5BO1L 1K85A 2NY6B 4YDMA 4DZ8B 5F9DC 3MLWH 1OCCB 3MMEB 4RZCB 5CSGA 5MI0B 3UBFA 2CCWA 3GMOA 3SO3B 1ZV5A 6FABL 4MLIA 1U93B 4L1TA 1N2RA 1AI1H 5K1JA 3EBGA 3EOAA 1A3LH 5AAWC 4J5VA 5JYLA 1IGIL 3WL9A 5E5MA 2E8ZA 1VZHA 3N42B 1DANT 3LTVA 3NCMA 4RRPA 3UBXA 3PGDA 4L8DA 2VLLA 5JPMA 3QB7C 3KPRD 3FQWA 4GQQA 1E9OA 2AV1B 4FQ1L 4HV8A 3Q8CA 1JXGA 3ARXA 4NC0B 4PJFE 1F2XK 4KXZH 4JPKH 4OLVH 4ORZC 2BW5A 1JHLL 3QG6B 1TZIA 1V8HA 1AZRA 1I1RA 3Q1EA 5F1OB 5IMOB 1U8IB 1TU2A 1OM3H 1IL1B 1F4AA 2A99A 3KHQA 1PLGH 1XR9A 4IBQA 3V6FB 2AJYH 3UC2A 2ADYA 3I6GB 5D1ZI 5EO1B 3U4EA 2VR3A 3ASOB 4YGAB 1SHSA 3MOBH 5EU3A 3EDKA 1BOYA 4PJXE 4Z5RA 2Z9TA 3V2AR 2JMRA 1RURH 2HRHA 5AAMA 4PJ5B 2OW7A 4NPJA 1J48A 2YN5A 1I8IB 3KCPB 3QZWA 4ZFGH 2ADFL 3LS4H 1HXYB 4CSPA 1S7XB 1D9KC 4PWEA 5F9JA 1FO0B 4XN5A 1Y1UA 1NGQH 3KVQA 1A6AB 3KEDA 1CTMA 1DEEB 3KWTA 5ADOL 5IVXA 1S9KC 4OBSA 4FF9A 4N0YL 3MRQB 2GW5A 1OD9A 3NIFB 2H2SC 2A83A 3RQ3A 1I9IH 2O61A 5LBSH 3IRPX 4M6OH 3BCDA 2LT9A 3AG4B 1Y0LB 1M9SA 3KYOA 3QJHA 3QNXB 4XT1C 4MHHI 3G5ZB 5JW4N 5HHVH 3RA7H 1M7XA 1HN1A 1V5JA 3O6LL 4WY7L 1IE5A 1P1ZB 1RZJH 4FKHA 3SE4A 3TIDA 1XWVA 1IB5A 2CR0A 5ID0B 3DV6A 3V0FA 4NQVB 1HXMA 3QJRB 4ZZKA 1WBYB 2ZWKA 4G9FA 1BVNT 1ZA6B 2K1MA 2WUBH 3BFWA 4A6YB 3ZVVA 1BIIB 5BMFH 1F00I 4DSYA 4JGMA 3ZQXA 4N87A 2Y0SA 1FZOB 1J8SA 4KX7A 1R75A 2B1OA 1GS6X 4TPRL 1DYZA 1KGYE 2LE9A 3HNSL 4KK8D 2X40A 3V7MA 1TUPA 4CW1B 2K6WA 3VU2A 4TQEL 2HT3C 2XQYG 2BOBB 3E9UA 2VN3A 2IAMD 4PI2A 3L1OH 4ELME 4LPTA 3F5WA 5GISH 2HVJB 3DUUB 4UINL 4UDTA 4F8NA 3WNMA 4B0MB 2NT0A 1ZTMA 3S5YA 2JQAA 2UVFA 3I9IA 4WGVB 5HJGA 1XR8B 1Q1JH 4LE8A 1INQB 2JJWA 3NP4A 4GO8A 1JRHI 5KZCD 4UQ2A 1R17A 1T89C 2E56A 1KDJA 3ZW3A 3CZKA 3MNDA 3FT3B 4JFSA 1DTUA 3MRMB 4P5RA 1NC2B 1OIOA 1E4KA 2BVEA 3LSOB 1PPIA 3A22A 1F4WL 1IGFH 1DSWA 3EH3B 5I1JH 1F58L 3B9KA 4GUQA 1MCJA 3IJEA 43CAB 5FO7B 2BHFA 1N6VA 1NLDH 1A4JA 5HTSA 2ZKHL 3VFGH 1KY7A 4H88L 3ARYA 4ANXA 4N0UA 4OZHF 4PS4L 3VFMA 1WE5A 4ZOAA 2VDMH 1X5ZA 1P2CB 2VUYA 3FMGH 5JO5B 3T0EC 3QJVB 1T1ZA 4S0HA 1F3RB 1I53A 1SYVA 3CHPA 3EYSL 4G59C 4P49A 1P0SE 4FTVD 3DXAE 3QISA 2ZWLT 1IKNA 4K73A 1OWWA 1XB6A 3FONA 5ADPL 3Q2NA 5KYUB 4MX7B 3VFVB 3MNZA 2I9LB 3DGGB 2AC0A 4F7CB 2CK0L 1UH4A 3TA4D 3VWJB 4A2LA 3VI3B 3GMPA 4XC1H 4MJ5B 