4W9HC

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9hC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9hC01
1VCBC 5LLIC 3ZTCC 4BKSC 1LQBC 3ZRFC 4W9EC 4W9HC 3ZRCC 4W9KC 4W9GC 3ZTDC 4W9LC 4BKTC 4B95C 4WQOA 4W9JC 4AWJC 4AJYV 1LM8V 4B9KC 4W9CC 4W9FC 4W9IC 3ZUNC 4W9DC
chains in the Genus database with same CATH superfamily
3W9DA 2FHFA 4FQLH 4YAQB 3V8CA 5JOPE 4K3EL 1ZK5A 1EHKB 3VXSD 4DETA 2P5WD 3RAJL 5EWIL 4HXAL 3EYFA 1P7QA 1RUAH 3N44F 1UD3A 1IAOB 4GFXA 3V4LA 3R4RA 1KACB 3QUXC 2GC7C 1SLXA 2YPKA 2Z1KA 3KH4A 3GDBA 4WUUD 3U48A 1F42A 1KYAA 2Y23A 1BQKA 1VA9A 3QAZC 4JQXC 4D7BA 4EUPA 1M1SA 3LVEA 1RFDH 4OGYH 1U3NA 5DR5L 1CI5A 4ODWB 4NQCE 3OWEA 5BQ7B 2BK8A 2R4RH 1U8HB 2ESVB 2P7TB 3IDNA 3S8FB 2XICA 3PL6D 1INDL 1QI3A 5DTFB 5E6RB 1KGXA 2G3XA 4POYA 1D5XA 2VW4A 2Y6TE 4DKTA 5TE7H 1PGRB 3D3VE 3B2UC 1J1PH 4Z3JA 5HJDA 3REVB 1H15A 1I7UA 3MV9B 4HALA 4HU8A 1J5OH 2MTPA 2AXFB 5ICXA 2OSWA 2CIKB 2W1NA 3PJSA 2HTLC 2BS71 4HPOL 2Q86B 3ULUL 2VLJD 2FJHB 5JR1L 1KJ3H 4GO9A 4AIOA 3GUFA 4H88L 1UZ6F 4AENA 2PXYC 2FTAA 3Q9QA 3VRIB 4QAMB 4IEFA 4QDGA 2C9VA 2DAVA 1WBXA 1BBDL 3PFQA 4Y2DC 3RPIB 3NCJH 3HAEH 1TPXB 2I69A 2ZICA 4DPBX 2C3GA 4ZDHB 4IS6B 5DD5H 5DWPA 2HFFB 1R5WB 1U92B 1TQSA 4NX0A 4XVSL 5EO0A 3TP4A 2P4AB 4B9KC 3SSGA 5BV7C 1FYHB 3ZMRA 2F7RA 4QRRA 1GGBL 4AEIH 1MFBH 5AW4B 2PETA 1U8JA 3LS5L 5DZOA 2FO8A 3HB3B 4EN3B 5K59F 3D0VB 2LABA 1DEEA 1DJYA 4ZODA 4Y4KD 3HRZA 4G80A 1RERA 4G6ML 3T1WA 4NQQA 2ID5A 4QGYA 2IG2H 3DO3A 3QXDB 3CX2A 3DTUB 4JZJA 3VI3A 4BSWB 4KTYA 1FGNH 5FX3A 4JZNB 4M48H 2XWRA 4P05A 5D6CB 4F2FA 5KYYB 2VDKB 5CD3A 3T09A 3ZXAC 2QPSA 5GS1C 3SJVB 3SYOA 3O81A 3OV6A 1XSJA 3QT2A 4G6AC 5PCYA 1QFUL 2ATPA 1T04A 3D2UD 4PEEA 2Q87A 1FG9C 5JW4R 3CZLA 3L4WA 1FVDA 1KBPA 3QJFB 2P47B 1GOGA 3IMRA 4AEFA 2EEDA 2A5UA 4QHNA 5EO9B 1C8PA 1O9VA 1NCTA 4RIRA 2X70A 1UQSB 1KDIA 2BNQD 1JRHH 4JPWL 2HRGA 3SO3C 5JNYA 5MP6L 3Q8CA 5IFJB 4OM0H 4X83A 2LW3A 1WIPA 1XTLA 2EACA 2WO3B 3MJ9L 1OEZW 5I1DB 4M3JA 3LZOA 4HIXH 2IBBA 4B95C 3GMPA 1I9JH 5CD5D 2MKWA 5EZOH 1A5FL 3FQRB 3VXUE 1UA6H 4YNYA 2M26A 4FL4B 3TBWB 1N6UA 5KSUA 4S10A 4C55A 4JB9H 3QR0A 2CK0H 1BVLB 4GXVL 3CHSA 1FAKT 2YA2A 2WCGA 5JUEL 5C07A 3RA7L 3GMOB 4FN0A 2XG5A 4KKQA 4AV5A 2NW2A 5ESAB 1IBGH 2ISDA 3S2AA 2P5EB 1GH7A 5AVQB 3T0BA 4BBWA 2PWFA 2PW1A 2AJZA 2EAEA 2D2OA 3NGBB 1JXJA 3RE0A 4W68A 2JJUA 1NGXA 3QQ4A 4FTVA 4MS8D 4QCIA 4AQ8A 2FB4L 3TGXA 5HYJB 2EDXA 3LH2L 1QFWL 5AAPA 3ZRCC 3ESUF 5JOEA 3WU1A 4R4BB 1P7HL 4JGMA 4G70B 1EMTH 2G75B 4LPTA 3EHBD 4OLUH 1SBBA 4Q6IC 3LKNB 1HNYA 1KJMB 5IHHA 1UD2A 5D7LB 3CZFB 3TOPA 3BXNA 4N9GA 2R69A 4G8EA 1EO5A 4V2BA 1KPRB 1MAML 2FO4B 3QDJB 3D6GA 4FQXB 4BE5A 2GCYA 4RGNC 4JRXA 5TK4A 3EG9A 5HHQB 3DXAA 3DPBA 3HN5A 3PCYA 1FP5A 2XKNA 1G6RA 3QR2A 2EO7A 2RQEA 4AKQA 4RAVB 5ECJE 4HWUA 5K9QI 5ADPH 2X2UA 5JIDA 1TJIL 3AS0A 2FATH 1AANA 4HIEA 4JFZL 2D0FA 1ZHBB 1VADB 2DQ6A 1AH1A 3D1MC 3H3BC 1AHWC 5DMIL 2LLNA 3FN0L 2ALWA 4Z7WF 3FUMA 5DO2C 4V1DD 2YPLE 4U1GC 1HYSC 2QQKH 1MEXH 4ZUUB 2DQIL 3TJPA 3ZE0F 3L5WB 1UKTA 3MO1A 5AWNL 2GQHA 5DQ9B 4EI6B 2C4FT 5CEZH 3ATBA 4UBDD 3MXVH 3HLAB 5DFAA 2DZEA 1A6VH 2WUCH 2NY6D 1IO4C 4G7RB 1HOEA 4IBSA 4PJIA 3BKMH 1BMGA 3CSYA 1MCHA 1JWMB 2VMFA 4PJAB 5KVDL 3EH1A 2YC1B 3D48R 4ZI8A 2R69H 4L8BB 4IHOA 4M5YL 5AVTB 3S3JA 4OI7A 2GJPA 1W8EA 2JKLA 1BD2A 4QNPE 2XV6B 1I7ZB 1JPGA 3B8SA 3VM5A 1ZEAH 3DX8B 4GQRA 3VFOB 4XCEA 1VLXA 4JR9H 5KYXB 1G6RH 2FCBA 1H3WM 3UFIA 4P23A 4HEPA 3T65B 1IKOP 3W56A 3BYTA 3APDA 2VLME 3C5ZA 4YXKL 1WF5A 1DZ0A 1T2QL 2EVIA 2B2XH 4YDJB 5D7EA 2NR6C 4G11A 4NRYB 4XMVA 5EU3A 3WAJA 1TQTA 2AJUL 4LLWA 5IB5A 5IT2L 5EEVA 4G5ZL 2MFNA 4GO6B 5LLIC 3NCYS 1H8LA 4WFEE 4L4TE 1RLWA 1EZVX 1TQWA 3LQAC 4JFQB 5E5UB 2I27N 2QDVA 2B4CH 3GSWA 3PWUB 2QQLL 2GG1A 4D0CA 2H32H 3C6LA 2O6CA 2P5PA 3ARBB 3PP4H 2ZOLA 3EDFA 3ZT6A 2MWCA 2GYSA 4JO8A 1DO5A 1OARH 2XI9A 4Z3HA 1H6EA 4N22A 4P5TB 5CIPA 3IWUA 3C8KA 2HKHL 1OGAE 3JT2A 4F8TA 1M7XA 3ZQXA 2D73A 3VQMA 4ZFQA 2F8IA 4Q9RL 4PJCE 4P2QD 4Q4EA 4QT5A 5EU6A 2YSTA 3FSZA 3S8GB 1U3ZA 3EADA 4F8OA 5KS9E 2NZ9D 4Q6YA 4E9QA 1JV2B 4KZ0A 1ZPUA 2Y0SA 5F6IC 3SDCA 3LRLA 5FOJA 3WLBA 3RUGA 3D69A 2Y25A 4YHZH 2YD1A 4C58B 4W9LC 3BPNB 4UNUA 2MQ3A 4NKMB 4CW1A 1I9IL 1LM8V 3GBLA 3DX1A 2IOMA 1NAMA 3G6AA 2PTTB 3KR3H 3FYIB 1D9KA 5FCSH 4TL4A 2LU4A 1EFXD 1KIPA 3TIDB 4DO5A 4L48A 2DI8A 1YHPA 4HJSA 5B1BB 4NGHL 1AS6A 3BDYL 3KDMA 4LQFH 5IG7B 1PZAA 2I24N 3MRBA 1FRGH 2FX8L 4PW3A 4QJ3B 5CZXD 2NQ3A 3DUUA 2WK2A 3IYLW 3MJ8B 4X6CA 4ANXA 1A1MA 2OR8A 3LIZL 5DYOA 3MGTB 4XH2A 3BH9B 3KJ6L 2GY5A 1K2DB 4ESKA 1SXNA 2V5YA 2O5XH 5C0CA 3BQUA 4XP4H 1JNHB 5DD0L 3ARFD 1FFRA 4LNRB 4OUOA 3VWKA 2CHXA 4CVXA 5B3NA 2OP4L 1FCGA 4Z77B 3VFUA 5AVVB 3T08A 5CIPH 2WBKA 3WEXA 3MACH 2Z31C 3MLRH 3VJ6B 3Q05A 5KVFH 3VXNB 1UM6H 3V6ZA 2R23A 1QSEB 4IRZL 1RSYA 3C2SA 4F9PA 4PS3A 4JM2D 1YDPA 4IOSA 3BE1H 5FF6A 4OLYH 1OAYH 4ALAL 3HZYA 3FU7A 3T0EA 4ISVA 3JV5A 2KQNA 3D07A 3RWEB 2I7OA 3NK4A 4BQCA 5LB1A 1KCSH 4J1UB 1CLYH 4S1DC 1WFIA 2QVTA 3N43F 4PRPD 5BZZA 2GI7A 3FO0L 3ZIYA 1DJIA 4FEMA 4Z7OB 1NAMH 4GRMA 4LT7A 5KYUA 