4W9LC

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 35
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9lC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9lC01
4W9FC 4W9CC 4W9EC 4W9LC 4AJYV 3ZRFC 3ZTCC 4AWJC 4W9IC 4BKTC 1LM8V 4B95C 4W9HC 1LQBC 4BKSC 4W9DC 4W9JC 3ZUNC 5LLIC 3ZTDC 4WQOA 4W9KC 1VCBC 4W9GC 3ZRCC 4B9KC
chains in the Genus database with same CATH superfamily
1AFVH 4F7EB 5JPNC 1ZK9A 2IH1B 4M1GL 3PWJB 4F15B 4PRPB 5IQMA 3KGSA 2FRGP 5I1IH 4G3YL 4XNYL 3WIFA 1T03L 3X3GL 2GJ6E 2W0PA 1CF8L 1IC0A 4ZUSB 1WQVT 1AQKL 3RZCA 3HMXA 1OP9A 5HJGA 4PRPD 5SV3A 1G7MB 4PLOB 5J1AA 3KLDA 4P46A 4Z0BH 4GG6F 3BZEB 1HSBB 3KBEA 4FQXD 5KYUB 4MDJA 4NNPL 4LEBA 3MLSL 4GSXA 2HRPL 2CDEB 2YK1L 4RGNC 1PMYA 1ZT7B 5F7LB 3IRCA 3O3BB 2FEJA 1MXDA 3FFDB 5IV2A 1Y6MR 3FQNA 1FCGA 2EO1A 3UGXA 4PJEE 4MBOA 4IS6B 2VXQA 1YEGL 4LLYA 4A66A 1FNHA 1M7UA 3HNVL 2JB5L 5F1IB 4DK5A 3UPRA 2HVKB 5T1LA 3ABKB 3C8HA 2EICA 3GGWA 2LE9A 4U1LB 4E5XG 4X4ZA 1EO7A 4TLTA 2VIRA 1LL1A 3MJ9H 2IDQA 5FB8A 1M1XA 1AMYA 4AEIH 5I30L 2AMUA 3GLDA 2GJZA 5F89A 4M5TA 2H2PD 3VXMA 5BS0A 1UB6A 4HK0B 3BVXA 2YWZA 4OZIA 2UY6B 4XVJL 1YQ2A 3GXDA 4X5WA 2C9QA 3T0DA 1JHLL 3Q8EA 1F86A 3SGEH 1GMIA 2GSIB 4LL9A 3RNKB 4GP5B 1DJSA 3QFGA 3NJGA 3IFNL 4OY9A 2V3EA 2K78A 5A16A 1FP5A 3L2LA 3ME0A 5D7JA 2YSSA 2YGQA 3LRMA 3SDYH 5LGHH 3T8MA 3HC4H 3WEMA 4PG2C 4HT1L 2VE6B 1Q72H 4LLDB 5D7HA 3QZNA 5F7BA 1SJMA 3OBAA 3CSFA 3PWPA 4MXVF 5DHXB 1DUYA 12E8H 2F5AL 2W60B 3IBOA 3BD5A 4LZKA 1E4WL 4NQEE 1MFBL 2I7SA 3O0RH 4PYGA 3ZKSD 4A2HA 4GW1A 1MFAL 3ESNA 3ZO0A 3AREA 1V7ML 4MXWH 1UXWB 4NUGH 4X8JB 5ERWA 4R2GD 4WUUA 4F2EA 4NSKB 5BO1H 1AD0B 5EEZA 2XWTB 4Y4FB 1A4CA 1UZ8A 3VQLA 3IDUA 4D3CL 1GRWA 1I4FA 2X4TB 4ZW5A 3DSNB 4N0FB 4OGXH 3U1PA 2DQJH 4LSVH 2E3VA 1N8ZA 1SJHA 2X4NB 1LMKA 2EIBA 4AYFB 3CDFA 3M7OA 1H5BA 3LQAC 1Y0LA 4HUWA 4Y8DC 1TJIL 4Y4FD 4XN4A 5E8DH 1O6VA 4MNHB 5HYSA 1BVKA 3REWB 4NFCA 1N2RB 2W0FB 3L4VA 3QI9B 4MMXC 3S35H 1JHKH 1ZJBA 4PJFA 3ILQC 4LLWA 5EV7A 1WO2A 1UOVA 4Q6YA 5T3ZH 1CL7L 4X2UA 4I4WA 4DP4X 4U6HB 4FNTA 1UD3A 1DEEA 1OALA 2Y3NA 1MUJA 1BEYH 2Y7SA 3QNXA 4EQ2A 4CVWA 3DARA 4XMWA 5I5MA 2GABA 3QI9D 2KQMA 3RYMA 4D0DA 5EEVA 3PL6C 3O6FA 4A2EA 1YPZA 2FX8L 1JZ5A 3RHWK 4HMDA 5CXPA 3H56A 3NSDA 4HZLB 4LP8A 1C12B 4JPKL 3M6DA 2W9LA 2ZXQA 3OAWA 4CKVX 4DO4A 2GSGA 2YXMA 5K1JA 4KDVA 1IM3A 3SKJL 1WS7A 2HX8A 3OC5A 4IRSD 3IPEA 4N6RA 1AGBB 2EVJA 3GKZA 3KVQA 1KXHA 2WLYA 5TDNB 4DVBB 3ZUNC 2X4QA 5EF3A 4YGVB 5EU6B 3UTPD 3KCPB 4XVSL 1DDHB 2ZKXA 2EDRA 1Z5LA 1UM6H 5EPMA 4G7VL 5DZPA 1CL7I 4YDVA 1IBDA 3CD4A 4X6FB 1A4JA 2D0HA 4FFTA 1CI3M 3I75A 1RZ8B 1SOKA 1R47A 1WBYA 2I32A 2WLIA 3ZMNA 3OKKB 4JKPL 3ECBA 4O4YH 2ZP9A 4M43H 5F3BB 1JBJA 4HGWB 4ZW8A 4LCIL 4RZCA 2WZ6A 3EGXB 4YH6A 1M05B 3IAQA 2P46B 5I0WA 1AGEA 4NO3A 3QHFL 2CCLA 3TEUA 3GXIA 3NZHH 5LB1A 1JZ2A 1NMAH 3NVQA 2DLFH 3UROR 4AQ1C 2ZOUA 2DTMH 2DEXX 3MO1B 2H1PH 4U1HB 5MI0C 3F12A 3D4YA 1MEXH 1SFHA 2ZP0T 4YXKL 3BIAX 4G11A 4P9HL 3K72A 4ZX4A 1RZGA 2WQVA 2GTWB 3U6XS 1KN2H 4K2UH 5PCYA 1KCRL 5HHOD 2ZUWA 1AGFA 1F5WA 3UZEA 4LOVA 1ZGLA 2XIDA 1AHWB 1OAUH 4M7LL 4MD5A 2O6EA 3LD8B 2ZXBA 1EGJH 2DKMA 4ELDA 1LHZA 4YFDB 4XPBL 1ZV9A 4BCYA 2WLJA 2YD7A 1T22B 1ZA6A 4FFWD 4EQ3A 2ZP8A 4FNSA 1EJOH 3N5AA 4NZUL 1KZQA 5H37G 1EQWA 1YNTF 2E59A 2XWEA 3NZUA 4H8WC 3B8YA 5E4EC 4BWWA 1TF4A 3MR9A 3NUKA 4QXUH 3GSUB 4O51A 1D6EB 5JXAL 4PJEF 3QDJB 2QKIC 3MNWB 5IBUB 