3W0WD 3WXVL 4LCCC 3SD2A 3KH4A 3H3PL 4AIEA 1ZD6A 5IHWA 3DMMD 2BHYA 5EH1A 3M88A 3VQMA 4Y5XC 1JWUA 1Q9WA 5E9DB 3CC1A 4DNLA 1Z6JT 4RSVA 5FKPB 4Z23A 4IK6A 1BCIA 3UH8A 4R5XA 2RA1A 3CBKB 4JDTL 3PHQB 4JKLA 3C60D 4OV5A 3HC4L 2VM9A 1JRHL 3LIZA 5KN5B 3T2QA 2AI0H 4NUJB 2BP8B 4JDZB 1A7PH 5DF0A 5KVDL 1G9MC 3TOPA 5J06A 2YGVA 1A1NA 3RI5F 1NAML 3DX2A 1QFWM 5DMKB 4S1RH 1U91A 2XACC 4PJAE 5FYLL 1EZVX 2P5EB 4ODWA 2WOYA 3RWJA 1RIVH 2AJSH 3CZFB 3HBGA 1GAFL 1HIML 3UEQA 4B96A 5LBVA 3S4SA 2GJ6A 1RQ5A 3OV6A 4XCEA 2VMCA 4C56B 4MD5B 2V37A 4HQQH 4O51B 4Z3IA 3QE5A 4JFEB 3CVIL 3KYNA 5D7IA 5BS0A 3GBMH 1KFAH 4Q74A 5ERWB 5DHMC 4XB8A 2H6UA 1U92B 3MRCB 4OUUB 5C2UB 4TOYL 2R8SL 1LK2A 2O6FA 3BH9A 3B1TA 1P6FA 2ICCA 3G08A 3EZ8A 2DJSA 2DMGA 2BP3A 3BKCL 2OYMA 2DYSB 5DEFA 4N9GA 2CBMA 2AEQH 5EC2B 2JKNA 3C6SB 4K2UH 1MUJB 1MLCA 4O2FA 2DY2A 2WW8A 3NABL 5M7QA 4TNWF 3CMGA 3QDJE 3V5DA 3TFBA 1AOHA 2MIZA 2R0WH 2V2WA 4LHQB 4PRDA 4QOKA 1JS4A 4MQ7B 3NZUA 1G7QB 4Q9RL 1IGCL 1IM9D 3ZSTA 5K59F 5F7FA 2E75C 1ZTXE 3SHSA 3AW5A 3IDYC 5F89A 5EC1A 1IQWL 1VGKA 4AK1A 2V17L 3OAUL 1P7HL 4W9KC 2AITA 5TE7H 1FE8H 4Y5YB 5DO8A 3O2WL 4GIPD 4WO4D 2UWEE 3BAKA 3WIHL 1KULA 2YPVL 3NCBB 4MVBD 4OJYA 4XPHL 3D3VE 4LCWB 1H5BB 1KCLA 1FRGH 2J3SA 3OX8B 5J0BA 1DBMH 2NXZC 3O81A 5DGRA 3ROOB 3AMLA 3C75A 3HUJE 3MMEA 4UV7H 1CB4A 3HZKB 4QRPD 3LVEA 2EYTA 1AHKA 1JZHA 5CIPA 1LQBC 1YY9D 3Q5TA 1I1AB 4B3VA 4GLRH 5TDOA 1GOGA 1FNGB 2C7FA 3II2A 5D7EA 1IC0A 2WQVA 2CUAA 1BGXH 2QEJA 2WVTA 1M1SA 1CF8L 3BYTA 3FQ1A 3QI9B 4DEPB 5KBDA 3BLBA 3NFPA 4XPFH 3OHXB 3PWPB 1FH5H 2AV1A 3D6GA 2O6DA 3ZTJH 4D2NA 1I7ZB 2IF7A 3FFDA 5JXEA 3IGUA 1F90H 1SFDA 3U25A 2ZAIA 3QG6A 2X89A 3QEUB 5IMOA 1KSRA 1BAFL 2ZCLL 5D1QC 2AXWA 5I1IL 1IL1A 2JELH 2VR5A 4Y1AD 4K5LA 5E8NA 3QORC 5GGSY 1QSEB 5EO1A 4OCWL 2X4TA 2R4RL 4U3CA 4Y4HC 1UJTA 1UD8A 1CTNA 3DVGB 1RD6A 3SQOH 2BFVL 4H7VA 1TLMA 2JJSA 1MI5D 1DLFH 1UT2A 3O6FC 4I0PC 4PJ5A 1JYNA 3KCPA 4OZHB 4PN6A 3ZDXE 3LAFA 1HXYA 4KO6A 4AZ8A 2XA3A 3IFLL 3QWOB 4PFEA 1U8JB 4KKQA 1T83A 2WO4A 5E0FA 1FO0A 5EU6B 1K5WA 2AEWA 3DGCR 1BBDL 3Q7JA 3QFGA 1X4YA 1E2ZA 5EZOL 2OW6A 3NUKA 5CZXD 1JIBA 1DEEA 4M6MH 3UFIA 1ZDSA 4DKEH 1R46A 3P3RA 1VFOA 3CLEL 4F5CE 4HIIB 3CBJB 4FADA 2XQYK 1XV8A 1SBSH 3AS3A 4X0KB 1XH2A 3V6OA 