2OL3L 2YMXL 4UINL 3CVHB 1JNNH 1NWPA 5EZIL 4B3VA 4R7LA 3ESNA 3REWB 4YHKH 2GSIB 1L6XA 2F53A 1N70A 4A6YA 1S78C 1BZ7A 1ASOA 2LHAA 4DKDC 4E68A 3RIKA 3C6SA 3HZVB 3O8XA 4RWYH 4ANWA 4B96A 5M7QA 5IQ7L 3L3KA 4U1MA 5IK3B 4OV5B 2XRAL 4G8FA 1JVLA 1ZS8A 4BKTC 5ABZA 1ADQL 4PJHF 4XNYL 5FKPB 3UBFA 4IBQA 1KN4L 1YYCA 2UZYA 4GMTH 1OF2A 1MHHB 3BGMA 3QIUC 1DHKA 4AYDC 4TLKA 3OKDB 4YBLB 5C0FA 1U8KA 2F68X 2GBUA 2VR8A 3TN0B 5D8JH 1ORSB 4YR6A 4YX2L 3BIKA 1E28B 3FB7A 1MFNA 5DVKA 5FUCC 4YSCA 4LLUB 4U0RB 1EPFA 2IOIA 3R06A 3EJJX 4KU1A 4CU7A 2I9TA 5ADPL 4LLDA 4U3SB 5SWSB 3OKNB 3WIFB 3EYVA 1K6QL 1LE9B 1FBIH 2BSDA 2A6KA 4A7UA 3NZHH 4YHPA 4TLTA 4BK8A 3LQZA 3OGCA 3SQRA 3OC5A 3HOGA 4N2CA 4F8PA 2CPUA 3UGUA 4GSQA 4A6YH 4MD0B 3TNNA 3VQ1C 1T0NA 2VO5A 3PHAA 2F18A 2J1XA 4YE4L 3S5LA 5IMLB 2AJYH 1MI5E 2GSMB 4LQ1A 5GGVL 4UZUA 2Y2WA 4I5BB 1CGSH 3K6SB 1N8ZB 1BOGB 3QJRB 1EAPA 4C56B 2XTLA 3MRKB 2MOVA 4JREB 5ICUA 3VDAA 3UX9B 4F57L 3L7FB 3VB9A 2OQJB 1Q9WB 2GY7B 1RJZA 4HF5L 3BHBA 5F70A 1U33A 2MOGA 3UJIH 1CBJA 4CC1A 2VDPL 4K8RH 1KIQA 5IHZA 5IQLA 4S2SA 1NUNB 3FUNA 5BO0D 2YBRB 3MLSL 4Z7NB 1TZGH 3GMLA 1NANI 3SKUD 4M1CC 5JHAA 1R19A 3O4OB 1KB5A 4EJ1C 2FX7H 4TRPL 2R7EB 3IAQA 4F7MA 1TCRB 1INEL 3U1SH 4JM0A 1K8IB 1S7VA 3DV6B 2J43A 4IU2B 4UM9B 3WEBA 4XBGA 4ZFFA 1BXVA 4YC2B 2YPVL 4E2OA 1MXGA 5EF2A 4C47A 2LU3A 5J1AB 4NC0B 1TJGL 2EO9A 5CCGE 1DLHB 2DJSA 4TMPA 3ZTJH 2R2HA 15C8H 1B4JL 3B7YA 4JFYA 4NCDA 4WUKL 2VL5B 1XSOA 3RWHB 3EH2A 3P77A 2QGCA 5IV2A 4HUVA 4AQEA 4PPTA 5AENA 1BG1A 5F6HJ 1NUGA 5D2NB 2GBTA 2HX8A 3IRCA 3WTYA 3TVMC 5I8CB 1GTFA 2EUXA 3SCMC 2OMWA 3UTQA 43C9B 1GIGL 3FT3A 1MZZA 1ZT1A 1RZ8A 3LDBC 1K8DB 1PTZA 4GRWH 2QPDB 2VW7A 5FS5A 4PAZA 1J8HD 1QTSA 2NY3C 3FUEA 1NEUA 4APQD 3SGKA 2B0SL 5C09A 1JE6A 4GKNA 2OCFD 3SBRA 3M1CA 2APBA 1KLUA 2OBGA 4Y5VC 2VL4A 1T20A 1TJMA 1UXSB 1KB5H 2JJTA 4QRPD 4TL5A 2Z0BA 3MBWB 1HFUA 2HJLA 3F5WB 4RNRA 5T1KA 5IUSA 5BO1H 2XFGB 2AABH 2JKTM 5L88H 3E8UL 3L4VA 4TULL 2ZKWA 1V3MA 3CPUA 4QNPF 1IT9L 4GJTB 1Z9MA 1E6OL 1OAXH 1WITA 1A9EA 4L23A 4RGNE 3RWJB 1N64L 1U8MB 2VTFA 1GOFA 1QD0A 4FQQA 4XC1H 4K7PL 2WNXA 2VJXA 3V0VB 1AIFA 2HXAA 4KBPA 4LCIH 3EYQC 3AITA 2X4QA 3DK2A 3ZE2E 4ZMYA 3SDAA 2L7JA 3L3DA 5FA4B 1T83A 5BPPA 5D1QA 3B9VA 3TJEL 4KTEH 3PNWB 1CXLA 4JNXA 3AS2A 2AANA 1AKJD 3J8F7 3V5HB 2X9WA 1NL0L 5TDPA 2P52A 2XXGA 1H5BA 4JFEA 1WAAE 2JB5L 5K39B 4JDEA 3GS7A 4JO1H 1A3RL 1IE5A 5KZCD 3GSNA 3VW3L 3JZYA 2J8UB 2WZ5A 1FL3A 4IRJB 1QLRB 4EQ2A 3MRMA 2CGZA 4B41A 3TPUB 1EXUA 3C9NA 3T9WA 1AMYA 1KC5L 2Z92A 4BZ2L 5DRNB 2WLYA 1OSEA 3DGGB 3ZVVA 4Z76A 4FYTA 4PW4A 3L2MA 4YK4B 4R2GC 4KXAA 1JZ3A 1XGQA 4XP9L 1MVUB 1QACA 5T5NF 1LMIA 4N1HB 2I07A 5GSVB 4Y2OB 2BFGA 3O6KL 4HBCL 3VH8A 2H41A 4JMNA 3VXPB 4PJCF 4TVPL 4UM8A 4P3CL 5F7DB 1KIUB 5CCJA 1UWEH 1T2JA 1Z5LA 4DEWA 1PDKB 4PGCB 2ARJA 5KS9F 4OF6A 4AITA 1OAKH 1PG7X 4DIXA 3MR9B 5B1CA 3HG1A 3T4AC 4ENEC 3ZKMC 4HT1L 1C5BL 1F00I 1N2RA 2IH3B 3IS1X 4TSBH 3OX8A 4RZCA 4Q9QH 1KN2L 5E99H 4QOKE 5IBTH 3IU4H 1CG9A 2ZXEB 4MXQC 4W9CC 1YEJH 1IQDB 3ISRA 3TESA 2APFA 3QAQA 1JF6A 2DPKA 3DX7B 3EOBA 2VXUH 3GSNH 1BVKA 5GGUB 4WFHE 4K23L 1Q9LA 1EBPA 1JXGA 2I85A 1IC1A 3SPVB 4MA8H 3MJGX 4U6VL 3RI5K 3ARPA 1E4XI 4WW2C 4LVOB 4QAWA 4J3OG 3FO1A 3RGVA 1E5BA 2NY5H 1EZUA 2WKLA 3QDGB 5JXEC 3TZVB 1IC4L 4IRSB 3AG1B 3II1A 2DQFB 4OZGF 1CE6B 4D0DA 4JKPL 2ZX9A 1R24B 4JRYB 2HVKA 3H9YA 2JKRM 1PYWA 2EIDA 1CFVH 1Y18A 5B39B 3MZTA 5I18H 4PLNC 4PVNA 4YHIA 3EUUA 3PDOA 4A2FA 4FRWA 3B9AA 3P4MB 1M7IB 3HRPA 2AGJH 2W81C 3BESR 3LPOA 1DZBA 4IGBA 4PB0H 3UAJD 4LDEB 4ZG1A 4I77H 3QUXA 3G04A 4PJFA 5ETUB 3V4UH 5CCHE 1W6WA 3U2IA 2EDWA 3JWOC 2XVGA 4M1GH 3W0WD 4IBZA 1PZBA 2EXYD 2NLJB 1OLLA 2ZG1A 2EDDA 4D2NA 3T2OA 1WS8A 3FONB 3A23A 4XPTH 5J06A 1JHLL 4A67A 5JW4M 2EYSB 4KC3B 4OKVA 4P3DA 3ELQA 4MNQB 1K4DA 4AV4A 3A21A 5KBLA 4LEOB 1OGSA 1UJ3C 3O11A 5AG9A 4RSVA 5I5IA 1ZE3C 4AC2A 1WE5A 2NY4C 2WJ7A 3LIUA 4HHWA 4G9FB 1G7IB 1CGWA 5DZJA 4JQVA 3JSSA 4J3SA 3VXRE 4YO0B 5E70A 2QFPA 5GS0C 3SKJL 5JMRA 3IGLA 4JY5H 1WFMA 3KPSB 2XWDA 4L1HA 5F6HI 3QWRA 1A66A 3A24A 2V7NB 4OCYH 2D3JA 2AV7A 1LJMA 2AK1H 3MGAA 1BJ8A 4L3EA 5DJ6B 2PXYA 3PWNB 4F20A 1LWHA 1E9OB 1G7LA 1O6VA 4TQ8A 3GMQA 4FNQA 1U3JA 4Y2DA 1UACH 2ZKYA 1YNTF 4J3VA 3OHMB 3WFCL 3GSOA 4D9RE 2FQFA 2OMZA 4PHXA 4P46D 3UYPA 2RFXA 2FGZA 4HS6A 2EXTA 1CU4H 5ADOL 1E3XA 2CO6A 3ULSA 2BNRD 4PY7A 4MAYD 5GPRA 3MRHA 3II2A 2CU9A 4E0RA 2XWEA 3IKKA 1BZOA 1X5YA 3DWTA 4NM8H 1UZGA 4CMMB 4F24A 2C8NA 2D7PA 3L1OL 1C16A 3I85A 1S9KC 4OZFG 4RQQB 2GJRA 3EGDB 3CFEA 3IFOB 4Y9CA 5JHLL 4QTIL 1DQLL 1MCJA 1SJMA 1E4JA 1WCQA 1ZA6A 3X13B 4KK5C 1EJ8A 5D7IE 4OIBA 3BWZA 3BH8B 4WCYL 1BBJA 4OZIF 1ZANH 2BNUA 2BOBA 4ZFOL 2OZ4A 2UZIH 4LO9A 1UT9A 5GS1A 1FN4B 4ZO7A 1J18A 5F3BA 4L29A 4AWJC 2KLRA 2LGNA 1T1WA 2VLRD 3AG3B 3OF6A 3MOAL 5FM5M 5IVZB 4EI5C 3KEHA 4WI0A 3O45B 3P3TA 5FGRA 3WD5L 1R5VA 2AXGB 4HUKB 1A6WH 2X4RB 4JFDD 5FUCE 3US1A 1U8CA 5LBVA 2ZCKL 2GEQA 4U1SA 1EBAA 3A6CH 5B38B 1M56B 2AJXH 3DYPA 3QUML 4M7JL 2VERA 1A3LH 1EZLA 4H8VA 3VXSB 2P5WB 1HIMH 3TO4C 4N8CL 5C08A 2UXFA 1YEFL 2QFRA 