4W9HC

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 37
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9hC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9hC01
4AJYV 4W9EC 4W9FC 4W9GC 4W9HC 3ZRCC 4BKTC 5LLIC 4WQOA 4W9KC 4W9DC 4W9CC 4AWJC 4B9KC 4B95C 4W9LC 1LQBC 1VCBC 4W9JC 3ZTCC 4BKSC 1LM8V 4W9IC 3ZRFC 3ZUNC 3ZTDC
chains in the Genus database with same CATH superfamily
2E86A 4ODVH 3QFJE 3CZSA 4MXVE 4RLDA 4S1RL 4KDVA 5DD1H 4ATWA 3ILDA 3ESUF 3KEHA 3SJVB 3I02A 1A9VA 2PO6C 4XVJL 4PJBA 2Y7OA 3C8KB 2ADIA 1RIVL 4MQTB 2KLTA 2IFFL 3Q2CA 3MV7A 4MD0A 1S9XB 2BFVH 1HZKA 3TTYA 2GFBB 3MLSL 5TH2B 3V10A 2P44B 2ADYA 4NQDE 2YAFA 5JIHA 5GRVL 1CF8L 2J1YA 2GJZB 3PQYE 2P48B 2GAZB 3LNHA 1G9ML 5I17A 3L4VA 4RAVA 3T0EC 1CXLA 1Q4NX 1J8KA 4HX1B 3OJDA 4JO2H 1CF8H 1NFDF 2FJHA 4WWPA 1LQSR 2DQGH 3QFJB 5DUML 2FECI 5MERA 3VSUA 5C97A 1BGXH 3EGDA 5EU7C 3QNZA 5J06A 2MCAA 5HGGS 2CO7B 4P2OC 3N3EA 1A9EB 1M05A 4ZUTA 4PJHE 1F6LL 3DSNB 1JZIA 3P2BA 2OW7A 3KPSD 3Q8CA 3BZ4A 2MTPA 4HP5A 4FNTA 2FIKA 3UJIH 1QO3A 1JPTH 4G6JL 3OQ3B 3KBPA 1RFDL 4WDIA 1M3JA 1FNSH 1HEHC 2CDFB 4GAJL 2VE6A 4UBDD 1EJOL 2P47B 5IB1A 4AYBA 1OPOA 5B4MC 3NJGA 1PYWB 1ORSA 3Q2VA 5E6ID 4YHMH 2H0JA 4PGJA 3TF4A 2E4TA 3T0EE 3ZVVA 3SYPA 4HJUA 1UZ8A 5HPMA 2Y07H 1XGTA 2NZIA 1XZWA 4B97A 3L5WB 2X12A 5EBMA 3OHXC 1IBBA 4E9SA 3L4CA 3ULUD 1W0WA 4Y16D 2OR9H 1IAII 3WJJA 5IWLC 1F3RB 1V3LA 4RA0C 4EF3A 3L4XA 4OV5B 5KSBF 2CKBL 4NC1E 4RMSA 3OR6A 4LU5H 3KM2A 4CN4A 4J3VA 1SEBB 3QEGH 4QRUA 1ET7A 2K8MA 1M7DB 1IKFL 1U91B 2ZOKB 3A67H 4ZYKB 1FLRL 4GRWE 4GIAA 4MNQB 4RGNC 2D7TH 3LRSB 1HYSC 1KGXA 1FNEA 2F7OA 2A73A 3D4GA 4ZTPH 3MRCB 4LSSH 5C0BB 2WQAA 3MRLB 4KGLA 5HTSA 2APXA 3VFMA 4HT1H 4NM8L 4YFDB 5AVWB 2HN7B 4Y5YC 1D9KB 3IGAA 3CN4A 4LPCA 1L7TH 5TFSL 4LF3A 2JJTC 5HY9A 3WNPA 1J9QA 4JG5A 2OMWA 3D25B 2IAMA 1DVYA 1X5LA 1N5YL 4HK3J 3Q2LA 4JDZB 4OFPA 4MCMA 3TT3L 2NW2B 1AKJA 3DHUA 4QXGH 1AXTL 2FWSA 2K8QA 3BIBX 5B3NA 1JD7A 5DRNA 4HOMA 2X6CA 3RKPA 4WNSA 1UJ3A 2DMCA 4H13C 1AS6A 4YX2L 2ATAA 3MBED 3MV01 3B2XA 4JKMA 5GPRA 5GZND 5DSCA 3L95A 5TK2A 2XVGA 5EEWA 4DGIH 2NUTA 5CCGE 2ALAA 5FECA 3JTSA 3H8NA 5E6RB 4U6VH 4RIRB 2GKIA 4P2RA 3FFCD 3H9SE 1SYSB 2V2XA 1N7ML 3N6YA 4CMMB 3BP5B 2WBXA 1SNRA 4LQFL 3QWQB 4FL4B 2WWKO 4LBAA 4JFEB 3D2UB 2HN7A 2L04A 1WG3A 5LAXB 3DO4A 3HS0C 4J3XA 3VGHA 3RVUD 1BP3B 1WJ3A 4WI3A 4BZ1L 1DZBA 1YSOA 2HTLD 3K91A 4NO0A 1NCCL 4NGHH 4YMPA 1DE4B 3P0YL 1NBZB 2YFOA 3II2A 3QA3B 1JE6A 2P8MA 3BWAA 1LO5A 4QYOB 1BAGA 3SE4A 5ES4B 5MEPA 1IQWH 1HHHA 2RALA 3NT0A 3DSNA 3WD5L 4EN2A 2YUZA 3QCTH 3RVXD 4WKZA 3V4LA 5EZJB 3RX8A 1A1NA 5C07A 1VPOH 3VA6A 3C6LB 3SKMB 3AY4A 1I3UA 15C8L 1JWUB 1ZA3A 4YH6A 4AXWB 4CRPA 3FUDA 3LKPA 3GSNA 1OVZA 5K39B 3QG7L 1LEKB 1OLZA 1S46A 2OSWA 1BX2A 1WGVA 2ADFL 3IDYC 3N91A 4LEEA 4ZNEA 5I1LB 1E5ZA 1UA3A 2R2HB 5HI4C 3KG5A 2R9HC 4XHJD 1KBBA 3OZ9L 1J86A 4L48A 2EXYD 4GOSA 3HR5A 3DIFB 4NJ9L 2CR6A 4OZGE 4A7QA 3LS5H 5KJRH 5DRWA 5C09E 4DJMA 4J5VA 5BUAA 1SUJA 1J0HA 4IGBD 1AVAA 1FN4B 2VH5L 3T3PE 3B9KD 3FH5A 3CMGA 4PJFF 5LQBH 5AAPA 3BEVB 3F83A 3HRPA 2NY4C 1TZHB 4FEMA 3T2NL 3GB7B 4AZUA 2V8LA 4O4YL 2W9EL 1RAMA 3UTSD 4PRAB 4XE5B 3L9RA 3OD3A 3GLAA 2FJHB 5MERB 5T3ZL 5EUOF 3NCYS 4PSRA 3CX2A 5GRUH 4Q9QH 4V1DD 2EDKA 4NHUA 1NUDA 2ALWA 4JUTA 3D18B 1UWEH 3C5XA 4CNIB 3UCRA 5DFTA 1AGDA 1SJEB 5J6SA 2BOBA 4EUPB 3N04A 1CBJA 1MEXH 3WNIA 4PJ5B 3MV11 5KVGH 2DQMA 2BRQA 5D71L 3US1A 1WVZA 4K94C 2WXQA 4P4KD 1HE8A 2QTEA 1T04A 5B38B 4P46A 4ZPVA 3C8KA 1YA5A 2R1WB 2KPWA 2P8LB 4LEBA 1IM9B 3DV6A 1M57B 2YOAA 1L3NA 4K2UL 1DN0A 1H8OA 4AYMC 3WIFA 3NRPA 3ZRFC 5EZOL 2Q0ZX 3ALPA 1TT6A 4XNXL 4UM8B 1UWYA 4N68A 5EU4A 1K2DA 5EUKB 3SDDC 2XTLA 4GUPB 3P4OB 4NS0A 4DN3H 3BUTA 4Z76A 3IKKA 2EDBA 5I1EL 2YAMA 4YSAA 1KJ2B 2JB6A 1MCPH 5GGRA 3WTYA 2J6WA 3U2SB 2VERN 4K7FB 3ZE1E 4EPSA 4YE4L 2B14A 2BVTA 3MX0B 1ZDSA 3OXSA 3KJ6H 3V4VL 5H2BA 5K9OA 3GXIA 4PJ5A 1NCBL 3D4YA 4KKRA 2A38A 3OGCB 4JMNA 1CICA 3BAKA 4HCRL 1D9KC 3P77B 1NDTA 4W9EC 4W9GC 1MW1A 4QXTB 1SVCP 4FNRA 3IXAB 1QTYT 5I74B 4EI5B 1DFXA 2VW4A 2G2NA 4GJTB 1A7OH 4XP9H 1LK2A 1QWUA 4FQHB 4PRBA 2EDDA 3ECWA 1R5IB 1TG8A 3M17B 3ARGB 3E2HB 3A24A 2K9UA 4Y4KD 3RPBA 4KK8C 5JHLH 4ORGB 4I5BB 2RJMA 3WY1A 4DP9X 3M45A 5CEZH 3QZMA 2FBJL 2FE0A 2QZQA 1JXFA 1ND0A 5E4AA 2CJTA 3T04D 4PY7B 5B7MA 2B4CC 2ITCA 1GHFL 5DO2C 3UJJH 3F6LA 4UB0L 4UT6H 3MJ8B 4Y1AA 4CVWA 4UV4L 4OD3H 1T7ZA 1CGWA 4JKPH 1GCFA 4PJ7A 5IVXF 5D7LB 3EUDA 4OCXH 4Q9QL 2UX7A 1U58A 5EN3A 3TZVB 4RDQF 1HQ4A 3O8XD 3P30H 4QF1A 2HA1A 3ILPA 4HGWB 4JGHA 1MVUB 4P49A 5C9JA 1OZTG 2PWGA 4XHJC 2IV9A 3BZFB 4GLRH 3ARSA 3WFEL 3IVKB 3GHEL 3RL1B 4ELMA 2DBLH 3QAQA 1WUNT 1I8IB 4W6WB 5KJRL 3PABA 3U79A 1CGYA 3QJUB 1UVQB 4FC3E 1ZA3B 2CHNA 2WNXA 3UH8A 1BIIA 5I0DA 4F7CB 4W9DC 5ESAA 3RL2B 2JTYA 2CO6A 1X5AA 4XP6L 1I1YA 3V0VA 3S88H 1OZUA 5I2IB 4Y2NA 1FL3B 3WCYA 4PWGA 4GBXC 4U4BA 2BXZA 3F7PC 4B60A 2BOLA 4JGNA 2ZXGA 1E3ZA 3PHAA 4JDEA 4W4OA 2YZ8A 3TWCH 4A66A 5HGBB 3VQLA 1N67A 4NQEB 1NLBH 2FWUA 4NFBA 3QUXD 3Q0HA 3UPRB 3CFCH 2VDRB 1MRCH 2XQBH 4DSYA 5ACMA 3ZOAA 5J1SC 