4K8RC 3V4LA 2AQQA 2LAAA 1RUPL 2ED9A 1S9WB 3JVGC 1NWPA 4FLQA 2J5WA 1DQDH 1TFHA 1X7QA 2VDLB 1Y0LA 3ZMNA 4ZG1A 4DGIL 2PW1A 3DOIA 5EEWA 1URZA 3QNXA 4U6TA 5IB2A 4OCRH 1J8HB 1FN4A 3D09A 3G5ZA 3LRKA 3ZHLA 3C5XA 5JZ7C 1D2PA 3BT2L 4A7SA 3IGFA 1ETB1 4YDLB 3DJTA 1IX2A 3LH8A 4R2GB 3UCRA 3MOAL 1ZVSB 4L3AA 3V52H 4BINA 5C70A 3H53A 3VVWA 3BUYA 1PKQE 4HJSA 1FIGH 4YDKH 2VITA 2JI3A 2EEXA 5ID0A 1K2DA 4NQVA 3ZHNA 1WBYA 3UGXA 2ZWSA 3GBNH 4GAYB 3RILA 2GHWB 4XP4H 1FZOA 3TA3C 2ZJSL 4N5EC 4PD4K 4M7ZB 5I5JA 2MCMA 1PZ2A 4CW1A 3WTYA 3QR1A 2VDLL 3G5WA 5TK2A 5JYMA 4JFDE 1KCRH 3LHPL 1EZVY 5CGBA 1SDAB 4PJGE 1XXDC 1OK0A 5IW3A 1V27A 3LIZH 1YEKL 5BVPL 1NM9A 4PG2C 4TULH 1YYCA 4JN1L 1INDL 2P46B 1FGVH 3LEYH 4HF5H 2XIIA 4L9LC 4CKQA 1XCQB 5I74C 3MRMA 1NC2A 3LSOA 4K3JL 3FTXA 4AV4A 2Y7QA 2YPLE 2VN7A 3Q9QA 3R06B 1QKZL 1HAWA 4X0NA 43CAA 2WBJA 4QTHA 1MFBH 2DM4A 3O3DA 2Z4QB 5GGQH 2YA0A 3DJZA 1ODUA 4NOFA 4TSCL 5J6GB 5B4MC 1P2CA 5GS0L 3D06A 1WCBA 3LNIA 4OZFA 2FSEB 3MN8A 3KPOB 5GQBA 1ZMYA 3F7QA 1OGAA 4PJIA 1OHQA 5GRXG 2ED8A 1EERB 4GS7B 3BI9X 3FB7B 4QY8A 5EZIH 2FWSA 4L0YA 2DQFB 4YPGB 5IHHA 4MQXC 2M8XA 4JAMA 3DGGA 3VFVA 3HE6A 4F7CA 2WTRA 3VWJA 3ALWA 1MCCA 3KPRB 2X9WA 3EJRA 4MRCA 2P8MA 4JRXE 3VYPA 1GW0A 3BUTA 4MJ5A 1JV2A 3HC2A 2YAOA 4N0FB 1LDPL 2Y7SA 4JO4L 1MJ8L 4YVUA 4B9ZA 2NNAA 5DXWA 4GOSA 4BFIA 4HPYL 4PJEE 4O4YL 5E9DA 2UY6B 5C7XL 3CZGA 3N1QC 3MLXL 3KPSB 1FDLL 2BS8A 5FKPA 4JVWA 5EDSA 5A2AA 3U2IA 5FYJD 2WQSA 3PHQA 2NQ3A 4XMVA 3CN4A 1YYMH 2HTKC 4HUCA 5EOCL 2BP8A 1UZGA 1K8IB 5DHXB 4I18A 4Q52A 1B4JH 3SDXA 5DMKA 3DRTB 4HULB 3QJXA 1OQOA 3AC0A 2P5EA 3A4DA 4FNPA 3CZFA 1XH3B 2XN0A 5CCKH 2WLMA 1MEXH 5GRJL 5CIPH 3B6SA 3RWCB 2YAHA 3H55A 1QFHA 5HPMB 4GAGH 3M1BB 3JZYA 1FV1B 2Q9OA 4PRPD 2B1HH 3QH3B 1J88A 4JG0L 4MD5A 4IRJA 3LXUX 4O51A 3U46B 2KH2B 2YD6A 3LDBB 3R18A 4ZO8A 5E8OB 1QTSA 4TN9A 2XETA 4OUUA 1U92A 3CDFA 3ABKB 1IO4C 4XNUH 4NT6B 4OLYL 4LL1A 3IGKA 3IMWA 3JXAA 3COOA 3LQAL 4PJDF 4OIAA 5EC2A 1T0PB 1U3YA 1M56B 2GT9B 2KDGA 4HBCH 4HG4K 5KG9A 4EAEA 1C9SA 1FFPA 2AQRA 1C12B 4OFVA 3BQUB 2ZOWA 1EGJL 4OCNC 1OL0A 3Q01A 3L3KB 1A6VH 1FC1A 4KWUA 3D05A 1A6UH 4PY8J 1SF5A 4RGOL 5E95B 5DLML 1U3HB 4QRQB 4DAGH 3EJUA 3H0TA 1CICD 1FO0H 5DVMA 1OAYH 2X12A 4YQXH 4XH2B 3UABA 1T2XA 