4PD4J 3UJJL 3MKKA 1Q1PA 2X4SA 1UM4L 1GY1A 1PMYA 2CM5A 3TL5A 5BV7H 5J6GA 4HIHB 3H8NA 1KCRL 3BPLB 3AY4C 2QPFA 1FC2D 1BXUA 2X89D 2YO3A 1AGDA 1FNAA 2EC9T 4ELMA 1S3KL 4NQEE 3SOTA 5KANG 5IJVB 5GRVL 3ME0A 4ZNEE 1S4IA 2B8OT 1XGYH 1Q0YL 1WCBB 4URTB 3PL6B 5AOKA 1L7TL 1A4JA 3ABMB 3F8UB 4NRXB 4YZWA 4PUBH 1MLCB 4N1CA 4M7LL 3NFPA 4NPJA 2LVCA 1PZ5B 5EUOA 2OZ4H 4PV9A 5CHNB 5CJXA 4L3CB 3ZR6A 5D1ZC 5A2FA 2VDQB 4LL1A 4R8WH 4OJFL 4KI5C 4XAKD 1UD8A 4K3JH 5I1EL 4Y4FC 3HNTL 5C6WH 3DHPA 1U8NB 1LHZA 1KYOJ 2ZE0A 1JK9A 5C7XH 2VLJB 5G5DA 3WEMA 5FFLA 2ZX7A 1XCXA 4L4JA 4BWTA 3ZDYE 1NWOA 1PAMA 5KVGE 2VZVA 2JXMA 1BOYA 2L4OA 4IDJH 5E9AA 4DP9X 5I19L 2RHEA 5CP3A 1BAFH 4JFHE 3V5DB 1G7QB 2WPGA 1YY8B 2HJFA 4EMZA 5DZ9A 3QUZD 4JPKL 3R18A 2X2JA 3O3DA 4OY9A 3VFMB 1ILUA 1SBSL 2FBOJ 5E9DE 3HR6A 4KO7A 4BSVA 4PJ5E 2LU5A 3RVXC 4N25A 4H26A 3KGTA 3FO9B 4XOBA 4Y4KB 5ITBH 2H9GA 3AREA 3HHSB 4NNPH 3OHXB 4Y1AE 4Y89A 4Z23A 4NO0D 5ICYA 2N0KA 3QDME 1IL1A 1IKNC 1DBBH 1G5GA 1WAAF 3KYKL 1X5LA 2XV3A 2H1XA 3NESA 3ULUD 1M6UA 1U91B 4AQAA 5E94A 2XN9E 3E1F1 3BCFA 4HK0A 4W9IC 1MIEH 2CR0A 2C4FU 1UURA 2EDLA 3D2UB 1OSPL 2YZ8A 4UILL 1VSCA 4E41E 3WTSA 2COVD 2GHWB 1SDDB 5LGKA 5CGMA 4KKBC 3QZPA 3U0PB 5IB3B 2VSMB 5IHLB 2ZSVA 3QNXA 3QPXH 2UZPA 4QIRA 1LDPH 3NFNA 1HXYA 5CP3H 5IB4A 1EEYB 1ACYH 2BNQB 4DTGH 1IX2A 1WK0A 2P49B 2CBMA 1X5HA 1X6NA 1F6FB 2ZCHH 4FG0A 4WNJA 2YIHA 2APTA 1UTDA 1WFUA 2NR6A 5SWQB 2DQGL 4XNDA 4PV8B 1AXSB 1SM3H 4I3SH 2AEPL 2VWEC 5G4NA 1GZPA 3WXVL 5ITFA 3TCLA 2VDML 4HIPA 3NVQA 3WFBL 2WN2A 4V33A 1MNUH 4UAOB 3NJKA 1OCZB 3LSOB 3D85D 4H4NA 4X42A 3QXWA 2R1XB 4LP5A 3N50A 4S1QL 3WKNA 3O0LA 2Y2YA 5HHPB 1TPXC 4OLVL 4G8GA 1AD0A 5HHMD 1DQDH 2NNCA 2BFVH 3WKPA 4MDJB 3MNZB 2VLKD 3U1PA 5I1CH 1QOKA 2EABA 4PWIA 4N2NA 3SE9H 2VXTH 2E8ZA 2E75C 4NC2B 3WNKA 4AJ0A 1OT1A 2ITDB 4M7LT 3D09A 3AUWB 4OUUB 2BIMA 2DMGA 3HB3C 4EN3C 4PLKC 2ZYSA 1FE8L 1SJXA 4LBEB 1TNMA 4YSQA 1JJUA 4XP5H 2ZCLL 4OTXH 3IDGA 1C12B 1M3IA 3O4LD 1RSFA 1KG0A 4Y7OC 2DLFL 4NM4H 1NIEA 3RZWA 4LCWB 3CZJA 1ZOXA 4TPRH 4J6RL 5JDSA 3ZIMA 4AKPA 2VDNH 2XQBH 2WBXA 2QEJA 3LKPB 5B8CA 1DQTA 3UACA 1E6JL 5CZVH 3DX2A 3K74B 2EVGA 3HZKA 5FPIA 2EZ0D 2OI9B 3HPJB 1J05A 3LKOA 1OV8A 1JVOA 1ZDSA 3CN0A 5EN2A 4JFOB 5KJRH 5AUMA 1W15A 3MBED 1LYQA 4HLJA 3BDBA 1YMHB 1IGTA 4A2HA 2PABA 7FABL 3F6LA 3WHE1 3MPCA 4FL4C 1AZVA 2RACA 2VDLL 4Y8DC 2WLJA 4AJVA 5JDJA 3V4VL 3N06B 5SWZD 4YDLB 2HLFD 2KLTA 1GGCL 1I3GH 5HHOD 3DMMA 4QRRE 3GTNA 4PS7A 4BZ1H 3F58L 2FQDA 4FNSA 4Y16D 3NGBC 3UPAA 3UTTB 1PKQB 4RRPM 1YYLH 4FG6D 1IEBB 3GKZA 4OJAA 1NBVL 4TNEA 4Z95L 1SVZA 3L3GB 1USQA 3RNQB 4LEXL 1UJTA 3TT1L 1BVNP 5B1KA 4PJEE 2EYTA 5IGXH 5KYWA 4OSUL 3ARDD 1CC3A 4MNGA 2OW6A 1HL4A 1XGZA 4I2XB 4PGDA 1QNZH 2X38A 2QVFB 3CV5A 4Y0GA 5F3FA 5TGBB 3WEAA 4EVNB 4NQDA 3DURA 2J73A 2VLLB 4FQ2L 3ZZLA 4J8RA 3TBVB 5JIQA 3VA2C 1M05B 1LILA 1DN0B 2H6OA 3D18B 1RLBA 1Z9SA 1HHJA 4FQXC 3FO2B 4PGEA 2G60H 5CBEB 4DESA 1S7QB 3ZKQD 5AAMC 4WDIA 3QHTC 2YXWA 1MFEH 1YMMB 4IW4C 3L4ZA 2N01B 2XPGB 5DHYA 1HHKB 1LWJA 1U58A 3FT2B 4HGKC 2K9UA 3LRSA 5GGSA 1ANUA 2WANA 2Z7WA 5DJXB 2PCPB 3MUGA 4X7DC 3QIUA 5HYIA 3LN5B 3N42B 3SY0B 5HHVH 2G5BB 4BGDA 1VFAA 1KGCE 1SHXA 5C2BH 5IW6B 1N6QH 3C87A 5HVFB 4PP2A 2D9QB 2PWEA 2SEBA 2HFEA 5EPMB 4FNUA 2X4NA 4JN1H 5C07E 2VDRH 5HYQA 2X4TB 2XNAB 3WYRA 4M5TA 4KROB 2I26N 3HCVB 3K6IA 4X98A 4P2RA 2A1WH 2R1WA 1DDTA 3P0YH 1RJLA 4JPVH 4HHAB 5FGBC 4P2YA 3DVIA 1PPIA 5T1LA 1ZS2A 1HS6A 2X3AA 3QRLA 1YJDL 5CEZE 4HZAA 3UZQB 4KK6D 1XZWA 5E2JA 3OXSB 1NBZB 1PQZA 3MFFB 5KVGL 5FOBB 2VOTA 2X4UA 1CFTA 4ZYKA 3UDWC 1CTMA 2OJEB 2VQ1B 7CGTA 4GG6B 4NN7B 2X6CA 5CILH 4IU3B 3TPKA 3QCUL 4AXWA 4JRXE 4LKXA 2ICWA 2Z7YA 2Y9RT 4ZUVA 4X4YB 1JZ6A 1X7QA 1DUYB 1A6AA 5IEKA 1OAUL 3D3VD 3ARFB 2QSQA 4OLZH 2GBVA 1I1AB 1LK2A 3LEVH 4OLXH 5IOPB 2P24A 4FQLL 5FKAB 3CDGB 1QSFE 3SBWC 1HQRA 1CGVA 3QPQC 4U1LA 3APCA 1J9QA 3HE7D 1PW3A 4HGWB 4JM2B 4LARH 3H9SA 4PH8A 3FS9A 3QI9B 1XCTA 1RUAL 4GLRH 4HKXA 2N3JA 4XX5A 3ZYOA 2VQUA 1UOWA 3ARBC 4ZOAA 3EH3B 5MI0C 4NO3A 4GKZA 4PRPB 3V7AE 2J4WH 4LRIC 3C5JB 4EF3A 5I15L 4P5TC 4OGYL 5JYMA 4C54A 4N2KA 2R4RL 1JVKA 3M46A 4DZ8B 3U7WH 3JTSB 1A7NH 5C0EB 2R39A 1OSYA 2ZYIA 3AXLB 5TE7L 3ROOA 1BD2E 1J1PL 2JK5A 3VXQA 3WIAA 3THMH 1J5OL 4ES8A 3D2TA 4EQ3A 4X4XB 1F58H 5AL8A 3TVMA 1U8PB 3I75B 1NGYA 3E9UA 4NQXB 3GMMB 3SDXA 4BH8A 4DFIA 4UQBA 1FCCA 3EDEA 3WBDA 4ZXBA 3W38A 1OXYA 4BUHA 4QRQB 1S46A 3VFRA 5HPMA 4F7TA 1YY9C 5DK3A 5CNHA 1KJ3L 1HU8A 2Q0ZX 4GW5B 4HV8A 3IVKB 1LLAA 2BY1A 4M6MH 5CGYC 2IQAB 3IJEA 5GZOC 4HIJB 4X5QA 2ZP0T 1BWMA 4P06A 1TETH 3NCJL 4YDVB 2GT9B 4KJWC 3BZ5A 5ICZA 5E4IA 4C83B 6FABH 3IBOA 1ECZA 4W4NA 5DD5L 2WTOA 3UYRH 3DKHA 1Z3RA 5E6SB 2UY7B 3BVTA 4JY6B 1QO3B 5BRZD 4AH2B 2QTVA 4AEIL 1ZVHA 4GAYB 1MFBL 1INQB 2CZNA 3LD8B 4W6YB 4QYOA 1HYRC 3NA9H 4PJGA 4F9LC 1UB6A 3D05A 3KJ4B 3F7PC 3QUKB 2ZWYA 5B3JE 2KDGA 3VXUD 1HNFA 5SV3A 5MEOA 3PHQB 2IG2L 1JGEB 2WYHA 4Y4HD 5J4MA 5EU6E 1FGNL 4NUGH 4JL1A 1UH4A 3KVDD 5IQ9B 3V0JA 4PJ9A 4Q97A 3CBJB 5EOTA 5IVXA 3CU7A 3G5XA 3RUGE 5L2KE 3QJVB 2BY3A 1CGYA 4ZPVB 1MCRA 