1NDGB 2FDBP 1YEHH 2WLIA 5F3HA 5IGXH 3FTXA 4PB9L 1FDLL 1GGIL 5BW7C 3L2MA 4L4TA 5D2LA 3F01A 5BS0A 2X4QB 3V0GA 2BIOA 1MH5B 1NGPL 3HR6A 1NWOA 3OMAB 5KSAB 2F54B 3LEVL 5DURB 2DIBA 2VZUA 1A6TB 1Y6NR 3HUJA 4PD4J 2IWGA 3PY9A 5IFAL 5DJDB 2ORBH 3QEQE 1R33A 3P9WB 1KEML 3PABB 1MAJA 4Q6YA 2A9CA 3FOLB 4GKLA 1B0WA 4N5ED 4PR5B 3D2UA 1TCRA 1BVLA 4MRBA 2JB5L 1CB4A 3QQ3B 2WANA 1B9ZA 1YNTB 3ARBC 1KG0A 3JZ7A 2B7DT 1YEFH 4Y4HD 3T1FB 5IG7A 3SB3A 1YPZB 3F7RA 1AOHA 2X4SA 4WU5A 3SE3C 4FQXD 4QRPE 5AKSA 5EIQA 2RBLA 1OV8A 4PVLA 1UZ6F 1GOFA 2VUOA 3O6FD 4DW2H 4L4VD 3CPLA 4PPTA 1YEFL 4G9FB 1FYTA 4OFIA 4DEUA 5MEQB 3SDDA 3MV7E 2RR3A 1NGZA 1K8IA 1GGUA 5C0AA 1KEMH 1JHLH 3MJGX 4FQQB 5MP6H 4OIAA 2WWMC 2R39A 3IU4L 3H1ZA 5BQ7A 4OGQC 1E2WA 3C6LC 4JFYB 4YDJB 3BJLA 3QCVL 5CN1A 5IBLD 3BDBA 4BFNA 1N64L 3DHPA 3CZLA 4TRPL 4WI7A 1YY8B 1T66C 2NX5B 3CFKA 2P4AB 3WS6C 5A3ID 4N2MA 1UG9A 4Y0GA 3HFML 7PCYA 3IJYB 5B8CA 3MRPA 5GSVB 2FH8A 2Z6FA 2BNUA 4APQD 4EOWL 4PR5A 1QR1B 4PJXA 3ZU8A 2EYSA 4YXHH 4JGJA 2JQAA 2VE6B 2ATKA 4MMXA 5EO1A 3MUY1 4ZMQA 5AAWA 5HPMB 3AU0A 4Y5YB 3BT2L 2Z4TA 5CJQH 4BUGA 1KCKA 1OOAA 1NCAL 2EYTB 5FFLA 1MCLA 3QIUD 4HXBH 4R4FL 1R3LB 2PYEE 3PXHA 2H41A 1BZ9A 3WSQH 3EO0A 1YEIL 4LCIL 2Z34A 4JKLA 1D5MA 3MBXH 2IAAC 4PJIA 4H8UA 4FTVD 1YQVH 3REWB 4GAGL 3MCKB 1IEAB 5DHVA 3UPRA 3MQIA 3GXFA 4ZUVB 2YR3A 3ZT5A 3ASOB 2BOCB 2WLJA 4ZXBA 1L7IL 3OMIB 2PPEA 4KO9A 5MHSD 2AW2A 4FERA 5IW3A 1DN0B 3C6EA 2OMNA 3FMGH 4U0QB 2YPVH 1ZV2A 3N2JA 4WFGD 4MJ6A 3VXNA 3P4OA 4M1GL 4YHNA 4GAJH 4NXSA 5JYMA 1JJUA 3FHQA 4IBZA 4LP5A 1G0XA 1A1MA 3VFRA 5EBLB 3M07A 3DROA 2Q8AL 1VSCA 2H2PD 1DSFH 5C0AD 3CDZA 4OD3L 4XODA 4BFJA 1J5HA 5CGMA 3EFDH 2BNRB 4Q56A 4PBWD 1M2VB 5ETUB 1KGIA 1P5UB 4FFWC 4M5SA 5IEHB 3KNBB 2E74C 4KJWC 4DUWA 1U21A 5GGTL 3UJTH 1NAKL 2GITB 3PWPD 3SQOL 1V54B 5KVEE 5B1JC 2NY2C 4PJCF 1CLCA 5DHYA 1HQ4B 1FLTX 3K71A 4NQDA 1ZLDA 4J4PC 5DK0A 4ESKA 2VXSH 3P4MB 5KSAC 2CBMA 4F8NA 2C3VA 1DBMH 3ARXA 4WLCA 2PR4L 3QPXH 4LCCC 1KXVA 2EZ0D 1FYHB 2C3WA 3RQ3A 3K6FA 4KMQA 1BXUA 2GTZA 3L5JA 4XP9L 5A2IH 4CAGA 5SX5H 3DV4A 1BPLB 1CGUA 1FFNA 4BQCA 5C2BL 1M4KA 3QDMD 5AVRB 3DURB 3HUJF 4JFDE 5H37A 3X11A 4KUZH 3FCTB 2HLEB 2AS5M 4NKMB 1UXWB 3GRWA 4AEHL 3L7EA 4I7ZC 4L2YA 4CW1A 4L4VE 4JFDD 4Y4FC 4YDVA 3TNMA 2WQRA 4WWOA 1FFTB 2V9QA 4M48L 4N24A 2F74B 3WIHH 2PO6B 2NY3B 2YD3A 2O6EA 1P9MC 4TM9A 3CH8A 3MRKA 3JTTB 4HUUB 4XVSH 5I8OL 5FA4A 4OCWH 5GGSA 5HDQH 4DIXA 3PGFH 1KCSL 2FHBA 2XXMB 1CL7I 1SHWA 2FUTA 3C87A 1A4CA 2H0PA 4FKHA 4FJ6A 5FO2A 4QJ4B 4U3CA 3FH7A 3U6XS 3SKOB 2OULB 1WZ1L 2FD6L 4HIQA 1JV2B 4K3JH 3ROOA 4AVHA 4EI6B 3RIFF 1FVDB 4NNXB 2LFEA 1PZAA 3LOWA 4LVOC 5FUOH 3QXWA 2H2SC 1CTNA 4LCYB 4F5CE 3K6NA 3AT0A 2GVYA 2AK1H 2NQ3A 1WBXA 2FGZA 2WO4A 2QPSA 3BLBA 4G5AA 4PH8A 5CWSA 2G3XA 4CILA 5F9JA 5D7LE 4IDLA 2CWRA 5KBDA 3MUUA 3IDMA 5TDNB 1ZLVH 2ZKMX 1IC5H 2BOCA 2X1QA 4GKNA 4RH4A 4JFSA 5LAXA 2NNAB 4S1SL 1U93A 4PJ6A 1UWEL 1A6UL 3APFA 1RZKH 2AXWA 2IFGA 4PJ7F 5IVXA 3GSUA 5FS5A 1ZPUA 3WI9A 1ASQA 4RMRA 3VXMB 5E8OB 3DECA 3W0WD 4YWGL 5L6YL 3CLWA 5CXPA 4XNDA 1ZGLP 3ZX1A 3UTTE 5GSRA 3RB7A 2OMVB 1JP5A 3H0TB 2D3LA 1ACYH 2H0EA 1X5GA 5IVNA 1GL4B 4AJWA 3KYKL 4Y5XC 3KM1A 2JJTA 3QUZD 3VSTA 5IQ7H 3OR7B 1QPKA 3P0GB 4LKCA 5J1AB 3FYEB 3PJLA 1V5JA 3U7YL 1K4DA 3OPZH 2VXQA 2VN6A 4P2YA 5F0LB 1V27A 3AADB 3DJRA 4LSVH 3LPOA 3I6KB 3VFTB 2NMSA 2ZKXA 4G5ZH 3FQNA 2X9YA 1XR9B 3OZ9H 1MHHB 3HE7D 1EBPA 2BX5A 3A3YB 1DL7H 4PS4L 4GSRA 1T5WB 5IF0B 5L0QB 4NC1C 5E94B 3D07A 4XWGH 4WO4C 3W57A 1ZE3C 2YHGA 5E5RB 1RURL 3RKDC 5DUBA 3HG3A 4Q6KA 1AE6H 2WZAA 3GTTA 3IDJA 3LPGA 2RFXA 5CJ8A 3SDDB 3FZUC 4TUOB 1EAOA 1FNGB 3ZTJG 4R90L 5I6MA 4LPVA 4KZDH 2YGQA 1NWPA 4OIBA 1TQUA 2P43B 2ZUXA 5KVEH 2GTQA 2Q7YB 1PBYA 5J1TC 3CFQA 3RIFK 2EC9T 5F7MC 3HJEA 1P7QA 5JW4N 1AHWB 4XC1L 5ENWA 1RY7B 4RIRA 4HQQL 2VB5A 1YY9C 3C75A 1RVFH 3GHPA 3GUTB 4NRYA 3EYUH 1ITBB 4OLEA 4D8OA 4X9HA 3D05A 4O2FB 1KLFA 5JW4R 1HHKA 4WI6A 4WI8A 5DZAA 4JKNA 2CUMA 2DQJH 2J4WL 1WBXB 2AXFA 2GK0B 1N8ZB 4UNUA 3FT2B 4HZLB 1BMZA 5E8PA 4XMKL 3CFNA 1O9WA 4FZ8L 1AO7E 5JHBA 2OMBA 4AX3A 1MFUA 1QSED 1A02N 1MLBB 1DBAL 3FN0L 2BS9A 4HIEA 4U1NA 2R69A 4C4KO 3ZKXC 2YGVA 2Z9TA 4J6RH 1IGJA 5MEOB 4OF0A 1L9MA 4P3CH 2GUOA 4DPBX 3B7UX 1TZGL 4FXLA 2GG1A 4BRVA 4PMEA 4LPTA 2XX1A 3LZLA 5E56A 4KZEL 1VENA 2Q76A 3H0TA 3LJ3A 1JK9A 1QZNA 4XN1A 3CVHB 2BCKB 2EH7H 1SLVA 4L5FL 3C5SB 3S3JA 5D7LD 2DICA 4HALA 5J3HC 5E5UB 2H45A 3KH3A 1KBKA 4BH8A 3ELAT 3QJZA 4G6FB 5EV7A 2R1XB 4LOUC 3F7LA 5LWYL 1IMHC 4OI8A 1WK0A 3BW9A 3ARDA 1P7HL 4X8CA 3H42L 5ANMB 3MA7A 4G6ML 1MHHA 1UVQA 3RWGA 2R0ZH 1NCUA 4TQHA 1Z5LA 4Q52A 3S8GB 5D1QD 3WHXA 1PNDA 3RUGA 4MXWL 2DI7A 4UUJA 4K7PX 4IRSA 5DO2D 5J1AA 3QUXB 1UYWH 4OLXH 4X4ME 2EP6A 3NZHL 4U7MA 2C9RA 2WPGA 1CZ8L 3AMLA 3FQNB 4G11A 1GSMA 4M5ZH 4KOBA 1TTGA 4DZ8B 2H32H 4XO3A 5BO1L 3S36L 3L3JA 4OVUA 2XX0A 4LLVB 4KI5C 2VLME 2OW6A 3BN9C 4OAWB 4LVNC 2FBRA 2HG5A 3T4AB 3WIIH 4XX1E 2X53A 2WLIB 4Y1AB 1WRFA 5T1DH 2KH2B 4C83A 1ORQA 4L2LA 1FVEB 1OKEA 2WCSA 1OY3B 4XP4H 2CGRL 4GKNB 3HI6H 4DAGH 3QDGE 3KR3L 3LB6D 1LO3H 5T3XE 3CTTA 