4W9HC

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
140
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
molecule tags Ligase
source organism Homo sapiens
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
total genus 37
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9hC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9hC01
3ZUNC 4W9HC 4W9CC 4BKSC 3ZTCC 1LM8V 4W9GC 4BKTC 4B9KC 3ZRCC 3ZTDC 4B95C 1VCBC 4W9IC 4AWJC 4W9KC 4W9LC 3ZRFC 4W9EC 4AJYV 1LQBC 4WQOA 5LLIC 4W9JC 4W9DC 4W9FC
chains in the Genus database with same CATH superfamily
3NEOA 4D9QD 3IJSA 1QMUA 2D0FA 4RLDA 1PLAA 5I73B 3DTXA 1TETH 3QUMA 2AV1B 1FE8L 2BFVL 2BZCA 5EH1A 2EAEA 5L9DH 4S1SH 1C1EL 2OTUB 3UYPB 4AGMA 3DMMB 5A3ID 5I2IB 1CI5A 4OD3L 3UPAA 4WDIB 3U2JA 4G80A 1ETZA 3TWYA 2XLLA 3AWGA 3KYMA 4H7VA 2Q9OA 3O9WC 5EBWA 4NKQB 4EQ3A 4F27A 5I1LB 4I9XA 4RMBA 1Q9KB 3LNEA 4NQXB 4FTDA 5DC0A 4PRID 3MXVL 3KWUA 4ZSOE 2YO3A 3U36A 4N3TA 1ES0A 3T1FA 3WEAA 3V10A 3KYOB 3U6XS 2DM2A 1NWOA 2WXGA 3CN0A 3VRLE 1HK6A 4JFZH 4DW2H 3SKMA 3LNDA 1T3FA 3OSKA 1X5MA 2FLRT 3QNZA 5DZPA 3PHSA 4WSGA 4NQCB 4OJFH 2R56L 1UM4L 2P47B 1RIHH 5IHWA 3L3DB 3LVTA 4JO2H 4G9FE 2XYBA 3VJ6B 1DVFC 4IS6B 4JN2B 4AUJA 1HCFX 5C0CE 3F7VB 4IIQB 3CVHB 3NZUA 1R3JB 2J5WA 1GOHA 4WHDA 3WAKA 1ACZA 2Z6FA 3MV01 3OMAB 5AAWC 3GSUB 4GAJH 4IMKA 4M1DH 4Z9KB 4IEFB 4FEIA 4HHWA 1B3JA 4WUUB 2PP9A 2F0CA 3EOBA 3LKOA 4PBWD 3KPRB 4QOKA 2WN2A 2QEJA 4HAFA 3T6QC 3FMGL 3QYCA 3W82A 1IM9B 3HCVA 5E03A 1SDAB 1WWCA 4FQ2L 4KTEL 5I0ZA 3CVDA 4MCYA 4BCXA 1GS6X 3HHSA 2B5IB 3FUFA 2OMNA 4AJYV 3H0TB 5E95B 4WQOA 5DVMA 2QT6A 5IESL 5F3HB 1NOLA 3BRGC 4MBOA 4L2YA 3RU8H 2NT0A 3FZUD 5CZVH 5LAPA 2QSTA 2UY7A 5LAXA 5EF3A 1KXVA 5B1KA 1N26A 4M8RA 3WFEL 3I02A 4A55A 3BH9B 4Q14A 3W2DL 1QW8A 3TO4A 4YHYC 4KHTH 1U8CA 4ORZC 2WQVA 4KX8A 1EDYA 4A2EA 4OCWH 3S96B 4FABH 3ETSA 5DLMH 1QI5A 2CLVB 3IAQA 3T3PB 2FATL 3FYIB 1DDTA 1ZGLB 2G2RA 1FV1A 3REVB 3DX9A 3MX0A 2A6KA 1F6FB 3TA3A 2Y07H 4OZIA 1ROWA 5KVDL 5KJ4A 2A1WH 3FSOA 5EUKA 1JWMB 3SE3C 3NIDE 1CGWA 2CJUL 2CZNA 2QHRL 4DQOH 1QLFA 2K0RA 1R19A 3GM0A 2BPBA 5HVHB 1GHFL 4AQ1A 3TXAA 3WCYA 3U46B 4ODTH 4YL9A 1UXMA 5J57B 4KV5E 4FQQA 1OB1A 4X4XA 4MMXC 4QGYA 3TVMB 4KFZC 3DPDA 5DS1A 1R46A 3NJVA 3VFTA 2IGFL 3WY2A 5DURD 4WFFE 4K7PH 2HRGA 1D7BA 4MXQC 4MA7L 3AZUA 5TQ0L 3RIKA 1G7JB 4APQA 1MAJA 4NKIL 4Y1AE 2OJ1A 2VM4A 1J5HA 5CUSL 2F5BL 2BZDA 3A5VA 4JHAH 3S8WA 1KG0A 2WXLA 3QCUH 4F7PA 1YEGH 4OW6A 4Z7WE 4NWTL 4YHOL 4RQQA 4KDTA 4DCQB 5EOTA 4L1TA 2XFXA 5DRWA 1H3XA 3OD3A 1JUFB 4IRSC 3EH1A 4DP1X 1H3UA 5ENWB 2FEJA 4GQ9L 3RVUD 2ZKHL 3IPFA 1PDKA 3U2SA 4KKNA 2D4DA 2CO2A 4YDJB 4RWYH 1IQDA 1JPGA 2QZ5A 5SWZE 1M6OA 1WC7B 5B39G 5BO1L 3CIQA 1YJDL 4XBEH 3GMMB 3DX7A 1QACA 1D6EA 2HRPH 1CFTB 2R51A 3D25B 3LN4A 3BD3A 5CAYB 3BCFA 1KB3A 4B97A 4IK6A 2UUDK 3GINA 3B2DC 3ZHDA 3TJPA 3MA7B 4DZ8B 3QXDA 5FYKH 1UWXH 4ODXA 3UZVB 5J6HA 1Z9LA 1JWSB 3NJGA 4MTMA 2AEOA 4NZRL 3ECVA 1LK3H 4ZXBD 2FQFA 5E7BA 1TVDA 2CIKA 3SBRA 5ACMA 5JXED 2I9TA 2RACA 3U1PA 2MTAA 4Z78B 1NGYA 4N8CL 5BXFB 4IU3B 2F5AL 2J73A 1BQRA 4MB3A 2JIXA 4JPSA 4LCWE 1UFUA 4P5MA 4ZFZB 4KNQA 4K0OA 4FA7B 3QIWC 4HUKB 4N0UA 1QFOA 3I2CL 2HWZH 2NQDA 3QUMH 4PJGF 3QH3B 2P80D 4DVBB 1MFAL 2CO1A 5AL8A 3WUWG 1MVUB 3QNFA 5F1NB 1P69B 3CDZB 1SXAA 1NCWL 1E5YA 1NIEA 4WNSA 1XBDA 4KKBC 4FXKC 1I8LA 5E70A 1LILA 3RX7A 3Q01A 3A6BL 4Y89A 1KENH 5EOQL 2J1KA 3WXWL 4DP0X 1MEXH 2CHZA 2GTWA 4LBEA 1JYNA 3QJSB 1EWHA 3GSQA 3RP1A 5AOJA 1NCAL 2RGSA 4QY8B 2E6JA 1NCDH 1L9TA 2CGYA 4QRQB 4FG6D 1OGTB 1UT9A 2GFBB 4NP9A 3TVMD 1R0AH 1YY9D 3DJRA 3DWTA 2A6IB 5DD0H 2BK8A 3TBWA 4EEEA 2C26A 4XP5L 2AK4A 1NKOA 1MCPH 3BLKA 3FO2B 4P59L 1IBHA 2FJGB 1BZDA 3ZQWA 4Z7NE 5F2FA 3T0WA 4DT2A 2VXTH 4XP1H 2N0MA 3UYOD 3W81A 3LRHA 1WTLA 3RPBA 2VW4A 1I8AA 3TGXA 1I9EA 2KPNA 4QXTA 4JN1H 1X9RA 1FCGA 5DO2D 1F8TL 4XVJH 1CR9L 1U8HB 2CK2A 1CICB 2FNWA 2X4UA 3MJ8A 1LNUA 1AVAA 2OW6A 4HSAC 5LBGA 4OF3A 3ARDD 1D5XA 3MLWH 1KN2H 2DD8L 3MBXL 2PO6C 1GC1L 3IRZA 5DMKB 3TOPA 1IC4H 2LHAA 3UBXG 2QV2A 3ZKXC 4Y4KD 2AJZA 3CFJA 2EIKB 1BQLL 2WZAA 3ILQD 3PL6D 1BQHG 2YGPA 3BISA 5CEZD 4Q2ZB 3SDAD 3JBG7 3D08A 2CWRA 1NC2D 1QSFB 4JGJA 1A3LH 3MRMB 5D6DA 3ZYJA 4WWKA 1PPIA 3VFRA 3D25A 2ADJB 1P4LB 4QRPB 1MJUL 3Q2NA 5D71H 3CSYB 1I7TA 1MJ8H 4Z76B 3MO1A 1FC2D 1HHHB 3CE1A 5CEYA 1FAKT 3Q6FA 2AK4B 2FUTA 3ZW3A 2J20A 2EUXA 2HX8A 2VLJE 4CDHA 1QEWA 3KPSE 5BRZD 3TYGH 1E50A 3AG3B 3VM7A 1B4JL 3WHE0 3MRFB 3EH5B 3O3BB 1E7VA 1MEXL 2QDWA 1AKJB 4KRPC 1ILUA 2YEZB 1WA0X 4GG6A 2N1TE 3ZYIA 1QWUA 2KZBA 2Q8BH 1ZGLP 5LNEA 1T1WB 2HRLA 1DJHA 3PABB 1XGZA 1I7UB 2QPEB 2Z8VC 4MQSB 1PMYA 1KYFA 1LEIB 1DDHB 4PRHE 1MVUA 2WP3O 2BVOA 1ZLSH 2VWEE 2QR0B 5F7WC 4JQXC 1I1AD 1JGLH 3L1GA 5JPNC 3BP6B 4IKIA 1SZNA 2XY2A 4W9JC 3EFFA 4B41A 4KQ3H 2YRBA 2X3BA 3FQNA 5C08D 1CI3M 3TTYA 4NZDA 3PWJB 1NINA 1UWYA 2VQUA 4QTIL 4UZGA 3EJYD 3K74B 3K5RA 5H4ZA 4NQSA 4NZTL 3AADB 4PRIB 2BIIA 3UTPE 4LFHG 1WWAX 4ZXBC 2XC8A 5D5MF 1GGUA 2QQLL 3A4EA 3K2UL 3QQ9D 3RTQC 2QBWA 2HFTA 3ZN6A 5I6OA 3VXOB 2BNRD 3H9SD 4OZFB 2FYYB 1CZ8L 3FPXA 3A24A 4WI8A 1OGAA 1A7RL 