3DVFA 3BP4B 1HWWA 2J7LA 2VAJA 1NICA 4TF4A 3MV7A 2PWGA 5IF0A 4XR8C 1JRHL 1S5IH 2BY2A 3H2QA 4K94C 3V7MA 4OM0L 5BW7A 3FRUB 1ML0A 4GW4B 5E8PA 4HOWA 2IFFL 3BN9D 2EILB 4HIXL 1THCA 4X6CE 5JPNA 1I9JL 5EZOL 1NBYA 1HAWA 3GM8A 2H6PA 2QQQA 1UA6L 2JNZA 1IAIH 3V0FA 2OJZH 2XTJE 1P2CA 4JB9L 1EQWA 5F7AA 2CK0L 5C0CE 1D7CA 2I60H 4UUJB 1KF9B 4YBLC 1OTTC 3TN0C 3B2MA 1NIFA 3QWOA 3Q2WA 4KZDH 1IBGL 1QQDA 1DSYA 2IO5A 2PP9A 4ZUTB 1N9PA 5EBLB 5AALA 5KSAD 5K9OA 1M9WA 4PIBA 3KPQB 2G4EA 3S36X 4GBXD 4C4BA 3GXNA 1P9MC 1UASA 2EE6A 3P4OA 4WAFA 3T0EE 5D6DC 3ARGB 5JO5A 4CUCA 1EMTL 1R5IA 5JQIB 2VWEE 4OLUL 3GZOA 4DGYH 4NENA 2OPCA 4AGPA 4UT9A 3FTUA 2IC2A 1CFSB 3KWWA 3TEUA 4HS3B 1H6FA 5DVLA 3OLIA 1IFGA 4AYBA 1C5CH 1U36A 1J8HB 5BVJA 3I02B 2PO6B 4AX3A 3FBQA 2F53E 2FIRT 4LCUB 4O2EB 5JA8B 4J3OH 3FU5A 1JWUB 3RHWF 3X12A 4MASA 1JFQH 3E8VA 2VZ3A 4QRPB 1AIZA 1WSST 5ALBH 4JREC 5EO1B 4LCCB 1F02I 2FATL 1MJJB 1F1GA 4TUJA 2NUTB 5JW5A 2G5UA 5GS2H 1P6FA 4WW2F 2CA3A 1F86A 3VD9A 3GI8H 3X11B 4AJWA 1CTNA 2OXGA 3C12A 3RQ3A 3KLSA 2QQKL 1XCWA 1MEXL 1KTRL 1ZTXH 3CHQA 3PLYA 1JZ2A 4NZRH 4NNYB 2C7UB 3X3GH 1MCQA 3LEXB 5HHNA 4PJEF 1CXHA 2RCSH 5CEZL 4PJDB 2NNXA 3MXVL 4LBAA 3O4OC 4FFVC 2WUCL 5DUBA 4QHKI 3UCRA 4WFED 1VACA 3T0VA 1T0OA 3PDGA 3CK0H 1Q9OB 2IANA 3V0WH 4HQQH 1AKJB 1BVZA 4X9IA 3HHRB 4LKCA 4UT9H 5C0AE 2R69L 4YC2C 5MHSE 5K5YA 1DJXA 4KDTA 4KHTH 1MG2C 1QUPA 2JLLA 2UX7A 3CHXA 2O61A 2VKXA 4OZFA 2BLFA 4BQBA 3AAZB 4MDIB 1ZEAL 5HPOA 1XSKA 5J9PA 1ZHLB 3PPEA 1ES0A 4WTXA 4JR9L 1J8KA 2BCKB 3DX0A 3HUJF 1G6RL 5E1QA 5I1IH 5DJAA 1AI1H 1S7SA 2F19H 4Z7IA 4HOMA 5D2NC 3VYNA 1NLDH 1F4AA 2WYTA 4QKXB 1UGNA 4PLJD 4RGMB 2B2XL 5IZ7A 2DQCH 3FTVA 4JJ5A 1B0RB 5DJZA 3S2CA 3EBIA 3BD5A 4B7IA 1P4IH 2K4AA 3UIYA 4XVOA 1P1ZA 2QVIA 1PZ2A 3VCLA 4HA1A 2ODIA 3K2KA 2VM4A 4X5XA 4BHUA 3PXLA 2WTRA 3PQYB 3WS3B 2ICEA 3S4SB 2R2BB 1NCAH 1NC4D 3B1TA 5DVNA 1J11A 3IDXH 1JERA 4FC3E 3RJOA 1PNCA 4H7VA 1AZCA 1JPFB 2VRAA 5CWSA 3WENA 4WI9A 3PP4L 3K6NA 3JVGC 2DYRB 1HXKA 1TG8A 1OARL 1TU2B 1QA9A 1JZ8A 1ZGLB 2DQJH 4K15A 1UOLA 3O41B 4FA7B 5IR1B 4FKKA 3HTLX 4FYSA 5I1HH 4IHBA 5J12B 1AACA 3TC9A 1PFOA 2G9HA 5FWRA 1ZE3H 3BKYL 5FCUH 4F7CA 4OZFH 2BXZA 2BVTA 2XV2A 2BVPB 2DL9A 1DE4A 1ZWIB 2E46A 4G1EA 1T4WA 2V5SA 5DMYA 4UQ3A 4LFHD 4FQJH 1F8TL 1NPJA 4U6YA 1S9XB 1XZ0B 2PCFB 4M8QA 4ODTH 4OV6F 4R26H 4UWQB 3H3PH 4FQCH 4Z0XB 1CD1B 4YHZL 1JFHA 1X5MA 2P26A 3R8QA 1ZVSB 4I48A 1PG7H 2FL5B 4TVPD 3MLZL 3KR3L 1OE2A 3H9ZA 2O5ZH 4HEMA 3FC8A 3INUH 3KPMA 4UNIA 3NZ8B 3UIZA 5C0IA 1UWFA 5I16A 4LQFL 4EDXA 4E42A 1FRGL 3O6FA 3HG5A 4MWFB 4NAMA 4OFYA 4Y5XB 1W72B 1OCWH 3MUJA 4GMSH 4M61A 3TO4A 2IALA 4QWWC 5F9WC 1TKWB 4BUQA 4BV1A 1F90H 3H42H 5C09E 4WI4A 2O5XL 4UQAA 4YK4C 3IAGC 2VQTA 4XP4L 4K7FB 2BSRA 4M4RA 3W0WB 5HYSG 2UWEB 2CG9X 3MACL 5FK9B 3MLRL 3NJIA 4L8CA 1UM6L 1D7FA 2X12A 3F7YA 2QADB 4BE6A 2GJZA 2F74B 2X2YA 3BE1L 4OLYL 4FNRA 1OAYL 1GCFA 1C5DA 1MHEA 2NNAA 4M5ZH 4QHUB 5AOMA 2YD6A 3JWNC 3U7YH 4DSYA 2EC9U 1KCSL 5C0BB 1CLYL 3FN3A 5FHBH 3VMNA 2VAAB 4H13C 5D1ZA 4KKCC 1E5ZA 5KUKA 2GW5A 1S7TA 2OM5A 2ZF8A 2W80C 1NAML 4Y4FA 3DDFA 1RZFH 1EXGA 4BXSV 1JNNL 2HWZH 2J44A 1SXAA 5CMAA 4AK1A 3P2BA 4YHKL 4FS0A 1BQSA 1AGEA 3DX9A 3D39A 4PJ7A 1KV3A 2CJUH 4ES9A 4PJBA 1HKFA 4LVOC 5GSRA 1TVBB 3STLA 2CKNA 4J39A 4RFEB 4RWYL 5I24A 1IAKB 4RMTA 3CXHJ 3TZVC 2BHZA 4IRSC 4U1JA 1DBKH 1G1CA 4RFOH 2X4PA 1YN7B 4NPYB 3SE4A 5EUKA 4BRJA 2BNRB 5I76A 4GMTL 4MAYB 5ID0B 3EYUH 1CDJA 4YAQA 1MI5D 2B77A 4GUPA 3PWPE 2YXMA 4GFTB 3KL3A 2R83A 3DBXA 1FLRH 3TWYA 5D8JL 2HT2C 5D1XA 5F44A 4J3TA 5AD0B 4GSUA 5H94B 1WD9A 1SXCA 5HJBA 5IMKB 3H7BB 4XZUB 5HD8D 3VFGH 3P02A 4LLVB 3ZSSA 5IIEA 3N0PB 4DP1X 3Q13A 3ZYJA 4UNVA 3HG1E 3RWIB 2D31A 1NBCA 4N26A 1VZIA 1FBIL 4H5SB 3KLAB 4I3GA 3HMXA 4O2FB 4Y9GA 1FIEA 3GSQB 5FWQA 2Y07H 3RDTD 5BQ7A 5FO8B 3NZHL 5LCVA 1PLBA 5DO8A 5DTFA 2VLRB 5IM7A 3SPJA 2ITEA 4A6YL 4XODA 5DQDH 2E6PA 3N85H 1OZTG 1O6SB 4JFDB 3N44B 3BAXA 4FXKA 3MV9A 1MW3A 2AJYL 2WIIA 1KJ2B 3RDJA 3KPRE 1QTYT 2X6AA 2I32A 3WL9B 2A74C 2EQDA 2NY1B 3VU1A 4GQQA 2CIKA 4B9JA 1AMXA 1CGSL 4XNQB 3U2SB 2ADJA 2BY0A 1OP3K 3FFCE 5B39G 3AU1B 1GGYA 3AUVA 2MOQA 25C8H 4R7VA 1W0VB 1TT6A 4L1LA 2XQ0A 2FJFB 1FORL 1QX1A 1XT5A 4JZOB 2FJHA 3MV8D 1SHSA 4GIOA 1TZHA 5E5RB 1JMZA 3UJIL 1XB8A 4K8RL 3E6HA 1ED3B 3AGWA 1XR9A 4TSCH 1FV1B 4N4YB 1WZMA 3OSVA 4H40A 2P8LB 4IKIA 3H85A 4I18A 1MQ8A 5E0QA 4A7QA 1MH5B 3JTTA 3QH3B 4AZ8B 3B9EA 3TBYA 3WS6C 1B3JA 1T21B 3ARWA 4BFRA 4KKLC 4IS6A 4KY1H 2HFFA 1R5WA 4OCMC 3SZKC 1FNEA 2JH2A 4QXVA 1H0DB 4WF7A 4N87A 4PJFE 4XBPB 5GISH 5H35A 3HMXH 4XCFH 3I50H 3C5SB 1KZYA 2CLRA 5LCVH 4XXWC 1OQXA 2VZUA 3D51A 2PYFA 2XYCA 3G7TA 3IJYB 1CURA 4D7PA 1TSHA 3FH5A 3EF4A 3GMRA 4XOEA 2YZ1A 3BWAA 4WSJA 1BFOB 2W59A 3CXHK 4F7PB 15C8L 5AVRB 3RVTC 3QXDA 1BIIA 1X9LA 2RTTA 4BSWA 2E9GA 2HVJA 1GW6A 1HZKA 4JPIB 1NEZB 3QFDB 4WV1B 2NXYD 3GTVA 3QUYD 1CCZA 1X5XA 3WG7B 2NUPB 3QVAA 2EO1A 4LLYB 5I75B 3B83A 4HH9A 1A7RH 2VMEA 4Z7VE 5HDBB 2JB6B 4XP6H 4K71B 4HZLB 3QJFA 5DLMH 2WTPA 2Z91B 3FCGA 4ETYA 4DP7X 1X6LA 2Q2LA 4GO8A 4JCMA 3IN2A 1UQSA 2Y22A 