3UYPB 3BSZH 2ITFA 1B88A 4HKJB 1PD1A 3HN3A 1GZPA 3PS6A 3W0WA 4GUPA 5I28A 1E28B 1AG0A 2OTUA 4P8QA 3DURA 2QVKA 3QW9A 4YHZL 1IKNC 4G7SB 4HSAC 1A8JH 2C4FT 3P9LA 2NR6A 1G9MH 3ZNGA 1F45A 1TIUA 2FIKB 1BVOA 2VDQH 4JREC 4IEFA 1EMTH 4CN6A 5DC9B 3MX0A 4MA8L 4TMPA 5IB5A 3FZUD 5EU3B 3SYAA 5FYJH 1JGDB 1MFNA 2MQ3A 4OD1L 4KITB 1E9OA 1YAIA 3CVIL 1CN4A 3OGCA 1EFXD 4RBPH 4IU2A 4HWZB 5FXCH 3U9UB 4KJPD 3KR3H 5BXFA 3A6BH 3G5ZB 4MCZA 3DOHA 2F7QA 5DMIH 4N0UE 1JZ2A 3WOVA 1U8PA 5HGDA 1BZQK 2CRYA 3VFPB 3O45A 1RZJL 2GJJA 1EO5A 2GJZA 4R7VA 4ODVL 1OP5K 7FABH 2DYRB 4KX9A 3WIIL 5E0FA 2Q86B 4HKJA 1RCYA 4KKNA 5D9SB 5DYFA 1IX2A 2YBRB 1YYMH 2Y3AA 1ML0A 4KROC 1NOFA 4A7SA 1Z9NA 3CSBA 2I07B 5FWQA 4NQCA 5B39B 5IQOA 5AZ2L 2X38A 1J5OH 4M5ZL 4LCVA 3CSYB 2DTML 3GHBH 3QNYA 5FGBA 1RSFA 3HAEB 5CS7A 3NZHH 5ELIA 1CD1A 4IOIA 1GTNA 1D9KD 1ZE3H 2O72A 3HKZA 1M71B 5KSBA 3ZKSD 2PW2B 4M03A 4OZFB 3N1FC 3F64A 3DRTA 3KGUA 4XPHL 2P42B 4XBMA 3MUGB 1IEAA 2HLFD 4FX5A 4E9QA 4I4WA 4JJ5A 1T2JA 3K8LA 3BUYB 5DHXB 1GZQA 2FLRT 2QVTA 3G04A 2G2PA 1DJXA 1KCRH 4ZX4A 3EXLA 3QUXA 1T7WA 3G6DL 2XXFA 3P3SA 3UTSB 1CI5A 3PP3H 3ZTNL 3V5HA 1W8EA 1KIPA 4TSCH 3VXUE 2G4EA 2ZCKH 3WELA 2B2XL 5LVEA 4GXVL 1NFIA 2VQUA 3K1DA 3TONA 2W80C 4DGYL 4F93B 4GT7A 4OFYD 4IGBB 4WWKC 2FVNA 3BD4A 3GJFH 5D4IA 2VISA 3K72A 2ZWKA 3MGOA 3O3DA 5DWUL 3VD3A 4MJ5B 1CFBA 2QSVA 4HHAA 2VDML 4KRLB 1Z5HA 1JCKA 1HHJB 5DJAB 4JO4H 1Q38A 3KLHD 3CFKB 1R5VA 3U6RB 2WVTA 4MDIA 3NMEA 1KCBA 1NFDA 1UFGA 2WM0A 3EJYC 3MRDA 4F7KA 1H3PL 2QKIC 4AIEA 5L2KB 2DQHL 3LV3A 4K8RC 2NX5D 2R2EA 1I82A 2Y69B 3VGAC 2AEPL 3B2UC 1EEQA 4QRPA 5IQ9B 1V05A 1WITA 4HC1L 1BVKA 3BP6B 5HI3C 2ZJSH 4LSRL 3QS2A 4JL2A 2Y06L 4XX5A 1GAFH 1RP8A 4M7KL 3MJ7A 1CDIA 4P9HC 2H4EA 1H9DA 2V5RA 3PQYB 4JE4B 2IPTH 3DTXA 4FLSA 1UWFA 2BVEA 4PJBF 4X9YA 3U0WH 2AJZA 4ZXBC 2EVIA 1QW8A 1X7QB 1AH1A 5KVDL 1H0DB 1JNLH 1TXKA 3VM5A 4UU9B 2I9LB 5F96L 5LGJB 4DKEL 4PRNA 1FVCA 3WY4A 1GJUA 3QDME 5IHWA 1JGUL 1I1AC 3RVTD 3QWRD 3PWLA 5CGTA 2Q87A 4ZW3A 1WISA 4K9EL 1D3CA 1LL1A 3BWSA 2XZQL 3IDYB 4IOFD 4WU7B 1JYXA 3QJSB 5KVGE 5F88A 3OSVA 1E43A 5JUEL 2VKXA 3LNIA 5MEQA 4BFRA 3EDKA 4IIQA 2YWYA 2UZPA 1UXSB 4QRSB 5JIQA 4F58H 3WTUA 2C4FU 1B4RA 4FI7A 4YDLC 2BP3A 3NTCL 4PLJD 3RWEA 1MVFA 5DD3L 4HWEH 3VW3L 3KPTA 1CLZL 3BAEL 1T1YA 4B9CA 2BCKA 3WBDA 2ODHA 4ZQKB 4MJ2A 5FOJA 4JFED 3KHQA 5I8KL 4F80A 2CNZA 2E0PA 3EGXA 1UA6H 3L3DA 4J4PA 4IGBA 1BV8A 4X8GA 1ACYL 5ICZA 2E47A 4AEIL 2WNWA 1DVFB 3MRQB 4KUCF 1DO6A 4YWGH 3GKWH 4HGMA 4HHAB 4YZFF 1YEWA 1D9KA 1OF0A 25C8L 4DT2A 5C7XH 3UTSA 2FQEA 5C3TA 3ZKQD 2WVVB 3M8OH 2NTFB 4H8PA 1IGCL 2VABB 3C6LD 4M61A 4N2AA 1IC5L 3HE6B 3RZCB 2BIHA 1VAHA 3CVHL 1IGTA 4NNPL 2ZCKL 3NIGB 5GZOC 2QPUA 3WN5C 2IGLA 3EADA 5F8RC 5I15L 5IMMB 2Z92A 4KH2A 2DW5A 3I85A 3QP3A 2JXMA 2FIRT 3GI8H 3KL0A 4XI5D 2YGNA 3WUWB 2YSSB 3QVAA 3X1EA 4EUPH 2DH2A 3MPCA 1MNUL 2NUTB 3O81A 4XGZA 4OIFA 1BJ1J 4RISL 1NGXA 1G9NC 1ZHLB 3TOPA 2WHVA 4OU3A 5JPMA 1XF3A 2O30A 5IKCA 1H8SA 4G2AA 4PJBB 3II3A 3P4LA 4IOIB 3MRRA 3IMWA 2AABH 1U3ZA 2WQ8A 3WN5A 1FP5A 2UVFA 3PIQA 1OP5H 4DKDC 1UOWA 3MU3A 1D5XA 2QFPA 1EUTA 1DQMH 4G7RB 5CSBA 4L3EA 3PWLB 4RGNB 2XJLA 1NSNL 1HX0A 1SMOA 1BD2A 2LU3A 2E9GA 3UZVB 4IU2B 4LAQL 1E50A 1D2OA 4IRZA 5E08H 1PLCA 1KCVL 1X5KA 4KAQL 4J3OC 3D2TA 3MLYL 4QAWA 3ULUC 4AEHH 2V33A 3IMRA 3EF7A 4WK0B 4KUZL 2N4IA 3ABMB 3OKEB 2YEVB 1ZTMA 1YYLH 3LPPA 3RGVD 3ZQWA 2WZPA 1KN2H 4QIRA 4PY7A 3L3OA 3DYPA 4YBQC 4HWUA 5T1LD 3DX6B 3GZOA 3VG0H 1B0GA 3IPFA 4A63A 2JIXD 1QSFB 2ZUWA 5FYJL 5LHDA 3Q2NA 4AM0B 3HI5L 3WFBH 1QFWL 4QRRD 5GQBA 4IBSA 4LLUB 3JTBA 1DBML 4OCLC 4TLKA 3ECQA 4NIKB 3KGSA 1QEWB 1NPJA 4UANA 1A7RL 1AS8A 2JCCF 4YHZH 2XG5B 3SDXF 2VMCA 5D6CA 3VTAA 1UEMA 2DBJA 1M6OB 5TJWK 4P2OB 3SZKC 4WW1A 3T4AC 3IXAA 2ATPB 1FYTE 2D2OA 3T77B 3FO2B 1KULA 1Z9OA 1QFWI 2FZ3A 2LAAA 4XC3H 1YC7A 5AG8A 3PPEA 2CGRH 5EEZA 3CCHA 3E3QE 1N3NA 3MKGA 4N90E 1JV2A 5J11B 4JFZH 3FB6B 3BSHA 4DOHE 2B08A 4L8SC 4CNIA 5E8DL 2DM4A 3FO9B 2WIIB 2NRDA 3D0AA 4XNMA 4JFFE 1KYAA 2Y2YA 1HESA 4X6BB 3OJDB 4PGZA 1U8QA 1J7VR 5D70H 1CLVA 2HJKA 2G75B 2C9QA 4E41D 1VLXA 3HS0A 5FLUA 4CDHA 3VYPA 1FCGA 2DDQL 3V0EA 3LDBC 2FEDD 4QTHA 3F6IA 2GT9B 2IGFL 3DHJA 4JM0A 4JX0A 2YMTA 4PV8B 1S2EA 4JVUA 1JHTB 3NJVA 2C9UA 2R1XA 3DV6B 1YEIH 1Z9PA 2ARWA 2OL3B 4Y4KB 1JPST 5BMFL 3QNXA 3ISRA 5ICYA 2PYEA 5IMLB 2D73A 4PRPE 4C56A 4IRZH 3QYCA 2UZYB 1AQDB 3D2UD 4BFBD 4NI6A 5KBMA 1EHAA 4NKQB 3S3DB 4J1UB 2QQQA 4TVPH 2NW3A 5HBBA 3MHZA 4O02L 3ZY7A 4U1GB 3P11H 1CK0L 1UJ3B 3N1QC 3O3EA 4DPCX 4X8XA 3QQ3A 2D2CC 5JTWA 1CPUA 1W16A 3BXNA 3CBRA 4YXLL 4ZUSA 5E2UH 3IFPA 2NY6B 2J12B 2C4XA 2FL5A 1AGDB 2A83A 3JWDC 2WWKT 4JRYB 3P02A 5BCAA 5JDJA 4QHUA 1XR8A 2GY7B 4BHUI 1J8RA 4KXAA 1I8KA 2V9RA 4EZLA 4BQ9A 3ZXAC 2KLSA 3F8UB 3FQWB 3IFNL 4J6RL 1XTLA 2ICCA 4HF5H 2BP0B 2VDKH 3MI6A 4WVRA 3TIEA 1FG2B 4NO3B 1XX9C 5I66B 5KVMC 4MNGA 2X4PB 1OAZL 3N50A 3S96B 2VZOA 4DVRL 1KDIA 2ICEC 5F89A 2YRPA 4RMWA 2RGSA 2ICEB 3INUL 5DRXA 2DQJL 3GSOB 4QR7A 4AQEA 5K39A 3QUGA 4KK6D 4XGZB 1VFAB 2PCXA 2Y7QA 3C9NA 4G7QB 4G8GD 4GI8A 4PM1A 1E4XI 