3DMMD 2XVLA 4S0TD 4WNQA 1R17A 4LSSH 5I1EH 2ENPA 1QHQA 4JRFA 1DQIA 5KVFH 3HC2A 2P52A 3JVFC 1AQ8A 3UJJL 5L2KA 3GLZA 5DRXB 4F1SA 1SOKA 3VYOA 5EEWA 3QYNA 1NIBA 5AKSA 2XOTA 3U0PB 3WXVH 1G9MC 2P43B 2VW7A 3G04B 2EYTB 1J0HA 1AP2A 3ETBJ 4P2RA 1X5LA 3V6OE 1EDHA 3VFOA 6TAAA 1D9KD 5HPMA 1TSHA 3IFOB 2Z91A 2WINA 1I1RA 4XE5B 4FNQA 4JFHD 1FNSL 3OAZK 3UC2A 2A74A 2J1YA 4KJWD 1MRFH 3FFDA 4YPGA 2CSPA 2GCYB 1MCIA 3FUKA 1FRGH 1J9TA 4R96B 3QQ4A 5DMYA 1DZBA 5CLWA 4Z8FL 3ZJAA 4J4PD 1XX9C 1RPKA 2D31B 4POZD 5FW7A 1DJIA 3GPSA 4W9IC 4PTTB 4X4XB 1V5JA 2ED8A 4LCCC 1RJZA 4B7LA 2AI0H 2RIKA 4HIXL 4NOFA 1QR1B 4Z7UE 3X3FL 1IGTA 5J89A 4NB7A 2ITFA 2V2XA 3L9RA 3LRGA 5CZKA 4KZDH 2G3ZA 4X98B 2Y5EA 4NN7C 5LNDA 4HS3A 3W11D 2Q7NA 1Z0NA 3I6KA 1ZSDB 2NYZA 1PZCA 3BPLC 1CFSA 5FK9B 3ILQC 5EO1B 3VFWB 4AV0A 2XRAH 3NGBB 5AZ2L 4PG2C 5A2FA 3PDDA 3L6FB 5ILTH 4LHUG 4YDVB 4KMLB 4OR1A 4HISA 3KYOA 1GAFH 1NMBH 1FFRA 4FD0A 4KKCC 3TIDA 3UBXB 2OW7A 3KM1A 3WL9B 1KY7A 2OLDA 3I74A 4F37K 3GRWA 3NH7L 2OCCB 4XXDA 4U1LB 4E5XA 1SHMA 2ZCHH 4DKTA 4ZUTA 1M7IB 2FQGA 4GYBA 3WIFA 3QJTB 4UOZA 1HKLL 3BD5A 1E4WL 4GXVH 1T6BX 1EQWA 4U6XB 1HZLA 1EJOH 4UV7L 5KUKA 3A6OA 1G9NH 1GZQB 1NUFA 2GHWB 4LBAA 2VQTA 3VMPA 3WS3A 5CZVL 3LQZB 5CN1A 1T20A 2OX5A 5DO2C 3RTQD 3K80A 4MJIB 5L6YH 3O81A 5DZAA 2AAVA 2W95A 3D69A 4HH9A 5D7IB 2F53A 4FTVB 5IVXB 3ARZA 5T5FA 1Z5HA 4OGZA 4WU7B 4KGLA 1QTSA 3FT4A 4ETQA 3VI3B 2NY6B 1NMCC 4IGBC 3VNYA 3WHE1 4GEJA 3VXTA 4QF1A 5IHLB 2H3NB 2GBUA 1FIGH 1LP9B 2C1OA 2TSAA 5EU5B 4X2UA 4JO3L 4G8GD 2P80A 2XWJA 3O45A 2UZXA 5CJOL 3CSPA 2QADD 4E36A 4JKNA 1J87A 1MPAH 4WW2A 2VLRD 2B4CC 3SGKA 5DJYB 3IRCA 2EO7A 1F11A 2QKIA 2YAMA 3ZDYE 1DVYA 3CBKB 5TE6H 3RL1A 3TFKD 1PJWA 2WTRB 4NUGL 1RJLA 3WE6B 3MU3A 1EANA 4C55A 25C8L 1Q94B 1TVBA 2A9MH 2FGZA 1P0SE 5I8KL 1MCEA 1D5BA 2ZUTA 5AALA 1RFDL 2G5RA 4EDXB 2NY5H 2A4CA 4Z0XB 4GW5B 3MOAH 3RVTD 1FNEA 5FKPA 3L81A 4LSSL 1BOGA 2C1OB 3GO1H 4TPRL 2X05A 3RAJL 1K3ZA 5HDBF 4KROC 4Y2DD 5F71A 3CFCL 3JT0A 3QR0A 5D93C 4ELME 1WRFA 1RHHB 4FHBD 1JBJA 3DK2A 5EEXA 2BFVH 1G9ML 1NBZB 3CFTA 3SGEH 2P48B 1Q0EA 4F15B 1OKEA 4AIZA 3VGBA 1E2VA 2J5LB 3BZDA 2PLTA 4TULL 4MDIA 4K3GA 3O8XD 4U6VH 3C08L 3QEGH 1U8CB 5DYOA 3ZTNL 1A5FH 2VOTA 4IKLA 4XCEA 2DWEA 1NFDB 2EP6A 3E9TA 3M17B 4YGVB 4RA3A 2A0LD 3CUPB 3LS4H 2IF7A 2OSYA 3ZHNA 2VXVH 4IU2A 2BOBB 1OP5K 4R84A 5DJ6A 3HFML 1A6UH 4ZPVA 2BSDA 1CD8A 1YYLH 5HJBA 2F7PA 4LCWA 4FHJA 4HUCA 4JO3H 2HJFB 4ZOEA 4UZUA 1PVHA 5FK9A 4U6YB 4X6DB 5LGJB 4PJ8A 1VESA 1WK0A 3GWJA 3I9PA 5DS8B 3JWNH 1QD0A 2H3NA 4OZFG 4MCYB 3AS0A 3V6ZA 2EVFA 1A4JA 3BP4A 3GYRA 1UYWH 3HNSL 2UZXB 4JKKA 1KWKA 4JFUA 1U3HA 3NZ8B 4H8HA 4HK0A 4TQEL 4NDMA 1AGEB 2M26A 4S0SD 2O6EA 4FFZL 4WFHD 4OAWB 1KN4L 4GRLC 4QT5A 5C7ZA 3P4NA 5E6IB 2K7PA 4U0RC 3N43B 5C71A 3QWOB 4PJ7B 5K9KA 4GQQA 1YYCA 4Q6IC 1OTSD 3L9BA 3VWJA 5GRJL 3IDJA 4F8NA 5F21B 2ADFH 4RAVA 4UQAA 1URIA 1HL4A 1XTMA 1IVTA 1HINL 1NEZG 2XIIA 5DEGB 1QPPA 2IXQB 2XFGB 1Z9MA 4OUUA 4WHTB 4D7PA 3UPRB 1RU9L 4MJIA 2EJ1A 4O5LH 3K81A 3QCVH 2JKSA 1ZPLA 3PF2A 2V7NB 3OKEA 5CEZE 4XPHL 2BP3A 2FR4A 3S5LA 2UY6B 1WHPA 3SHSA 3W39B 1MLCB 1U95A 4AQ1C 4AXWA 4NO3A 4FABL 4HFUH 1QEXA 2ZJSL 4E41E 1AP2B 4P57A 2IFGA 3GRBA 3SDXA 3ZTEA 2P8MA 5F3BA 3POCA 4XO8A 5IW6B 5A16A 3R4DA 2WO4A 1HCYA 2WQXA 3BSGA 5LDSA 5E9AA 1OLZA 4P2OC 1BJ8A 4JJHA 1M2VB 2IWEA 4Y4KB 5BMFH 4A7UA 4JKMA 4RAHA 1WITA 1XR9A 1S5IL 1VFMA 2FJFA 3AB0B 4LRIC 4UQ2A 3BWUC 4MDIB 1KB5B 2A9NH 3AREC 2ED6A 5J11C 4XAKE 4GW1B 3NIDB 4JFQB 4CGUB 2RAMA 1P7HL 3QDJB 4XRCA 3K1KC 1EUUA 1J8HD 4A2GA 1XH3A 4UQ3B 3D34A 2RTTA 1J0YA 4YDLC 1U92A 5TTRA 3RDTD 5DJXB 1DR9A 2IIJA 1AYRA 3B2UC 4KK5C 4RMTA 2DQ6A 4KPHL 1W9XA 3DIDA 1N0LB 1LEGA 4P2RD 4F92B 3VB8A 5KSBE 3NIGF 4HFWA 2FLMA 2WTPA 4NQSB 1BPVA 1VRSA 2Y6SC 3E3QC 3GSWA 3PWVB 5DQ9B 5F9WC 4ZMXA 3EOYG 4HJTA 4V1DD 4DKEL 4BGLA 1WIUA 1AY1H 2V7HB 3B8YA 2NW2A 2FJHA 3WBDA 1MZZA 5I8CB 1B0IA 2Z91B 1WO2A 3ATAA 1JCVA 4WEBL 4NM4H 4FG2A 4AC2A 1ANUA 5F0JB 1PSKL 2LTQC 5HYJE 1L4IA 4PLKC 1JNLH 3DO7A 2YC1A 5HJDA 3A67L 4GXUM 3C9NB 4YFDB 1JXFA 2ARJQ 2CRYA 2R23A 1FVEA 4UQCA 1BIIA 5KS9B 4JPKL 1QLRA 1DEEA 2CCLA 3HG0A 5IB3A 4B9KC 3KLAA 4W4OA 2FECI 2J1WA 4XN4A 3DSFL 3FQ4A 1NCBL 2DQEL 4FYSA 3LV3A 4WVRA 1BQKA 1BX2A 3HMXH 5DD3L 4AW7A 1A1MB 2Z64C 4WEBH 1AIFB 4H0LC 1I7RB 1WFUA 4MLSA 4YSPA 5ANMA 3WIHL 3ZTJG 3Q6FB 1ZLEA 1YJDH 2XHNA 3MO1B 1FWXA 2VLLA 4XBEL 4DKEH 4BH7B 1NDMB 3F04A 4YR6B 5J12B 1PG7L 2ERJC 4PRPB 3MUY1 4N6RB 3TZVC 5EZLB 1YHPA 3CLEL 1L7IH 1S7VA 5KTEH 2R1WB 2HA1A 3CN4A 5KVFE 5T3XE 4PRDB 4OFIA 1PAMA 2K6YA 4KPHH 1G7QB 3KLQA 3NVQA 4M4RA 5HDRA 1DCEA 1G1KA 2EINB 4ZMZA 4HIJA 2BC4B 1TYRA 4MASA 4AEHH 1GZQA 1U2HA 3ZTJH 2OMBA 3MJ6A 5F7EL 5FA3B 5JHMA 2FBRA 2ZONA 1OV8A 3HC4L 4M7LL 5CIPH 3CQQA 4LRNH 3NP3A 4JFFE 4ZUTB 3IN0A 3RIAK 4U1LA 2NY3B 5DMKA 3QCUL 1X3DA 2NXZD 5DT1L 3VGHA 5DO8A 1OQOA 4BA8A 1AR1D 1WIPA 5CLTA 2Q8BL 4QHUA 2H1XA 3D9AL 2YPLD 5DHEA 1MHPH 4HWBH 4LQFL 5C0IA 1VA9A 3I6KB 3V4VB 4AYFB 1LM8V 3HLAB 4E41A 3F12B 1W80A 2VITB 2WXRA 2UXTA 3RZCB 5T3ZE 5H8DA 5JHDD 4YZWA 2EE9A 4I0PC 1SFDA 5J1AA 1Q9LB 1L5GB 4ZTOL 1WLHA 