3QQNA 4NUMA 5IQ7H 2B20A 4Z7UB 1EAOA 5E2UH 1Z9PA 4KK6C 4D0CA 1VKXB 1TZOA 1HNFA 5KBLA 2O5YL 4HJEA 3QDJD 2BY2A 5AKRA 3FULA 2EDQA 4K0OA 4X5QA 5I16A 5JNYB 3QAQA 3DURA 4O9HL 3SEPA 4AV0A 5TH2B 4BV1A 1G6RA 4KOBA 4JANA 5CBAA 1S9YA 1BQUA 2ZOLA 3KS0J 3ZRSA 3PGCB 1AXSA 4KUZL 4WIQA 2EYTB 3FQXB 1JNLH 1D7BA 5A3ID 1MG3C 5IHUL 3I9GL 3GTTA 4M00A 3A6BL 3VMOA 2APBA 5CILH 4XNBA 4NKOA 1FAKT 2V7HB 1R6VA 3DJRA 4ZO6A 1HKLH 5CAYB 4PJ6A 1HINH 4HV8A 3KLQA 3ZKNC 3LEYH 1M6OB 2IOMA 5IJCC 4AG4L 1OGAA 3ATAA 2B9AA 3B7RL 2WN3A 1ZHKB 3O81A 1MHHA 1X5ZA 1UH2A 1QA9B 2BXYA 3ULAB 2KC0A 3V5DB 3RBGA 4AEFA 1KT2A 2DDQL 4NM4H 2YUWA 3NSXA 4GS7C 1DLHA 3BKYH 5B39G 1BEXA 2ICWJ 4HUMB 2RD0A 4L1LA 2GTZA 2H26B 3MQIA 3OL2A 2P42B 5E0QA 3BVTA 3V4VA 2XTLA 3VXSE 1KYOJ 2WIMA 1EDHA 4PJBA 5CUSH 5JOPE 1MWAL 4Q6IA 4R0LC 3UTZA 3N55A 3X11B 2CJTA 1NGPH 1KIRA 4KO7A 2BC4A 5I1JH 4XE5B 4XHJD 2Q7YA 1PEWA 4ELMF 4WFHD 2OZ4A 5D1ZA 4ODVH 1K2DA 2NUTB 1NBCA 4UQBA 3QH3A 3DPDA 5DDHB 2XV3A 2FJUB 1A6AB 4I5BA 1KCVL 1BFOB 2ICEC 4D8OA 5C0AB 1IE4A 4AW4A 1HQ4B 1VACA 2BSED 1VA9A 3ARBB 3DIVA 2IGLA 4LSUH 4OIAA 4PRBB 3WJJA 4RWYL 4PR5A 2BOBA 2QVMA 4Y1AA 1VEPA 1XGYL 4X80L 2V8LA 1F1GA 5F21B 5ES4B 2NT1A 5IOKA 3NN8B 3QZWB 4NEHB 4N24A 5C0AD 1JI1A 3FOMA 2A6JA 3ARBD 3FT2A 4HXAL 1Q8MA 3MRFB 4WJG3 4JZOB 1QNZL 2VL4A 3MREB 1QBML 3DX6A 2GC4C 1HHGB 4P59L 3AG4B 3X3FL 4B53A 4IGBC 3FU7A 4N3TA 3V4UL 3N42B 2NX5E 1HAUA 5CLYA 2HVBA 2CCWA 1T1WB 5IOPA 1FNFA 5C0EB 5IZ7A 3RVXD 3IDNB 3P4OB 4Y5VA 1DQDH 3B3BA 1Q0XL 3C6LB 3OR6A 5B7EA 4Z7QB 1NGWB 2ATPB 2HKHL 3DX3A 3Q5YA 3TCTA 5CFAA 8FABA 1XSJA 4G43A 2FZ3A 4GIAA 3VNYA 1WFTA 3WGVB 4F2FA 5AB9A 3C6LD 5CIPH 4W6WB 1N9PA 3QRBA 1LTXA 3HCVA 1MJUH 3V9FA 2Z31B 3X13A 4J2QA 2CGZA 5IB3A 1AXTH 1G7HA 2C9AA 2FNBA 2VC2H 3BVNB 3T1FA 4JRXE 1T20B 4U3SB 4ZUTA 2Y0SA 5GZNC 1QSEE 1WFUA 2X1QA 3JT2A 3T65B 1DQLL 2WAQA 1A7OH 2QGDA 2Z31D 5B1JC 2E74C 2VDNL 4QXGH 3CDGA 5F1NB 2V9RA 3Q2NA 2XFGB 4CU6A 3U0WH 4MRBA 4EZMA 1T66C 2XZZA 3HB3C 4PJAE 1OW0C 1KJ2L 2R2EA 4QKTA 1LNUB 3MRPA 4OZGB 4PY8I 1UVQA 4WO4C 1NZRA 4OQTA 2YGPA 1OTTD 4HJJL 1KN4L 1RZFH 5J06A 5KYWA 3CU7A 3QUMH 5ITBH 3E80A 3KPSE 2AJUH 5BQ7B 3MLVH 2A9CA 1YYMH 3G6DH 3KYKH 1D5IH 1ORSB 2GUOB 4Y1SA 4YDJA 5HHMD 2UVFA 1FL3A 1YEKH 1E30A 1NCBH 2OJZL 1N0LA 1GGBH 4J6IA 3V0FA 1XMWA 4YFLF 1VFAA 2FX9H 3CFDA 3CXFA 5C0FA 2J12B 1TQBB 1IBGH 3FF8A 1MH5A 2D3JA 3KBFA 1C16B 1WBXB 5EC2B 1FGNH 4HCRA 4D8PA 3QIBB 1EANA 4WI0A 2A74A 4MYWB 5AW0B 3P3TA 4UM9B 4PHZA 1HHHA 3OZ9H 4KGJA 5EWIL 5D7LA 4R7DB 2P8PB 1XF5A 2J21A 3AADB 3IDMB 3L3HA 4HC1L 4UQCA 3TZVC 3QIBD 1PJWA 1EA9C 4UYPA 2EE6A 3D0VB 4UM9D 2B39A 3L81A 4Y9GA 2G9KA 3WDJA 4BK5C 2EE9A 4X5XB 3ZZLA 1RP8A 2JB6A 2XVGA 3FQ1A 4R4BA 4PWJA 5F7YC 1AQHA 4QRFA 1PG7X 2JCCE 4K5MA 3BD3A 1C5DB 3UAJA 3WLWD 2V5MA 4YWGL 4ATWA 2CA3A 4I8DA 1RZ7L 2F68X 2K1MA 4PJ5A 4N0RA 4AYSA 3SDCB 4K7PL 1KBWA 1E5ZA 3SO3C 2NNCA 3IDJA 1GVIA 4M8UA 5GJSL 4WGVB 3TN0B 1YY8B 5K69A 5DC9B 3MCLH 4QF1B 4ZDHB 1GPOL 4UAOC 1I1AC 5DJ8A 4YO0A 1PQZA 3TPUB 4CBZA 4UQ2B 1RJYA 2NTSP 4DP0X 1JXGA 2AVFA 4YDMA 4C59B 3TN0D 3UP1A 2AGJL 3MYJA 2LV4A 3CVIL 3US9A 5E5MB 3O3EA 1J9CT 5IIEB 4NZFA 5L2JB 3FHAA 4JM2A 3WDHA 4FZ8L 2PPAA 5HVHB 2GIMA 3D1MC 3B6SA 1EEYA 3LN5A 1FLRL 4XCCH 3OQRA 1I9IH 4PS4H 1S9XB 4BFGA 1OAKH 4OD1H 4I0CC 3Q7JA 3FFCA 4G6JL 4IRZL 4XRCA 2WC7A 4PGBB 1MNUH 2HB0A 5EO9B 2AEPL 3QHTC 1M9WA 2CGRH 2E47A 5I66B 3CJJA 4NYLB 4QRRE 1MLCB 3EFDL 2E75C 