2R69L 1S7SA 1FP5A 4XAKE 1ICTA 3ARFC 4FOMA 1E5UI 1NJ9B 4Y5YA 3NCYP 4F7TA 2DBJA 1VFBA 3G6JE 3QJQB 4MA8L 4J2XA 4S1DC 1ZXQA 2V7NB 1H5BA 3RNQB 2R23B 3WNPA 3WY1A 4PWIA 2WGXA 1J5HA 2UVEA 5B22A 3BE1L 3S5LG 5BZWB 4ZNCD 5HVHC 3ROOA 4W6YB 1UURA 1FC2D 1TEGA 3MV9B 5ALCH 4G1MB 3UTTD 4XVTH 3WYRA 3FDWA 3HC0B 4J6IA 1FNGA 2LAGB 5CHNB 1T7YA 1LILA 4KXAA 1Q8MA 2R2BB 4ZFZB 2GBTA 1L6ZA 2GITA 2FBJL 3OHXA 4J7RA 3FQRA 3CFEB 3H3BC 1I7ZA 2ROYA 3A67H 5DO2C 4A6YH 4NN7C 2DOCA 3QEUA 1WV7T 4JRYD 1OAQL 1WS8A 3IFNL 4FTVB 5DJYA 4P2RA 3FH8A 2VYRE 1PZBA 3OZ9H 5FFLA 3U30C 1F13A 1CLYL 1HJBC 3DVGA 1S3KH 3BDXA 4HIQA 5EZJA 4TUKH 2VRKA 3ZKND 3ZU8A 1N70A 4LHUB 2EIDA 3W0WB 2FR4B 4FLSA 4NQCD 3VFNB 3VNZA 2W38A 3V0VA 4D0DA 2DTSA 2X6CA 4BSWB 4OZHA 1PKOA 1TYRA 3DLQR 2NXZD 3F7VA 5E6SB 4YXLH 4Q58C 5EU6A 4OFYD 4G3YL 1QHQA 5E8PA 5F0PB 4JQXA 1VJSA 5I30H 1QBMH 5HPOA 5DUPL 1CLCA 3C60B 2XG4A 3RU8H 2OV0A 2VDKH 3RHWF 3ZUCA 1HCFX 2EDNA 5C71A 2C1PB 3C8KB 2AXJA 3OR6B 3UOAB 3GTTA 4ADIA 2WWMD 3L48A 4E5XB 5B39A 2EZ0D 1HK6A 4FX5A 1EO8L 1ZJAA 4NRYB 4WW1B 3MUJA 4OZFH 3U2JA 3QORD 3VTAA 4FE9A 4S11A 1OSZB 5BUPA 3NIDE 2Z0UA 5IKCB 1EFXD 4EDXA 4LLYB 5KVEE 1R3IH 5INDA 4IBSA 1Q0YL 4XP9H 4YGVB 1IC4L 1Z1WA 4IRSA 1AQ8A 6CGTA 3BZ4B 4U1KB 2A6KB 2GJJA 2KMWA 3O6FD 1M2VA 4A38A 1AQDB 1JK9B 3FFCE 2GC4C 2HKHH 4JG1L 2DJMA 4GAYA 3QIBA 4MQTB 5IK3A 2W1NA 1XEUA 4N2DA 3D8MA 3TEWA 1JNNH 2YEZB 4GSRA 4JCWA 3N43F 4JCMA 1UM5H 4AM0Q 1RULL 2BIIA 2W9LA 3IS1X 1KC5H 2D4DA 3I6KB 4P23C 5JNYB 32C2A 3D34A 1RIHL 3E38A 5D5MA 1AGCA 4K8RD 3UTQB 4MZ2A 4AMKH 3K6OA 4XBEH 1MSPA 1KEMH 2DWTA 3EBIA 4ZX4A 1AR2A 5CEZE 2IGFL 5SWSA 3HG1D 2GSIB 2NY4C 5E00A 5T3XL 2HWZL 1L9TA 2PWFA 2VLKA 3VXRD 5EZPA 3HHRB 3QVAA 2Y2WA 3BAEH 3DIFA 1SJHB 4ODXA 4UILL 4DP0X 1Q94A 4MJID 3KYMB 4RWHA 4LP8A 5JW4M 2JB6B 4LSSH 3HG5A 2DW5A 3TBCA 3VMOA 3X1GA 1KN4H 25C8L 2VDNH 3R06A 5MHSD 2A9ML 2PP9A 3VYNA 4PJDB 4WO4B 4TLUA 1CT8B 5IOKA 3BPLB 1JGVH 2CNZA 2VDOH 5IROA 1UH3A 2IO5A 3MRGA 2A74A 4YXHL 5IFJA 1M6UA 1TNNA 5J1AA 1MCBA 2VO8A 3GXUB 3MBWB 4KXZI 4XCYA 1JJUA 2A3TA 2FO4A 2NW3B 3TA3D 3KPTA 3RGBA 5KOMC 4WI2A 3AADB 2BX5A 2BZDA 2FSEA 3BOVA 1WZMA 1E5AA 3O4OB 2QDVA 1IBHA 1VIWA 3FB7A 3FO2B 5AALA 4GAJH 1M71B 2PPDA 2K6ZA 1FCCA 2Q86B 3OM3B 4HU8A 1OV8A 5TDNB 