3P54A 4Q0XL 1XMEB 4MJ6A 1J0KA 2X6CA 3BPCA 3OKKB 4JGNA 2I7OA 1J1OL 2VLKD 3QCVL 5T3ZL 2JCCB 5GRVK 1X7TA 3RDTC 3W9EA 4TS6A 4AYGA 4QKTA 1ZHBA 3L4YA 4GRMA 1NOAA 1V7ML 4M93C 3S36X 3QHTC 3TN0D 3V7MA 2NZ9C 2HFEB 3MRPA 5DEZA 2DH3A 3OXSA 1EHLH 2FD6H 3WIIH 4GAFB 1IC4L 2Z65C 3NA9L 4LBEB 2W92A 1TTCA 2MOVA 2IANE 4ZD3L 4ZG1A 5F1IA 1GJIA 2V2TB 4O2FA 1CVSC 1DO6A 3BLBA 1GRWA 4XZUB 2EUZA 1UASA 2NCMA 1H15B 3E6FA 4JHWH 3TV3L 3G04A 3BZFB 2VW6A 4OF7A 1HOCB 3TNMB 4H8WH 3QISA 3F8UB 5C92A 5I16B 1U6AL 1QQDA 2LLLA 4I88A 3GF8A 3C8KB 2J2ZA 3FT3A 5I66A 4GKZA 3SD2A 1MLBA 4NKOB 4NQEB 2F6AA 4N20A 4U2ZA 5KVGE 3RU8L 4PRAA 4FNLL 3EXJA 4JM0A 4OCXH 3VQMA 3QZWG 1A9BA 3MAWA 2OMZB 3BGFC 1OPGH 3LXUX 4JRLA 1BXUA 4FQ2H 5J13B 1VADA 1OM9A 1LQBC 3SPCA 4U1NA 2YD4A 5D7LA 4P2QB 1NJ9A 3VXRD 3RWCB 3WJMB 3JVGC 5IWLC 1ITBB 4A67A 3MNVA 1S46A 2ZF8A 2Z0UA 4KZEH 1G7HB 1XF5A 5J9PA 2GIMA 5CR1A 1K4DA 3NFNA 1A7OH 1U8QA 4L48A 5E24E 1A0QL 3NIFF 3UH8A 32C2A 3V9FA 1Z32X 4RIRB 2C3VB 2APTA 5C09B 1AIFA 3QCTL 3L16A 3GKZA 4DO6A 1L5GA 1Q9LA 2CM5A 3D4ZA 5C0CD 2MIZA 5AOIA 1RZKH 2VLRB 3DIFB 3DO3A 4P5KA 4BXSV 3PAUA 5EA0H 5EIVA 4AYFA 2D8KA 1QFWI 2HKFL 3SKJL 2AKRB 4G8GB 1HJBC 4WO4A 2VZTA 2EUWA 4B53A 4GG8B 2DN7A 5E7FA 3RNQA 5HHOA 3TJHC 5HHPA 3QO1A 4S0HA 4P5MB 4G1MA 5EA0L 5FA3A 3ES6B 3TZVD 3WGUB 1RZJC 5C97A 4PRIE 5DK0A 1BHGA 5HDBB 5D72H 3K71B 2AQ2A 2APVA 3QZMA 3GEWB 2XZQL 4PJEB 3B5TA 2AEQL 3SE8L 3FB7B 3MNWB 3WD5H 2DI7A 4FFVC 9PCYA 5I19L 5IREA 4XE0A 2WUCH 4HZAA 4DHLA 4OZIE 2WIIA 2CA3A 4LRIA 2W65B 5C6WH 1XF2A 1G7HA 1FNGB 4LVNB 4QEGA 3G5XA 4TQIA 1L9MA 3PNWA 5IGXH 3COOA 3PU7A 2X4QB 1JFQL 5D4HA 2DBLL 3PDGA 5EUKB 3S36H 1IFHH 5FUZH 4K7PY 3SGDI 5IEKB 2ZYRA 5T5NG 4LCIL 4Z7NF 3E8VA 5IHZA 2AJSL 2Y5TB 3BFWA 4Y5YA 4Z0BL 5DK0B 3TH3T 3ARBD 3QQXA 2X89A 3NJKA 1G6RL 3MLVL 4WI2A 4UM9A 2JKRM 3FN3A 4EZMA 3KD4A 3LNGA 3QA3A 4WO4B 1ZKAA 2ZWZA 3MV8B 4NPKA 1M42A 1NGPH 2H32A 4DOHB 3ESMA 3QJVB 4I0CC 2PO6A 3TA4D 1YC7A 2GC7C 1B0RA 5ES4B 5FYLH 4O02B 4R4ND 4OCRL 3NRFA 4XZUA 2VZSA 5CBEB 1ETJA 4Z3HA 5IHHA 1JD7A 4Z7AA 2EDEA 2D03H 1Q0YL 3MODH 4LLDB 1NGQH 4LL9A 2WAQA 5CKGA 2WBJD 1S9XB 1NCJA 1U8QB 1S3KH 4URKA 4GUPA 4HFWB 5FYJU 2E0PA 1S8DB 4P3CL 1JWMA 1UENA 2P5PA 3D2UA 4BRVA 3FFCB 5IROC 2VR6A 1R5WB 3EDEA 5I26A 2OI9C 1U3ZA 1XGUB 4MXVF 3LX9A 2BLFA 3V0VB 4JG0H 3ALWA 1L9OA 1TQCB 2Q7YA 4M7JL 3X3FH 4O02L 4PGZA 2DQFB 3C6EA 5CEZH 3ZBMA 2VR8A 3QIUA 5KBKA 4HF5H 1WS8A 2PYEE 5E0FA 1GL4B 4ZO9A 5E00B 1II4E 3SPIA 4WJ5A 1XR8A 4JNXA 4ERSH 3AACA 5TQ2H 5AAMC 1WF5A 5B3NA 2VMCA 2QELA 4EIGB 4TVPE 1YAIA 1TOXA 3S8GB 3IETA 1MHCA 2D9CA 2VXQL 1TIUA 5J3HD 3JWNG 1BREA 1HFUA 3K8MA 4ZPTB 3G5VA 5J13C 1NCGA 2XTJB 4JE0A 1NGYB 2F1BA 4NT6B 4UUJB 4HHAA 3FO9B 1MELA 4DZ8A 4JPWH 2VDNB 3O4LE 3ULUH 4WDIA 2ZICA 3MXWL 2IPUK 3WEXA 4AG4H 1AO7D 2CIIA 5HHNA 5IVZB 2YUXA 2Z1KA 4L4TB 5EU7C 2IWKA 1ZVHA 4ODUB 1QUPA 1YNKH 4LEOB 5AKTA 2HT2D 4DPCX 3DUSB 1NBVH 1QA9B 3KPSA 1W8EA 1WC7A 3OGCA 3GUTB 5JA8B 2X9YA 3AUVA 1A6AA 1FL6A 4GB9A 1KJ2L 4XHJD 1QRNA 3EXLA 5FOJA 4ONFH 4JG1L 1ECZA 1E5UI 2DZEA 3TJHD 1GS7A 4PJ5E 5TFSH 4BEIA 5C0BA 3SGKC 2IJ0C 4QHNA 4K7FB 2OZ4A 2EUVA 4FFYH 3MRRB 1DJZA 3RDJA 2EDDA 3L3GB 3OAZH 1MNUH 5CJQH 2D2OA 2MJWA 3SBPA 2I5YL 4FQCL 2NY1D 1FGVH 5ECJE 5DJDB 2WQ8A 1MDAA 2EZ0C 5EFIB 4DQAA 4YHIB 4ZODA 3T6ZA 3DOSB 4QTIH 1KNOA 4XBPB 3UPCA 1KGYE 1DLHB 2GHZA 25C8H 4JRYA 4X6CB 4H4NA 2KERA 3ARGB 1D7CA 4OKVB 4ES8A 3FT2B 2F61A 1FFNB 3NPSC 4L3EB 3ZVVA 1MRCH 4LSDA 4DEPC 1KTCA 3BJ91 1TNNA 1XGRB 3ZO9A 1H3VA 4L37A 5IF0A 5FYKD 1FYTE 3ZRSA 2AK4D 1E40A 2BP8A 3CQFA 4JEGB 3OR7A 3L7FB 4N9GB 2IQAB 5I71C 5DFTA 1A7OL 1TETL 3LPGA 4EIZC 2OKMA 2O6PA 4HJIA 1XF3A 4EI5A 2DLIA 3SQOL 3ZU8A 1FV1B 5CO1A 4EN3C 1MHHB 3NSXA 3QFJB 1MCQA 1AGDB 3R8BB 5TE4H 1FNEB 1QR4A 2O5XL 2ICEA 1OP4A 4DPBX 3VTTA 4OCXL 4BJLA 5L6YL 5LBSL 1C5DB 2CBQA 5E8NB 4GG6E 1GOFA 5A2BA 3WHXA 2AQTA 4P06A 2XG5A 3KPOB 1IARB 4X9BA 2X2UA 3SGEI 1IFRA 3FQWA 3LNIA 2H6OA 1W72H 3BAXA 1E4WH 2DWSA 4GXVL 2YC1B 3SQBB 5AENA 5IQOA 3ARGA 1RJLB 4N26A 5C2BH 3WJLC 1ESOA 1OANA 1JK9B 2F2HA 3RWJA 4DNLA 5IK3A 1GC1H 1ET5A 4LOUC 4MDJB 3ESUF 5SV3A 5DJYA 3D09A 3JV4B 4MMXA 1WT5C 2K4AA 1NMBL 3EYQD 3PQYD 2AFNA 1OD9A 1BAFL 2P5EE 5FO7B 5K33A 1MVFA 3L3GA 1SN0A 4O5LL 5AZ2H 2FGWH 4F58H 3HKZA 1ZLWH 4FJZA 3ZDZB 3EFOA 1HWGB 3GMNA 2BNQE 2OZNA 3NPZB 3Q5YA 4OSUL 4Q56A 1SBBA 2A4EA 4D9LH 2DMBA 1XEDA 2F9BT 4PUBL 2QGDA 1EHNA 2R0LL 2CR3A 5BPPA 1W6WA 3BYYA 4EZLA 5IJKC 2DMKA 1RURH 3NP4A 4FQPA 3WFCH 4UT9A 4WSJA 4HQQL 3WDJA 5KG9A 3SOBL 1CTNA 2IVFC 2YIHA 4L4JA 4ODUA 3MRBB 3GI9H 3DV4A 5IOPA 3ELQA 2ZWKA 4P4KB 5EIIG 2X70B 1KCSL 3VU2A 2DTMH 1QO3A 1JZ5A 2O6DA 3B56A 3CXDH 3CHPA 4OLWH 5KVGH 3EGSA 2BNQD 3LYRA 2BS9A 3WI9A 4RETB 3GJFH 4Z7VE 2HT2C 4LLQB 5ESQA 3IMRA 5LHDA 3GJEB 4PGEB 3FQ1A 4CRPA 1KTLA 3DMMA 3BEVA 3U4AA 5I2IA 3RURA 1RVFL 4GKLA 5EBWB 1A9EA 4Q97A 1SMDA 5ACLA 1TITA 2H3KA 2ZOLA 2F5AH 4PJAB 2JKLA 1TMQA 5IHUH 2GG1A 1HZHH 5AG8A 5BUPA 1QBML 4L0YA 2MNJB 1TZIB 2YXFA 3DBSA 3NCFB 5FHBL 5TDPA 3OHMB 4LMQI 1TNMA 3E9UA 5K9KB 2QSCH 2NY1C 2UZPA 4RFOL 3F58L 1F4WL 3UERA 2V17H 4KVCH 1P7BA 4UM9D 2H32H 