1F4WL 3CMOL 4CMHC 3PHQA 4X5RA 4J8RA 1J0KA 5EMYA 3EUUA 3I02B 4Z6AT 1UM5L 1VERA 5AW6B 1N5YH 3E0GA 2P47B 2JMRA 2G3NA 5D72L 1N7ML 1XBDA 2CU9A 1KXQE 3HUJA 3QEQA 2C9WA 1HSAA 1LO3H 4ZOBA 4JO5A 4ZAKD 2X6CA 1IT9L 2HZHA 1X5XA 2WMPB 3QG6B 2G5BA 2D3VA 1XCQA 3SDAA 1IC4L 1OAJA 4ZXBA 1UJ3A 3H3PH 2P52A 4HS3B 2O5NA 3ZLQC 2MNUA 3HR5A 2BP0B 3FT3A 43CAB 4DVRL 4U2ZA 5DEZA 2OS7A 4Q89A 1F3RB 2FEEL 1CBVH 1PX3A 4PJ9B 2YJLA 2F7PA 4NQCA 1FAIH 4PVBA 1IEAB 2AEWA 1X7SA 3CVCA 2Y7MA 1INQA 5EU5B 3A0OA 3MJ9A 3V55A 2V7NA 2I7OA 1DVFA 4XMKH 5J7CC 2PCFB 3AM8A 3QYNA 3L1OL 1LO2L 3JV0A 1BAFH 1RHFA 3MCKA 1CQYA 2XI9A 3MV8E 4XMUA 5J11C 4ZMTA 3L95B 2VN4A 1XL4A 2ADFL 3CVBA 4YDZA 3HN8A 5AB0A 1FG2A 2OMVA 4N0CC 2DQUH 1XF2B 1N6QH 4FOMA 5CJQL 3B3IA 1T6BX 2YRLA 2FEEI 3NRQA 3X1GA 3T2LA 3K80A 4I0PA 1YEFL 4LKCB 4L37A 4X4KA 4PJAF 3K1KC 4XCEB 1DSYA 4YNYA 1WAEA 4GG6A 4BKSC 4B9PA 3IU4H 4MD0A 2VMEA 3VRLE 2XBDA 4UIKH 3IN2A 3TV3H 2F58H 3BSZH 3C9NB 2YQGA 3M7FB 3QNZA 4UT6H 1OAZL 1WGOA 3WJLC 3IDYC 4OT1H 3R0NA 3O8XA 1K8DB 2ESVB 1S78D 1DHKA 5C92A 1MJ8H 5DJAB 5E8NB 4AW7A 1I7TB 1WCBA 2MOGA 3EDFA 1A7RH 4LHQB 3JVFC 4KKBC 3WTVA 4WCYL 1R3LB 1YC8A 5AENA 3PV6B 4LCWB 4MNQB 5EU6A 2ESVD 1YY9D 2NLJA 3N0AA 4HUNB 1OEZW 4ZUUA 3T0ED 3ZW3A 2KDYA 2RQ8A 2Y1AA 4DZBB 2WBJC 4HCIA 4QRPD 3S3BB 1YUHA 3HNSL 5E9DD 1PVHA 3AXLA 5FAAA 2DIEA 4LCWD 4PRAB 4MNQD 3BW9B 4MJIA 2I60L 1PNDA 4BWTA 3K8LA 1U8LA 4UMGA 1S3RA 3QJVB 3ML8A 1FZJA 4XVUC 3AT9A 3L5WB 5EZIH 5IESH 1XQ4A 4E5XB 1KIQB 3CN2A 1ID5I 2FB4L 3O11A 1Q1JL 1JPSL 3A5VA 1D6VL 2MCPH 3LH2H 4TVUA 5TQ0L 4ZNCD 2DRUA 3GK8L 3L4WA 1OT4A 1A6ZA 1KV7A 2EH7L 2ZUUA 4GMSH 5H94B 2JCCF 2OJEA 2X1OA 4M48H 2MOVA 5FDWA 3QARA 3UG3A 5I76B 2AXJA 3OPZH 3UJTH 3ELAT 1LDPL 2GY7B 1Y1DA 4CMMB 2J8OA 4J3WA 1I1FB 4LHJB 4JFXB 4KV5E 5F2FA 4HHWA 1YMMB 3MA7A 1EZLA 1H15B 3FU6A 3I2CH 1AXIB 4NN6C 3QDME 3RDTC 2ENQA 4XB8A 4UV4H 3MRDB 4GRLB 2J5LB 1TVHB 2F61A 3ISRA 3OLIA 4WEUD 1T2JA 1GYVA 3HAEG 4G6MH 4MMYB 1VFBA 5DEFB 5ALCH 3ZZ1A 3FZUC 3F5WA 1KGUA 1YMMD 2E9BA 1TUPA 3D0AA 4NJ9L 2NW2A 5BUPA 4M1CC 4BHUA 1TJHL 2H3NA 4GRLD 3WNLA 5F72S 4HLEA 2X28A 2VQ1B 2PCPA 3WD5L 1SNRA 5DZ9A 4XCNA 5KVMC 3FCUB 5CMAA 3UO1H 2MCMA 5FYJH 2XZCL 3HI1B 1BQLH 4MCMA 1J5OH 2C8NA 4HAFA 1HXKA 4YX2H 4CNIB 4PRPE 2B4CL 1BFSA 4AH2A 3U7YH 1PL3A 4IBSA 5FFOA 3UH8A 1BWMA 3C60A 3R19A 1T83A 2X4RA 2CKBH 1S7QA 2KL6A 4AITA 2YAFA 4HGMA 4PWGA 2CGYA 4HALA 1H3UA 2IJ0C 2YPLB 1IC5H 2P24B 4WGKA 2WBWB 3QRGH 4TOYL 3FB6A 1YNKH 4YSRA 5D1QC 1CGUA 5EC1B 5AVWB 3U7WL 1QW8A 3V5HB 5E5LA 5AVSB 4LLUB 3QDGA 4A04A 3ES6A 1EGJA 3D48R 4NO2A 5BUAA 3LKOA 4GRMA 3P73A 5IWLA 3MV7D 1AVAA 3L08A 4ODSH 1UATA 5DK0B 5C3TA 1CFSA 2V2WA 2YPLD 4KQ3L 3AY2A 3HPJB 3LSOA 1JPFA 3T6WA 3UOAB 1SM3H 4Z3TA 3MROB 5JIHA 1OWRM 4NLHA 4UV7H 2O6PA 4NBYB 5BVJB 5ANMA 3RZCC 2WIIA 1DJGA 2A6KB 1CLYL 4QNPE 5IEHB 4IMKA 4P46C 3BWZA 3VXPA 1A7NH 4MX7B 3QIUD 3KCWA 4JO1L 4XO3A 1QFUH 2BNQB 1A6UH 1NCDH 4WW1A 4YOKA 2VR5A 3MRCB 2GAZB 4G8GA 4Y88A 1OD7A 4D0BB 3G5VB 1T7ZA 2K7QA 5EZJB 1TENA 4N85A 3D9AH 2ZX9A 3LS4H 1FG9C 5FO8A 1PY9A 3JTTB 2IIJA 2KZWA 3MACH 4NDMB 1L3NA 2BNQD 2JTDA 2R23A 5GQBA 4BQCA 5CD5D 2HT4C 3DTXB 1KB9K 4YBLB 3BWAA 4FTVE 1AO7E 1CDCA 3OWEA 4PI2A 3F04A 1DEDA 2BW5A 1Q9OB 4NZTL 3NCBB 1CFVH 3NSJA 1P2CB 1N64L 4POZD 4X6EB 5DXWA 5JPNB 4DAGL 4UNUA 3F58H 2AHIA 1NGQH 1D7DA 4D7BA 2AK1L 2GJ6A 1KCUL 1KPUA 1VZHA 4DKEL 2CALA 1O7DC 5IHZB 3EKCA 2G60L 4WU5B 3TH4T 