3SGEH 3CQFA 5IFJA 3MAWA 1KXQA 3L4YA 2ZP9A 1ODUA 1NFIB 2N56A 2XOTA 3LEYL 4JAMB 3S0PA 2NW3A 1LXMA 2NY0D 3ES6A 1KB5L 1LK3H 3F85A 4HUUB 5DJDB 2G0KA 1ZLUK 5F7WC 1HSAB 2A6DB 3FQRA 2IGFH 5JMOC 4NO0B 5CM1A 2IDSA 3QG6A 3TBWA 5BO1L 1I3UA 1UXMA 3BPLC 3F64A 5DA4A 5CSBA 1BVLA 4ZD3H 5L88L 5I66B 1KCKA 4R0LA 3BPOB 3ILPB 1VCAA 3ERXA 1E27A 1D5IH 3MNWB 3QO1B 5ESAA 1ZLVK 4ECNA 1OAXL 1R3KA 4GS7C 3T2NH 1ZLDA 1A1OB 2Z6FA 2EDHA 1OE3A 3PL6C 5G55A 4XC1L 4XTRD 4AYSA 3HBPA 5FYJH 1ND0A 4XWGH 4ZMXA 1L6PA 2WP3T 1SRDA 1OLZA 3HS0B 4MJ4A 3G6JA 1V27A 2FECL 3QDAA 4KTEL 1IBZA 3T1FB 1AP2B 5JIMA 3LKNA 4FFTA 3TYFB 1DVTA 2W0KA 1KJMA 1JZHA 4H0HB 4PS8A 3CZFA 4X9BA 5D7LA 1I8MB 2A9CA 4WIQA 1SN0A 4U6TA 3EKCA 3BVWA 3LZPA 4DW2H 5ILTH 3UABA 4G42B 2VABB 1KPRA 4EXKA 4UIKH 3RY5A 3QDJA 1CO1A 2W9DH 2Z65C 3HVDA 4XXDA 3FH7A 3NTCH 2VZ1A 3A4FA 2ZXQA 1U6AH 1NM9A 4QOKD 4R7DB 5AAMA 3PXHA 4A38A 1A22B 4I0PB 3B3IA 3LZNA 2WM0A 3AC0A 4RAVA 3UC0H 4B27A 5CJBA 3G6DH 5I6PA 4WFHD 4PM1A 5CN2A 4O02A 3V6OC 5HHMB 1M71B 4Z5RB 5C08E 1JDCA 2IH1A 3VM7A 3PP3H 3KLQA 2V2XA 4JKKA 2VLKB 5D7JD 3UERA 3L3HB 3DIFA 4YHLH 3OB0K 2V9TA 4WWKD 1UWEL 1SN5A 4ZUUA 3L5WA 1OAKL 4EI6A 1HOCB 5EOCJ 3EOAA 4Y4KC 3GKWH 3ATFA 5IB2A 3HLAA 5FGBA 3OHXC 4I3RH 1AR2A 1KTDB 3TWCL 4YSOA 1B3IA 1BZ9B 2A6JB 2XWBA 1ASQA 3KYNB 3L4UA 4TSBL 1C9SA 4M7ZB 3D30A 4Q9QL 3CFNA 5E99L 5A2LH 4PJAA 3QORB 3BP5B 4H0GA 2YC1A 2CSPA 3GXIA 3IU4L 3NAAH 2ZT9C 3B5TA 5IBTL 6PCYA 2E74C 3MRQA 1HL8A 3T0AA 4H8WH 3GQFA 4RZKA 2VGLM 2VXUL 3GSNL 1PS3A 5F7EH 3E7JA 1U3HD 3UDWA 2CR6A 4HLEA 3ZE0B 2N7BA 4GQZA 4MA8L 3BSGA 5KYXA 5EU7C 1GMEA 4OW6A 1TUPA 1DCLA 1LP9A 4GSXA 3QIWD 5E56A 3C60D 1OSZA 1RK7A 1QYGH 3ARVA 4KGJA 3TURA 1ETJA 2NY5L 3T65A 1MRFH 5TFSH 5LBGA 1CS6A 4WHTB 4C4KO 1N59B 4GYBA 4O02H 5I1GH 4XMUA 3AG2B 2JKSA 4M4PA 1MG3C 4K73A 4MMZB 4LSTH 3QNZB 2KZBA 2UVFA 3CDCA 3MBEB 4FYQA 1MAKA 2M8XA 4NRYA 5CD5C 5BJTB 5IROA 3HMWH 3BUDA 1CFVL 3OZ9L 3KL5A 4NO5B 4FNTA 5I18L 2MCPH 4N20A 1X7SA 3PWVB 5SWZB 4BH7B 3UPRA 4Z78A 4UAOC 1O9WA 5TDOB 5HHOB 4NHUA 2XETA 1WFJA 4P5SA 2AGJL 3PWUA 4PB0L 4PRHB 3MUHL 2BZ7A 4Y16B 4I77L 3V4UL 1AXTH 4LHUB 1EGJA 4AUYA 2WXQA 3CMGA 3RPBA 4M1GL 5IKCB 4TNGA 4ODUB 4P5TA 3W37A 1I3RA 1WBYB 3KVPA 2VR5A 3ARDB 4XPTL 3S34H 5EU5B 2QMKA 1IVTA 4NLAA 3RHWK 1XL4A 4D9RD 5IFAH 4XMZA 4WQOA 1HH6B 2AJ3B 3MV01 3Q2VA 3VDBA 2LT9A 5FUOH 3TNMB 4G1MB 4N2EA 1QRNE 1JV2A 1GRWA 3DI2B 3IFNH 1BP3B 1QI5A 1SF3A 1ZY9A 4N8PA 5ESQB 4YSPA 3RIAF 3NBNA 1S7RB 4DQOH 5LBSH 1LL1A 3QA3B 1VAHA 1UZ8B 1MWAB 4JY5L 3GIVB 3STBA 3TIDA 5C2UB 2J1YA 5C6TH 5EFIA 3QJTB 3Q6FB 2AK1L 4K2UH 5E6IB 5IG7A 4P4KD 2ZOOA 1QEXA 1TNNA 5TF0A 4PY8I 1BF2A 4I4WB 4OJCA 5F1NB 3MJ8A 1DL7H 1IC7L 4PHZA 5CLTA 4GG8A 2OI9C 1DQJB 4JANA 1UACL 5DHMC 1AO7D 5DURD 1YUKB 1MFUA 3MGTA 3BH9A 1EGJH 1NAKH 1NDMB 5C8JA 1CU4L 4YFEA 1JNHA 1GSKA 4H25A 5JLZB 1XH2A 3P3YA 1SJVA 3NZSA 4KFMA 4OFDA 1A0QL 2M83A 2NY6C 3NH7H 4Z77A 2XVBA 4BCZA 4F1SA 2DMKA 3VJ6A 1XGRB 2ILLA 3VUAA 2E7LC 4FXLA 4NM8L 4YDLC 1EEQA 2CHDA 4F9LA 4CN4A 5IQMA 3WN5B 3J7HA 2XQYG 4ZFZB 3RWEA 2WNKA 2KBGA 4EPSA 1KFAH 2OAAA 2MH4A 3VRLE 1T3FB 2P80A 1CLZH 4NQCB 1ZANL 2UZIL 3CVHA 3DHMA 6PAZA 3DRTB 3KPPA 3MRPB 3QFJE 3QBTB 1DTUA 1SN2A 3CDZB 4ZMZA 2BC4A 4DN4H 2DTMH 3D3VB 2J8HA 1A6WL 3L16A 1VEMA 1BHGA 3G08A 3A6CL 4YZFE 2AJXL 4DHLA 1JRHI 4DVRH 3F00A 1RHHA 1A3LL 2YGQA 3CFBB 3CZUB 3RZCD 1VCBC 1YAZA 3N43B 5C9JB 2B16A 4OV5A 4AQOA 4PJFF 4DO4A 2ETWA 4U4BA 5FKPA 5BV7L 1L9PA 2AAVA 2PN5A 1MHHA 4X8XA 3ZSTA 2F08A 1T1ZB 5DK0A 4WU5A 1G9NC 2YKKA 4JFHD 4BFIB 3MRFB 1XGYL 4M43H 3F6JA 4X6FB 3V95A 4AC4A 4MMXB 2WD0A 4KROC 1LEKB 4DAGH 2ZF9A 2DIEA 2VM3A 4PUBL 4XPHH 3DJRA 1IE4A 3P4NB 3GSRB 1LE9A 2OZ4L 4RCAA 5DC2A 3ULVE 3CVHH 1ZHNA 4Z7VF 4F8LA 3HZMA 4R8WL 2HKFL 2UZXA 5CXPA 3TH4T 3WJLC 5AQ0A 4K3JL 5HGDA 4BFOA 3RTQB 2KUTA 2YAFA 4MNGE 3JWDH 4ODSH 1Z5HA 2WZPA 5C7XL 3DIDA 1BF5A 3QDMD 1RZKH 3IXAB 3MMEA 5DRZA 5GQBA 1FG2A 2HX7A 3PABB 3BZDA 4IDJL 5CZXC 3P0GB 2BX5A 4I5BA 4PRDA 1OY3B 1N8ZA 4FEIA 1BAFL 2GITB 3QJHB 5AZEH 3V55A 3MRKA 5JPMA 4FX5A 4E41D 1DR9A 2FDBP 3HW7A 3OG6B 4KTGA 3CAFA 3IF1A 3L7FA 4KVCH 2OQJA 3DV4A 3ARFC 5DUMH 4YBHA 1I1AC 5I6LA 2Q1EA 3NP4A 1OP9A 2WBJB 4AJYV 2HG5B 5DUPH 4O9HH 1M2VB 4P2OA 1F11B 2YBRA 3VVWA 4YJZL 2V2TA 4JM2C 4XNAA 5C0ND 3VDCA 1SUJA 2P1YA 1A6ZB 4H8UA 3QI9C 1IM3D 3KPLB 1MCIA 3VXUB 4NNPL 5ITBL 3FUIA 3I2CH 3LH9A 4Z6AT 1ZSDB 1CL7H 1PD1A 2RD0A 1J8RA 4NKDB 3ZL2A 2OK0H 4Y4HB 5ANMA 3HI1B 2OMTB 1DBBL 2F1BA 3DV6A 4P2RE 4UM9A 2E7CA 4HVBA 1IMHC 1GGTA 4LPXA 4CJ0A 2X87A 1N7MH 4IDLA 4YEFA 1QW8A 1TTUA 4HMEA 1MIEL 2FIKB 3U4AA 3VQLA 2BSCA 1ZAGA 1DLHA 1EDYA 3VGEA 1P7QD 3JYCA 3VD2A 4MTMA 3F83A 1DJZA 1HL9A 3FCTB 2F58H 3QPXL 3RTLA 3RWHA 1T0MB 3SQOH 4AG4H 2FZ3B 3N1QC 1ACYL 1HE8A 1MHPH 2FUTA 4DP0X 2EDBA 3K8MA 4QRFA 4WUUE 2ZCHL 3RVWD 1KNOB 3MBXH 4BK5C 3LZFL 3QHFH 1AHMA 3FCUB 1HL5A 2FO1A 2RAMA 43C9A 1TFPA 1TIUA 1F56A 1SM3L 1NGQL 3EF7A 4G43B 1K8DA 4HKJB 4I3SL 1NOFA 1E4KA 3OTTA 3ALXA 1AZUA 1RUPH 5AYUH 4PVBA 4P5RA 3K6OA 2Y2TA 5IHBA 1R0AH 3CMOH 4KXZI 1UXSA 1HHHB 4LHQB 3G3LA 3LXUX 1XH3B 4WU7B 