2ITDA 1KJMB 4HS6B 5F1KC 3T4AC 4OM1L 1FDLL 4JY6A 3Q8CA 4JQVA 1HHKB 1GY1A 2AJ3B 1AH1A 2AEPL 1YNTB 3K7UA 4BELD 5BRPA 5KWYC 2CH8A 3EOTL 2OMTB 4JMNA 5DI8B 3H54A 1T89C 1U21A 2NCEA 2WBWB 2E6PA 4IKNA 1KV7A 4L29B 4Q8BA 2Q87A 4RGNC 3MCLH 1ID2A 5HJGA 4BINA 3FCSA 3GIZL 4G8FB 3FONB 2L0DA 2NTFB 5JPMA 1YMMD 4O02A 3V0IA 3BUQA 3U0PA 2PWEA 5D55A 1H3GA 4LLUB 3N41B 4LEEA 5FHAL 2VZUA 3TNNB 2RB8A 4JFXB 4GS7C 4M3HA 3WNLA 4MAYD 2CRIA 4ZSOA 1IGML 1JPTH 3FUMA 5GGSA 5B38B 4OGXH 2XG5B 3NN8A 4LOEA 4UZSA 1ZPUA 3HFFA 2OMUA 3HMWL 5DTFB 5MENB 2K9FB 3QDGB 1BZ9A 4LLYB 2ICWB 5C0EA 2CE6A 1PNCA 1H9VA 2Y7NA 2B14A 3V4UH 2UWEA 1DJSA 5KJ7E 5PAZA 2CKBA 3B1UA 4KRPB 2VRQA 1KIQA 1BCIA 1UURA 2FX8L 2ENJA 5HGBA 1SDDA 2H2SC 3EFDH 1AE6L 5DA4A 3JQOB 5F72S 1ND0A 1MHHA 2HAZA 4WK0B 1I3UA 3BQUD 4CKVX 3U7AA 4WI3A 3UZEC 5ESVB 2LV4A 3R18A 5FKPB 3WNIA 1DUZB 4L18A 3T0EC 5FF6A 1YEFH 1P5VA 1YJDC 5ITBH 4Y4KC 2ARWA 4FA8A 3FQNB 2XJLA 2F7QA 4F9LC 4LPUA 2JJSC 1HSAB 2KH2B 3WMQA 3QDMB 4PY8I 3CSGA 4NENA 2DQUL 2Z8SA 2XETA 5DMIL 4A7GA 2VKXA 3HOGA 3FT2A 4J3BA 5HYSB 4K07A 3FOMA 1TVHB 2H45A 3JUYA 1CICA 1RSFA 1DL7H 1P7KA 3O0LA 3IMTA 4I87A 5DRNB 4B9JA 3UTTD 2LW3A 5AVUB 3TEXA 3L1EA 3AQYA 4NZ8A 3O3BA 2X0WA 1GYCA 3FC8A 4HJ0D 2GSIA 4CL7A 1F58H 1TEFA 2OSXA 4FS0A 1HINH 4KK6D 4Q9QL 4CSZA 2FECL 1U30A 4EZJA 2VT0A 2ADFL 3VQLA 4M6OH 2XWTB 3LSOB 3SEPA 3T65A 5D1XD 5CSBA 3NIGB 5BV7L 2KS0A 1WCBA 1G7MB 1ZLDA 1L3WA 3GTNA 3O3EA 4YX2L 3R7RA 1BZOA 1HCVA 1SXNA 2XQBL 5E1QA 1O7VA 3QR2A 1LO3H 3FPYA 1J88A 1VFUA 1WFMA 4JM2A 5HYIA 3SY0B 5HGAB 4GKSA 3WNPA 1OEZW 2GAZA 4L1LA 4PTUB 1IEAB 1SEQH 2QVIA 3UYRH 2I7SA 3GMLA 3KPLB 1OTUD 4M5TA 4K3JH 1NBQA 4E9WA 5EC1B 4O2EA 5CGYC 3U4BH 3GXDA 5ICZB 4G70B 3NJJA 3REWA 1JV5B 5AVZB 1NCWH 3IJEA 1MI5B 1SF5A 3ULUC 3KLDA 3QQ9C 4OLVL 1QP1A 4W6WB 4N0UB 1CYGA 1NAML 3PCYA 3JV0A 3PWLB 3NK4A 3WYRA 2HWZL 1V54B 2IDQA 2NNAA 3BGMA 1QG3A 3K6OA 4Y2DA 4YO0B 3D0AA 4U1JB 2TRYA 4DW2L 1RSYA 2CPUA 2J5LC 3X1GA 3LQAL 1S6NA 3QBTB 1L6XA 3Q8FA 5HVHC 1MAML 4M03A 5E4OA 2IOOA 5K1VA 2GVYA 1OPOA 3K72B 4WNJA 4HAKA 1IGYA 5D5ME 1R5VB 3A4AA 1N5YL 5J6GA 1NM4A 1OW0A 2OTWA 2AJYL 2WD0A 3HLKA 4GSDH 1OGTA 4O2EB 3GMOB 2HN7A 3C60D 5D1ZB 3U7YL 5FYKL 4XMWA 3Q9QA 1E4XH 1JRHI 3FCUB 3EOTH 2YPLE 4Y1AB 5LCVA 2HLFD 5I1GH 2JK5A 5FUOH 5HYSG 3PWPB 1GZHA 1N0XL 2V4LA 3KHOA 4AENB 3AJ7A 1O9VA 3W9DB 2Q6WA 1C7SA 2F8XC 1XVSA 2BVPA 2DWDA 1KJ2H 2MTPA 4FP8L 3ULVC 1BG9A 1EDQA 3KS0H 2PCPB 1WUNT 1E27A 1NBVL 3NESA 1GGBH 2CRZA 3FU8A 1HSBB 2YS4A 2J12B 2Y1VA 1T66C 5MEPB 1UCBL 1B0RB 3HS0A 3V8CA 4JFEE 4KQ3L 3V4VA 2EE6A 3ULVF 1EJ6A 2JJVA 3EJRA 3CMOL 5BVJA 5DJZB 5KSUA 3TU6A 4MA1B 1ADQA 4PJEE 2IMMA 2G60L 4X7DC 2A38A 3MZTA 4XN8A 3V0HA 4P9HH 5JNYB 3OVUB 2FEEI 1CXHA 4KC3B 2V2WA 3D52A 4LEBA 4TUKH 4Z78A 5JDJA 5AOZA 4FFTA 3AC0A 4F7MB 3ZE2B 4KQ4L 1FYTA 4J39A 1BZEA 2CD0A 2IGFH 2EYRB 3HRZC 5D5MA 3PAZA 4KV5F 4WGKA 5L4MA 5MEQA 2DICA 5JW4Q 3UG3A 5E2TH 3STBA 4BSJA 4ERSL 2F58H 1OSZA 2OYPA 3N6YA 3DX7B 5FUCC 2W94A 5D7HA 4U3HA 3IJHA 5D7JD 7TAAA 3PHOA 1LQSR 3OJ2C 3RVWD 4RSYA 1FO0B 1WBXB 2W8CA 4NO5B 4YDZA 5ESVA 2EDRA 4D9LL 1QOKA 5E4AA 3EYVB 4Q2ZA 5DC4B 5I15L 4M6NL 1CLOH 4V1DE 2KZWA 1HKLH 1YQVL 3NJFA 5KYXB 5IB3B 4JFFD 1IV8A 1XGYL 3OKNB 2ARJB 4PG9B 4XP6L 5JYMA 1G9EA 3LKSB 4MD5A 4PRBA 2YFNA 2NY5C 2OULB 5SWSB 3VD1A 2ERJB 1SY6L 2VAJA 4OI7A 3IRPX 1ZA6B 4DCQA 3UCQA 1DL7L 4PJIA 2ZKXA 3PIQB 3QRGH 4H26B 5I6XB 4TVSa 1E4JA 1BQUA 5IVNA 3EUUA 1A8JH 3MJ9L 2C8NA 5H94A 4KK8D 3OF6A 5FLVA 1R75A 3CH1B 2EDYA 1BEYH 4WHYH 2BH0A 1JK8A 3OLIA 2V7HA 1JHKH 3S3BB 2MCPL 2IBGA 2JKXA 1JYWA 4KKBD 3HS0B 4J27A 4OQTA 1OB1B 3C60C 4EZKA 2NTFA 5JPMB 4FQQB 4A63A 1FBIH 3QXAA 5EC2A 4E9QA 4EOWL 4RIRA 2J57A 4Z0BH 3WLWC 4GAAA 4OLXH 3GSWB 4RGNE 2PCPA 3CZEA 5I28A 4BFNA 1QFWM 3OR6B 4JUTA 1DVUA 5FUZL 3WJLA 2HT4D 4S1QH 1GGCL 2YKLL 4TLSA 3RHWK 4PP1C 1I31A 1G6RA 4HLZG 3RPKA 1RZFH 2JNZA 3N85H 4XMLH 3C6SB 3KPQB 3OKOB 1FC1A 5HGDB 3BAIA 2EDWA 4LNVA 3TJEH 1L0XA 1GCYA 3A4DA 4ZX5A 5AAPA 1EHAA 4N0YL 2G60H 5F7DB 3P4OA 2DDQH 4P46C 5IOKA 1UM4H 4ZFZA 5JNYA 4IIQC 5DD6B 3T3MF 5E2UH 4TM9A 5E51A 1AI1L 1U8HA 5KANG 2JI1A 2ZUVA 4HKXB 1MRCL 3FTXA 1IC1A 2VH5L 5D1QE 4MNGB 1CF8L 1L7TH 1MCWM 5HVFB 4FQ1H 1XGQA 3EYFB 3UJJH 3S48A 5KVEL 3FOLB 3NA4A 5KYWA 4NUQA 3P2BA 1CD0A 3VMNA 5JHDE 4DGUA 3DHMA 4NBYB 1SM3H 3VXUD 2EILB 2IXQA 4RFNC 3ULUD 1Y6NR 1K5WA 4HOXA 4Y4FC 2EYSB 1I9JL 3LEYH 3PGCA 4YDKL 4A7VA 5AB0A 3CPLB 4ADIA 2AITA 2K3TA 5IMOA 2F54E 1IB5A 2PW2A 4U4BA 1NIDA 2BRRH 3KEDA 3VUAA 2DQMA 5FO2A 2DTSA 5HHMB 4J3VA 4TRPL 5ECGA 1RMFL 3HN8A 1FH2A 4NUJB 4LT7A 5A2AA 2VTFA 1B2YA 1I1FB 2WLLB 2LFEA 1IJNA 3HAEB 1CYWA 4MQXD 2FQEA 2VDOH 4E41D 4ABUA 4JGMA 2E59A 3NZSA 4HK0B 1FG2B 3O3AA 5DXWA 5T3XD 3VYNA 4Y16C 3KLSA 3K4ZA 2YSTA 2EXTA 3HC3L 1LEKB 3D1MC 3CFBA 1K8IA 2BNUB 2Q1EA 3HVNA 3ZMRA 4A2FA 1LE9B 1XD0A 4U1JA 1B3IA 3GJEA 3RTLA 1C5BH 4MJID 4HUVA 4B9CA 3O2WL 2AXFA 3CU7A 2YMOA 4TQPA 5EEYA 4LCUA 1BQHB 3L9YA 4Y4HA 3N43F 3QWNA 1KYDA 1I1AC 4OJAA 4F1ZA 2J6WA 2GIXA 1MCRA 3QPQD 1EFXD 5GJSH 5L88H 3RY6A 1KZYA 5D70L 3NCWA 3UAEA 2EDHA 3DI2B 1NCNA 5AB1A 4DKDC 3SOBH 5CGBA 2C7UA 