1G1OA 1U8PA 4JDZA 5I6MA 1SN2A 3H0TB 3TXAA 3OF6A 3VRLF 3PRZA 4GYBA 1ZLDA 5J1SC 4FJZA 4GAGH 3P9LA 2F18A 3DHUA 1RULL 2XY1A 1WZ1L 4TNVK 1YNTA 5D7JC 3A22A 3R0MA 1JWUA 3KLAA 1QPKA 4PJEA 1OTUC 5F7EL 1JVLA 5KEZA 2FH8A 4RX4D 4FQQA 4QHUB 4KJYB 1CF8H 4XNQB 3GBNL 5GISH 4F7PB 4N1HB 4JLRA 4E0RA 3C6SA 4IBTA 1RJLB 5JHDB 4RGND 2KS0A 1AKPA 4WGWB 4ZUVA 1WUZA 3H3BC 3LH9A 3TBYA 1U30A 3FUMA 3MLSH 1EZVY 2HRPH 3GSNL 3KJ6H 4EIBA 4AZ8B 1IQDB 1BZDA 3K4AA 3ALXA 3V9CA 5SWSB 1RHHA 5FUZL 3IS0X 1YEGH 1HL8A 2IMMA 5CJOL 1H5BC 1JPGB 4LSRH 4N2FA 2JB5H 4OLVL 1K5NB 2AFNA 2WXIA 1OCRB 3UTPE 3N9GH 1IQWL 4W9HC 2H9GA 5SWSD 2QR0A 4N3UA 4BUGA 4R3SA 5CLZA 2J1WA 3B34A 2X38A 5I30H 5GSRA 2IGFL 2BCKA 5EU6E 1L5GA 1E5UI 4U6VH 1HAWA 4FA8A 3S9DB 4M03A 4KV5F 4ACPA 4JZNA 4M6NL 2E7BA 2XETA 4NQEA 3O6FC 4XVJH 5AOMA 5GGVY 4CN1A 1IU1A 2FSDA 4UT9L 1DQMH 1YQVH 1M6UA 5ESAB 2IH3A 2R0KH 1IJ9A 2ZG2A 2O30A 2YBRB 3MLZH 3MLTA 2QDWA 3KZ8A 4JFEB 2DPKA 4K9EL 4OKVA 2XXGA 1NINA 4HT1H 5E8PB 3S3JA 1YO4A 5KW9L 4XC1L 4FC3E 5E4IA 5A2JH 5C7ZA 1UFGA 4OLUL 1ZXQA 2F5AH 4HETA 4TULL 5CIPA 1T1XB 4PJCB 1YEEH 1E4WH 1TVBB 1MFBH 1VFOA 1B2WL 2OMZA 4XN9A 4JFED 2FL5A 1MFAH 4MZ3A 1KPVA 5DD0H 5IQOA 4JFPB 4R4FL 1KNOB 5DU7A 1V7MH 2CPCA 1OLZA 1YN6A 3GXMA 4FXKA 1A1OA 5F44A 1U2CA 4M6ML 3INOA 3OR7B 3OJVC 4DZ8B 1F4YL 1R3KB 2YGNA 1QEXA 3O2DL 2ZE0A 5TQ2L 1R5WB 2W38A 3ATEA 2ZUVA 4D3CH 4J4PA 1V3JA 1C8QA 1FNEB 5LLIC 5BZWB 3QWOA 2NMSA 2VDKB 4B41A 5EZOH 2YD1A 4NCC1 3UX9B 3PL6B 4Q0XL 1FSKB 3ILQD 4I18A 2VM9A 1DO6A 3EJRA 4UTBL 3FQWB 1M9SA 4PTTA 4U1IA 2EC9U 3DV6B 2W9DL 2WYTA 2X4PA 4QYAA 2QT6A 2R56L 3BCFA 5LKNA 2QQLH 1CL7H 3QDJE 3KM1A 2E46A 3PL6D 4ZZKA 3UZEC 1IBYA 4PJXE 4MVBC 4QNPF 1YECL 2Y5TB 4L4JA 3Q8FA 4WI9A 2AV7B 4HIPA 3V10A 1H3VA 3LKNA 1R5VB 1N6VA 3IJSB 2N3JA 1Z66A 5HDBE 1CF1A 1J0IA 4HD5A 4G5ZL 1RK0B 2X4OA 1IAIM 2JI2A 4JPKH 1KYAA 1DFXA 4KO9A 3ZL4H 1CDUA 3ZYJA 5EUOB 1J8HB 4M5YL 4L3CA 1W8NA 1JWSB 1MG2C 3SKJH 2VM3A 3MLXL 2P5WB 4WDIA 3CFBA 4MA1C 4JO8A 1H19A 4DHLA 1H3GA 1LD9B 3TO2A 4H88L 4Z76B 4L8DB 3VU2A 1S7XA 4KHTL 3LRSB 5LNDA 3W39A 1OSEA 1J8HD 4G7VH 4AQ1B 2P5WD 4FLQA 4L8SA 2BS8A 3L13A 4WKZA 1CD8A 3AFLA 4G80B 3KPLA 1XGUB 1KXTB 2ENJA 3CX2A 5GGRY 1HL9A 2DZEA 2HH0L 3MUUA 4JKPH 3K6IA 4L2YA 3WKQA 3DPBB 1CVRA 4A63A 1IGJA 4LCIH 4HJ0C 1KCSL 3FTGB 3UG4A 2QBWA 5IB4A 2XFXA 1RZJC 2F7IA 3L5HA 2BSSA 4MAYC 2K3TA 3IJHB 5HY9B 4M3KB 1VPOL 3PWLA 1AZRA 4HCGA 1TTAA 1W0VB 3MRHB 1B3JA 1T04B 4XPHH 4FI6A 4XZUB 4YXKH 4RNRA 3K8MA 1CXKA 1JWMA 4WFHE 2E9GA 3MLPA 2BSCA 1KCRH 2AJZB 1VF5C 3A4EA 2AAVA 2MPAL 3TWCH 4IKNA 5T1DL 2QKIB 2NCMA 4M7LH 1VEMA 3DHMA 4HFWB 5JOFB 2P7TB 4EDXA 4XPBH 1SOXA 5KVFE 1AP2A 3DVGA 4R83A 2B59A 2NDGA 4UIMA 1U8HB 4NZUH 4DUVA 2IADA 2VT0A 2VR4A 2ZOTA 3DX7A 4S1SL 6TAAA 1JNNL 4F7TB 3JTSA 1IARB 3O2WH 2GUYA 5C0AE 3C08L 3E9UA 2N56A 2PTTA 2C1OB 3NFPB 4Q6IC 2FGWL 4KK6D 1TFPA 5JA9A 3NCJL 5HYSG 3P0YH 1HL4A 2V9QA 4AMXA 3CSGA 2BOLA 4X6BA 2WO2B 2D4FA 2MKWA 4QHMB 3QXVA 4KTDL 1IAOB 5TE4L 4O5LL 5LBSA 5KJ4A 4HPOL 5DMKB 4DK3A 2F8IA 1RJCA 1OIOA 1T21B 3HZVA 5D1ZC 3SB3A 1RKRA 1JS4A 1J05B 2F9BT 2O5YH 2VISB 2WCGA 3MUGA 3N50A 1OAQH 1FZMB 3HRZA 1PBYA 3QWQB 1O9WA 3V5KA 4QOKE 4X4YA 4M61B 3GI9H 3ARFA 3KJ4C 3Q2WA 2VN6A 3B5TA 2AAAA 2F54D 4ZQTA 4KUZH 1S5HB 3IPFA 1A0QL 4KI5E 3A6BH 3VRIB 3ZKND 2Z93A 1LE5A 1SLWA 4P23A 4YXHL 3HC0A 4ODXB 5SX5K 4YDLC 1DQJB 2UXGA 5DO2C 3VXSA 2ID5A 4ANUA 2EADA 1WE5A 4Z7QE 2GEQA 