2DQUH 3OF6A 4XP5L 1R9FA 1F3DJ 4Z95H 3FTSA 4DF9A 1JPFA 2YAMA 2IDTA 2EO7A 5DK0A 2J1WA 4LSQL 4FNLL 4OI8A 4LVNB 2HFEB 1IAIH 4Y1AB 1UZ6E 3QUML 5IMKA 2JNZA 1VHPA 4Q4EA 4OF5A 3TNMB 3MCG1 4YDVA 4ZUTB 4PEEA 2UXVA 3MRFA 4DP8X 3IS0X 2XWTA 1EUTA 1TZHA 3IMSA 4AH2B 5C9JA 4JFZL 5EUOA 1HZKA 1CL7I 3HTLX 4HJIA 4BUGA 3D39E 5B4MD 1JWMA 4ZPVA 1T20A 4NPYB 2G2RA 5I8KH 5IWLA 1LE9B 3TX4A 3OLEA 5HI5D 3U7YL 3B2MA 1K8IA 3HI6L 3QEQA 2BSED 1UH2A 2J2ZA 3W11C 3WKQA 1SVCP 1RZKH 2HKFH 3QZLA 3KPMB 2XA8L 3TONA 3ULUD 2VLME 2DBLH 5HHPB 4MQXD 2IVFC 2WHVA 5HHMD 4IYKA 3C5ZA 3QO1B 2GK0B 4HWBL 1RSFA 4FZ8H 2FX8L 4HS6A 3O41A 1BZQK 4OLVL 5HPMA 3M1BA 4JKWA 1UENA 3QH3A 4GXVH 2MHAA 5I0ZA 3AU0A 1OM3L 4IU2A 3U46A 1TT6A 4DP6X 2CLZA 5FA4B 5JHAA 5E8OA 2F68X 3LNHA 1SXAA 3MOBL 3EBAA 3MNWB 3HR5B 3D25B 2WLNA 4Q7DA 2BOCB 2NY2C 4NT6A 3ZGHA 5FR3A 3FT0A 2G5UA 1NLBH 3FOLB 1ZLVK 3X3FL 5GPRA 3BAIA 3EJSA 2WLIB 5GS1A 2VDQH 5DSCB 3MLPA 1L9RA 3NJNA 4TQ8A 2XZCH 4JFPA 1TO4A 3ZZLA 2WJ5A 2F5AH 2J4WL 1L7TL 1TETL 3BKYL 3EOBB 4M7JH 1FLTX 5C3TA 1OARH 3VAEA 4Z7AA 3L3KA 3MYJA 2Z7WA 3ZTNL 3ZRSA 4R26L 2FYYB 1DJYA 3H7LA 4E36A 4LO9A 4XGZB 1YG9A 4JQVA 2V8LA 1FUNA 1PYWB 3UC0L 2AK4E 4OCSL 1CL7L 2IAMA 3V0DA 3MV8E 3KPPB 5LBSL 3MJ7B 3U9PL 4M6OL 4F93B 1FWXA 1FNEA 1ACYL 1NJ9A 1F4YL 1DEDA 3C2AH 4G6JH 5D1XE 4I5BB 2V9QA 4L3ED 4WFEE 1X44A 4PAZA 2UZIH 1PG7W 4DPBX 4E9YA 4OFIA 3RA7L 5AL8A 1SJEB 1X5FA 3H42H 3RIAF 5IFHL 4PYHA 4R4BB 5BZWA 1YHPA 4M5YL 3TC9A 1MCOL 3UTSE 3VFUB 5MEQB 1YUHB 1P69B 2BCKB 3VI4A 4UQAA 3IJ7A 4JO3H 1TQUA 5IZ7A 3N43B 3VFTB 2AJZB 3DDFA 1U8PB 1CXLA 4QWWC 3KLDA 5TQ0H 4ZFZA 3D08A 1DN0A 3L13A 4KKBC 3P4MB 3V0WH 4WI0A 5BOZG 1IRAY 4AW4A 5EORL 1T0NB 4EOWH 3A4EA 2KPNA 4FLOA 4R7XA 3I3DA 3TPUA 3UZQB 4MBRA 4PS8A 4N8PA 2WUCH 4GNKB 3KG5A 2JQMA 4UT6A 3ZR5A 3GXPA 3WNJA 1U4FA 4WU5B 2K4AA 2WLYA 2VXVH 3D52A 1GZHA 4FP8H 4QD2E 4K3EL 3ULVL 1OTSC 2YD5A 2DLTA 3W0WA 3QQ4B 4AKPA 2UXGA 3NTCL 7FABL 3IDNB 1HHHA 4DPRA 5KSBF 3DMMA 3DO3A 4Q6IA 4FG0A 1BZ7B 2YC1A 5D72H 1IGFL 5I1JL 5CJOH 1Q4NX 2H1PH 3OLIA 2NYZA 2J6WA 4ENED 3ATFA 1F6LL 4KK6C 4HA1A 1QZNA 2VLJD 4PRNB 4PH8A 4ZFFB 1AZBA 2VAJA 2FX7H 2HA1A 4JFVA 5B21A 4DPAX 2IJ0C 1RXLA 4KV5E 4M61B 4J27A 5F1IB 2VDML 4PLKC 2GSGB 4L2LA 2FJGA 3C60A 4IGBA 2E86A 4P59H 