4JFDD 4BZ1L 1C5DA 1ZVSA 1KJ3L 2GAZB 3GKWL 4YDLB 1XHHA 5HGAA 2ZOKA 1DQVA 3SZ6A 2WXMA 3F64A 1SNRA 3O6LH 1OCRB 2F54A 3FU6A 4JQIH 4N0CC 2WWOA 1CQKA 3WOVA 2VZVA 4YIQB 5LCVH 1A7QL 4LVHB 2Y1YA 2H0FA 5CR8A 5IMKA 4J5VA 5D7KE 4FYQA 3TA3D 2DIAA 4P3CH 5FB8A 3ZKXB 1RD6A 1V7MH 3AG4B 5C0AD 5I0WA 4NYLA 4O4YH 4YAQA 4LLMB 4F15C 3U6RA 3GZKA 2CO6B 1O7DC 4Y9BA 1BA9A 2JQZA 4XOBA 4DFIA 1T7XA 3ILPA 4FNTA 1ZS8B 2X7LA 1ZRUA 1HWWA 2UXFA 4D8PB 2NX5E 4IYKA 1JTOA 4Y5VC 1F4YL 5GZNA 1R3LB 2HUHA 5CU5A 2XIBA 3PJLA 5G4OA 3RWEB 1UD5A 2BSCA 3ARWA 4UDUB 2IG2H 4NHCL 1CXFA 3MMEA 3B7YA 5GJSL 1K8DA 1UVQB 2AERT 3VVWA 2VGLM 4Z7WF 4LLUA 4PV9B 3VFTB 1AOZA 1H8NA 3VRJA 2XZAL 3D5OF 3US0A 2B1AL 1FPTH 1S7QA 1DVFD 3BC9A 1HX0A 2R27A 4NO0D 5E08H 3DX8A 2W9LA 3H7LA 5HHOE 5EDSA 5C0BB 4XXWC 5J56B 2YAFA 4OKDA 3EADA 1JV2A 4ONHB 1PX4A 2LT9A 1NDGA 2ENYA 2YZ8A 4S2SB 4WTZG 1A6AB 1FL6B 1KIRA 1T2JA 5JOPD 3OGCB 4Y88A 3GUTA 3AFLA 3HG1D 1SEBA 3BZEB 3ESOA 3QI9D 1JCKA 3H7BB 3LKQA 2RCSH 4OUOA 4AVJA 4UILH 2C34A 2FL5A 2W60A 3CHQA 4X5RA 1E4KA 4M7ZC 1RIHL 4IRSD 3QUML 1OCWL 5K1JA 2R39A 1K85A 1NAMB 4NNYB 2HVJB 3HR5A 4ZSOB 2UYLA 3IFPB 5DD3H 2IQ9H 5GGSB 4JFZL 1IIKA 3QUXB 2F1AA 1T1YB 3D3VB 5KJRH 4OCNC 3D30A 3FRPB 3TP4A 3SJVB 4O51B 1IBDA 4U1GC 3TTSA 3V5DA 4AEEA 4EXPX 1MREL 3ZHKA 2P42B 2VR3A 2N0KA 4K3EL 5LAXB 3EF4A 4ELKA 1HEZB 1LTXA 1MWAA 2Z9TA 3B9AA 5JO5B 1LDPL 2VM3A 4BM7A 3BYTA 4PJFA 2MH4A 4LGPB 4XXWA 4O9HH 3TBVB 4WHTA 5JW3H 2OMTA 3UPRA 4NM4L 2WWMC 3PUUA 4U0QB 3OJVC 3RGVB 43CAA 2HRPL 2JE8A 4ZO6A 5J0BA 3FO1A 4PJAF 1A6TB 4HCGA 4UILL 4F20A 3EJJX 3L13A 3VXQA 2Q2EB 2YMXH 4TTDD 3SBWC 2VDRL 4Z7VA 5CCKL 5J8OA 3RZCC 3UFIA 2HYMA 4CADA 3NGBC 3OG4B 2FIKB 1M71B 3GMNB 4NIKB 3SDDB 1INDL 4N90D 1AKJD 2XN9E 4KDVA 4GPVA 4R5VA 5T1LB 3KW8A 2HCZX 1G1CA 3UDWC 4ESKA 5BRZB 4GEIA 4ANWA 5B3SB 1AANA 5GXBB 1KTDB 2IAMD 4OLUL 4HEMA 1YEGL 2VCOA 1X9QA 3O11B 4NQDE 5C6TH 4JHAL 3WSQL 4PV9A 4NZFA 1DANU 3CZGA 1FHGA 4CC0A 1JK8B 1ZANH 2IGLA 3RKDD 5FCUL 2AK1L 4H5SA 1S7WB 5FX3A 5LG1A 1EXGA 3QUZB 5D9SA 1MH5B 4XB7A 4AQEB 4ZI8A 3D2UD 1JZ2A 4ADGA 4H88L 4PW9A 1BFOA 2QGCA 5AW4B 3UROR 4IMLA 4ISVA 1P4BH 1ZS2A 2JB6B 2R59A 4HQQH 3UAFA 4JM2F 3H1ZA 4G8IB 1JERA 1QBAA 2G0KA 3MLZH 4WI6A 2P46B 5C08E 4XPHH 4E42A 1JXGA 5EV7A 1XB8A 4FZ8L 3SYQA 4BUQA 3QUYD 5EUOE 1RU9H 2I25N 5EG6C 4LPCA 5DCCA 3ULSA 3VFMA 1E0OB 1MW0A 2ZXQA 1BFVH 1T0NB 1ZLVH 4H40A 3U79A 4KKAD 1RCYA 1EERB 1S9VB 5T3ZH 3QB7C 4EDXA 1MCDA 3DYMA 4LSTH 4K73A 5EU6E 7CGTA 3QORC 5IY5B 2QKIC 2YXMA 1I1YB 3ZR6A 5D7SH 4DEWA 3G6JE 3O8XC 4HCRH 1SYSA 4ZTPL 1CDJA 2XU9A 3N40P 5E2TL 3BUYB 4HIPA 3BP6A 1E42A 3AS1A 4NAQA 3VFVA 3CZNA 3BN3B 3HI1A 5AB2A 4DAGH 2DJ4A 4TSCL 1TTBA 1DVXA 2X4SB 3T8XA 3RVVC 3MV7E 1YEEL 1MHPL 1DDHA 3GHEL 4EVNA 1MRDL 2W80C 2GITB 4WW1B 2W5PA 5I74C 2OSWA 3ZSTA 5C0CA 1XT5A 5ISZA 3ZSSA 3W38A 4MQ7A 5AW9B 2JKNA 2R8SL 4JO4H 4XMPL 4JRYB 3KPOA 4NN7B 5I76A 3VDAA 2UX6A 1A6VH 4HD5A 5FYJD 2W9DH 4I0PA 1A6WL 3ATDA 4M02A 3SB3A 1YEKH 2FH8A 5BS0D 3N1GC 4Y5YB 1JZ8A 1UA6L 2GJZA 2IH8A 4QRFA 3VWKD 4QF1B 4BH8B 1OO2A 3MLUL 5C08A 3CVHL 4H0GA 3BP7A 3HAEA 3CFQA 3NSDA 4L1DA 4QHNB 3V0EA 4PV8B 1RUKH 4B9GA 5CINL 4C8XA 2G75B 1VENA 2XJKA 2NXYD 1XF3B 1R6VA 4IRZH 4PB0L 2Q76A 2X44D 5CMAA 2K7QA 5FOBB 4MMYA 2DM7A 4ODBD 5AWNH 3P30L 4KVNL 2BNRA 2P5WD 1K4CB 1S7RB 2JJTA 1HH9A 5JW3L 4JL2A 3OZLA 2ATPA 5K9OB 1BD2D 4ETYA 5DZVA 4C58B 1MFDL 1ZT7A 2YK1L 4TNFA 1XIWD 2ZSWB 3G6JA 5F7KC 5JIMA 4MWFA 2IO5A 2VUOA 2RD0A 3MRQA 5ESAB 2FTAA 4BK8A 2XG4A 3UIZA 1DLHA 1RFDH 4N0FB 2DQGH 3FO9A 5EEZA 5HGGS 5I5IA 4W6XB 3DHUA 3L3KB 4ZFOA 3CFKB 3I6GB 3DMMC 3SE6A 4M43H 1LO0H 3A3YB 2E9IA 5E6IC 2KDYA 1AI1H 3AAZB 2P49B 3PL6C 4XNXL 4F93B 1U91B 4W9ZA 3KYAA 4Z7VF 2A77H 1OM3H 5AWNL 4WWOA 2MQ3A 3T8VA 2RCSL 2IDCA 1BMZA 1QR1A 3T4AA 1P6AB 1RLWA 3WFZA 5HI4D 1A4BA 2BHFA 5ALCH 3FO2A 3S5LG 4B0MB 2BCMA 4P48A 1FAIL 3TWCH 1IEAA 3WMPA 1TT6A 2B1HH 5JZ7C 2KI6A 1NEZB 3FFCA 1JF1A 3UAJC 4FAAB 2HN7B 2JELL 1UA6H 2BSSA 3IMWA 4FOMA 5D1ZA 3AXIA 3BHBA 4TLTA 2Y6SD 3NPSB 4DKFH 3SGDH 1CGSH 2JK5B 3CZLA 3QORD 4MJ6B 4QNPE 1D5ZB 3X12A 1FA4A 1HT6A 2XNAA 4GJTB 1FPTL 3QT2A 1RZ8B 3GSRB 1VJSA 1KYAA 1IO4C 4HWEL 1MN4A 3BPCB 2CHXA 1BM3H 1ET8A 2A74B 3OKKA 4MJHA 4L8SA 2X1QA 1LWHA 4HJ1A 3X3GH 3DC0A 3KXFE 4PRPE 4Q9QH 1TZGH 1WICA 3EYFA 4L0PB 2PWDA 12E8L 3CFKA 3RIAF 5C0RL 4ZMNA 3IETB 4YBLC 2I26N 3ZKMD 4AM0Q 4TV3A 3R06B 2Z7UA 4CUCA 1NLBH 4W68A 3IMSA 4Q9CA 1AGCA 2QLVB 4S1RH 2B77A 3ALXA 1INEL 2DB8A 5DMIH 5JOEA 3QC6X 2WWNA 1UEYA 3LRKA 2JXMA 8FABB 1O5DT 3EBGA 2OJEA 3L4ZA 5EC1A 2WXKA 2ZX8A 5I1JL 2H7WA 3QDHA 4KTDH 1EAOA 4ZUSB 3WLBB 4FJ6A 2JH2A 3PWNB 1G7QA 4JM2B 4XCFL 4HMEA 2WPGA 5EBLA 4KJPD 4OV6F 4MXVE 1LVEA 3K46A 2ALAA 3MA9H 3KPSD 1H5BC 2UVFA 1D7FA 4N2AA 4N87A 1BX2B 1M1XB 1YVLA 2QR0A 3VSTA 1I7RA 1ZLVK 3BQVA 3QO1B 1ZTXL 1CDBA 4OI8A 3ZTCC 3APCA 4DEUA 4GQPH 2R0ZL 3DOHA 3G3LA 1S9WB 3LDBC 1EAPB 2NY4D 2GITA 2NY6C 3BP5B 4FQLH 4IGBB 1KG0B 4F7PB 5CJ8A 3M46A 2VZOA 1F5WA 3KJ4B 4W9LC 1DBJL 1DQDH 3MYJB 3PG2A 2KHAA 3K6IA 3LZOA 4AX3A 3UX9B 1N67A 1CL7I 4RRPA 1G6VK 4YDIL 2WGXA 1NLDL 3QJFA 4B7IA 3B2VL 4MLIA 5DQ9A 1EGJA 