5D4IA 1ACYL 2L0DA 2VDKL 4AG4H 2W07A 3P77A 1A2YB 2BFVL 5EU7E 4N26A 1N3NB 5TGBB 2HT3D 4FMFA 2DQEH 1NANI 2JE8A 3F7VB 1JYXA 1JZ7A 2Z4QA 4B50A 3BP5B 3CQFA 3QORA 3OVUB 4AI7A 1KIUA 2BMKB 4AC4A 5MHSD 4BFBD 5A6IA 5D6CB 3MRQA 4Y5VC 2GK0B 4KGLA 2JKTM 4NQSA 4K3EL 2NUPB 2H4EA 3OJDA 2BHFA 4UOJA 3SOBL 3UYRL 3NPSC 5GPRA 1NBQA 2C3VB 1OP5H 4ORGA 4A2GA 1XEDA 2ZT9C 1OHQA 1JK9B 3DOHA 2CBOA 3VCLA 2FIRT 4RDBA 2WINB 4PRNA 3RJDA 4XPFL 1HWWA 1E9OB 1MJJB 3ESPA 3WXVL 3ZQXA 5CCKL 2DQDH 4OZGE 5I24A 5KJRL 2QFRA 1VDGA 4QHKI 5AZ2H 2Z64C 5HHPB 2ZOWA 4FQ2L 3HVNA 1AKJA 3RY5A 4HHAA 1T7XA 2PYEA 4Z7IA 1KCVH 3FFOA 3TBTA 4EN3B 4PJXF 1XGPA 3CSBA 1AIZA 1I7RA 3QAZC 3MRLA 4U6TA 1ZD6A 2NX5A 1DQKA 4RWYH 1KTRL 5DR5L 3UAAA 4IGBB 1XH1A 4K94C 5G5DB 3R1GL 4P5KB 2APWA 1UT2A 2KLSA 5EBLA 5E6RB 4EN3D 4R96A 4QHPA 5HPMA 3RL1B 1GGUA 1HT6A 1IGTB 4PREB 2VDPL 4CN6A 1QNZH 1CPUA 4IGBD 1MCQA 5HGDA 2O5ZL 4BELD 4PLNC 5HGBB 1QBMH 5I1KL 4FADA 3TBBA 4JY5L 3VB9A 3POHA 1KB9J 1SVZA 3P11H 4PBDA 4AL8L 3ARUA 1JN6B 4JFWA 5CD3B 1ET7A 1CGWA 1UTDA 2H8PA 5KS9A 4Z7VA 5GRZA 2VLMD 3FQTA 1P5UA 1HOCB 4JRXA 2OBGA 5IFAL 3PWUB 1CTMA 1QSEA 2CCVA 4HLZH 3WCYA 4ZTOL 2QHLA 1Q0XH 2CRYA 3EYFB 4OFYD 4RAUA 3WLBA 3L3OA 4C55A 5D7SH 4LGSB 1QLRB 3BP4A 4ZMYA 2A74C 4GI9A 4LCCA 2ZAHA 4HJSA 4ZFGL 1E42A 2Y06L 4TTDC 3OJMB 1MVUB 2D03L 4HWEL 3NFSH 3QRLA 1Z2KA 3BPCB 4PV9A 4PGJA 2IAMA 4W9ZA 2A99A 4JJ5A 5GZND 1VRSA 4B9YA 2FR4B 1CMOA 2I5YL 2ZXDA 1RK1B 5EHFA 1RZQA 2BNUA 4JEGB 2FX7L 4W9KC 1J86A 3KPSA 4WJKB 2EDKA 3H6JA 4OAWA 2WQ8A 2R9HC 3QXTA 1DQLH 3IXTB 4KKZA 4OI9A 1X5FA 4I2XB 3L3IA 3UAJC 3GJFB 4W9FC 3A67H 1T66D 3HB3D 4CJ0A 3L1GA 3PNWA 3CZEA 2AQRA 3EO1A 3PP4H 4OU3A 4WK2B 3RWFB 3WKML 1U8JA 3DX9A 3LPWA 3QUYB 4ZFOA 3T6VA 5IJVA 4HJJH 4R4NC 1KN4H 2OTWB 5FYJU 4B0MM 5BMFL 5L9DL 4EF3A 3E3QC 2O26U 3GRWL 3VQ2C 4YDKH 4S0HA 3B5GA 3DROA 3WJMB 2WANA 4TSCL 3DGCR 1DBAL 1YHPA 4JM2C 1NCJA 1ESOA 2DTSA 1R3JB 3VD4A 1A9VA 4YSEA 1L0QA 4I48A 4KRMB 5E1AB 5E2VL 3TZVB 1TQTA 1UXLA 1TCMA 2XIBA 1PX4A 4BFKA 3GUTB 1DJWA 4IU3B 5MEQB 2JCCA 2HJKA 1C5CH 1T4KA 3JZYA 4JPQA 5KTEL 3GSWA 3BAJA 3IDXL 2WQRA 3KBPA 1WISA 5MEPB 2EKSB 3KVPA 3N42F 3TZVD 1F18A 3WKNA 4KI5F 4UUJB 4PLKC 1BQRA 2QQQA 4IKKA 5DFTA 3L17A 1UG9A 3WFDL 3ISYA 4FYTA 4N4YB 2Y4SA 4Z7QF 4HWBL 1UGNA 1JZ4A 3CVHB 3SO3B 3MLRH 1O6SB 4L3AA 1ZHNA 3IJ7A 4HEMA 1EFQA 3OLGA 1P53A 3NTCL 3KGRA 3RZWA 3WFEL 3QZOA 1YEHL 3FT9A 3SDAC 1I1AB 2WYHA 2CHDA 2ZSWA 5KVFH 4P2AA 3NACH 4Z78A 2MKLC 1IUZA 5JHAA 3AS2A 4ZXBC 1UJ3C 3L48A 3LKRA 5DZLA 1P5VA 4YWGH 4C54A 1PD6A 3B2PA 1JMZA 3FJTA 3K6FA 5FO7A 2W1NA 3MRKA 4XI5C 1MCEA 1ICTA 3K7UA 1I1AD 2C26A 2EC8A 3OAUH 2Z35A 4BZ2L 2MQGA 1G0DA 5GJSH 3CC5B 1I3RB 2ILLA 1RV6X 1AG6A 1BF8A 2FJFB 5M7QA 4C56D 3FH5A 1UURA 3BGMB 3OG4B 2ZWYA 4QRRA 3ZTJH 1A1NA 1DVFC 4U1MA 1BCIA 4C8XA 4O02A 4TYUA 3CVIH 3AM8C 3IGAB 3I6KB 3ORJA 5EU4B 2VLRA 4OZGF 1CXIA 2JK5B 1GS6X 7TAAA 2OXHA 4FZ8H 1KXQA 2OX5B 5IHBA 1B0IA 2WZAA 4B9KC 3CXDL 4GOSA 5C09B 1JZGA 3NABL 4JHVA 4LEOB 4FG4A 3VQ1C 4RISL 2EEFA 4K3JL 1KDIA 2ESVE 4RFOH 1MCPH 4HUCA 1KENH 2CUIA 4LCYA 3IJ9A 9CGTA 3GLAA 2IWEA 3NK3A 1NDTA 2PPDA 1NSNL 4A39A 2YR3A 1RMFH 3QEUB 4G8EB 4MD4A 3ZU8A 4HOZA 3M17B 1DSWA 1M57B 4B0MB 4Q9RH 1WWWX 3JWOL 1WFMA 3UIYA 3D33A 2UXTA 4I0PC 2E4TA 3OGCA 3EFDH 4LCWE 2HG5B 4MNQE 4P2RB 4CADA 1F4WH 3CMOH 3D2UB 2B3IA 3TVMD 1SHXA 5L6YL 1YNLH 1DP0A 1UM5H 3I6LD 4NUJA 3ZO9A 4NWUH 3ZZSA 1TG8A 3EYQC 4JFDB 1HU8A 