3MLRL 3CU1A 4TL5A 3VWJC 4NZFA 3EYUL 1QZ1A 4U6XB 2DEWX 1NIEA 1EFXB 1LE9A 1DVFD 5E6UB 4WRLA 5FA3B 1P1ZA 4XOCA 4XNZC 3SGDI 3T1FA 2PWHA 3RGVC 5D1XA 3NJKA 5GXBB 4FI8A 1U8HA 3MRQA 5KW9H 4X7SH 3DVGB 4YAQA 5F71A 1JGEA 3MA9L 3QEHB 1RPQA 1G6VK 2NY1C 3ILPB 3N9GH 3L45A 4L0YA 2BP0A 1KC5L 4U1JB 3V4UH 4XNUL 2J88L 4B41A 1X5FA 3MOAL 3AG1B 2F53E 1I7ZB 3BZFA 4N2GA 3BWAB 3FQTA 4EXPX 2A4CA 5IB2B 4N87A 2HG0A 5JOPD 2WAQA 4Y5XB 3S6CA 2XSKA 4UINL 2JLLA 1TYEB 1DL7L 3NFPA 3S5ZA 2M8XA 4UM9A 4LLDA 4GY4A 2EDFA 1ZJAA 3ATDA 4P0DA 5KVFE 2B1AL 3MRNB 2MIZA 2NDFA 3DMMB 3D3VA 4YXKL 4Z7VB 2HSIA 3QBTB 5CZVL 1OT2A 1ZK5A 5ICXB 2IDCA 1QSVA 1O6SA 1PX3A 2R56H 5TK4A 3GHEH 4PJ8D 3O0RL 5IJKC 4JLRA 4NQVA 2DD8L 4U3SA 4N2FA 1E5BA 4YNYA 1PFOA 1JPSL 4WFFD 3K2KA 4Z7WF 5B1BB 2B4CL 2UZYA 3D33A 3X13B 4IU3B 3FFCA 2CBOA 3HC0A 5EN2B 1PAMA 1TKWB 2OXGA 4AVKA 4E41B 4RBPK 5CJ5A 1K4CA 1PU0A 3PWJA 4AIZB 4JANA 2BP8A 4D0CB 1RP9A 3LPFA 2QBWA 1BZEA 4POZC 4IRJB 1W72H 3ZK0A 4CGUB 1OE2A 3H7LA 2WSPA 3GJEA 1TJGL 1R5VB 5HJBA 4LE8A 3F12A 4N0YH 2WLMA 3ILEA 2HVKB 1IAIL 5LXVA 2VRAA 1A4BA 1NDMB 4U1KA 3SE9H 4L1BA 4CMHC 5KN5A 3A6CL 5E5MB 5IROC 4CC1A 5DQDH 2RACA 1IARB 3QJHA 3NCYP 4YDKL 4BFKA 3LV3B 3ULSB 1E8XA 4AGOA 2J6EA 3ROOB 4JM2F 4K73A 1QLRB 1V8HA 3D09A 1XGTB 3QIUC 4U0RC 5FA3A 5JHDE 4DKFH 4F15B 3VD2A 2DJ4A 1KYFA 3KMDA 2EDWA 1G7LB 4JY6B 4JJ5B 5AB9A 1MFBL 3QULA 3MLYH 3MRGB 5IZ7A 4X8JB 2KERA 3JWOL 3IKCB 2V3FA 3V4VH 4FQJL 3KH4A 4K3DL 5BVPH 3QO0B 3I3EA 3T1WA 1JZ6A 1FVDA 4NNXA 5IR1B 3EO1A 1I3VA 3KXFD 1XTMA 1QR4A 1TNNA 1RZ8B 3BQUB 4LCCB 4WEUD 4UQIM 4D2NA 3N43B 4EN3B 2EE9A 5HHVH 5I8CA 1UWGL 3QUMH 3RWCB 3K72B 1BQLH 1AP2B 4E42A 2D31B 4EIBA 1G1OA 4WIQA 5DEGB 3CMOH 3KL5A 4DN3L 3SKUD 3ZIMA 3C8HA 5C2BH 4KMTL 1FCCA 1IEHA 1TTRA 1NCNA 2VDRL 4FXGB 2ZXDA 5KS9A 2EE2A 5GS0H 4WI2A 4CN1A 1IZJA 3QDMA 2C5DC 4I77H 4RGND 3FB5B 3UGEA 1JDCA 2CLZA 1E4KC 4YDKH 3RAJH 5IT2L 3LKNA 3A6CH 1KTDA 3HI1B 2EDQA 2IWKA 2VERA 4EAEA 3VXPA 1OARL 3VFRB 1DZ0A 5DRWB 1HKFA 4WHYH 2V5YA 1JWSA 2PYEB 2YBRA 5EHFA 3IU3B 5CD5C 1SDAB 4H5SA 1KENH 3BEVA 2NLJA 4HOZA 1AQDA 2BJML 2X28A 1DSFL 2ZOUA 1V3KA 3CLFL 3VD9A 2H6OA 1P5VA 3O9WA 1HE7A 3BKCH 2NY3D 4C56D 2FT8A 3LX9A 2X4RB 1JVOA 3VVWA 3OWRA 1FVCB 4QRRB 3BI9X 5LXGL 2HTKD 4XBPB 4JKKA 1CR9H 4ODSH 6CGTA 5DJ8B 4LSUH 4OZIA 5AAMC 4P5MA 1S9WB 1JGIA 2EDMA 4PGDA 1EEZB 3M7FB 4XVUC 3MGTA 1LEKA 1MNNA 2C1OB 3GSNL 3W39B 1BQKA 4PJFE 5FYKH 2Y7NA 4YHIA 5FUCC 4EN3C 1I85C 4Z7NB 4IS6B 3B7TA 3MRHA 4MBRA 4XB7A 4B9JA 3HW7A 1PMYA 4DFIA 4RRPM 1KGWA 2BIPA 2ZX7A 5E1AB 1H8NA 4QTIH 1HS6A 1OCCB 2WINB 4F37K 1RSYA 2ZXWB 3LKSA 1VGEL 2RMNA 1XZ0B 4X4MA 5EOCL 3MRKB 1U2YA 4I2XA 5JIKA 1MCFA 2I60H 2ITDA 3A4FA 4JHAL 2J73A 3VXNB 2GI7A 1BREA 5DQJA 2A9NL 5ILTL 4AUUA 1F2QA 4IJTA 2X1WL 3NN8B 3WTWA 4XAWH 4JFQB 4YR6B 4G6AC 1JGUH 3CC1A 5KWYC 4M5YH 3C5JB 1IQWL 1I7UB 4P2RB 2X2YA 4JM4H 3TBCA 4UT7L 1YCSA 1FYTB 2FJGB 1RJYA 1MCKA 3B3IA 5I8EB 4Z7NE 3DUUB 2ZX8A 4PLKD 2AEIT 3ULVE 3NSFA 4I1RA 3W39A 2Y6SC 4ANKA 4F2MA 5IROD 2UUDH 4X5QA 4G8AC 3V5DA 4HS6B 1DVZA 4Z7UF 2ZYSA 3QI9C 1BQHA 1N4XH 3ZHFA 4DGUA 4HWBH 5DFVC 3VX1A 2Y06H 1SDDB 2PCYA 1AZZC 1X9RA 3QA3A 3PRZA 1FHNA 2MNJB 2NX5A 4HEMA 3RDTD 3T71A 3EJYD 2GHWB 5SV4A 1S9VA 4GRLC 5ANMA 7CGTA 1FAKT 1QR1A 1G7MA 4FG4A 1Y6MR 4OBRA 3C60D 3A6OA 1JVLA 2QADC 3SDCC 1BVLB 1TO4A 3STLB 1H3WM 4IOSA 3ZL4H 4TQPA 4ONOA 2B1HH 3UYOD 4MMXC 5BV7L 3D1MC 3EH1A 3NRFA 5IKCB 2E6JA 3O41B 2AQSA 3OKKA 1S7RA 1JK8A 4FD0A 3ZDZE 5GS1B 1F3DH 1K6QH 1RZQA 4LCWD 3HE7C 2H6UA 4AI7A 2FJGA 1NGPH 2ZCHH 1D6VL 3I6SA 3BSZA 3TPUA 4GSDH 4L8BA 3L81A 1S8DB 1KIUA 4PJIE 4WU5B 1YNLH 1L7TL 2Y1ZA 4BZYA 4XXDB 3FUNA 2ZUQC 4ZDHA 4XMUA 3DMMA 4ICXA 4O02H 4TS6A 2BZ7A 2MCPL 3T6WA 5IEKA 4HIEB 4U1NB 3ZTCC 1DBJL 4L8SA 3QJFB 5EEYA 5HHNA 4WNQB 3EOBB 3FT0A 3ROLB 4G8GB 4EN3A 3EJZD 4ELMB 1E8WA 4LU5L 3EYQD 4GRWF 1ZSHA 4WW2A 2WB7A 3VFWB 1ETZA 3LVEA 1DVFA 1NAML 1KBGH 1BFVH 5EZLA 5CD5D 1RU9L 2V7HB 3HTLX 4HBCH 1PD0A 4LXFA 3SD5A 3TZVC 4AMKL 1X5HA 2IGFH 2WQSA 4XNZB 4Y4FD 2FGWL 2ZKWA 1LHZA 4HW6A 1PLGL 5FYJE 5L4IA 4YGVB 4IRJA 3EG9B 4JFHE 5AFAA 4OUUA 1I8MA 4XCCH 4N3UA 4ZUUB 4JFOB 3X12A 3UYPA 2QDWA 3S8WA 4C58B 4AJYV 3ARRA 2OQJB 4ANUA 3U2JA 1T1WA 3D34A 2HAZA 2LVCA 3BD3A 1UENA 2J8OA 2Z0BA 2VNCA 4PJDA 3TO4A 5CJXA 2PWDA 3PJNA 5EMYA 4JRLA 4JZNB 3S3SA 2ESVB 3QNFA 4G9DA 3JV5A 1MZZA 2AV1A 1P2CB 5GS0D 1N26A 3UTTA 2Z7WA 2E5EA 4EN3D 1PZBA 4UIKL 1JTTA 1AO7D 1LEGA 1MHPL 2AJXH 3FO0H 1QSFE 2R4SL 3O6FB 5IHUH 1FO0L 5DSCB 3T65A 1AHMA 4RNRA 4J3SA 3TA4D 3EH5B 1N68A 4GBXA 1EMTL 4KI5E 4LIQH 4XMTA 3IE9A 5DD5H 2DKMA 5CEZL 1Z9LA 1IFHH 2VL4A 1XQ4A 4DNLA 3FQRB 4PRIE 4LPXA 2YD9A 2KZWA 4QTHB 1O7DE 4Q9BA 5PAZA 3TA3C 1EAPB 3IDXH 2GCYB 4P4KB 4EZJA 1EX0A 2Q3XA 5I6OA 4G7VL 4JHVA 1CFQA 1CFSB 1FV1B 2DIEA 3PF2A 5FGCB 3ZQXA 5T3XH 4Z0BH 1S5IH 1SPDA 1SJVA 4R96A 4EI5A 1KIQB 2IDQA 1RZKC 1RIVH 2R59A 1F0LA 2IVFC 4L23A 1SJHA 1O6VA 4JJOA 4BH8B 1F8TL 4FI6A 4I88A 4ODUA 2IH8A 4V33A 2ZWSA 3BQVA 4PLKC 1RZJC 4J1UA 3KDMB 4NRXB 1NCBH 5G55A 2W0KA 2N7SA 4L1HA 3UL4A 4XAKD 3IJHB 3WYRA 4A6YA 3O11B 1NPNA 3BKYH 2ZP9A 2XJKA 