1H3PH 4IIZA 1KEGL 4Z76A 4L29A 2HP4A 3CAFA 3QJXA 3L7EA 1YEIL 4MXQD 5C07E 3SKNB 5FYJE 5TF1L 2Q6WB 1U8MA 5I1EL 3NCYP 3W9DA 4K15A 3C5ZA 3ULUE 1ND0B 3P02A 3RWCA 3WJMA 3MNWA 3PP3H 4YXLH 5SWQB 4OLYL 2PPFA 5JMRA 5KW9L 4X99B 2R69L 4FMKA 4LLWB 2ADGB 2XKSA 3S34L 1UXWA 3DPBA 2WOBA 3V9EA 4MNGE 4AIEA 2NNRA 1B9KA 1ZGLM 4NC0B 3ABLB 5JOFB 4LESA 4EN3D 3LMJH 4KROD 4BWTA 1IUZA 1OB0A 4NUGH 1KPVB 2A4ZA 1N70A 1KZQA 3DIFA 3QULB 3EH2A 2Y7QB 4DK3A 3JTBA 3DK0A 1JPSL 1E9PA 5JTWA 3II1A 1GKEA 1UQSB 1YEHH 5F3HA 4DP6X 4E5XG 4G6FD 3D07A 4L8SB 1DFXA 1W72A 3L2NA 4ZUUB 5HDLA 5T1DH 3RUGA 3SODB 5F89A 4KI1A 1BSIA 1H0DB 2WOYA 2HFGH 4HIHA 4LLVB 4Z3FA 3HUJF 2DQHL 3MRPB 4PJ9B 5DK3A 1TCRB 1HILB 3KEHA 5H37G 1QRKA 1AQHA 1S9KC 3GSQB 4XCYA 4NFDA 5GGVH 4AVIA 1QFWL 1FZJB 2AJUH 2ZCKL 1YNTA 4KO9A 2DLFH 4YSRA 4AYBA 2Q10A 3ZLQC 3NJIA 5JIDA 1U3HD 3NUKA 1OPGL 5E6ZA 1A47A 1X5GA 3L5XL 3CVHA 1JGDA 1KFAL 4F7CA 5ISZE 3EJTA 4IEFA 4LKXA 1CDHA 3DRTB 3KVPA 3EFOB 4WI0A 4XXCC 5J6GB 4IW4C 1MJ7L 2YEVB 1A22B 5B8CA 3HZ3A 2C4FT 4HEME 1M2VA 1MY5A 5AW2B 1NPJA 4CU6A 1YYMH 2K1MA 1M3IA 2J88L 2AJVH 5IMLA 3IBEA 5F1SA 2VSKB 4LDOB 1HAWA 3OB0H 2ZD0A 3S4SG 4FG6C 4Z23A 2VB5A 4Y4FB 5CFHA 5IB5A 4R2GB 2VJ8A 1PZ3A 1E5CA 2P9RA 4KJYB 3VA2C 2MCG1 2BNQA 5E2WL 3ZDXB 3RFZA 5K9OA 2GABA 2HVBA 2NYKA 5FC9A 2EIBA 1N3NB 5LXGH 4JM4H 2EH8H 2ZXWB 3D85D 3SY0A 1N5AA 4G9FD 4P0DA 3RB5A 2DWEB 5I15H 1CS6A 5IQMA 4X7TA 3Q2CA 2R2HB 2ZZUT 3SCMB 4CDGC 1SMOA 2EC8A 3LKRA 4P2CG 3TBYA 3VI3E 1BG1A 2E75C 1HKFA 3GLDA 5T1KB 1UUNA 5DVLA 4NKMA 3KJ6H 4J7RA 5IB2A 3EJCA 3WE1A 4K9EL 4KKLD 1GS8A 3WN5A 2RA1A 2DQJL 3BN9D 4LLYA 3OJMB 5TPWL 2Q8AL 2IQAA 4UTAH 1IJ9A 3ZRCC 4L37B 1FNFA 5IF0B 3W37A 4WWID 4F2MB 3DJTA 3QORB 4J8QA 4AJ0A 5INDA 1LE5B 5E2VH 1DFBL 1MCOH 4OCYL 5KSAD 1D6VL 4PJDB 5EOCH 2NY7H 4HKBA 2B5IC 3NSCA 3FUHA 5CJXA 1UT2A 4N8CH 5BS0A 1W2KT 5EFIA 4F7TA 4YQXH 3Q43A 3VRIA 3NJNA 3U1SH 2E9JA 1LP9A 3JTSA 3PAYA 5F1OB 2VL4A 5IBTL 3GBML 1YMHB 1KULA 3QQDB 2CO3A 1S9VA 3A6CH 2C3WA 1KB5H 4R7LA 4MRBA 4U1IB 4YAQB 1RHHA 4HUXA 3VI3A 5HGBB 3KLHD 3IN2A 3NCEB 4YHKH 4HXAH 4FQJH 2ICWA 4OD1L 4EI6A 2QDVA 3MV7D 3VFMB 4R4FH 2V3EA 3MRDB 5FYJL 4N9GA 4MCNA 3WTUA 1YEDA 4J8RA 3VQ1C 3CJJA 3KBFA 2BNRE 4L9LC 4GQZA 4GT0A 3GHPA 4M3KB 2R0KL 3OKMB 3U1SL 4CC1A 4BYHA 3T0AA 4YK4B 5DGRA 1N5AB 2DQTH 3Q1EA 3AXHA 4IMLB 3SD5A 1BYNA 4Y7OC 2LE9A 1BBDH 3H3PL 3RWIA 3L3OC 3H9YA 4JRXB 4JDEA 4UNVA 1BQHA 1JGIA 4Y4HB 1I9IH 3QEUA 1HEHC 2AXFB 2PNDA 3K6NA 2IEPA 3G5ZB 4NO3B 4WTZA 4EKJA 1OOAA 4JUSA 1KGCE 2PETA 4KY2A 3ARFD 4N0YH 3CXHK 3QGVA 3G9AB 2ZX6A 1I53A 4XBPA 1HHGB 3I9GL 4A2MA 1C12B 5EO1A 3VFWA 4MVBC 1F00I 4PCYA 3HCVB 1KXTA 4X4YA 4CVXB 2MRYA 4AL8L 2ICES 3II3A 3DURA 3GNMH 3LB6C 4X42A 5JPNA 3WU1A 3NEXA 3O3DA 3RGVC 1SJHB 5DK2A 3HJ0A 3VG9B 3WTWA 3RBSA 1UOKA 1T1ZA 2ZT9C 4OAWA 3CSFA 2Y0SA 3N44B 4Y16A 4JVPA 4HKZB 2OA9A 5DJ2A 1A4CA 3OF6D 3EHBB 4KKLC 2H6UA 3BH8B 4YXKL 2P26A 1Y6MR 3DXAD 3GXPA 3UJIL 1XH2A 2B59A 2EH8L 3KVQA 1ZT1B 3CLFL 4XPGH 4HZLA 5C3TA 3OWRA 4KUZH 4AI7A 3MJ9H 1QZ1A 2X6UA 2MCMA 4D9QE 3DO4A 4PRNA 4M7ZB 4POZC 2XN9D 3E7JA 3B6SB 5CZXC 2DV6A 3G6DL 4NQXA 1FFQA 5FV2A 1OTUC 3DV4B 5IIEA 3MRBA 2K45A 1VGKA 4RESB 4ZDHA 12E8H 5C0RH 2VO5A 3QDJE 4XMKH 1PZBA 5D1QC 4OZGE 4I2XB 2CA4A 3VI3F 5IOPB 1WS7A 4ABQA 4P3DA 1DBMH 5F93C 3MLSH 1KPUA 1QYGH 3NCJL 3QIUB 4NN5C 4X8CA 4BUGA 3QUYB 2WXJA 3O6FB 3ASOB 4NAMA 4NI3A 3D50A 2D9QB 4A38A 4OT1L 1I3RB 2VDLB 4XP9H 2Y23A 3DETD 4XO9A 2F58L 3T2QA 1CK0L 1IFHL 1FZOA 2X6BA 1NCDL 2K9UA 1G6RB 4B5ZA 4GUPB 4NS0A 2OSLA 3DX6A 3MPCA 4OD2B 2Y22A 1OGAB 2B1HL 5KSAC 4NSKA 4D0CB 4GW5A 3V4UL 2E9WA 3LDBB 1UXSA 1D2OA 1Q4NX 3IDNA 5ALCL 1KXTB 1RERA 5F97E 4X4YB 4JFPB 4ZNEE 5L4FA 4XNBA 3TM6A 2H2PD 1DN0A 3UC0L 1AS8A 5T33H 2KYIA 1IGJA 3WD5L 2R56H 1XGRA 5AW7B 1BYOA 1LWJA 2OQJA 3BZ5A 3NK3A 5C8JB 4N2IA 4XX1G 4W4OC 4B9FA 1LO0L 3J27A 1MCKA 4ODHL 2ZIDA 4H20H 1IGCL 2CMRL 3HG1E 3ARFC 35C8H 1UXLA 3L8QA 3ULVD 1DJWA 2WAHA 3OHXC 5F96H 1J9CT 3TT3L 2VDKL 2CQVA 3C2AH 3PABA 1R3LA 3CN1A 3OX8B 3AT9A 3RWFA 3WJJA 5FO8B 4PWGA 1LEIA 1LK3L 5B1JC 1WFIA 5HHOD 5IBLC 4HLZH 2ARJA 3TZVA 4R4FL 5FYJH 1U8PA 3H6JA 4U7MA 3VH8G 2DQIH 4FQJL 4OD1H 4LPXA 1SUHA 4WFED 3U2IA 4YN3A 4ZX4A 2X3AA 4MJIE 4F33B 3X2QB 3DJ9A 1PZDA 3MRIA 4ZS7H 2ZG2A 4KVCL 5TF1H 3U7YH 4J3OH 5IV2B 2I85A 2IC2A 4HPOL 2WLHA 4PY7A 3KPNA 4JZJB 4X80L 5GRWA 1Y7VA 1P4IH 2ZKYA 4WIQA 2E7BA 3HNTL 4JAMB 3UO8B 2VDQH 4Y19B 4JR9H 3B2VH 3KWTA 3R0NA 4RX4D 4PJEA 3HS9A 3IGLA 1BBJB 2X2IA 1NL0L 4MAUH 4OB5H 1BVLA 4JFDA 4XVTL 3BDYL 5ALBL 2NY7L 3WTSA 1CBVL 4ZZKA 2A9AA 1T1XB 4HUUB 3U1QA 5AUMB 1CTOA 1EEZA 3WO4C 5C0AE 1UACH 4P9HC 1EXUB 4PJDA 4HUVB 4Z7QE 1S3RA 2FHBA 2F54D 2H6PB 1QSEE 2BSRB 3MR9A 4L8DA 3RBGA 5IROA 4FXLA 4YHIA 3U9WA 3KPPB 4MA7H 5I1DA 5JQ6H 1J05B 3CNKA 1X7SA 2F15A 1JVKA 5B8CB 5LKNA 4TSCH 4K3JL 2F1EA 3VXNB 3VFPA 4RVBA 3TBSA 2EXWD 3LXCA 1H8OA 4X4ME 4KDTC 4LSUL 2IBZX 2VL5B 2DQFA 4LSPH 2KZKA 2XA8H 2V2TA 3LEVH 5GZND 3MGOA 3C2SA 4N25A 3VM5A 1LK2A 1J1XH 1OAQH 4MNQD 1W0WA 2PCFB 4X8GA 1N6QH 4HULB 2I9LB 4RWHA 4R96A 3X1FA 2GKIA 2GTWB 1PZ5B 5SX4I 4XMKL 1ED3A 1ZK9A 5F7MC 3MDJA 1NUDA 