3SE4A 3H7LA 3L5XL 2BSTA 2BVQB 3T71A 3U9UB 1N7MH 1EHXA 3O8XC 1UENA 3LZRA 1EO5A 3BUYB 4P2RD 6PCYA 4QCIB 3IRZA 1WH0A 2P8LB 5DWUL 1GTFA 2IH9A 1RD6A 3CZKA 4I85A 1IC4H 4KROC 3TA3A 5EO1A 3LRLA 4JFDD 3VD9A 3FHEA 3SE8H 4EE2A 5IB2B 2WM0A 1WBZA 3D87B 3MV8A 3VSVA 3G5YB 3UBXI 3QEHA 3AC0A 3LZQA 3RX5A 5K9OB 2ZIDA 3RTLA 3T0VA 2VDRB 5J11B 1H8OA 3KDPB 3REVB 3Q05A 5D9SA 1CFNA 2EXTA 2G4EA 1UC6A 3HZYB 3AQYA 3IF1A 4GEIA 2OXGA 3O41B 4JDTL 4W9LC 3N40P 4BCXA 2X4SB 2ARJQ 1ZA3B 3OHXB 5C8JA 5E6UB 1LE9B 1VIWA 1MCWW 3GUFA 2Z1KA 3WG7B 1I3GH 4DGIH 4N0CD 4ERSL 5BZDA 1SOSA 5JOEA 1BXXA 3RWGB 1NFIB 1JCKA 5E95B 5I73C 1ML0A 5IT2L 4K3GA 5IG7B 1G0YR 5EIIA 1HOEA 2CRZA 3IDYB 1V55B 4FQHB 2YGOA 1I9JL 3RIAF 5CJQH 2WLKA 2V37A 3DBXB 3NMEA 5GGRB 2CBQA 5CWSB 4HBCL 3V7AE 2HUEA 1GJWA 3B37A 5EOQH 4NO5B 4M7ZC 4UYQA 5D93C 1K9TA 2BLFA 2WLZA 4ETQB 1JGUL 3PY9A 1WHOA 4LPCA 5FO9B 3EXJA 1H3PH 1KYFA 1WC7B 4KKBD 4BSVA 3WTTA 1WS8A 3TJEH 5K1NA 5LGJB 3RIAK 1MWOA 1TETL 5E5UB 2YPLE 2YAHA 4EIUA 1OPGH 4H0LC 3F7YB 5KSBE 4OGZA 4WCYH 1PFCA 1GKOA 4MMZB 1IKNA 2VO8A 1A6WL 1J5DA 4JREC 3SKOA 3MJ7B 1HC1A 2VUYA 5IREA 4TUOA 4WU7A 3SPCA 4EVNB 4LP5A 2A6DA 3D0LA 5I1EH 2EP6A 5DJ0A 5I15H 3C60C 1AD9A 1T83C 4XVUD 1FNGB 5DYOA 4DGVH 1SVCP 1GZHA 2ZXGA 7PCYA 1ONQB 4CVZA 3S6CA 3B7SA 1MRFL 1SDDA 3BXNB 1GJUA 1R34A 3QDMA 2MEJB 4NBZB 3OB0K 2R0LL 3RDTB 5I2IA 4HIJB 5TQ0H 4NN6B 5IWLC 1PLGL 1NGZA 1XXDC 2XWCA 5EO0A 2EH7H 2F7QA 4JNXA 5D96C 2B0SH 1BJMA 3IPBA 3S5ZA 4DPRA 2AANA 3LX9A 4LARL 2DKUA 4UT7L 1MJ7H 1S7VA 3R8BB 4BFJA 3RDTD 4UOZA 1LDPH 3QR1A 4OH2A 2FJHA 4QRQB 5F9JB 1SBBA 4IMKC 3TU6A 2IH1A 3GIZL 5IMKB 2VLKE 3PWJA 2FJGB 1G1KA 4PRPA 3U4BH 1LQSR 3FZUD 1P4LB 4MAZA 5E8EB 3K6DA 4ZO9A 1F11B 3RVWC 2PLTA 5T1KD 3ZE0B 4UNIA 1KB5B 3MLUL 3KH4A 1NEPA 4M62L 4ZUSA 1OY3B 3S88H 3K46A 2HRHA 1A25A 3ETTA 3OM3B 3D51A 2C9XA 1G7MA 2YN3A 3QCVH 4NBXB 4NJ9H 4W4OA 4G9FA 1TJHH 1HSBA 3AB0C 3KPRB 5J3HC 3BZEA 3SE9L 4YDIH 4LCUA 5A43C 3IMRA 3OD3A 3WD5H 3BT0A 4QRAA 5GRWA 3PU7A 2CDEA 1ZT7A 2XZCH 1OGTB 5L2KD 1RU9L 2UV3A 4CGTA 1WFOA 3FFDA 3KPRD 3QJHA 4AENA 3FYEB 5D1QD 3O3AB 1DBML 5LJYH 4E9SA 1NC4D 1FF5A 4QJ4B 1GIGH 4Y5YB 5I71C 4MJ2A 4UANA 4PY8J 5F1IA 1OP3K 5J5EA 3SQOH 1FORL 4TOYH 4GSRA 4NT6A 4U3HA 2Y36L 5JHDE 4JFQB 1QWUA 5J1AB 3W11D 4K4KA 3VSUA 2NNFA 4DP8X 2BX5A 1ZOXA 2BRQA 5C2BL 3MGAA 2QLYA 1U3NA 3C5JB 3BISA 3FCSA 4JRLA 2B9BA 4ZW6A 4HK0A 2EZ0D 3RZCD 1UOLA 5KSUB 3IVKA 4G7QB 4K9JA 3BQVA 5SWSE 4YSCA 3L7FB 4P46D 3D7PA 2E7HA 5IV2B 5IJKA 4FTVA 5LGYA 1AO7A 2Z8SA 1GGIL 3RNKA 4H5SB 2L7UA 4FYSA 3L4ZA 4CKQA 4AYID 3MZTA 1MLBA 1CLYH 3MV9B 4U2YA 3FONB 3BO8A 3UPRB 2E9IA 4LDLB 2CKNA 1YC7A 4U4BA 3GPEA 5G4OA 3QO0B 2KHAA 2VXVH 2A0LC 3CQPA 3OXSA 3QIWB 2VE6A 2VIRB 4YAQA 5FB8B 3AGVA 1UA3A 2GBAA 4ZMPA 4TXVB 3MV9D 1RVFH 3ZX1A 2E86A 4KRPC 5F89B 2GJZB 2JXMB 2DQTL 3GB7B 5BS0B 5J6HB 1UB6B 5E1HB 3VD2A 2F8OA 3CHRA 2DQGH 4KAQL 1MI5A 3QIWD 3STLA 5IBLC 2VOTA 4AJVA 1TU2B 1UXWA 4X8JA 4PH8A 2WBXA 5ILTL 5K9KA 2RCSH 1KEMH 3VXMD 4Y4FA 2KZKA 3Q44A 5BS0D 1Z3GL 1XH3B 2X9XA 2X4TA 5A16B 1D5ZB 1JCVA 1HH9B 2NY0C 2X42A 4BUQA 3ME0B 3C5SB 1OL0A 1LO4H 2AK1H 1D9KB 1KCUH 2X4NA 4I3SH 4AYFA 4N1EA 3MV01 4ZMLA 3FUIA 2QTEA 1I8MA 2G60H 2NY7L 3MNZA 4HSCX 1L9MA 5FW6A 1XB6A 3ILDA 1F6AA 3PWPB 4OZ4A 3SY0B 4PJCE 5D7JD 2W0FA 3QI9A 4M8VA 4FD0A 3NIFB 4K7PX 4WSJA 4GW1B 1OTUD 2WZ5A 5DT1L 5FPIA 4U6HA 1RULH 3B9KB 1XCTB 1REIA 3QQ3B 4WUUB 3B56A 2HJLA 4GB9A 