2WIIB 1DQMH 5EIIG 1DQLL 3OR6A 3LD8C 4QJ4B 5D7JA 3EYOA 4E5XA 2JLLA 2ODHA 3MGTB 3FB8B 3H9HB 4R96A 3FRPA 4FZEH 2Z92B 3K1DA 1ZGLA 4XB3A 1MW3A 3PUUA 2GC7C 1EMTL 3RTQD 1VEPA 1G9EA 3MRHB 1GIGH 2FQDA 3TJHC 4ATTA 5IKCA 5ANMA 4BZ1L 2DLFH 4DJMA 2IALB 5KYYB 4HIEA 2HMID 1TG8A 3LN4A 4MCYB 1N18A 4YGVA 3BIKB 4PRPB 3BZ4A 2MMXA 4U1KA 4KJQD 3SE3C 1AQDA 4OGZA 3IU4H 3K80A 2VQUA 1UOKA 4K9EC 1KCUL 2EE6A 2X2IA 4I87A 3VJ6B 2P8PB 2FIRT 1AO7D 4PCKA 2FWLB 3S3JA 4F24A 1CGUA 1MJUL 2QGEA 4LOUD 1PU0A 2YEZA 4H40A 1FL3B 2A9NL 2ZX7A 3VA2C 3LRGA 2ZOTA 5I6NA 2EUWA 2WLLB 4JEGB 2IG2H 3I6KA 4RFOL 5DU7A 1A7PL 3FQXA 4C47A 1OPOA 1I9RL 3UTQA 4O2CB 4BHUI 2WKLA 4LASH 2Y07H 2MSPA 5DT1H 5KVDE 1J5IA 3D4ZA 4EN2A 4ZX6A 5CBAA 2GSIA 5JA8B 3T3ME 3GEFA 4IOIB 1IM9A 2JJUA 1A7RH 1R5WA 4WJG3 5EULV 1CICB 3TBBA 4AUYA 3KYMA 5LWYL 1O6VA 3Q6GL 1K3IA 2O6EA 2K8QA 5I8OL 2J12B 4WV1B 3L17A 4H0LC 4YHYB 4P2YA 2CDGA 3GMNB 1AP2B 3JQOB 1F4XL 2C9UA 3BUQA 3GBML 5ICXB 1MY5A 1OTTC 4M4RB 1Q90A 1I9JH 1NMCC 1JK8B 4WQOA 4YHZH 1KUMA 4JVPA 1HI6A 1MREH 4KK5C 1UEMA 5D93B 4IMKA 1ZHKB 5IP4A 1HQ4B 1WEJH 4PJ9C 3QDMD 1K4DB 2VXQA 4QRPA 4K94C 3GTNA 3UTTB 1II4E 4P23D 2DM2A 5HJ3B 1SM3H 3E6FB 4FS0A 1MVUB 1M71A 1OAXL 4GO9A 5EOTB 4IBWA 2BJMH 2I7SA 2LABA 4XC3H 3GD1C 3WIIH 4I9WE 2D0HA 3VO0A 4L0ZA 1D7BA 4PJBE 4BFFA 3QHFL 4R7NA 4WHDA 4JFQB 1E67A 2G60L 1KTRL 3P0VH 3ULUF 2HFEA 4Y1AA 5MEOB 3TIEB 5GRVL 4HXAH 1D6VH 3TCTA 4HS8L 1WFUA 3ALXA 3G6DL 4LVOC 3N9GL 4S0TD 4YZFE 2BSTB 2XIBA 5E4EB 4XCNB 1G87A 5DD5L 1U95B 4N0CC 1O7VA 3PY9A 1MI5A 1DZBA 5K1NA 5JW3H 5J1TC 4F57H 4ZNEE 1M57B 5L0QC 1U8OB 1SDDA 3ETSA 3CXDL 5TE4H 1Q9OB 4BIKA 3QCVH 4MJ4A 1MCFA 1P5VA 3ROLA 4V1DD 2PCFA 4KI1A 3MU3A 2O4EA 4TV3A 3KPMA 5AB9A 1SHXA 3B7YA 2XC8A 4LCIL 4JREC 3AJ7A 3WD5H 1FH5L 2GK0A 4DGVL 5AFAA 1A02N 4PJ7E 4ALAC 2EDFA 3H1ZA 4DT2A 2W07B 2HFFB 1AZZC 3G6AB 1TVBB 1GYWA 1X7SA 3BKML 5IEKB 2H6OA 4AJWA 2BCMA 2FJFB 5JHDA 1MCDA 1NDMB 1WWWX 5BRPA 5KSBB 4ORGA 5DQDH 3D7PA 4G5ZH 5C09D 1JTPA 2DF3A 1MWAB 2WTPA 3LKOB 4S1SL 2I69A 4OUOA 4UT6H 1NINA 4XOEA 5GGSB 3WFEH 5MEPA 2WBKA 2C9AA 5E94A 2C1OB 2HJLB 1WITA 2WLIA 4XBMA 3UJJL 2R7EB 5BZZA 4KI5C 3QDGE 4TUJB 2NRDA 4EQ3A 4UQIM 4LNRA 4DW2H 4PLOB 5J9PB 1RJCA 4QLRA 2PF6A 3R4DA 1D9KA 1R5VB 4X6FB 2FYYA 2J88H 