4P2OA 4PJIE 5DUMH 1H5BA 3LD8B 5KYUA 2H2PC 3AG1B 4IRJC 2XN2A 4NC1C 1KBBA 4UT6L 1BPLB 4J23A 4ZX6A 4JFED 2Z31D 4NKOA 3GZQA 3Q8EA 4NO0A 3VFOB 1DCLA 1GAFL 3KDMB 1UB6A 3IJ8A 4ZAKD 5IQLA 4ABVA 1MHCB 1IM3D 3TIDB 1M56B 2Z34A 5B4MC 5EIIA 3NACL 4UTBH 5FWQA 2X4UB 3CXHJ 4PJ8C 4PP1D 5K9QG 5I1IL 1P5UA 3B43A 2J2ZB 3FT3B 4IRJB 3BW9B 3LKNB 3WKML 4LQFH 1NGPL 4JREC 4D0BA 4PWJA 1XGPA 1KPVA 4JLRA 5D2NC 2CGRL 2FQDA 1IRAY 1OAZH 2EDTA 3QUZC 4A04A 1GGTA 3CV5A 4Q6IA 2GB2A 4EUPB 5E6UB 3CDFA 2XICA 4I1PA 1A7NH 4RGOH 4PJFE 5E8DL 1S7RA 1DQML 4Z8FH 4LSQH 3OXSB 2Q86B 2ZCLH 3N2JA 1LMKA 2GTZB 5CMAB 4QY8A 4XP4L 3SO5A 3WXWH 5ELIA 1VB9A 4QYOB 5KYNA 4DZBB 1BOYA 4MZRA 3UACA 4A6YL 2IV9A 3JUZA 2HFGL 4PQXA 1PDKB 2B15A 2CJSA 1D5IH 4M7LT 1IT9L 1RP8A 3TBSB 3MC0A 1RK1A 4WK4B 5ADOL 3PS6A 4U6HB 3V0WH 5EULV 3VXSD 3VD7A 1SHSA 5I1DB 1RJYB 4X0NA 4P8QA 3MTXA 1FLTX 4PJGB 4PU2A 1U8JB 2WO2B 5B1JA 3Q2VA 4QHKJ 1CBJA 2PXYD 3FF7A 4ZFOB 1E28B 5DVPA 4LIQE 3QC5X 4UYQA 3V4VL 1MAKA 1I8LC 4W6YB 1TPXC 4MA8H 4R0LB 3PNRB 3EYSL 3MTRA 2CIKB 2BWIA 3KE0A 4J2QA 5ANME 3OKLA 3BVXA 4ILDA 5C07B 4A37A 5F9OH 3W5MA 3UMNA 8PAZA 4Y4HD 1QSEA 5AUMA 4AGPA 1WZ1L 3UG4A 2AVGA 2X4QA 4AVKA 1QUNB 3QUXC 5D1XE 3QAZB 2VM9A 2HVKA 1HL8A 2CLRA 4DVRL 1WZMA 4F9LA 4Y2OB 4I9WD 5DJ0B 4XC1L 4CNIA 1K4DB 3NFNB 4QRRA 3FTWA 1NA8A 2OM5A 1RK0A 2Y25A 5FHBH 3UTSE 3GRGA 3VXPA 1FLRL 4JPVH 4PRIA 1E30A 3BT2H 1T0OA 4XWGL 3UTTE 1OF2B 5D5MB 3M07A 3QVAA 4I77L 1M05A 5CGYD 1CXEA 1ERNA 2E6QA 3LPOA 1C16A 1G9NC 3CX5J 4GLRH 4K8RC 4KO6A 4M7KH 4UIKH 5KSVB 1TZHB 5MEQB 4EIUA 1KIQB 3MKKA 5EOCL 3B34A 2GSMB 2J4WL 1ZV5A 5MENA 3VACA 2LU7A 1A6VL 5C07A 5C0EB 3C6LD 3KHQA 4GG8A 3Q1SH 3RNQB 1OAZL 2QQNL 1BIIB 1QTYT 4ACPA 3BO8B 1JDDA 1A8ZA 2R9HD 5BW7A 3PWUA 4HPYH 1TQTA 4R6UA 4CMHC 2AQRA 4WW1A 1FFPA 5IW6A 2COQA 4NQVA 4XMTA 1TJIH 1EEYA 5JR1H 3IU3A 4PJFF 3FQTA 4K4KA 2CCWA 3EJPA 3OG6B 4YPJA 2GEQA 3LY6A 2FR4B 2Y1AA 3NSYA 4A7TA 3ATEA 3ZKNC 5ITFA 1F6AA 3PGFL 4XWOD 2BERA 3PFUA 4YLBA 3BUIA 4D0CA 1DQQB 2OYKA 4R7NA 4U1SB 4XMXA 3IDNB 2YD3A 4JY5L 2NNXA 3MBED 3GZOA 2YRZA 4NJAL 4UQ3A 1KBGL 4PS8A 2VAAA 4AGQA 4NJAH 2XQYG 2CNYA 1OGPA 4UMGA 2BSED 4FL4C 3GSUA 1J12A 4NP4H 4MX7B 5DUPH 5E2WH 3WEBA 2WVVB 4DWHA 1NGQL 2OMZA 4U1GB 3VA6A 2ZUSA 4XZ4A 3L3DA 4I0PD 5F7LB 1AKPA 2F7OA 2G9KA 4TOYH 3RGVA 1TQSA 2LFGA 1ODAA 1E8WA 1VGEL 1HOCA 5IVOA 3OAYK 4PJAA 4N8VA 2P8MB 4G9FB 5F3BB 2R29L 5A2LH 4HPYL 1W72L 2XXFA 2VLJB 1P5UB 4N0FA 1U93A 4G7YL 1QBBA 2UY6A 1G7IA 3N55A 1JAEA 1EHKB 3FK3A 3REWB 4BZYA 3K5SA 4JAMA 1ZXKA 3L5JA 2EE2A 3HN3A 4LEXL 3QUXA 5DD0L 3AM8C 4OF6A 2RMNA 3MJWA 1BZ8A 4BXVA 2F8IA 3FHEA 4XVTH 2JSFA 5CGTA 1UWGH 2ODHA 4EE2A 4LSRH 4I77H 4J2XA 1HH9B 1N59A 3C5JB 3MSPA 1I8KA 5HHVL 3ZE0F 5G5DA 4I9WE 3DTXB 2YD6A 1C7TA 4KJQD 2VDRH 2J8HA 3I75A 3VTAA 1A66A 4D3CL 4OJFL 3E3QE 1BOGB 3HEIB 4ODSL 4FADA 2MEJB 3K8LA 4WW2F 4L2LA 2V9RA 1A4JB 1KELH 4ZNEA 2BS71 4GKOA 1XV8A 4N2BA 4YSUA 2C4XA 4HJJL 3O2DH 4L3EE 1JGUL 2BVQB 3EYSH 4X4MA 1P7KB 5IBUB 1W8OA 4UOW0 1OL0A 2LABA 4K2UL 3MCYA 4XNAA 1NC4A 4LOUD 2R9HC 3X14B 2CRMA 2GJRA 4HKJB 2WTRA 1MWAB 5HD8D 3VXSE 2W59A 3EDDA 1JGUH 1CF8H 1L7TL 5T8IA 1I8MB 1G7JA 2G4GA 1BFSA 4K5NA 1QSVA 4ODSH 3L4WA 1BZ7B 2XZCL 3UBGA 4ZFOL 3MUJA 5JIKA 4R9HA 5T33L 2ZWYA 1IT9H 2TRHA 3N3EA 3V55A 2BO0A 2DKUA 4P46B 1QI3A 1YQ2A 1WISA 2HFFA 4ZXBA 1MCJA 4L5FE 4QHPA 4BKSC 2CUIA 4IOFD 3F01A 4PJXB 3ZXAC 4HG4J 1T4KA 4Y9GA 1A1MA 4ZAKA 3VFNA 1WJ3A 3ULSB 1NLDH 3UAAA 3U2SB 3CVHH 5C0JB 4FTVA 1CURA 4YE4L 4OJEH 1P1VA 2J1XA 4K9EC 4B95C 3V6BR 1K3IA 1JUFA 3N91A 3VYPA 2CKBB 1OT4A 1UWEL 3HE6A 2K8QA 1V55B 4HMDA 4JRXE 5ID0A 4TKWA 3MUGA 3IAGC 3L3IA 1KGIA 5G4NA 2V5TA 4MHHI 2EIZB 3FS9A 3LIZA 2YGVA 5CLYA 1S5IH 1P7QD 3Q3GA 4NRYA 4PS4H 4CU7A 4L3EA 1EFQA 1OAYH 2HLAB 2P5EB 4AQEA 1X5IA 1YSOA 1NBYB 4HC1L 2MQGA 4LASL 4R4BB 5DWUL 4YZFF 4WI7A 2X4TA 2C1PB 2CDEA 1W0VA 2X4RB 5INCB 3ZDZE 1EA9C 2IALA 2X10A 2ZOWA 5GGRY 4QD2E 1A9VA 3EGDA 1EEQA 1JI1A 5DRZB 3QXTA 3NRQA 3OZ9L 4PPTA 4XR8C 2OSLB 3DX6B 4OLEA 2TAAA 4JW3A 4J3OC 2E7HA 1IE5A 1NICA 3E8UH 4KQ0A 1UXSB 2WKOF 3D39A 2DL2A 3EYOB 3VXMD 1BFVL 1OW0C 3VXTB 3VX0A 4QHLA 3DV6A 2VISA 1M9WA 1IM9A 3GXFA 3QWOA 4PJ7A 1RKRA 1CLCA 4W81A 3MRKA 1U8NA 1INEH 5DHYA 1BVZA 1NGZB 3ROOB 1UA7A 5AVYB 1X6NA 1KJMA 1AGEA 2YMTA 3ISWA 3QZLA 3WS3B 1UJ3B 2NQCA 5DK2B 3NIDF 1MHEA 4Q0XH 5I75B 4L4TA 5IB4A 4JM2D 1T20B 1ZJAA 4H0HB 1I8UA 3U0WH 4M1CC 3DIVA 3CC5A 4QMEA 2ATAA 1GIGH 4UT9L 3QEUB 4XPAL 1QSED 5E8PA 1CD9B 3ECWA 3VH8B 4CU8A 3SDAA 2WKOA 1KCUL 3Q8BA 3Q05A 4ZPTA 5A6MA 3IXTA 4U7SA 1U8IA 4JZNB 2F7IA 2V3FA 5C0FB 1MQ8A 3L6FA 5FPIA 4X4ZA 4FQXD 1G87A 1M53A 5TD4A 4DESA 3E80A 2H0PA 2RALA 5EIQA 1XB3A 2GK2A 4HS3B 4Y9EA 2P7TA 2X2HA 2Y4SA 1AYOA 1FVDB 1CFSB 2G4EA 4GOSA 1MHEB 4ZMQA 4OQ1A 1ZDSA 3CK0H 2OP4H 4J8RB 4NPJA 3ZDYB 1AO7E 2R0KH 5ICUA 1Z2KA 3FCTA 5MEND 5DHYB 3IJSB 3D4GA 4JZOA 1CG9B 2Q3ZA 4UQDA 1F4XH 1UD4A 2AV1A 3C6LA 2Y5QA 1TG8A 5I19H 1FZJA 1A7RH 3MUHL 5DHVH 3TT1L 2YD8A 1NFDF 3RA7L 3HMXL 4O9HL 43CAB 3GO1L 2YN3A 4MZ2A 5C0GA 3S3DB 1BZQK 3CFMA 4JCWA 1A2YA 3TCXA 5D96B 3MOAL 5C0BE 2WZPD 2JI2A 4GBXD 1LO4L 1OP9A 2M8XA 