3PWPD 2HX7A 5EBMB 1ZGLM 3BZFB 1UZ8B 4KU1A 5F7EH 1T5XA 4XX5A 3EHBC 1I4FB 1ZV5A 3AMLA 4FFZL 4TSBL 1KFAH 1MWAA 5DD5H 4DW2H 1DZBA 1QPXA 2BINA 2FHBA 3GBNH 4HZLA 3B9KD 3CTTA 1C12A 1SJHB 3V95A 3D4ZA 4XP5H 4PBVC 4WUUD 1H5BB 1WYJA 2QLVB 2YXVA 4BKTC 2WN2A 3H9YA 4HIEB 5I5JA 1WAAE 3KXFA 3F7QA 3DSFL 4IRJA 1AGBA 2WNXA 2AK4E 5HYSB 3P69A 1NAKL 1OGSA 4DVBA 5TDNA 1GS8A 3OV6A 4E9WA 4BGDA 5CS7A 1I7ZB 3GT6A 2X0WA 4QRUB 1M71B 4PJFB 2G0KA 2KPNA 3HOGA 3KCPA 2XN0A 3ECUA 1S7SA 4LLWB 4XX1G 5T5NG 3VD1A 1DDHA 3EYOA 1P9MA 1OOWA 3UBFA 4KDTA 1VGKB 3IT8D 3HE7B 2BS9A 4XP4L 3VD7A 5FUZH 4KO6A 3SDXE 4D94A 3QNXB 3WY3A 3P3SA 1GZQB 1I3UA 1TTUA 4OLVH 4D0DB 3O6FB 2F1AA 4C4BA 1YPZB 4I18C 3CCHB 3D34A 2D9CA 3OKKA 4O00A 3OXRA 1I8IB 3RPBA 4HGWA 5EZLA 3EGXA 1J8HE 4F5CE 3NJHA 3NA4A 1NIAA 3GSRA 5GS0D 3DIFA 3O6FD 4GXFA 4DQAA 1MREH 5F7MC 2ATKA 2FBJH 2GG1A 3MO1A 2IFFL 5HDQL 3GS4A 4U1HA 3RWCB 2FT6A 3N04A 4RAHA 2RACA 4M6NH 4P9ML 5DMGC 1KBBA 1Z5LB 5EPMB 1BXAA 1IM3D 4K3DL 1MF2H 3O4OC 2GTWA 4I9XA 2VW4A 3I50L 3UCQA 1A4JB 4F8OA 1F2XK 1LWJA 3I75B 3LHPH 2W88A 5SX4I 3RDJA 2ZNXA 1W8EA 3EDKA 3H1ZA 1AHWA 5FKAB 2JJTC 3ECBB 2B16A 1KFGA 4RZCB 4K9EH 2O6FA 1O9ZA 1T22A 3K2UL 4X9IA 2E6JA 4AQ8A 4AEHL 4XC1H 2WY3B 4L1SA 4OLUH 4Q4EA 3M8OL 1ITCA 1D5MB 3TESA 4U6XB 4TULH 4ZPTB 1ETZA 4L8SC 3SE6A 2AP2A 2UY7B 1B2WH 3F12B 3LZFL 3WIAA 4QLRA 4RCAA 4NN7C 4R4FH 3QDJA 3MNWA 3K72B 5DS1A 4C4KO 5HJ3A 3RWEB 2ZOKB 2IWKA 4PJXA 3VRJA 4NS0A 3MJ8A 3A6CH 5TQ2H 3O2DH 3SO5A 1MAML 3CHQA 1M3IA 1ZGLB 2XTSA 4MD5B 2XC8A 3P40A 2B08A 2KI6A 1ZVHA 3F01A 1M2VA 4XNXL 3QDHA 4A7SA 1ZA6B 3B7YA 3BT2H 1T5KA 5C0CB 3TIDB 4XGZA 4J27A 5TH2A 5D7IB 1HTYA 1W16A 1QI3A 1JRHL 3DJZA 4ELKB 4MVBD 1KJ2A 2XVLA 3PGCA 5E6YA 2ZUXA 2FVNA 1K4DB 3FQXA 2R56H 5T3XL 2CSPA 5CR8A 3EH1A 3WUWA 3MR9B 1FNLA 2LT9A 2X40A 3GTNA 3ZN6A 3S36H 2OMNA 4HG4J 2ZXCA 1FVCB 1OK8A 4XNDA 3L16A 3VXUE 4D0CB 4CDGC 2PXYA 5FK9A 1Y6NR 4G5ZH 1KGYE 1BMZA 3MBEA 5E6IB 4KKAC 3IK2A 2HFEB 4GO9A 2L7JA 1DBJL 3Q9QA 4M5YH 2C5DC 3QC5X 3V5DA 1MY5A 3KWWB 3MLXH 1K6QL 2PYFB 2OAAA 5CBAB 1AR1B 2VDML 1E5BA 3FUDA 1IB5A 4TQEH 5E6ID 1KPRA 1AXSB 5JW4N 2Y1YA 2Y2YA 4KHTH 1JRHI 2H26A 4MAYB 3MTXA 4UWQB 3GTVA 5B3NA 1T7WA 3RNQA 1CLVA 4QTIH 3NCXA 3QXUA 3RIKA 3WKYA 4BCZA 2V17H 3HRZC 5GRVL 4QTFA 2XWRA 2HH0H 2P4AB 1OGAB 4P3DB 4F8PA 3D39B 4MAYD 4U1JB 2EDLA 2EUXA 3ARFC 1MHHB 3L3KB 3K2KA 3E6FB 3ML9A 3LN4B 2CLZB 4PJCF 3D18A 4HP5A 1KT2B 5AYQA 4P23C 1C08A 1OGAD 4QHNB 3I9AA 4JFFB 3TM6A 3K4ZA 5GRJL 4M29A 4ZI8A 3L1EA 1D5RA 4ONGL 2EIEA 5C0AA 4JO4L 3V4VB 4PRBA 1GOHA 5GS0L 4E41E 1NMBH 4KK9C 2XYBA 4MDIB 5GGSA 5DZAA 4JFFD 3QZWA 2O5XL 2AXHA 3QORC 5C0JA 4XVTL 3FF7A 1PTZA 1X9UA 4YFEA 4G7YL 1SJVA 1UM4L 2QGCA 1WRFA 3MRFA 4GIOA 2A2QT 3Q1SL 4KVCL 4E9TA 1WAAF 3LH8A 2Q7YB 1KJVA 2PETA 3PJSA 2QPSA 3JWNE 5AYUL 2MCAA 4MQ7A 2XA8L 1G9NL 4HUUB 4S1SH 3ULUC 4QOKA 3QH3B 1HHGA 1KACB 5CCGE 1JNNH 2NNXA 4P3CH 1FN4A 4RMQA 2J88H 2PO6C 3NCJH 5DJZB 5D1ZD 3KJ4B 3SDXF 3ZE1B 2G2RB 4IRZA 5C0EA 4PR5B 1A6TA 3IDNA 5HYFA 4O5LH 4HPOH 2DWEB 1NGWA 4RIRB 4YN3A 4LASH 3FOMB 5A6MA 2A6JB 2VH5L 2IALA 5JQIB 2Y2WA 1JHTB 2OSWA 2YAEA 4ZW7A 4Y1AD 1FRGL 2VW6A 5CEYA 1UUNA 3QR0A 5AWNL 3DX6B 1IGFL 3W9EB 1AYRA 1JOIA 4PS7A 2YEVB 1VGEL 4XCFL 2Z31A 4JE4B 3FU7B 4K7FB 5DO2D 5JIKA 3SBWA 1A0QH 2ZJSH 1E43A 3BVNA 1BM3L 2AZUA 4U3SA 5DWPA 4YXHH 5L7XH 5IOPB 2QZ5A 4LNRB 3ISWA 4R7VA 1Y07A 2QSVA 3T65A 4Y5VB 1YEDB 3OR6B 4D9RE 1XVSA 