3JVGA 3DRQB 3F5WA 1DQDL 3KNBB 3H9SE 3GEWB 2BFVL 4YE0A 3ZYZA 5I1CL 2YPLB 3SE9L 4P07A 2VXTL 3L5JA 1MVFA 3QULB 2YGPA 5HYSA 2QZQA 3RVUD 1T22A 2ZUQB 3LD8C 3RWJA 1U8MA 2OULB 1S5HA 2VDPB 4G7QB 5DXWA 4JPSA 3NJMA 3KJ4C 2R0LH 3V0VA 4UQIM 2HB0A 4IK6A 4XP5L 1BX2B 2IAMA 3HI6H 5JA9A 4OTXL 4C57C 1FNLA 3VFVB 5I73B 4Q8BA 5FA4A 3POCA 1MY7A 2Y4SA 1LO5A 3JXAA 4LDOB 3V5HA 3F7VB 4DEUA 4QRRD 1PZCA 5ID1A 1NCOA 4KK9D 1IV8A 4NM4L 2NSQA 1LNUA 5AVYB 4XO5A 5JORB 4L1TA 4GRLA 3HBZA 4AIZB 2AK4A 4P49A 4R3SA 3GGWA 1FZMA 5HGBB 4H2AA 4HOXA 4MQSB 1OPOA 3ZR5A 2J8UA 4GEIA 4NZUH 2DIJA 5DK2A 3SE3C 4MJ6B 5CZVL 3NSYA 4IRJA 1ACZA 4PRBB 5M94B 3GD1C 3GB7B 4FG4A 4WVRA 1CFQB 3OGOE 3DGGA 5A1AA 5EBGA 1CF1A 4JMXA 1G7PB 2YKLH 5KJRL 2AC0A 2F7PA 4Z3IA 2XG4A 1JZ5A 3RP1A 5GSVA 3FQNA 4X7CC 1XIWB 4Y2OA 5F1IA 3KLLA 1SY6A 5E2TH 4L4TB 1ET8A 2AQSA 5F7DA 3H1ZA 2FGWL 5AB1A 1FFOB 1XF3A 3HNSH 1I3GL 2ADIB 4O5LH 4JE4B 4JG0H 4PGCA 5J57B 1U2YA 4HC1A 5DJ2B 4BZ1L 1MFDH 3D25B 3HNVH 3NRPA 3MR9A 1WT5C 2D3LA 2VC2B 4POZD 1USZA 4ELKA 4PJGE 1YYLL 1KGCD 2XWXA 4FQIH 1CLVA 2NX5B 5E2WL 5IGXL 2RIKA 1OGAB 1JK8B 4PJ8A 2QGEA 3UTSA 3D9AH 3ARGC 3E3QC 4N8VB 2C1OB 5C07D 5I74B 3WTXA 4PJCB 2Z8VC 3BT0A 3T04D 4N0FB 3VRJB 1QNZL 4LSVH 3VE0A 5GGUA 3R1GH 1GS8A 1EJ6A 3P1VA 5IVXE 3SPVA 5KS9B 4FTVD 5LWYH 5HBBA 1I1YB 1ZHKA 3U79A 1AD9A 5CEZD 2PO6C 2G60L 2WWNA 2XLLA 1NC4B 3VFPA 5IW3A 2YAHA 1MFEL 2H0JA 3MV7E 2I25N 1I7TA 2DQFA 1MCNA 1CE6A 1ZMYA 3OKKB 2FR4A 1R24A 1BQLH 1T7YA 2G2RB 1BEYH 2A4ZA 2EE0A 3JT0A 5B39A 1Q8MA 1LO2H 5HHVL 2A4EA 4HKBA 1LEIA 4MA3A 5C2BL 1RZGB 4X4ZA 2FX9H 3MNDA 4HC1H 4JRXD 3P4MA 2IOOA 3DXAD 2YLHA 3ABLB 4JN1L 3SQBB 2VDRL 3CVDA 2ZUWA 5ETUA 2B39A 4NO2B 4WK0B 1QP1A 2VN4A 4KGLA 4NWTH 2A1WL 4PP1D 5GHWH 3P0YL 4JPVL 5HDRA 4FABH 3WMQA 5DJYA 1A4KB 2NSMA 4OZGB 4ERSH 2NLJA 2W60A 3SYAA 2G3ZA 1NUFA 4IMKA 5DJ8A 2RA1A 2EYSA 3SY6A 1TQBB 4MNQA 5K1NA 4MMYB 5DGQA 4YZFF 2WZ0A 1O7SA 4DCQA 4V1DE 3QYNA 1AZNA 4TQHA 2QJDA 3FB8B 5F1OB 1J5DA 2A9DA 3B9KA 4L0ZA 1G7IA 4NC1C 1ZVNA 2E9WA 4P5MB 4UNTA 3WAKA 1HEZB 4YO0A 1Z9PA 5AVWB 4NHCH 5CILL 1CBVH 3SGDH 3ELAT 3OQ3B 4RGOL 4HXBH 5JOFB 1EAQA 1ITCA 2QSVA 3KPSA 5DFTA 1KY6A 3I6LE 3K3QA 5BNXD 4MNHA 4JHWL 4RGMC 3EBGA 2FBRA 1BD2D 2L7QA 2XIIA 5DJ6A 5C86A 4KKAC 4OLXL 4TYUA 4CNIA 3PWNA 4MX7A 4JHZA 3SHSA 4MGXA 3AY2A 4GQ9H 2PWHA 1JV5B 3BEWB 5CLYA 1IZJA 4XMPH 4LAQH 4P23D 4LARL 1O9ZA 2PW2A 3WS6A 2OMNA 3BCDA 3IMTA 3C5ZD 2GIXA 4N6RB 3FQ2A 1MJ8H 1W0WB 4JLRB 3ULVF 1JF5A 4BFKA 5T3XE 1UCTA 5SV4A 1RK1B 2JI2A 2J4WL 2RH0A 3FDWA 5I28A 4XXWA 1NMAH 3MLYH 4WI7A 5D7HA 4AQ1A 1KCWA 2V7HA 5EBWB 5J12C 2J55A 4NIYE 2QHRL 1A7NL 1QTPA 2IANE 3EGDA 3U7WL 5A2KH 1PSKH 5F3HB 1EHXA 1YNTB 5ESVA 3HBQA 3X13A 1UKQA 1E43A 3C6LD 4ZAKB 3BH8A 1IARB 4LPYA 1VGKB 3BVNB 3THML 3R7QA 3O0RH 1G7JA 3KL0A 4U2YA 1FN4A 1F58L 1B6UA 4H0LC 4J4PC 1FNSH 4CGTA 1H8SA 5IVZA 5FV1L 4HWEH 1XVSA 3O45A 5HYFA 3S4SG 2AXGA 4QHMB 4L18A 3BW9B 4X9FA 5EU6D 1MI5B 1WDAA 5SX5H 4LIQE 1UXWA 5DI8A 4P2QE 4M6ML 3SDCD 1KJVB 1YVLA 2OSLB 1DUZA 1ZXKA 3SGJC 3OR6A 1TETL 5F0PB 4IKJA 4M3KB 3RLSA 1R3HB 2H3NB 5BMFH 5K9JH 1BZEA 4Z3FA 1PY4A 1B88A 2HLAB 3OC8A 6FABL 3QJZA 5KWYC 1D9KD 2MSPA 5SX4H 3RIAK 3UYRL 4X6EB 1YZZA 3CUPB 2EICA 4KOCA 3RDTB 2QADC 3A4DA 4H8HA 4FZEL 4L9DA 1I1FB 3NA9L 3EGSA 3QQ3A 3BN3B 1FDLH 3MRCA 5G4OA 1JG9A 4MJIA 3H6JA 3O2VH 4NRXA 5E1GA 2XTJD 5JXAH 1HILA 1XF5B 4UV7H 5C0CD 3BQUD 4EN2A 4LGRB 1PZ5A 4PMFA 4UTAA 3VWKD 3P2DA 3D7PA 1AG6A 4NUGL 4KMLB 1EO7A 4WWNA 4MZIA 5I6OA 1TR7A 2AQQA 2CLVB 2PPFA 3ALPA 4KO6A 4G6JH 1RUMH 2BW4A 1BZ8A 1VFBB 2EIMB 1P7KA 4IOSD 4OAWA 4OCXH 1JYXA 5C0DA 5DD1H 3JUZA 3T0ED 4HEME 2AFNA 4PS4H 3CSFA 3NIGE 1TEGA 3ARSA 3X17A 2X4OA 3WIIH 1NINA 1OCCB 2RQ8A 4P9HH 5CBAB 2ZUVA 3FJTA 2HT4C 3U9UB 3NJJA 3FK3A 1G7QA 3EJQA 2P8PB 5DHVB 1RZIB 1RU9H 1IAIL 2OJZL 4MAYC 4DP6X 2F53D 3VFMA 2I60L 3SN6N 3FB5A 4FP8H 1U9KA 3IU3A 3DTXA 4KPHH 3D0LB 4KZDL 1JHKL 2AJVL 2GUYA 2R4SH 3QUMB 3FO9A 3O8XD 1XSIA 4Z18A 5H4YA 1KEGH 4PMEA 2X0UA 2O5YL 3HJ0A 4UTAH 5BUAA 1GGIH 2ZXWB 3UTZB 4PR5B 4Y1SA 5D72H 4DJMA 5J56B 1EEZA 4LSQH 1KGYE 5E6YA 4XPAH 1TJHH 1U91A 2WQUA 4RGNB 4AK2A 5F7UA 1SVBA 3TFKD 2NXYB 1F1AA 3QUYB 4DGYL 3WY2A 4K8RD 4TV3A 5I1AA 2HX9A 4S0HA 4OGZA 3ZE2B 5CR8A 2DW5A 2A9BA 3L5HA 4UIMB 2TSAA 5IB3A 1QI4A 4FNPA 1C5CL 1KTCA 3CHRA 1UT1A 4RMBA 4WO4B 2AZAA 4PJ7E 4QI3A 3FOMA 2NY1C 3FU9A 1HCZA 3VA6A 4CC4C 4F2EA 2NY0B 4DH2A 1JFQL 2JJVA 5T33H 1NCHA 2CKBB 4K07A 5ALBL 5SWQA 4D8OA 1NMCB 5LAXB 1KCUH 3TIEB 4KVNH 1FFQA 1IM9A 2BSSB 2K6ZA 4AKOA 2X9YA 4U2ZA 1EZSA 1GYCA 4N2DA 5DHEA 1CICA 3MQIA 3O9WB 3GI8L 3ULAB 1B9ZA 3LSOA 1YPZA 2F9BT 1CTOA 5EC1B 1ZTXL 2Q6WA 5EF3A 4YGAB 5CZKA 4NZRL 3JYBA 3OAUH 3WHE0 3X3GL 5D1XE 5F9DC 2RCSL 4NDMB 2CO4A 2PCYA 2KDYA 3MNZA 5HGAB 4FZ8H 3KE0A 4X4ME 1PJ9A 2VR7A 4DVBA 3ZRFC 3CK0L 3V0WL 4HQQL 2HRHA 1HZLA 1LO3H 2ITDA 2CUMA 4UT9L 1UVQA 4G6KH 3RWFB 1RHFA 4WKZB 3S3SA 4OUUA 4M29A 2CR3A 4KHTL 4MZRA 1FF5A 1T5XB 4YPJA 5JW4Q 4LBEA 4FI6A 1OQOA 2LAAA 1NCBH 1N5AB 2ZD0A 4APXA 2QVKA 2YXVA 1WTGT 3L9BA 4WENB 1GYVA 3VD0A 1GGUA 2XQYA 2ITFA 4QOKB 5I1IL 2LR4A 