1UQSA 2XX0A 4LIQH 2DM4A 2HX7A 4PGCB 3BMWA 4LGRB 1CU4L 1K8DB 1UVQA 4ZUUA 4JRXA 4S10A 4Z7OE 2BY3A 3P9LA 4L9DA 2VUYA 2XI9A 4KO7A 1GMEA 3TURA 1JNHA 1OCCB 2I69A 1UA3A 5GRZA 3X11B 3KYMB 3E0GA 3GLEA 4U31A 4WW2B 3H9SA 1CO1A 2PO6B 1R9FA 4E9RA 3OMNB 4ZW8A 3EYQC 1I9RH 3HIZA 5E1AA 2CDGA 3AUWB 4GH7B 2DWXA 3V7AG 2J71A 1IKNA 1R3IL 1TFHA 1THCA 3Q13A 3WFHB 4WY7H 4JHBA 4WEUD 3D3VE 4MJJA 2FZ3B 1TZAA 1N59B 1FIGL 1CFQA 1XWVA 2DWTA 3QUMB 3GS4A 1EBPA 2B8OT 2VDNL 1B4JH 4BSVA 2XQYK 2R2HA 3OB8A 2IPTH 2WO3B 1TDQA 2E9BA 2O30A 3MCKA 5ETUB 5SWQA 2WXPA 5KN5A 4QKXB 3ISRA 4JG5A 1HXMA 3HB3C 1SBSL 3KLKA 3QDME 4XB8A 1TQCC 3MLYL 4PIBA 3U7WH 4G83A 4PRHB 3DUUB 1YMHA 1D9KA 5DDHA 5KYYB 1ITCA 2B1AH 1UD8A 4TNVF 4XO5A 3L54A 3EDKA 2YWZA 4J28A 4Z7QB 1A3LL 1KJ2B 5BNXD 5GRXG 3MLXH 3I6SA 1BF2A 4JDVB 1X7QB 4Y1SA 5BQDA 2Y7LA 2C7UB 1EH9A 2R29H 3RFZB 1IKFL 1RV6X 1F58L 1H19A 5F6HJ 3TCTA 2B16A 1ZDQA 2Z4QB 3GB7B 1Y0LA 2ZXDA 1I8MA 5IB5B 3UO1H 1ULVA 1MOEA 4FI7A 4MKMA 5L2JA 3QPXL 1BVNP 3LTVA 1ZHLB 1PY4A 5MHSE 2X7LB 3MUUA 2XWBA 5IT2L 3M45A 15C8H 2AJVL 3LAFA 4J3UA 3PUCA 4GW4A 4XBMA 1KT2B 5I6MA 3U6RB 4PMFA 1UJTA 4AUUA 1PZSA 2QGEA 2X6MA 3K4AA 4YXHL 3OKNA 1MXGA 3BIKA 4O2CB 4C56E 2LTQB 3LH2L 5AKVA 3ME0A 4NFBA 5BUAA 2DL9A 3TF7C 1DYZA 1JGDB 1J1OH 1J5OH 4G1EB 1HE8A 4ALAL 2J6EL 2GJPA 4M61A 4Y5XB 4ZYKA 2CHWA 2DJSA 1SVCP 5DUBB 4I48B 1EEUA 1JGVH 5GGTL 1WWBX 2D2CC 5FECA 2C9PA 1K5NA 5E8OA 2K3HA 4NBXB 1XAUA 2ZCKH 3H6AA 1KCVH 4FCAA 1M7IA 4P07A 4RGMB 3BZ4A 2JB5H 1NJ9B 1ZE3H 4LVNC 3TL5A 1FO0H 1IBYA 3C5ZD 4A1RA 5F6IB 2BSBA 2BS8A 3CFJB 3ZPDA 5FYKU 4GP5B 4YMPA 1KXVC 2WSDA 3MJ8B 4P9HL 1YYLL 4PB9L 4X6EA 2OXGA 4JB9L 5JQHC 4FZEL 5I75C 4PJCB 5JOFA 1G5GA 3LIZH 2O26U 2PKDA 1FSKC 4OFDA 4NQEA 5DVOA 4HWZB 4UAOC 4PVLA 1CLYL 4B60A 1AGFA 4FLQA 1Z9SB 4H8WC 2C9SA 4PGBA 3BZFA 5ALBH 4A2LA 5F7EH 1CBVH 1H9DA 4PWHA 5LLIC 1DSWA 4M1GL 4DK6A 1G7PB 4CN4A 4HU8A 1CL7H 3B9VA 2D73A 3US1A 2VDOL 2XQ0A 2PWHA 3KM2A 4IJ3C 2VDML 4TMPA 3GIZH 3O9WD 3V2AR 4C4UA 1QFHA 4Y5VB 2R2BA 3BVNB 2G3NA 4PTUA 4OZFA 3GUFA 4MX7A 3VGEA 4MB4A 2ITCA 1KXQE 2AXGA 1N0XH 1BLNB 2XWCA 3ARSA 3HZKB 2NNCA 4M48H 1IQDB 3QK0A 4I3SL 3T4AB 1TCRA 2Y3NA 3BWUF 1SLWA 4GSDL 4KO5A 3THMH 4OZFH 5EORH 2DLGA 3OQRA 3GMRB 4K3EH 3QXAB 4NC2B 5E9DD 5EC2B 5AW1B 3AMKA 3T71A 2YSSA 2BHUA 4GRLB 3F05A 4YDIH 4L4VD 4PCKA 3GXUB 1RIUH 4I18C 4A6YB 5EWIH 2CO7A 5E5UB 2D3JA 4IBVA 4P99A 3KCPB 4OLVH 4QCIB 4B9ZA 1ROCA 4PW4A 5IVXE 1YPZF 1IFGA 1MF2L 4RZCB 3EBAA 2JCCF 5E9NA 2VLKE 4OI9A 2YFOA 4HC1A 4OZHF 4ZZFA 5GSRB 4L4TD 1RUMH 4WGWB 1AHMA 3AY4A 1RHFA 3MLTB 5IHZB 2ZCLL 3VXOA 3EYVA 3GFUA 1GGCH 3GMMA 4NZJA 3O8XA 3VW3L 4Z95H 3OLEA 3AS2A 4RGMC 5AVVB 3LN4B 2KLTA 4G3YH 4WUUE 2GSGA 4IBTA 1FNAA 1GHFH 3DROA 5GS1C 2EDOA 2CLRB 3PFQA 3PWJA 2P8PA 3ZX1A 1FFOB 2VABB 1H6EA 1YUHB 5IEHA 1G9NL 5GS0D 1Z5LB 5FM8A 2JCWA 2JXMB 2BY1A 4HA1A 4HU2A 4QO1A 1SN5A 2EDQA 4JM4L 5I0DA 3APMA 3BP7B 3B2PA 4F58L 1F97A 4X9YA 4KFMA 4U2YA 3T2LA 3KDMA 3VGGA 2XFXB 4PLJC 5JA9A 4GLRI 4I0PB 4P4RB 1T1WA 3QPXH 1B88A 1LHZA 5HDOA 1X5JA 3CFIC 1TJGL 1EGJL 4KUCF 3PLYA 1BXXA 1A7BA 2OR9H 5DRNA 2BP5M 2XKUA 3ZE0E 3RUGF 4Z77A 1IC7L 3PXJA 3F7PC 1RZGA 5IJBC 4YBQC 4N2DA 4KAQH 1JZJA 2IADB 5C9KA 1CLOL 3G6AB 3ZZLA 5I82A 3BWAB 1N2RA 2ZWLT 2EEFA 2E7MA 4DGYH 2PYFB 2WCGA 3IWVA 3F5WB 1IE4A 2D3NA 1JHLH 2EEDA 3O6LL 1N6QL 5IEHB 2QVTA 1CE6B 3H56A 1J1PH 5C09A 4LVOC 1KFAH 1FO0A 1ORSB 1HAUA 5F7YC 1U42A 5FF6B 3UDWA 3I85A 2X87A 2ZNWA 3DROB 3TX4A 3N9GL 5BOZG 2X9ZA 5L8JB 4IRZA 1KLUB 4QYOA 3UAJD 2FX9H 8FABA 4WUUA 1MVYA 2QQKH 4WWKB 1A1NB 3W56A 1B9ZA 1J05A 3AGVA 2A6KB 2W07B 4FFZA 3KCWA 4U1NB 3U4KA 2N01B 2UXVA 3ZIYA 1VKXB 2F7RA 3FB8B 4PIRF 4PRAB 4K71B 4FEMA 4I89A 3IDIA 3L3KA 4TUKL 5DFAA 2WQWA 2ZKMX 5SV4A 2EC9U 1GY2A 1P53A 1OCOB 3FO0L 4IKJA 3NG5A 4QCIA 5KOVC 5DVKA 1U4EA 3GMPA 1BVLB 2CDGB 4JFDB 1REIA 1AQMA 2N59A 4PGEA 4QOKE 3H2WA 2X38A 3HNVH 4OZHE 3VD5A 2E5EA 1EHXA 3I02B 1T4WA 5D2NA 3NCMA 3ENEA 2OMWB 4BFKA 1KTJA 3SDXB 4NM8H 2YSSB 3O6KH 4C83A 1A21A 3BPNB 1JYVA 1FYHB 1KGWA 2YA2A 1CE1L 2ZG3A 4M6ML 3T2OA 2R69H 3UXFA 4ZS7L 4L0ZA 3BESR 4HXAL 4V1DA 2EICA 5LN4A 4OD3H 1CCZA 5MERB 1QFPA 4TNGA 4AVHA 3T6VA 4HV8B 3F83A 4TPRH 4I7ZC 3RAJH 5SWZB 2GK0A 3SE4C 4LDCA 3BPNC 1F4XL 1XCXA 2V17L 3LQMA 4GIOA 4HP5A 3TESA 5CBAA 3VJ6A 2X4PB 4YZFE 3UBHA 2OP4L 1SXCA 2F19H 5A7EA 1YNKL 3O3DB 4KXZI 1F13A 1QHPA 2KKQA 4WU5A 3HR6A 3K72A 5B1AB 1Z0MA 3IGAB 3D51A 1Z9NA 4MYPA 4N6QA 3VE0A 2CXKA 3II2A 4PLJD 3M88A 1PW3A 4IU3A 4ZTEA 2XWBB 1DQDL 1UOVA 4I85A 3NAAL 4UNUA 3MRHA 3KR3L 3DX3A 4BE6A 1AGFB 2NY4C 1OAXL 3FO0H 3QIBD 3STZB 4CILA 2YQGA 1NAMH 2VMFA 1PQZB 3BMVA 1EO8L 3QJZA 4MWFB 3RNKB 4LCWB 4QRUB 4HUMB 2QFRA 1VPOL 4TUUA 5HHXH 4H8QA 4PJ7F 3KWWA 5KVDE 3P4MB 1MRDH 5TQ0H 4F7EA 1MCFA 5AW6B 4MD4A 1E8ZA 4WWKC 4N5EC 2EECA 1J8SA 3VXRB 3RI5F 4BSWB 2DQJH 1PZ2A 3JXAA 5M95B 3GI9L 2IH9A 3FT0A 5JIQA 3CFEA 4UAHA 3M8OL 2FX9L 2L3BA 3CLWA 3GDBA 4LHUB 1WG3A 5I71B 2J8UE 4GO9A 4NN6C 2UWEF 4P5SA 1D6EB 4CSSA 5DVNA 2I60L 4TNWF 2XQBH 4PREB 3MV9D 4XP9L 5HYJD 2EVJA 2FWUA 1FBIL 1A4AA 4R0LC 3NDYE 4YX2H 1MG2C 3SKOA 1YNLH 4KZ0A 1JHLL 2HT4C