1BPVA 3G08A 1Q90A 4JB9L 5CZXC 1U8CA 3NN8A 4YIQB 4W9LC 4TULH 1ZT7B 3ZYOA 4XXWA 4C4UA 3TV3L 5K9QI 2V5MA 4M6OL 3CJJA 4LSPH 3I3DA 4LQ1A 2PWFA 5DRZA 5C0ND 4JREB 4G1MB 5INCB 2UY7B 1IRAY 1JPEA 4MXWH 5CZRA 3MNZB 5L88H 5DJ6B 4RISH 4XPGH 2PTTB 3QORA 3HRZA 3TNMB 2JJWA 2FZ3B 1AO7A 4GYBA 3QB7C 1D5MB 4G6MH 5DVKA 2UVEA 3LHPH 5C09B 2VISB 4UOZA 5IQMA 4FQXA 1XIWA 2BSRB 1BZ7A 3MBWB 3KXFB 1HDMB 1ZHNA 3KLSA 3KYMB 1J12A 1V10A 3QO1A 4RFOH 3QQXA 4XBPA 3HC3L 3FYIB 4Z3TA 4FDWA 3RIKA 5D71H 3WS6A 1D7DA 5JHDD 3V7MA 3S4SG 3WFCH 3D7PA 3SDDD 2XG4A 1UADC 1F58H 4YO0A 1IT9H 3VJ6B 2AXJA 5JDSB 1AIFA 2FO8A 5CHNB 5I76A 3V0WL 1VADA 2ZKHH 3GSWB 1LDSA 3B5TA 3TESA 1MW2A 2V7NB 3UTSE 5C7XL 3WKNA 3T65B 1QBLL 3MCLH 4PTUB 5EFIA 3QHZH 5GGVH 4Z7QF 3US9A 1MFCH 5ICYB 3NSCA 5BNXD 2OX5A 2BNRA 4M3HA 4FLOA 3FN0H 5JW4M 4X4XB 3VXRA 1C7TA 5HYSA 1EFQA 1JV5B 5CBEA 3WEBA 4KKAC 1YLBB 4ZPVB 1WA2X 3DOSA 4NFDA 4DEPB 1QWHA 5DD3H 3VW3H 3TO4D 4XHQA 1CFSA 1U8KB 2Y9RT 5JMOC 1ZTXH 3Q9QA 1DYZA 5EU5A 1BJ8A 3V6FB 1JWUA 4N6QA 3FTZA 4F8PA 1QSEB 2VL5A 1MWAA 2IQAB 3UYRH 2NY2B 2GJ6D 3UTPE 5J12C 5LGHL 4Q2ZB 1F6AB 1SZNA 5H4ZA 1EO8L 3B7RL 3BESR 3K6IA 1OSPH 3EXJA 1BW8A 3UAAA 4N8CL 1CQKA 4FG6C 4K7PH 4DQOH 2XKUA 3HCVA 4PJIB 1PKQE 1SOSA 3IKCA 5KVEL 1VRSA 4F7PA 4H40A 2JELL 4N0UB 3CX5K 4K5LA 3NH7H 4K3EH 1R0AH 2EC9U 1U3HA 4LO9A 1ADQA 4B9ZA 3HN8A 3SGKA 4K4KA 2DL9A 3OKMB 4UYPA 5CEXB 4AQAA 2WYIA 1RK1B 4R8WH 3WL9A 5JHDA 3EHBC 1EO8H 4EDWH 5DLML 2WSDA 2YEQA 6PAZA 2ZUVA 2N59A 4M61B 4ZW6A 3OKLA 4TUJA 3GRWH 3B43A 3IN2A 4MWFA 4LAJH 2V17H 2XT1B 4JFFB 1XH2A 2VM9A 3GTVA 1GMEA 3CVBA 3O2VL 4WKZB 5TF1L 1GVIA 4LSVL 2W88A 1CF1A 4K55A 3ZRCC 5FKPB 1SHSA 2YPKA 3HG5A 4PYGA 3VB9A 4M6NH 1WAAF 5AVQB 3RPKA 4LOFA 4YN3A 1QYGL 3BGMA 4P2RD 5CILL 2A74B 4E9XA 1U8MA 2CIIA 3ZE0F 4B9IA 1PFCA 2AQ3A 3LMJH 4KK5C 2YRLA 1CURA 1MFCL 2YD2A 3HBQA 1TQSA 2Z91B 2D03H 4NKDB 3TA3B 3IXTA 3CUPA 5I73B 6FABH 3LZFL 1HJBC 1E6JL 2GBUA 3AABA 3H7BA 4R0LB 3DUSA 1P5VB 2DN7A 3O9WB 4WEBH 5K59E 4LFHG 3HBZA 1FNFA 4HKBA 3CHRA 3HZYB 1G87A 2ZSWB 3FUJA 5D1ZC 4DP1X 1TCRB 3MAWA 1C16A 3OL2A 4K07A 4C59B 4ODUB 4FADA 3P1VA 1KIRB 3X11B 4IHOB 4OQTH 2ESVA 1OK0A 1S7XA 4LSSL 1AXIB 1N59B 4G9FD 1JWMA 1T2QH 1RPKA 2AK1L 1BYNA 2X5PA 4MA3B 4HKZA 2Z93B 1KWGA 1MQKH 1YO4A 4BSVA 1Z3RA 4K94H 4UT9A 1UKTA 5AQ0A 4XTRC 4GQ9L 5DS8A 4R83A 3NPZB 4KXDA 1N2RB 3QEGL 1U3HC 3WG7B 2YC1B 3IAPA 1TENA 3ECBB 4QO1B 2MNUA 4RGOL 3UZVA 1AKPA 2NY0C 1ANUA 1BXXA 1JK9B 2QPEB 4OJFL 4X7TB 5CIPB 5BRQA 1DBKL 1JNNH 1A7NL 1GPOL 2G60H 4M6OH 3CNKA 2L7UA 1YEJL 4I3SH 4TQEH 3RI5K 4A2FA 4YEFA 1L9TA 1REIA 2PP7A 5HY9B 4GEJA 4OSUL 3F85A 3BKYL 1HXMB 4TQ8A 1BVNT 2JIXB 4KXZH 3X1NA 5JO5A 2A1WL 1BWMA 3ZHLA 1IBFA 3W1ZA 4IQHA 2HTKC 5HPOA 4HD5A 4AY0A 2DKSA 3KWWB 3CSPA 4G8IA 4NO2A 1QHOA 2EVJA 5E8NA 1RUMH 4AEFA 3BIKA 2OMTB 3QRGL 3B3IB 4N9GA 4YZFE 5I8EA 1F8TH 3OKOB 5E8OA 5EIIA 3U36A 3IPEA 3A6BL 5C0JB 1T66D 4OB5L 1NA8A 2F18A 2OJ1A 4F9PC 4Z0BL 2L0DA 2QQLH 4Y4FB 3GK8H 2EIMB 5E9NA 1P1VA 3MMEA 4UQ2B 5EIVA 5ALBL 1QLRA 4A39A 1M6OA 2CNYA 3CAFA 3MODL 1UD5A 4GAYB 1U9KA 2GQHA 3ME0A 4QRSA 2VC2B 3MR9B 2PR4H 3QPXL 4FG0A 4E5XA 1KXQE 4JR9H 1HAUA 2VDQL 2H26B 2IOOA 4LL1A 1JZ4A 2F74A 2DEXX 2J7LA 2R1YB 1AJ7L 4AENA 3FB7A 4AJ0A 9CGTA 1JZEA 4MNGE 3SJVA 2VMEA 3HVNA 1A6ZB 3B3BA 2HX9A 4WWKD 3MROB 5GGTH 3UJTL 5IF0A 1LDPL 5E4EC 5LG1A 3T8XA 2JSFA 1LNUA 2UUDK 3E9UA 3ZO9A 3CK0L 4FG2A 3AQXA 2QQLL 1J5IA 2F2HA 4Z3EA 1W0VA 2AFNA 4JG1H 1OAKL 4PRNB 3VXOB 4C47A 2YLKA 1XCWA 3IMUA 1IBGH 2E27L 3U0TB 4J3OH 4APQB 4P5SA 3NIGE 2NW3B 2YKLL 1NANI 1K5WA 4HS8H 5GIRA 3RWHB 3T2QA 5J56B 1MHCA 2D0HA 5TH2A 5DHYB 3OV6A 5C6TL 1ZJBA 3SE8H 1CG9A 5FUCE 2JCWA 4MZRA 4PWJA 4A04A 4UQEA 1CZ8H 2CJUL 3KS0J 4HJSA 3S3PA 1A65A 1A7NH 1QSFD 2D9QB 2X4OA 1PY0A 3COOA 3MDJA 1JWMB 4CBZA 5EEXA 1J9RA 4MD5B 1SJMA 3LH9A 4H26A 2O5YL 3DIFA 4NQQA 2BSTA 3NK4A 5E1HB 2CO2A 3GBDA 3N5AA 4OCNC 1KTLA 4MQ7A 3WAKA 5F7BA 3FOLA 1RHHB 2IANB 1ZIBA 1HTYA 3APMA 4RAUA 5JW4Q 1OP3H 3ZKMD 3H55A 1WIUA 5HHPB 3RBGA 3WMQA 2NTFA 3SDYL 3PP4L 1U8OA 5F7NC 1QWNA 4WUUD 5HJGA 1BLNB 2CO3A 1GZQB 1JZHA 2EIBA 1PD6A 3BFOA 2H0FA 3MLWL 4GPVA 4KJQC 3RY5A 6FABL 3IFLH 5HHQA 5A2JH 5JOEA 2YPLB 1TQVA 3HS8A 1WS7A 4MYPA 1KTJA 4XP1H 2B1HL 4OLZL 1JI2A 4PJAB 4AQAB 4TF4A 2AC0A 1NCDH 2DLTA 2VLRB 2GSMB 4R7DA 3DA0A 3HZ3A 4ODHL 5FC9A 2E8YA 5CSGA 4PBDA 2P8LA 4WWID 4XMLH 1K2DB 5EUKA 4Z76B 3CC5A 3MV9D 1MLCA 2WLYA 5E2JA 1TVBB 2Y4SA 4S2SA 1T0PB 5DUPH 4DK5A 2ZWLT 3NIFF 4FXTA 4U1HA 1VGKB 1RV6X 4BFFA 4N1HB 5B39G 2DQIL 1GS8A 2YQ3A 1IVLA 1I8KB 1SHXA 1NPUA 4XXCA 4ZODA 1YPZA 4BK5A 1USQA 2P1YA 4WU7A 3MXWH 3EOTH 3TN0B 2PO6D 4TYUA 1CFQB 3CZNA 4AITA 1XF4B 3LRGA 2YQBA 1FIGL 1T83C 2IXQB 4RFEA 5FW6A 5TD4A 1KLGA 3LDBB 4Z3FA 3BGAA 5E2TL 3GD1C 4I48B 1X7QA 1C7SA 1OSPL 2BP8B 2WQWA 1OSZB 5CKGA 3DO3A 2ZF8A 3EDDA 2AITA 1V3JA 1MPAH 3NCMA 4UZUA 3MYJA 2HFGL 4QTIL 3TASA 1KACB 1GY1A 2CPUA 5BRZB 1AQHA 1ZT7A 2OS7A 1AQMA 1HSAB 1GZHC 3ZE2F 5E03A 4MAYC 2AGJL 3K74B 3DX7A 4RZKA 5CLTA 4AUYA 3ZSTA 3BN9D 1JN6B 3HPLB 5FYKL 4DZBB 2DBLL 5AALA 1LE5A 4AQ1C 3T6QC 4P3DA 3LKPB 3N41B 