3MR9B 3UO8B 1FYTD 4H8WH 3V9FA 2AF2A 4YFDB 1EAQA 4AE0A 5IY5B 1KXQA 1NEZG 3KXFD 4LPXA 1PYWA 4Y4KC 2XWBB 4X98A 5BRZE 3KPPA 2VZOA 5I71C 4UTCA 5FC9A 4PB9L 3KE0A 3THMH 1BEYH 1YEHL 1QSEE 1T1WB 2I27N 4XMPH 4HGWA 4I5BA 3S36X 4OH2A 4HCRL 5D7LE 3MLYL 3RFRA 3VH8B 1OPGH 3UACA 3HG1B 4ZMYA 1JZ6A 4JO2L 4HT1L 3Q06A 1AGDB 2C9QA 5KW9H 1SJEA 2D4FA 5LN4A 1ZT1B 2OS7A 4MJIB 1TTBA 1KJMB 1TJXA 5I18H 2AANA 2WYIA 5LGJB 3MBEB 3SPGA 4NERA 1D5RA 3VFUA 5BXFB 1YUHA 4JY5H 2BCKA 3CD4A 3JTBA 3VFTA 2AJZA 3DX7A 4H1LG 5C6WH 1U8PA 4RSYA 2ENJA 4TL4A 1QSFD 5ILTL 2B4CH 1BXVA 4BWUA 5DD3L 4NEHB 3OMIB 3ZKXB 4FEMA 1T0NA 3OJDA 3C5JB 3GLEA 4G6AC 4DGWC 1BVOA 1KIQB 1HYSC 4CVXB 1S7RB 3Q13A 4XNMB 1BMWA 4LGPB 1ZK5A 3B9VA 4W9CC 2XZQH 5DC2A 2XXMB 3P54A 4TULL 5DEZA 1LYQA 1ONQA 3RVUD 5TH2B 5DYFA 4HF5L 5FOBA 1PLCA 4HW6A 1TQVA 4DK3A 1E9PA 3I9PA 4XXCC 3Q1SL 1NCAH 4LLMB 4N2NA 2QZ5A 1BZ7A 4X5RA 4LL9A 3EF7A 4PJ8C 1NWOA 3ZE1F 4PTUA 1KLGB 5C0JB 1LP9F 2E6JA 4CL7A 1SQ2N 5FM5O 2Q5BA 1FFOB 3DJ9A 2JJTC 3P11H 4J4PD 3D9AL 3IEAA 4WJ5B 4X8XA 5GJTL 1IV8A 3UMTA 2C9SA 3DPBA 2SEBB 4L4VA 3KW8A 4QWWD 5KVFL 2GSGA 1CE6B 1I4FB 9PCYA 4LEOA 5KS9E 1N4XH 4KKBD 4MMZB 2DIAA 4U1IB 4PJCE 2HN7B 4JHVA 3TEXA 1LQSR 4H8QA 3MGTA 2Z92A 1JGEA 1H3TA 2YPKB 4JRLA 3CSGA 4B9PA 1WFMA 3VXSE 3REWB 3BP6B 4Y9CA 5D2NC 4QAMB 4OZ4B 1U8MB 2Y7MA 5HHMB 2VXQH 2R1WB 2WQ8A 3TT1L 2X1XR 1DUZA 2CALA 3CLFL 4L8SB 4RGNC 4Q9QH 3ILQC 4MCYA 1DBAL 1DQJB 4FJZA 4N90E 5HP5A 5J56B 4B9CA 4LCCA 2KHAA 1SBBA 3BLKA 3GGWA 4MD4A 5DS8A 4BQCA 1WFJA 1R1CA 3FRUA 4XI5C 4YDIH 2VUOA 2EEFA 3UPAA 2J6EL 1QW8A 3A3YB 3VJ6A 2P8PA 4ZX3A 3EHBD 4FYSA 4PB0L 2OJ1A 3S88L 1HHKB 3AGWA 1BVNP 2DMKA 3TM6A 3U4BH 4GB9A 5FO9B 4KBPA 5F0MB 3QXDA 4PLKD 5IOPB 2DI7A 4C54A 2HSIA 2R51A 4RMQA 3VW3H 3TO4C 3PDOB 1PDKA 1UXSB 4U1HB 1JI2A 1JHKH 1JZDC 3HPLB 4ZRGA 4AG4H 3NJGA 2K6YA 2Y1VA 1BM7A 2EUVA 1D7CA 4HG4J 1IEAB 5FK9B 1MH5A 2QZQA 5A2KH 4AYMC 1CICA 2IV8A 1QNIA 3OKKA 1CFSA 3B7SA 5I1GH 3PHOB 3HC3H 4XOAA 1EEYB 2BPBA 2H3XC 3U83A 1AP2A 2YD0A 1AFVH 4HEPA 4OQTA 3V4UH 1UATA 1IGML 3FN3A 4JFOB 5ICXA 3L2MA 5IQ7L 3KPSE 1N6QH 1GCFA 1A1MA 3MUZ1 5E6UB 4BEIA 1HESA 1QVOB 1DHKA 4XNUL 5AG9A 1JK8A 3B34A 2OMWB 3HMWH 3S34H 1FPTL 2WAHA 3GBDA 4ODBD 2KBGA 1ZHKA 5FA3B 2CNYA 3SYCA 3CC5A 2HKAA 