2ZKMX 3OLDA 4KRPD 1AI1L 3OZLA 2F19L 4LCWA 2ICCA 4WV1C 3F7LA 4JG1H 1NLDL 2R0WH 5I75C 5CP7A 2DQCL 4ADGA 1P4IL 2V2WB 2XHNA 3LKPA 4B0MM 4K71C 4U6XA 1G1YA 3D4CA 4W9JC 2WB7A 4HCIA 2W9EH 4XC3H 7PAZA 4O2CB 1NDGB 1TQCC 1NCAL 1HNGA 3HPJA 3NSJA 4WWKB 5T3XL 1KGWA 3TYGL 2HN7A 3IMUA 2ZUTA 4KK8C 4U1NA 3VSUA 2DYSB 4OLEA 1YMHA 3TXAA 4JO3H 1XGUA 2DQJL 2YAQA 5I1HL 3ULUC 3BPOC 1MZYA 4MB3A 4K0OA 4KDVA 1TVHA 1HEHC 2VDMB 3T6VA 5C09D 3BI9X 2X9ZA 5FCUL 3CC1A 1XO8A 3ORJA 3NQIA 1U3HB 5T1MA 2Q3XA 2Y1AA 3UTTA 4AOFA 1I75A 1XF4B 3F05A 2J5LB 1THAA 3L3GA 4FQJL 1NEZG 4HWBA 4N2FA 5T1KD 2OMUB 3C60B 4R26L 2JCCE 4ZX5A 2XWCA 1QPXA 4G82A 3H3PL 4FQCL 3V6FA 3AWEA 2H3KA 1I1CA 5AW2B 1S9VB 1XHHA 5GIRB 4I2XA 3K2IA 1BQHB 4EVNA 2OA9A 1YEWA 4ORGB 4ZFGH 2O5ZL 2Q3AA 4M02A 3VYPA 3FO2A 1J1XH 3U9PH 3VXRB 2IH8A 3MUZ1 3SDAD 5CBEA 2WWKO 1S7QA 4HCFA 3QQNA 1OCWL 4GMSL 5D1QD 1JPST 1YMMA 4OLWH 1ZGLM 4I0PC 2XPGA 1HHKA 1XAUA 4OT1H 3FT2A 1F90L 8FABB 4FMKA 2OMVA 3T77B 4AGQA 1KXQE 1MCFA 1YN6B 4KQ4H 5MERA 5DJXA 5D2LE 4JFED 2PCPA 2KS0A 3LN5A 3SY0A 2WO4A 2NYYC 5BZWB 2GFBB 1JGDA 1QVOB 5K33A 1Z5YD 3QRBA 2G5BA 2ZONA 3DVNA 2I9LB 3BAYA 2WQVA 1DDHB 1KGJA 3HVNA 4Y19A 3V0IA 2V33A 1O5DT 2BIQA 4PLOB 1FGVH 2XNAA 1L4IA 1IBDA 2AERT 3IPBA 4ZSOA 4OD2B 1UD6A 3QYCA 4M5ZL 2CUAA 2JKIS 4HWBH 4HHAA 3SE8H 3U7YL 4FYRA 5FHBL 4XHQA 4LSRL 1PNDA 1RP9A 3AMLA 1QASA 4DZBA 5IW1B 3WJLA 3QQ9C 3G6JE 2ED9A 3QORC 3HS9A 1PLCA 3OXSA 1RZFL 4NN6B 1NBZA 3MFFA 3N40P 4P48A 3L95B 5FOBA 3V4VB 1Z9LA 3HA0A 4KMTH 4UU9A 4DQAA 4KITB 2KZ1B 4MB4A 5D7IB 1G9MH 3ZTNH 1YEIH 1PIFA 2WIMA 3HG1D 3HS8A 4GG6A 2CJUL 2QSCH 2XFXB 3EGXB 2RJMA 3FQTB 4PIRF 3CXFA 1FYTA 4HX1B 5ACLA 35C8H 2CGYA 3QHZH 5DURB 5BXFA 4ZTPH 3AT0A 4YWGH 1DUYA 1KPUA 4MMZC 4UT7H 3RY6C 3II3A 3MBEC 2ZQKA 1DBKL 4HDIA 1PX4A 3VGHA 4RFOL 5B7EA 4I7ZC 1D5ZB 1I1AA 1U8LA 4OIFA 5H4ZA 3EYUL 3WNIA 3WDJA 1B2YA 5HTSA 1FLRL 3CH1B 2MRYA 3OKEB 1RIUH 2HLFC 2ARWA 4HWZA 5AW6B 2GABA 4GKLA 3RGVD 4QO1A 4UZGA 4DP2X 3QI9A 3N1PC 4JJOA 4Y16C 4W4OA 3NACH 3VFGL 4FG6C 2XBZA 3M17B 2OMXA 2G3NA 1CE1H 4NQEB 2YAPA 3C5JA 2OZNA 1YEEH 2MQGA 3UMNA 1ADWA 3OJDA 3ARDC 2Y07L 1N5YH 3NSFA 4RAUB 3JTSA 4JM2F 4HIIB 2IGTA 4QGTA 2W91A 1NJ9A 5AVZB 4RA3A 4I87A 4IGBD 3AXLA 1S7UA 3K7UA 1I8LA 3SBPA 4EDWH 3L08A 3QUXD 2CNZA 2Y7MA 3N85L 4LSUL 4WI8A 1NSNH 1SYSA 2X6UA 4B9FA 3PHOB 2ZX5A 3AZUA 4X4XA 2XWZA 3FQWB 2PP7A 1TZIB 3P3UA 2X7LA 1LP9E 1ZLSL 1HH9B 3GSVB 3I75A 4NQXA 3GMMA 2OYKA 4BK5A 1I53A 4NZDA 2ZOWA 5DMKA 2A99A 25C8L 5IHUH 1EJOH 2FQEA 4NP9A 3RG1C 1LD9B 2YJQA 3LKRB 4U1KB 2CBPA 3B2UD 4KFZC 4L4VA 1B90A 3S98A 1CLCA 4MQ7A 4TSCL 5G2NA 4IQHA 4LHUG 5DJ0B 3Q48A 1WHPA 2IBZX 3KD4A 2GT9A 4JK0D 3CFTA 2O6EA 2NXZB 3HE6B 1S9WB 3AMKA 4FI8A 3QWRD 3VD1A 3U36B 3FUJA 4QD2E 5GISL 4JY6A 5E9DB 2K3TA 1QO3A 3HMXL 4PJ5B 4L3ED 4MDRA 4XCFL 1E90A 3I50L 3FUFA 2PXYD 5LCVL 1J0KA 5DD3H 4JFPB 3RX7A 5FW8A 4DK5A 4L8DB 4Y2DD 4Y1AB 1BYNA 3WN5C 4ZS6C 3PHQA 3QDMB 3S8WA 3NIFE 3SCMB 1ID2A 2ICWJ 5BUGA 1OAZL 2CDGB 5A43C 1N0XH 2XCMC 4TVSa 2Y69B 1A21A 1RK0B 2XN9B 3B5GA 1XF2B 1ETB1 3B3BA 5CN3A 1H6UA 1DVFA 5FB8B 4PWHA 4AE1A 1LO4L 4ODVH 3FQUB 4E41B 1AE6H 2VQ4A 4HPYH 4BFBD 1FL5B 1MF2H 2R0ZH 2TRYA 4XP6L 1EDHA 3SE3A 5DLML 3MCLH 4LLQB 1G5AA 3AQDA 2E76C 2XY2A 5JHBA 2ZYHA 4AIEA 5TJWK 3WLWC 1AFVH 4QYAA 2XA8H 3FRUA 4GW4A 2WLKA 1X5ZA 2DMBA 3IB4A 2ZXGA 3UG3A 4WEUD 3ATEA 1LK3L 2WNGA 1IM3B 3BQVA 2ZUYA 3H9HB 3MU3A 2WWOA 1RUQH 4G6AD 4S1RH 3T6ZA 2IGFL 2VN3A 3OF6D 4HH8A 4K4KA 1ORQB 4UB0H 4JDVB 1NCDH 3AM8C 3K0YA 3ECWA 1UWGH 3ZE1E 1PJWA 3V9FA 1D5IL 5HJ3A 1YAIA 2Y7LA 3T2NL 1SOQA 3NJNA 5DMGD 4ZUTA 5EBLA 4R96A 2HYMA 3ECBA 5C08D 2HJKB 3KPQA 1O6TA 1J9SA 3QISA 4MMXC 1NUDA 5FYJL 4BA8A 2ZUUA 1P7QB 2B3IA 1EZVY 3TEXA 3ML8A 2DICA 4JGNA 4X8GA 2TRHA 3GSUB 3ARGA 1XD1A 4EUPB 1EFQA 2GC4C 4YHOH 5E2VH 4MCYA 3KYAA 1F18A 1CFSA 2FLBT 3GFUA 1RZ7H 3NDYE 4HS3A 4UMSA 5ILTL 3RTQC 4A37A 1WA2X 3VSVA 4UIKL 1FNFA 5FM4A 1X7TA 2W9DL 2EDJA 3AGVA 2PO6A 2JKJA 2A6IB 3NTCL 4LCUA 3VXTA 1U6AL 3CSPA 1H15B 1I7UB 2ITCB 3FT0A 4CU6A 3DJSA 4XCNB 3UC0L 4DERA 2R8SL 1M7UA 5ICXB 2CE6A 3G6DL 3PJSB 4NBYB 4J27A 5KUMA 5DF0A 4LCCA 4QXGH 3BLKA 3KEDA 1NCJA 4N24A 2NUTA 2OTUB 2CK2A 4LVHB 4R5TA 4A2LA 2MHAA 5EEYA 3PREA 2EIKB 4PRAA 2YAMA 4YHLL 2WBJC 5I0ZA 1A6TA 1DO6A 4AENB 2Y36L 1T4KA 3QQDA 1OKEA 1SNRA 1V5JA 2BOLA 2F15A 1WBXB 3FFDA 3LEXA 2JCCF 1CVSC 3GKWL 4PJDA 5CJ5A 3GXUB 2A38A 4I3RL 3LMJH 4YEEA 4RBPK 5IJBC 3B7TA 4RDBA 4Y4HC 1A6UL 5EO0B 4KH2A 1Q9OA 4QRRB 5DO2D 4WW2B 2XSKA 3NAAL 4I13B 5EF0A 4W9EC 2PPEA 4IM8A 1FC1A 2W65B 4H8WL 1U8JB 2WKOA 5F7EL 1RY7B 3BGFC 1ZTMA 1DEEB 3AAZA 2VITB 4M93B 1QPKA 3BWSA 3HRZB 4MDIA 2X44D 3ARED 4LGPB 2BCKA 4LPWA 4PJEB 2NZIA 3F3HA 3NK3A 2YEZA 1QYGL 5D2LF 1MRFL 4XVUD 5TFSL 4AYFA 3LPFA 4O02L 5I1GL 5CD3B 3FAWA 2F6AA 4HJ0C 4LSTL 1KCBA 5E4EB 3J2PA 1OP4A 4RDQF 3NRFA 5T1DH 3BFQG 3ZT7A 2ZOKA 3QWNA 1FVDB 2F5AH 2KZKA 3PQYA 4NFBA 3WS3A 3S4SA 2MCPL 2DJUA 3ZOAA 5J13B 2R2BA 1BDYA 3BAEH 1XXFC 2X70B 3EJYD 5TK2A 5JNYB 1SUHA 1R1CA 4FG2A 1JPFA 4ONFH 2VN7A 5B1JA 2EDNA 1AXTL 1RZJH 3GMPB 2NR6D 4NKOA 4IJ3B 1TU2A 4K7PX 