2EDHA 3EJCA 2IH3B 5TE6L 5T8IA 2ICWI 5IFJB 5CLXA 3B9VA 1WAPA 1CFTB 2BVQB 5I1LA 2XLLA 2XN0A 3LNGA 4X9BA 2I32A 2XG4B 1SQMA 2VR3A 3ZKNC 2FHFA 3S37H 2FYVA 3SYQA 4KK6C 5FM5M 4FGMA 4XCEB 3SPJA 1J48A 5DF0A 1G7QB 3QJHB 1P69B 2OMYB 3DI2B 4PJGE 5TE7H 2NUPA 3MYZA 4YUEL 5CIPA 3FS9A 2O61B 4ZOAA 1U2CA 1MAKA 3ZDXB 3LZPA 1AMXA 1JG9A 3WNMA 3MUHL 3Q1SH 1SYSA 2PETA 4IRJC 2NY0B 4Q89A 2EDTA 3UP6A 3VXTB 5ICZB 3CX5J 3BFQG 1U33A 3DX4A 5KEZA 1G6RB 1QSEE 2NXYD 4JFEA 4X42A 1LE5B 1KZYA 4KVCL 4WI0A 2DMBA 1QLFB 3J2PA 5GS0L 1A7OL 1INQA 1INDH 4K3JL 3WXWL 3UERA 4HLEA 1WICA 1JPGA 4JFTA 1VZHA 2XZAH 3ILQD 5C0DB 4LLMB 4MCYB 2NQCA 4YDZA 3QJQB 1AZBA 1DR9A 1KCSH 3CQFA 4M8RA 4QRUB 4PJEA 2HRPH 1YVLA 3W2DH 2J2ZA 5GJSL 4L3AA 2XRAH 4NCC1 5I9QB 4LNRB 5T1MB 5GJSH 3UDWC 2O5XL 1W0VB 3VXOA 1QHQA 2A83B 4U1LA 4A37A 2VITB 4URTB 2VWEE 3QEHA 4YK4B 2DWXA 4HK0B 1CICC 5ABZA 1XXFC 1ZLWH 5F9JB 5M95B 8PAZA 2ZSVA 4W4OC 1ZHKA 1BA9A 3CZUB 1CBVH 5A3IC 5EOTB 3LHAA 1INDL 4TTDD 2YK1H 1D5ZB 2OJZH 5K93A 4I0PC 2X09A 1CD0A 2K7PA 3LY6A 3N85L 4N28A 4F92B 5E9DE 4FXKA 4YSSA 5I1DB 4XCNA 1M9WA 3ZE1B 3RFRA 1P4BL 4OIIH 4PGCA 1CS6A 2HTLC 2YPKB 1A4AA 1HT6A 3IJ7A 4NZUH 5AWNL 3W37A 3VXMA 3M86A 4JM2B 5D7IB 2NY5L 1OGSA 3MVSA 4HC1A 3STBA 2KS0A 1O9VA 4BK4A 4EEEA 3H56A 3U2SA 4AL8L 3WTXA 2EIZB 4Z9KB 1B4LA 4G80A 5KVGL 1QRKA 1ZMYA 1KFAL 1MI5E 5MEOA 2WY3B 5KSUA 4PD4K 2WJ7A 4FQ1L 3PL6C 3G08B 1T20A 5T1LB 2DMKA 2FB4H 4UIKH 4P3DB 5I16A 3B2VL 3U9PH 3BGMB 1WEJL 1GC1C 2JKWA 1NL0H 1U8LA 3EAKA 5DA0B 1A1NB 4MJIB 4IMLA 4O02B 1UOLA 4YHIB 3H9HA 1ZANL 1WT5C 2BHZA 4YHLL 5IMKB 3IDGA 4Q0XH 3TBBA 4PJ5E 4F7PB 3P3TA 4KVNH 2X89A 5D5MB 2B9AA 1OAYH 5CCJA 5TE6H 3FMGL 3BAYA 4PJAF 5K9KA 1HCFX 2VM4A 4N1EA 3ATFA 1ERNA 5JPNA 2OTWB 1KIPB 4NQSB 2NNRA 2JCCE 1GOGA 2NY4B 1PLGH 2X41A 3TEXA 1HIML 2MOVA 3G6JF 4E41E 2AJSH 1YQVL 3DJ9A 4W9ZA 1MIMH 4LEXL 5ADOL 4K7PY 2K9FB 4FQIH 5DZVA 1ECZA 5B1AB 5TQ2H 4DERA 4O9HL 4X80H 3EGSA 4OJCA 4BKSC 4XPFL 5F9OH 2FATH 5IP4A 3HUJE 5D1QE 1QA9A 5AW1B 1SGKA 3ZKND 2V7NA 3H9YA 2ED8A 3RWDA 4Z7VE 1DCLA 3V7AE 1WUZA 1EHXA 4MAYB 5CJBA 2VYRE 5I1JL 3VRJA 4UI2A 2JQZA 4GT0A 1BDYA 1JHTA 3R1GL 1WA0X 2O26U 3NIDF 3RHWK 1FGNL 3F5WB 5F1IB 1U42A 5F7LB 4A6YL 1YNLL 3O41A 4WUUA 4PJ7E 1UGNA 3IXTB 4B5EA 5L9DL 3PG2A 3AC0A 4HD9A 4HEPA 1I3GL 1VB9A 2H32A 3WGUB 2GITA 3C60B 2YO3A 3RGBA 3WJMA 3NEOA 5DLLA 1IGML 1KY7A 2Y7SA 4LLAA 4U3HA 3UPCA 3VD1A 1M2VA 4J28A 1HKLH 2W07A 4IIZA 3GBEA 4J39A 5BO0D 5BRZE 5DUPL 3ZL2A 4AXWA 2HYMA 2W0LA 2X2JA 4G8EA 4LCWB 4IKLA 1T2XA 3CDFA 2AV7B 1RZFL 2Q7NA 5CCKL 2DM2A 3UZQB 3GWJA 3HNSH 5C0IA 3AS2A 4OFVA 5A16A 2V5SA 4KFMA 4WEMB 5KSUB 1NCDL 4KQ4L 2NY6D 3FU7B 4PJ9A 3FPXA 4MD4B 3QIBC 5AL0A 4OLZH 1F1DA 1QEWA 4YX2H 5A43C 1E65A 5DJCB 3CFUA 2ZG2A 4KNTA 3TNNA 5FO8B 1DQIA 3CFJB 4IKIA 3BEWB 1T6WA 2NLJB 3SDXE 4GW5B 4MJ5A 4Z8FH 1I3GH 1KXQA 3ZMEA 1N5YH 1IAIM 4PFEA 2NNFA 4WI5A 1P4UA 1I7RA 5D93C 3TFBA 1D7CA 4ZPTB 3ARDC 4PB9H 4M5YL 5ECJE 4WHTB 3VFSA 3RPIA 5GJTH 4X4YA 2Q7AA 2CHXA 5I1HL 2PXYC 2K45A 3CFCL 1B90A 5F93C 2J5LB 4H20H 4PWKA 4OJDH 2FCBA 3U0TA 4APQA 4FL4C 3ZDZB 2AV7A 2G3ZA 2V5TA 3VXQA 2FSEB 4NRZA 2WBJA 1TZIA 5LLIC 4KY2A 3QH3A 1YMMD 2KC0A 4TPRL 1I8UA 2Y1YA 1K4CB 4XCFL 1BFOB 2CU9A 2CKBH 4ZX5A 3ZSSA 1TSRA 4FQIL 1NCIA 3S35H 1IM9D 2LGNA 1GYCA 4XP6H 4MD5A 2IAND 2OR9L 3S88L 4I8DA 3NJFA 2K6YA 3DJZA 4MQSB 3WMSA 1HIMH 5C0AB 4A38A 1D2PA 4PJAE 3O3BA 4JANB 5E99H 4D0CA 4ZT1A 3AY4C 2AQ1A 2WZ0A 3BPLB 5BUPA 1X5XA 1TQBB 3GLEA 3L3GA 1GMIA 2AQPA 3EGSB 3LIUA 1C5DA 1UD2A 3QC6X 3W9EA 4BFIB 4HS8L 2YZ1A 4LLDB 3NFNB 2YSSA 1S7XB 3QJTB 3TJHD 5LXGH 1SBSL 2QFRA 1T1ZB 4F7MA 4D9LH 2EIZA 4QRFA 3S9DB 1RFDH 4OKVB 3TEUA 1ZHLA 4JKPL 4AWJC 3SGDH 4ZQTA 3VRIA 3TBTB 3T8VA 3V55A 1N18A 2EEDA 5EU6B 2WYZA 5TGBB 4DWHA 3O2DL 3GIZH 1GYUA 3CZEA 5HD8C 5FB8B 3F7QA 5HHOB 4X9GA 4QLRA 3KBFA 3EKCA 3LD8B 4FMFA 2EKJA 3HMXH 4JFDA 1SYVA 1UH2A 1J9CT 3VFOB 4G83A 1SN5A 2HT4D 1N8ZA 3IWUA 3VI4B 3DBXB 1QBBA 1QVOB 4FMVA 1AJ7H 2BP5M 1EZLA 4K23L 1QTPA 2H3NB 1IE5A 2VT0A 2Z64C 3EOAB 1A1MB 5GRYA 1FORH 3K0YA 4M02A 5HYQB 3FL7A 2IOMA 4JY4A 3HBGA 3N85H 2IDFA 1KZQA 2C26A 4Y2LA 5SWSA 1TMQA 1G0YR 1HINH 2GIXA 1DJIA 1U41A 2OJZL 2Z1PA 1N8OE 3MLVH 2ZX6A 1NUNB 2H5UA 2IFFH 2CGYA 4AGMA 3BAWA 3QRLA 1A3RL 5EC1A 5CF3A 4CU7A 5EZIL 2XTSA 4JRXD 5DU7A 4S1RH 2L4OA 4MA7H 1VFMA 3P0VH 4H2CA 3T4YB 3HA0A 4M62H 1HXKA 5EO9A 4CVUA 5I0VA 4LDLB 4FQJH 2KQMA 3W2DL 3MNVB 3U9WA 2A2QT 4YC2C 1C5BH 4KKCD 1EWHA 2A6IA 5FAAA 3KWTA 2BPBA 1JWSB 1MCPL 1QACA 1MFBH 3DJSA 1DBKH 1JNNL 1TTFA 3NJHA 4LLQA 3ULVH 4W9FC 4AV0A 5GZOD 4NEHB 4GRLB 3FQTB 5IB2A 3CVDA 4ODTL 1HXMA 1NFKA 5IQNA 1E6OL 3NRQA 3SY6A 1S9VB 4PYHA 3OX8A 5JR1H 2DQTH 2MSPA 4QHKJ 3BQUD 2GTWB 4X7EC 3C5ZB 3DETD 3EUUA 4G71B 1OM3L 1CD9B 4MBOA 4V11A 1KDJA 1S9KC 2FT7A 4PY8I 1TVBA 4MJIE 4NC2B 1JK8B 4W9IC 1EGJH 2P45B 3OR6B 1AGCB 2E56A 4DP6X 1M1SA 1TFPA 1MVYA 4XBEL 1OIOA 3LRSA 1JHKH 5HYFA 3LNFA 3TO4B 5E70A 1QI4A 3E8UL 4CVXA 4KGJA 2HLAA 2WMPA 3E2HC 3FHEA 3ABLB 4GAFB 4XN8A 4HU8A 3JWNE 5IMLA 2OKMA 2APBA 3UMNA 4D7BA 1N19A 3VM7A 4AEIH 4JDVA 3OAWA 3T2NH 3LMJL 5ISZE 4X99A 