2HPOA 5EIVA 2MPAH 3GDBA 2Y1ZA 3L3GA 4NYLB 1DVQA 2FB4H 3T0DA 3E6FA 2NQCA 3S8WA 4H26B 3TFKC 2LHAA 2LQRA 1MVUA 2YMXH 4JPIA 3FSVA 4F2MB 1VFMA 1RI8A 4Z6AT 4ZMLA 1C8PA 1A6UL 3U0WL 1FZKB 3V8CA 4ICXA 3RP1A 1IM3B 1C7SA 3M8OH 3L2NA 2X2UA 1VESA 4KXCA 4Q2ZB 4JRYA 3BYYA 4NO0D 4UQCA 2GI7A 3TZVD 5IHZA 4PQXA 2XJLA 5MEOA 1W0VB 3BSZA 1JPST 1BFTA 1J1XH 3STBA 1XBDA 5EEYA 4PY7A 4KZDL 1BF8A 1DQIA 3BAXA 3IN0A 4FXKB 5C86A 4KRPC 1YNLH 3EGSB 4L8CB 1YEDA 4MB3A 1BFSA 4MZRA 2D0GA 3QIUC 4NQCA 5H37A 1E4WH 4K4KA 2DQJL 1KB5B 3A6CL 1HZLA 5FUCC 4KK5D 4K5OA 4P57B 3L9YA 3ZHDA 4U31A 3FNKA 4LF3B 2IC2A 4X6CE 2AAAA 2BY3A 2XWJB 3Q8EA 1H8SA 5DWUH 4MA7L 4P04A 2VLJB 1TJIH 4TMPA 2GY7B 4YBLB 4AQAA 2QQKH 5EA0H 3RY6C 4JB9L 1G0YR 3RB7A 1MG3C 3V6BR 4EBQL 3QWNA 4LQFH 1OB0A 4R90H 3H85A 1UTDA 3MLVH 2VRQA 4L23A 5DMIL 4RMRA 1H9VA 2HFFA 3KL3A 3TJPA 4HFUH 4E9LA 1ZPLA 4KPHL 1M7IA 3S5ZA 5IEKA 3LRSA 2EDHA 3DWTA 2FJFA 4ZW6A 3OZ9L 2EDTA 3WS3A 3QORA 1NBVL 1YVLA 3ZE1B 3RTQB 3R0MA 1JZEA 1MWAA 2HAZA 1EFXA 1A3RL 1IJNA 1KB5L 1O75A 1LP9B 2HRPH 4Y4HA 3MV11 2J21A 1AAJA 4GJTB 2CCVA 2MFNA 3MRPB 1MHHA 3U9WA 5IGXH 5IB1A 1D5XA 3O6FA 4I0PA 3O0RH 1QWHA 1XL4A 2GHZA 1ND0B 4TTDC 3X17A 4Z3FA 2N59A 2BW4A 2WNWA 4XVJL 3GHEH 2P49B 1AO7B 1XAUA 4IK7A 1U9KA 3MR9A 1CFVH 4JHAL 2K0RA 2Y5TB 1J05B 1W2KT 2J55A 2XWBA 3RL2B 4HKBA 3CFCH 4CADB 4YSQA 4HKJB 3GHPA 3NCCB 2ERJB 1KGUA 3OJMB 4LGRB 1T1WA 3EJQA 1LEKA 5A40E 4D8PB 4DEWA 3V5KB 1M7DB 1XGPB 3VXRA 1ZDQA 1J5CA 2XFXA 1U8NA 2C5DC 4PS7A 5T1JA 3QFJD 5I76B 4JL2A 5BXFA 1SYSB 4OLZL 2G3MA 4MMXB 4PVNA 3QG7H 2R1XA 5D7SH 3TYGL 5SX4H 4XPTH 1IU1A 1ZSDB 3DHPA 3L3HB 4KI5D 3GINA 4OF8A 4IKJA 3A0OA 2NY0C 3HRZB 3TA3A 1E6OL 3C5JA 4AQEA 4U1GB 3IBEA 5F70A 5I73C 2DWSA 2ZUTA 4IM8A 2E7DA 1KIQA 1SRDA 2OPCA 3JWNC 2Q8AH 3QDMB 3UYPA 3OKOA 1H0DB 2ESVD 3QCUH 2O30A 4XMWA 2OSYA 2VUKA 4OCXH 5KTEH 1JV5A 1DSYA 1JWSA 1KFGA 1T21B 1T7ZA 4HHAB 4MA1B 5EN2B 2PCYA 3BT0A 5C0BE 1KENL 2WXGA 3V4PB 2XFGB 5T3XE 5IR1A 4PG2A 4KMTH 2YXWA 4JL1A 4KJWC 5AKTA 4Z78A 2ADGB 4LLMA 4NUGH 2AXFB 4WI9A 3ABZA 1PZAA 2V3FA 4HIHA 4MXWH 2VDNL 3CCHA 1KLGA 1FVDB 3D87B 2H26B 5C0JA 4PUBH 2ZUYA 4NLHA 4ZTEA 4EVNB 4FHKA 3CFQA 5E2UL 1FFOA 4P9HL 2VDOL 3QUXC 4WJ5A 4Z8FH 1FBIH 3C2SA 4Z3TA 4RAVA 1GSMA 1U2HA 4PRHA 5B3JE