4U1IB 5EG6C 5JW4N 5JW3H 4YNYB 1ZIAA 1P69B 5IR1A 1Z9OA 4N5EC 4ABUA 5KSVB 4WSGA 3S34L 5C07B 3B43A 5ANME 3MA7A 1A3QA 2XG5B 1XGPA 1G7HB 4YXLH 2ZUQC 2NW2B 2OXHB 1T2XA 1QFWM 2BVPA 2X6MA 3DLQR 3IDYB 4BDVA 4BGLA 1WWAX 4G8GD 1NGXB 2WCSA 3QQ4B 4OF7A 3MTRA 1S9XA 4JW3A 2XWJA 3IFNL 5I73C 2YEVB 2ICWI 1SOKA 4M7KH 3ESPA 2EIJB 1SOXA 5D93C 4Z0XA 1CD1A 4J4PA 5E4AA 4DQOL 1ZVSA 2RB8A 1WRFA 4BKSC 2FL5A 3BAIA 3IK2A 2BS8A 3X1FA 1RPKA 3T6XA 3LHPH 2HTKC 3LN4B 5C6TL 1YCSA 4N9GB 4G8EB 4K2UL 3QJXA 4KKNA 4XN5A 1ZV9A 3GWJA 1R3LB 1BYOA 1KTLA 4Y5XA 4MWFA 2GCYB 3FSVA 4JRXB 1DL7L 1L0PA 2N4IA 1G1OA 3EG9B 4FFYH 5D7SH 4ADIA 5EULV 3O4LE 2DIAA 1EGJL 1NAKL 5L4FA 4KVPA 5MEPA 3BOVA 1AY1H 4NRZB 1FWXA 4OIAA 4ANKA 4HIEB 4WHDA 4X9GA 2Z35A 2UWEA 3NH7L 1QSFB 1XIWC 3RIFF 4M8UA 4YQXH 5AZ2H 1FZKA 2R1YA 3HI5H 4WGVB 4RETB 3VFSB 3MRRB 3BKCH 1TITA 4UZSA 1I85C 1UXLA 2L7EA 3M88A 3BEVA 3FHQA 3NCBB 2X3CA 2QVMA 5DEGA 5I71C 1I9RH 2X1XR 3OAZK 4QHUA 1MUJB 3MO1B 4ZMVA 5JIPA 3IGAA 2W07A 4ZUWB 2QR0A 1FNGA 1MCWW 1NANH 5C0BA 3Q3GA 4EI5B 1KFAL 2VAAA 4OF0A 1E0OB 2O6DA 4PGJA 1CYGA 2G0LA 5JHDA 1IFRA 4R7NB 3T3PB 1Q1JH 4LHJB 3CSYB 3S6CA 4UQ2A 4XN9A 3DMMD 1TTBA 4I1RA 4IHOB 3CE1A 3NQKA 3FTSA 3FXIC 4I9XA 1BD2B 2DTML 2ICES 4NUJA 4YSRA 5AKRA 2Q7NA 4DN4L 5BZXA 1JPGB 1F45A 4PRNA 3ZDXE 2AK4E 1NBQA 3ZW3A 2VDOH 4YSDA 5C1MB 2R56H 4DVRL 4XCEB 5DD6B 4OCWH 1TVBA 2J8UE 4HS8H 1QEWB 1A4CA 4NP4H 1X4YA 4WWOA 1MN4A 1CYXA 1IAKA 1Z9NA 2EEAA 4P23B 3PAUA 4WI6A 4BFJA 3C5ZB 1MRDH 4X6DA 2O1AA 3L4XA 4ATWA 1IAII 4NPYA 4PBWD 4NQDD 4A2DA 8CGTA 1SOSA 2NTFB 1X4ZA 3DARA 4LLWB 5IB5B 2DKMA 5KBDA 5JIIA 3IN0A 3QCTH 4Q2ZB 1RQ5A 3NIFF 3S35X 4M43L 5AD0A 2EUVA 4AQZA 2ERJB 3HC0B 1MCKA 5IMKA 1SGKA 1AC6A 5T5NG 4DAGL 3GSWB 5FC9A 4LLVA 5CO1A 3SKOB 3GXFA 4XPHL 1DBMH 4N8VG 3ZKND 1LO0H 2PTVA 3QIUD 3Q8FA 5F8QC 1RMFH 1DSWA 1MPAH 3LN9A 5BCAA 5KVDE 3GSQA 3CVHL 3EOTH 5FO8A 4TUKH 3X2QB 1JHTB 5CIPB 3GIZH 4WHYG 1QBMH 1TQBC 2JE8A 1C7TA 3UTSE 4ODHH 3QIBB 5HDOA 3JWDL 5BUPA 4ODSL 1R6VA 4RMWA 2FLMA 5KJ4A 3PWLB 1O6SA 3TH3T 1RZKL 4P2RD 5EU6B 1KJ2A 3LJ3A 3WL9A 2F5BH 4CSTA 1JAEA 4GAGH 4CC4A 1GOHA 5T1LD 1JWSA 2YGNA 3RUGB 3U2SA 5L2KB 5IHWA 3AU1A 4UOZA 5AZEL 5E8DH 4CW1B 2IWEA 1W0VA 3CLFH 3PGDB 1NAMB 3BH4A 4JZOA 4WK4B 1DFBH 2V8LA 3ZE1F 1D9KB 2C3HA 5F96H 1KIPB 5DUML 5KBNC 3QRGH 1M57B 2WHVA 2Y1VA 3KDMB 3HAEA 3T3PF 2YAOA 1Q0XH 1OWRM 3AQXA 5DUPL 3MI6A 4O9HL 4BFFA 1XGTB 2WVTA 2WUBL 3CJJA 4W6WB 2C26A 3P9MA 3QH3A 2X0VA 2ZSWA 4X6CB 4AZ8A 4F80A 5I26A 3IWVA 5E9NA 1A1MB 1BSIA 2MNUA 5DYOB 3N1MC 4XH2B 1JDAA 2XTJB 3I2CL 1H0DA 2EEBA 1CL7L 2VH5H 5C0CB 5E6ZA 2OK0L 4XBPA 4DKFH 4CVXB 3W82A 2KPWA 5E8OA 2XV0A 2G3MA 4AVIA 1AOHA 5ISZA 2BOCB 2R23B 3IDJB 4JHBA 1QHQA 3U2JA 3DUHA 1T0PB 1BEXA 1DEDA 3DUSA 1EUTA 3IJSB 1YDPB 1IRAY 2V5RA 3H9SD 4L5FH 5AKTA 1JZGA 4N0UE 5FF6B 2VE6B 1TDQA 4F7PA 4OZ4A 3HZYB 3LRKA 3CX5K 1KJ2H 1R3IL 2JJSA 2EUWA 1OW0C 3FU7B 1EAJA 3T0EB 1ZD6A 3FQYA 1MLBB 3NPZB 4ISVB 4ZAKC 3SQOL 2DWDB 3MNVB 4AG4L 4HOZA 1XXDC 1F41A 2DEYX 1MHPL 4JPIA 1NEZA 3ESVF 1GPOH 3B8YA 1A14H 2H7WA 2NUPA 2H1LM 3MBXL 2V37A 3QHFL 4CDHA 4PYGA 2JB6A 3A4AA 5F1KC 2RR3A 2D7TH 3M86A 3VI4E 2F53B 3ASNB 5AYUL 1RUPL 4A6YB 1JXFA 4YUEH 2H0FA 4LAJH 1E4XH 4JAMA 4ICWA 3CMOL 5HVGB 3TVMD 5IP4A 3IGKA 4KKPA 4HUUA 3T2LA 3CLEH 4L1SA 3L3KB 2E9JA 4G8FB 4JFTA 5HDBF 1ZS8B 4ZXBD 3ZTEA 3JV6A 4ABQA 1TQUA 4UYPA 1YEHH 4DP8X 5I66A 4MQTB 3BGMB 4PWJA 1DVZA 4TXVB 1OCRB 5EF1A 4XNZB 3WJJA 3QO1A 5TQ0H 3HKFA 3RDTC 5C0FB 3W11D 3IDIA 1KGUA 1IIIA 1NC2B 3BIKB 3FB7B 5F97E 1ZJBA 1J0JA 4JDZB 2DH3A 2VIRA 2FEDD 2B1HH 2GTQA 3HI6L 3ZT5A 3HS0A 1HHGA 2I9TB 3IMWA 1ZA3A 2CMRH 3ZUNC 3ARQA 3S37H 3WE6A 3T1FA 3ULUF 3EDKA 5C0AB 2LQRA 3EYVB 5CUSH 3TYFA 1PVHA 1F6LL 5C0RH 2A6KB 4GY4A 5AW3B 1HEJC 5BRZE 3OGCB 2YQ3A 4G42A 4Y88A 1TMCB 1LQSR 3TH2T 3EYQD 4NZUL 1ROWA 1MIMH 3MN8A 3MRLA 4OKDA 4X5WB 2YMOA 3BRFA 4NB7A 4JKNA 4R7DA 3S5LB 1JSYA 2IIJA 4I0PA 3P54A 4OFKA 3SPCA 3RI5F 4FQ1L 3WTWA 2L7UA 3FU6A 4PJ9D 4P8QA 5I8OH 4ZNCD 1M71A 4Z5RA 3N3EA 3MRNB 4IBYA 2EVFA 4EXPX 1J0ZA 1JIBA 2JIXA 2GTWB 4LF3B 1JD7A 3L3HA 2AQPA 4JN2B 3FSOA 5E2TL 3DJZA 1IILE 4WEBH 1XMWA 3BHBB 4XGZB 1MFCH 3JZ7A 3A6OA 3MV7D 3HNSL 3KPOB 5KVEH 4O5LL 1QFHA 4PB9H 4JG0L 1A2YA 2PMZA 4R4FH 4S2SB 1MFDL 1JNJA 3US9A 5KOMC 3HNVL 1HOCA 3VFNB 1QZ1A 1SFDA 4J3OD 3FAXA 3GMLB 3I3EA 2QL1A 1BZ9A 4MJIE 4WO0A 4FQIL 4NZFA 4H20H 4F7MB 1BQ5A 1S7WA 1PZSA 2HMID 3N1GC 3D9AL 3BP5A 3QORA 4JRLA 1BFTA 5GS2D 4Z7WA 1Z1WA 5B1AB 3U4KA 2NXYC 3QUYC 4RMQA 2KKQA 4LSVL 3N91A 3WY1A 3HFML 3FF8A 3R1GL 3DC0A 3MX0B 2JI1A 4HFUH 5LWYL 3UC2A 4NOFA 1BQRA 2R2HB 4JFYB 1JTPA 1MCOH 5TQ2H 4WO4C 4WHTA 4HUVB 4N0CC 4AQEB 2ZG2A 2ZX6A 2JELH 2D7OA 4MMZA 3GBMH 4UQEA 3LB6D 2CHNA 2NY0C 2A83A 4X7TA 4ZX6A 1WWCA 1LDSA 1BQLL 1HDMA 1OALA 3AJ7A 5DJCA 1BEYL 3UTQB 4BUGA 1NMCC 1SY6L 1LO2L 4K9EC 1XH1A 4NO5A 4TQEH 3FT3B 5IESL 2EXSA 1ZT1B 3O9WC 3PWVA 4BH7A 4HJJH 2H32A 2FX9L 4HC1L 2CRIA 2RALA 2IVFC 4NJ9H 1JZ4A 3I6LD 4PRHA 5C09B 3WUWB 3F84A 5HY9B 3N9GH 3SYPA 4YBQD 3CFDB 3KGSA 4QLRA 1T5WB 1KLUB 2EKSA 3MJ9H 4XTRC 3EFOA 4LHUA 3PWJA 4MJ5B