4TQIA 3JUYA 5L2JA 1OTTC 4GG8A 4QOKA 2GUYA 1Y18A 1MXDA 2FJFB 3QXDA 4PU2A 3V0AC 3TEWA 2NOYA 1IL1A 3TJEL 2MMXA 1T0OA 7TAAA 1WFOA 4Y5XA 1A6PA 1S7UA 4WEEA 3US0A 4M4RB 3HZKA 3AW5A 5B3JF 1S5HB 4MMZB 4NWTH 2WW8A 4FFYA 2P5WA 1SM3H 5DD0L 2MHAB 1CU4L 2ZCZA 1JGDA 4P2RE 5JA8B 4LSQH 2NY4D 2JB6B 2J1XA 1F4WH 2DYPA 4F33A 3ELQA 2QVFB 4UM9D 3SGJC 3VI3F 5FF6A 3K5RA 4BE6A 1YMME 1BEYH 3QHFH 4GP4B 2XWDA 4R97C 1YPZE 3V4UL 3DLQR 3JYBA 3S37X 1TEGA 4Z6AT 1LMIA 1AQKL 1RPUA 1RJCA 4ZAKD 4AYID 4L37A 2YXMA 3C2SA 3OKLB 4TUJB 3VQMA 4Q9RH 5G4NA 3RVWC 2XQYK 4FQCL 4YHYB 4IS6A 2VLLA 2I07A 4DKEH 2F7PA 4UAOB 3GMMA 4FYTA 4KKBD 1TZHA 3EYQC 3G5XA 1F4XH 3KPRA 1OCRB 5CO1A 3VD0A 3FU7A 2K1MA 4JY5H 2PPDA 4ZS7L 1NKGA 3HAEA 4G3YL 4LESA 1LO0L 1FZOA 2VAAA 4AKOA 3D87B 3M17A 5CGYC 2VZ1A 4HWBA 1QX1A 3VA2C 5CU5A 2WXHA 1E4WH 1IGYB 1XR9A 2UZIH 3O8XA 2VMJA 1CTMA 4HLZG 4FRWA 4R9HA 1DQQB 1AD0B 4ODXA 2WBJB 1EAPA 1XSKA 4K3HA 4P4KA 4ODHH 1DUYB 2P7TA 5HDRA 2SEBB 5C09A 4S1QL 3A0OA 4KKAD 1H3PH 3BD5A 3CWGA 4RFNB 4GG6E 4IDJL 3GBMH 4AMWA 1V55B 1K72A 4KJYB 2EDNA 3QUYC 4Z7AA 4JS7A 4XN2A 2NXYB 3BXNB 4QDGA 3F7YB 1RUKH 4WHCA 3DXAB 4ZUWA 5DR5H 5GS0C 4DPRA 1FL6A 3MFFA 3RBSA 3C5ZC 4GEIA 2F19L 2ZE0A 2ZKHL 4HZLA 3KLKA 1U2HA 2P5PA 4GRWB 4CL7A 3RYMA 2NZ9D 2R2HA 2FNBA 4MJID 5TFSH 3BGFC 5AKRA 1T5KA 3QG6A 2FJFA 3QXDB 4GNKB 4NOFA 5C08E 2A9MH 4ZZFA 4U31A 1A6WL 3QUMA 3QWNA 4FG6D 3PDOB 3ZTNH 5FK9B 1MJ7L 1H3TA 4FTDA 1GGBH 4U0RB 3TBVB 3TYFA 4BKLA 2OQJA 3SPVA 4U3XA 1X5MA 4F1ZA 3KBHE 4OCSH 4YC2B 1U3JA 2WVVA 4JFFD 3HG1E 5C0JA 1I8MB 1BIHA 3LEYH 4JVWA 4ZFFB 3LKQB 5EOTA 1U8NA 3QORB 4UQ3B 3KYOA 1X4XA 5FF6B 3M7OA 4HMDA 5B7FA 4XNQA 3ZZ1A 1F11B 1DSWA 4FXKB 3KWWA 3PL6A 5ITBH 1J1OL 2BCMA 4UNVA 3GHBL 5A2LH 2Y22A 2P5WB 4M8QB 3FTGA 2XWRA 3VSQA 3ZR6A 1MCIA 4I13B 4BH7B 1TTAA 1T0NA 5D5MF 3RWGB 5CCHE 5CIPH 5HHNB 3BP4A 3O8XC 2EEAA 5C8JB 1F4AA 2YUWA 4R7LA 4DPAX 4QLWA 3AAZB 4ZBJA 2IADB 4Z77A 2X88A 1G7PB 3AWEA 4P57A 4HIPA 3WNKA 4CW1B 1IM9A 2HVBA 4G6KH 4JPVH 2WB1A 2IPUG 5D1QA 2R1YA 3B9EA 3G5WA 1MQ8A 4ILDA 3WHE1 4KOCA 3T4YA 1MCEA 1KIQA 4LLVA 2DWDA 4ENZA 1OGAB 1S78C 2C3HA 3BPNB 3RWHA 3HC4H 5AZUA 2VXTH 3ENEA 5E8EB 3LRMA 3L1OH 4FA8A 3SDAC 4QTFA 1BAWA 4K5PA 4QMEA 5ICXA 5BVJA 1U30A 4A55A 4NP9A 5E94A 2OMUB 4J6IA 1CVRA 1MWOA 4FNSA 5DVMA 2YIHA 4PRBB 4PJHA 3SGJA 1VEPA 1N0XL 1NTDA 3O6ML 3QIWA 2AQQA 2A6IB 2JKLA 4HKXA 2O61A 1M7DA 2WXLA 2Q5BA 4QXTA 2AJZB 3F62A 3WN6A 4WJ5A 4HFWB 2EIKB 4LLQB 5C0FA 3QDJA 2BY0A 3QRGH 1MREH 4OW6A 3QUZB 2HFFA 1RUML 1TVHB 4KAQH 3LKRA 1WBZB 2BSSB 3TO2B 1U8HB 3EDFA 5EG6C 4L9LA 2X3BA 2XIBA 3BH9A 1E27A 4S0HA 4QRQA 4WI4A 3GSUB 2COQA 4FULA 3SE3A 2WLLA 3MXVH 3VWKB 5D7IA 4HPOL 5DQJB 1GKOA 3VI3A 4KKQA 3V4PH 5T5NG 4WF7A 3O9WD 5BV7C 3REWA 5CJOH 1KBGL 3O3AB 2VAJA 4YPGB 5DEFA 2ZOLA 4TNEA 1YMMB 3V52L 1EEYA 3A4DA 4I9WD 5EIIG 5JO5B 1THCA 4KBPA 5CEYB 5AG9A 3AT9A 2R0ZL 1E9PA 2Q9OA 4K94L 5ISZB 2WWMD 4RA3A 1G7MB 5E8NB 4F7CA 2CDFA 1XEDA 4XNQB 4QF1B 5I15H 2XWXA 2UXVA 1FF5A 4I18C 2M26A 1NEUA 4UMGA 3TA3A 4K8RH 1R5WA 2J55A 3CZFA 2VXUL 4LKXB 4DCQA 1UM4L 12E8L 1KBPA 1UTDA 2TSAA 3UDWA 4PW4A 4GSDL 1IGFL 4AIZA 1IAOB 2Y6SD 3Q8FA 4F7MB 2DLEA 1E2ZA 5HYSB 5F89B 1FL5A 4KZEH 2F19H 4JHWL 5K9JH 3WXVH 4P5TC 1S7QB 3Q7JA 3TBSA 3IF1A 3UBGA 5AVYB 4PUBH 5DFVD 4JN1L 4IHOA 1S7RB 1ZGLA 1XMEB 4OKVA 1KYOK 4A2EA 1E30A 4NP4L 3GNML 5KG9B 4J3OD 1BQRA 4YPJA 4S1QH 4BSVB 5JXEC 4J3OF 4IBUA 4BHUA 1GKEA 2DQEH 1XF3B 2J44A 3C60C 3HLAB 4NN6B 1WFNA 3X2QB 2EXSA 4HULB 5IJKA 1L5GA 2HRLA 4XMZA 1C5CL 3FCUB 1DQLL 1JERA 2BZDA 4AV4A 5HDBF 2KI6A 5EULV 2K6WA 1A64A 5IROA 1SEQL 2WXGA 2DV6A 1PW3A 1FZMA 1XF2B 2P49B 3LZOA 4HDIA 1ZDQA 1ORSB 4XVTL 1RZ7L 1MCRA 4BCYA 3IMVA 5FM4A 1FPTH 4JY5L 4HSQA 4MJJA 1K8DB 3CCHB 4YHPB 1HZHH 2PW1B 3WS3A 3GGWB 5FR3A 1IGIL 1T4KA 3MJWA 1V7NH 1F3JA 1Q9WB 5BRZD 2HUEA 4PGEA 4ZFQA 3RIAF 1WWWX 2ENJA 5JIIA 4P48A 1T5XB 5E1QA 5FYLL 4QT5A 1MWAB 1S9WA 2IQAA 2KQNA 2VXQL 1JGLH 1EXHA 2KHAA 3ZYIA 2JE8A 1RIUH 1MI5B 1BYOA 3N0AA 3IJ9A 5F96H 1CCZA 4J4PD 3L2NA 3FN3A 5EOCH 4ZOEA 1JF5A 4KKZA 3I2CH 4LOEA 1RZ7H 3RFZC 1RI8A 3AGVA 2DYSB 4LARL 1VZIA 2EDYA 1KJ2L 3VRJB 4LSQL 4Y88A 5E1AA 3TWYA 4YBLC 1D6EA 4IJ3C 2LE9A 4LSRH 4OGAD 3MFFB 2VDLH 5E6IA 1A3ZA 4D3CH 2WIMA 5KUMA 1HILA 2AK4A 3FUEA 3SBQA 1RK1A 5JHDB 2VCOA 3TJEH 2AEPH 3A47A 1ZEAH 4MMYB 4OLVL 2VOTA 1QKZH 1X7SA 1U3HB 5JZ7D 4PIRF 2VDKB 3QYNA 4X7CC 1BLNA 2YN5A 1A3LL 1AZVA 3BZ5A 4I89A 4ZO7A 1MF2L 1QRNE 2NSXA 3B6SB 5HGDB 2C3VB 2FQGA 4JCMA 3K6SA 3V0HA 1QBLH 2AKRB 4JN1H 5E51A 2FLBT 4UQAA 4Y5YA 2VC2L 4H25B 3N42F 1RJZA 4MXVF 3CLFH 4GQQA 3G6JE 3V0WH 3DVIA 4EBQH 3MRMB 4Y4HA 5D1ZB 3FW6A 3FSZA 4LGRB 1F58L 2MQ0A 1KENL 3IN0A 3PNRB 5H94A 1UXWA 2XPYA 2JMRA 2V6HA 4TSCL 3NVQA 1PX4A 1TLMA 4MS8C 1NCTA 1BVZA 5DHVH 3CBJB 4Z7OF 3BVDB 2PW2A 4EIUA 1YDPA 4OFKA 1UGKA 3D30A 3TA3D 2HWZH 3OG6B 1UM6L 3LHPL 2LT9A 4BYHA 4PP1C 2I85A 4R7DB 4TTGA 4EDXB 5IJVB 4NB7A 3RU8L 5DTFA 5G4OA 2NCMA 3O2DA 4ANVA 4PP2A 2XHNA 2JFCA 3T9WA 4KV5E 3U36B 1DDTA 5GGTA 4MQXD 3RX5A 4W6XB 3VFNA 1T22A 4KROB 3CMOL 3KYNA 3TCLB 3QORD 1HDMA 1ZHNB 4KX7A 1YN6B 3GFUA 1RZPA 4GRLD 5F70A 3EYSL 4NUMA 4ES9A 4W70A 4RDQG 2B59A 4KUCD 4ISVB 2FX9L 4KTDL 5EU3A 1NQBA 3C2AH 4ATTA 1V7ML 3HNVL 3GLDA 1YYML 2YPLE 2PTTA 1B9KA 3U7WH 1M9SA 4WJG3 4J27A 2HKFL 2ZYIA 4BSWB 3D69B 1S7TB 1LO2H 3A5VA 4M48H 1I7TB 5ABDE 5I1DA 3SQBB 2M1KA 1N5AB 1XCTB 1BBJB 5I16B 2UWEF 1GRWA 3KDPB 4HUCA 1UJTA 1DLFH 3EYVB 3EFFA 3MV8A 2J1KA 3WENA 2LLLA 3B2UD 3R7RA 4OD2A 1FH5H 3ISYA 1S5IL 3L5XH 5L4FA 3PPSA 2JF1A 1LILA 3RWEB 4N86A 4HV8B 1N0XH 3LRLA 2E59A 4WUKL 5EORL 3LN9A 4UZSA 1JRHL 3H9ZA 2P46B 4O2EA 4M00A 4MA8H 4NX0A 1W6WA 5FYJD 2ODIA 4ELKB 4KI5F 2MH4A 3V7AG 3BH8A 2N0MA 1NJ9A 2YPVA 3DUHA 1IIIA 2CGZA 4HPYL 4AKPA 2AJ3B 2YFNA 3ZKMC 2UZXB 3B8YA 1W2KT 2XYCA 3LXUX 2WBJD 1T6VN 2PPFA 4X6DB 1TR7A 1AACA 3DPBB 3MRFA 3HHSB 2Q3AA 4P23C 5IHBA 5BOPA 3FO0L 5ADPL 5DZ9A 4HGKC 4KHXL 4NZTL 4PCTA 1Q9LB 4LP4A 4XMPH 4AG4L 1A9BB 3V6ZA 2Q8AH 3E6FA 5FV1L 1JYVA 1IEBB 4J12A 1QNZH 2ZXCA 5IVXE 1QBAA 3Q3GB 3PAUA 3SODB 4NZDA 4OLWH 4FQHA 3OB0H 4GH7B 3FT3A 4H25A 4FLRA 4AM0Q 4M43L 2CRZA 3VXUA 5T5FL 5ISZA 1PG7X 2B5IC 2YAOA 3GSRA 4L8CA 2VXVL 1E8YA 4UILH 2D3VA 4POZD 1I4FA 1JTPA 1Q9KA 1T03H 1XEUA 4LSTL 2D4DA 1CQYA 5DJDA 1FNEB 3FSAA 2W91A 2B1AH 2Z93A 3FU3A 2J21A 3MZGB 3PFQA 4UQ3A 5L2KA 5EEUA 2XZCL 3GUTA 4OQ1A 2Y25A 2CSPA 3AS1A 3KPSA 4UINH 1T7XA 3VGAB 3IM1A 3WL9B 3UTQA 3FAXA 3JT2A 5D5ME 1UD4A 4WFFE 2ZYRA 4I0PD 5DZJA 3BT2H 2IQ9L 4X5XA 3NZ8A 3HZVA 5ID0B 5IFJA 3FTGB 2C1PA 5A16B 2Y5EA 4PJAA 3N9GL 1XWVA 4NI3A 2HFEB 2ICWB 4M1DL 3PL6B 3RZWA 2R29A 2VRQA 3MJ7B 1FC2D 5GJTL 3VWKD 3FQXB 1ZT4A 1KXTA 1JF6A 4OY9A 2WINA 1XGYL 2FLMA 3MOBH 3W5MA 4Z8FL 2OMYA 1BLIA 1G1YA 2BY2A 3KPOA 1TZGH 4I18B 3GSQA 1S7TA 2XV0A 4QJ3B 5DZLA 5CBAA 4X6CB 1CO1A 2WOBA 1BYPA 2VDPB 4RAUB 2EVGA 1TLKA 3ZJAA 3QR1A 3KHOA 4J3BA 3X3FL 4LSDA 3RURA 3K2IA 1XB6A 3Q5TA 2FNWA 5HI5D 4YHOL 4H0HB 4KQ4H 3APNA 4NZRL 3TPUB 5D6CB 3GXUB 1J8SA 4L0ZA 3SPGA 1EA9C 4OKDA 1RZFH 1FHGA 1NM9A 4WUUB 3TVMA 3VU2A 4QRAA 4ZDHB 3DJTA 5LBSA 5I75C 1KFGA 3QZOA 4RETB 1QFPA 4K71C 4GS7B 4L1SA 3X3FH 3PWNA 4HWBL 4NIYE 5LCVH 2NT0A 4ONHB 3QGVA 4QJ5B 5DRNB 3NIFE 3ABKB 3OJMB 4GMTL 4MMYA 3BKML 3K4ZA 1MHEA 4RMBA 4HEPG 3AB0B 2Z0UA 4NO3A 5AD0A 5HJDA 3FT3B 4OFQA 5DD6A 4Z1PA 4G8EB 4X6DF 5E2UL 3GIVB 2OTWA 2ZZUT 4JM4L 1L9RA 4GKSA 4MB5A 2BRRH 3T2LA 3EH3B 5KOVC 2BY1A 4PJXE 2JKNA 5JA9A 1QP1A 2QTVA 4Z23A 1M1XB 3KAAA 2A9NH 5ILTH 4TVPL 1IO4C 5F6HI 4P2QB 4JHAH 4PJEF 4RVBA 2CR3A 5I19H 4W9HC 2AXGB 5IW6A 2IQ9H 1BEYL 2Y36H 2QR0B 2K4WA 4YQXL 4MYWB 1GXEA 1HHGA 3MV7D 3KE0A 2NY0D 4XN9A 3B6SA 5D7JC 3WDIA 4MDJB 5E9DA 5DWPA 4XNYH 2FWOA 5D1XC 2O6CA 4HH9A 4P23D 2KKQA 1SM3L 1CDBA 1LO5B 3VXME 2DRUA 4CGTA 3CSTA 4ZX3A 2ARJA 3BDYL 4CDGC 3D12B 4PGBA 4ZRGA 1R46A 1PZ3A 3HS9A 2OTUB 2Z31C 4ZMVA 1K3IA 1WE5A 43CAB 2JNZA 4Z3IA 2R8SH 1WV7T 1I1CA 3GSXB 2DL2A 4MQ7B 3UO1H 3O6KH 2YD6A 3TFKD 2O5ZL 5DJZB 3TC9A 2I9TA 3AU1B 3SKNB 1F90L 3LN5A 3T0AA 2CJSA 4XNAA 1QEXA 1FZKA 1BX2B 1YNKH 2XWTB 4AK1A 3MNWB 2WLKA 4CSPA 3GO1H 2DMHA 1TITA 3L9YA 4WDIB 3GC3A 1LVEA 1L9OA 4LCWA 4OCXL 3L3JB 4YDMA 4JN2A 1RZKL 3I75A 1EO7A 1JHKL 5IW6B 1H5BA 4AG4H 4S1SH 1KTCA 2FB4L 1ZVHA 5L7XH 4FE9A 1OAQL 3EO0B 3QJOA 4Z7UB 3SD2A 2HFTA 1KEGL 1PG7W 1MZYA 1NBCA 4PHXA 1BD2E 4HCFA 3ARDD 1WP6A 3V95A 5GS1C 1MY7A 1IUZA 1D7BA 5E00A 4FXKC 4DZ8A 3BVXA 1TKWA 1WD9A 3B9KA 3NIGF 3OB8A 1ZVNA 4W9KC 1DLHA 4C54A 3VFGL 5EEVA 1L9SA 4ZMAT 5TPWH 1QFWH 3SHSA 3G6AB 2P5ED 1QPPA 3WFBL 4F57L 2NYYD 3LEXB 4KTEL 5ACZA 4GRMA 1O6TA 3U4BL 2XN9E 3CSYA 1VCAA 2UY6B 4X6DE 4O51B 4V1DA 4PMFA 3L5XL 4ACTA 5TF0A 4MZIA 5AVXB 1CT8B 3PAYA 4R2GC 3AROA 1FNLA 4MD0B 4QCIB 3I6GA 3BE1H 3NDZE 4X6FB 3EJUA 5GZOA 4NQUA 2F5AH 3VRLE 2K7QA 2X4OB 3VI4E 5EB9A 2EE3A 3NUKA 2BVYA 1UWGH 4BBWA 4WCYH 3PGFL 4OLYL 1W6LA 2PCFA 3OM3B 4HUMB 4UT9H 2EIEA 3PV6A 5C09D 4FQ2L 1EDHA 3GDBA 3T3MB 2LTQB 3QIBA 1JF1A 1Y1DA 3ES6A 3HNVH 4WWKA 3JWOH 5BXFB 2ZG3A 3LSOB 1IBHA 2NW2A 5BOZG 4JY4B 4KTDH 4OGXL 4PRID 2GJPA 3KXFA 3SKMA 1MOEA 3AG3B 1S7SB 4AZ8B 1YYCA 2Z92B 1LNUB 1YEKL 1YPZF 1TQBC 2EEXA 4NAMA 5I5RA 1IE4A 4FCAA 4M9OA 3X14A 2H2PC 4IMLB 3BWZA 3GSQB 3W81A 1ICTA 4WFHE 4DP0X 3FF8A 2CCLA 2FO4A 4FFWD 1FORL 1Y18B 4X6CF 3ESMA 3WKMH 5L8KB 4YLBA 3ZDYF 1RUPH 2PNDA 1F18A 4QRRE 1IZKA 2ZUSA 4NPYA 4O2CA 4XPTL 2QGDA 2R69H 3Q1SL 4OBSA 5D96B 2BERA 2PLTA 5KSAD 3TH3T 3SQOH 4BSJA 1EFXA 3EDEA 3IB4A 5C0CB 3NCXA 3OJVC 1J0IA 4RRPG 4TUKH 3NABH 5EU7E 3WJLA 2IH3A 4H8QA 5I2IA 1XCXA 1JGVH 2EZ0C 2YA0A 3L5WA 2X6VA 1WS8A 5DHMC 1MLBA 2UWEE 2W59A 3GSOA 4KNUA 1MCBA 2YRBA 4IM8A 1KGCD 4UIMA 1FE8H 5TDPB 4L8BB 1DQDH 3SBPA 1KB5A 3BYYA 5ERWB 3ETBJ 3SBWC 2VGLM 2ADGA 4HS3B 2BW4A 4HA1A 3TV3H 5HYQA 1A3LH 4P04A 4ZX6A 3UROR 4N26A 3IFPB 5H35A 2DD8H 1ADQH 4P05A 5KBLA 1UQSB 4X6EB 5DI8B 5E99L 1CLZH 3BAEH 1R3JA 2Y1AA 3PE9A 1X4ZA 2G3MA 3CXHK 4HUKB 3TPKA 5K59F 4J8QA 1A9EA 1M05B 4D3CL 4D94A 2XVLA 1X6LA 4A7GA 3QK0A 1AFVH 2KPNA 4DP7X 2P5WD 2EIDA 5A7EA 2VM3A 4HXBL 4Z7OB 3QG7H 1ROWA 4PRPD 3EYFA 5IESL 4FJZA 1TOXA 5CSZB 3WNLA 2EDJA 5HDLA 1WAAE 4MWFB 2WKOA 4TSBH 5BRZA 3NP3A 4K9EH 3IDNB 2VDNL 1LD9B 1WBYB 3MRJA 5I1HH 4LDOB 2VN5A 2YD7A 5FKPA 4EQ3A 2EEBA