5BVPL 1ACYH 2VDKH 1X9RA 2WUCL 4J3OC 1RIHL 5F1NA 4X7SH 3M88A 5C0IB 3HE6B 2ZZUT 2X6UA 2GJJA 4G43B 3VMPA 1E5YA 4J3BA 1UXMA 2XNAB 4OZGA 4BRVA 3HCVB 1LO0H 1P5UC 3PFUA 1ZE3C 3X13B 1JI2A 1WFIA 1E4XH 4JPWL 4CU7A 2YFNA 3T1FB 4OIFA 5BQ7A 3L3OC 4GKZB 3VWKA 1XHHA 5ADOL 4H0IA 2QADB 4I2XE 2GUOA 1XGRA 3C5XA 4LCCC 4MCYA 4PP2B 2J1ZA 1P6AB 1GW0A 3CC1A 2AXGA 3T5WA 3CH1B 2IAMC 4XPFH 3VG0L 3VFRB 3QA3B 4NNXB 1AZCA 1C16A 2EE0A 4W68A 4FXGA 4C58B 1CR9L 2R2EB 4MA3A 3VFVA 3MRPB 1NBVL 3HN5A 4LBEB 1UVQB 4HEPA 2EILB 4FQ2H 4HS8L 4YHNA 2NTFB 4UM9A 2A1WL 4AQEB 4M9OA 1D7FA 3EOTH 4NAJA 4WI2A 3CZFB 2A83B 1OP4A 4R7DA 4JGJA 3IDMA 1RQ5A 3MRIB 4FMVA 1DUZB 5DR5H 4YDJB 3R1GH 2BP8B 2R0WH 2EIZA 5JA8B 3AJ7A 3D0VA 1FL3B 2SEBA 3RGHA 1N0LB 3EJZC 4X5XA 3U83A 3CFDB 1WPCA 3P2DA 4H20L 4P0DA 5ACLA 5C0FB 3ULVC 1C5DA 4Y9EA 4PW3A 2P8MA 1CLOH 4FHJA 3KPQA 3U2IA 1Q9KB 2O5ZH 4D8PB 5AVXB 4OJDH 4YL4A 3SDCA 1IBFA 4UB0L 4UI2A 3WY4A 3ARTA 4GXVL 5FUCE 1HHHB 1UA6L 2NNAB 1WEJL 4AL8H 3U0PB 4DKTA 4JK0D 1ROWA 1YY8A 3VXOA 3FS9A 3TEWA 3L3HB 1L6XA 4HJUA 2GITB 2RR3A 4ZTEA 2J1KA 3CFEB 1IBZA 2UYLB 3K4DA 3R4RA 3EJTA 4X8XA 2R83A 1P4BH 2ICWB 1XGTA 2DWDA 4R4BB 1X5GA 3GZQA 3NA9H 5B1AB 4O2CB 4F3FA 1QHQA 1KBGL 5IIEA 1GY1A 5L2JA 2AZAA 1AQDB 1E2VA 2CR6A 4KKLC 3BEWB 4JRFA 2JQMA 2MHAA 2PR4L 1OCCB 4K8RC 1L7IL 4I88A 2R9HD 3W82A 2A4ZA 1T2XA 1DQQB 3IDJB 1F6LL 2I5YH 2BJML 1V8HA 3B4NA 4B9ZA 1FE8L 3UAJD 1HHIB 2D7TL 2E0PA 3A21A 4PGBA 4PIBA 5EO9A 2FX7H 2OP4H 5C0GA 5I66A 4PJ5D 4YO0B 3NJFA 2ZCHL 2VZVA 3DTUB 1G4RA 1RJYB 3QYMA 4JFOB 4DP1X 4NGHH 4L1HA 1BMWA 3EYVA 3I02A 3MYJB 1B4LA 3QXWA 1IAIH 4ZMXA 5BOPA 1UCBL 3NZ8B 3AY4A 3BZ4B 5EORL 3WTSA 4JM2B 4YJZL 4O2EB 4R4ND 3N85L 5E08L 5C09E 3EH3B 3T09A 3FBKA 3WKMH 3BN9C 4QWWC 1O75A 4XZ4A 3G6JB 4XWOC 4LRIA 2M8XA 3I6LE 5L9DH 4HS3A 3RLSA 4JM2D 4FNPA 4KITB 3P4MA 2BP0A 4FYRA 4R90L 2ITEA 5C6PB 1U58A 1XWVA 4I3GA 4GO6B 4TSCH 1DBAH 1U4EA 2DBLL 2ED8A 3MUY1 3H9ZA 4PJ9A 3CK0L 2DICA 2ZWNA 4J8RB 4PY7B 1IEAA 3FFCD 4YHYB 3UC0H 5E2VH 2XXMB 1U36A 5IW1B 5J13C 3ZRFC 1UQSA 4MFHA 2H45A 1GKEA 4PD4K 3L4TA 4ZUWB 1B90A 1HSAB 4PLKD 4NKMB 4KDWA 5KTEH 2ERJC 2XUWA 1XCQB 3M1OA 4FQLH 2PCFA 5AW2B 2NSQA 3HBQA 3DX2A 3O2VL 2DMCA 4GSDL 4H44C 4PRHB 4ZXBB 5MEOB 1Q0EA 1E4KA 1HCZA 4ZOAA 3L95A 4P2OB 4J3OG 4JR9L 3T2NL 1N70A 3EJQA 3HR5B 2YPVH 1NUFA 1ZKAA 4HWBH 1G9ML 2XV6B 3RVTC 3WYRA 3SDAD 3SE4C 3IEAA 4RMWA 1XF2A 1MQKH 1O7VA 3QHZL 1ZLWH 4GO8A 3UTSB 4ZXBD 1E8YA 3NTCH 2PPCA 4N90D 1THCA 4P2OD 3BWUC 1QSVA 1ZSDA 2XZAH 4LKCA 3TA3C 4GJTB 4XCEA 3JWNH 4IDLA 2DYPB 2V7NB 5EF2A 1KC5L 2X53A 5IVZB 4HU8A 3U46A 3UTSD 3ZDZB 3LPOA 4NQCD 4EN2A 1PD0A 3BVUA 3ZKQD 3H53A 4WQOA 3H42H 3MCKB 5JR1L 4IIQB 2BCMA 1LVEA 2ESVA 3EOBA 3VU1A 4ZMNA 5L8JB 4Y8AA 4BZ2H 4TNWK 2DYPD 3V0EA 1I7TA 3T0AA 3QG7L 2R4RH 1OGPA 4AUUA 1FG2B 5F88A 2ZTBA 4IBLT 2OMVB 3HBZA 5H4YA 3HC2A 2ENYA 1C1EL 4N8VB 1R3LA 2FCBA 3PV6A 3V52L 5BNXD 3FO1B 3B3IB 4MNQA 4AY0A 5I1DA 2K0RA 3EF7A 4WKXA 2W80C 4HPHA 4LMQE 1GJIA 3PGFH 1E6OL 4L37B 5FGCB 4DZBA 5FA3B 4YNYB 4GG6B 2Q8BL 1I31A 5AFAA 3GDBA 4LGPB 3FH7A 4XAKE 5TTRA 3CXDH 3QNZB 3BW9A 4R97C 4X9BA 4RISH 5IVXA 3GJFK 3CXHK 4QI3A 3KL3A 4I0PD 3SKUD 4OGYH 3L5WA 4OSUL 2Z8RA 1E2WA 1KWKA 1WCBB 5I17A 3NG5A 1BG9A 3EYQD 5D4QA 2N7BA 2NY5L 4AX3A 4NZRH 1NCTA 3O8XD 1CZ8H 5L6YH 1MDAA 1AZVA 4HOXA 2F74B 3N41B 3TIEB 5J56B 5H94A 5J12C 4OKDA 1HXYB 1PZ5A 2IEPA 2LAGB 4N22A 5DK3A 3MN8A 3RU8H 1YUHB 1H6UA 3B2MA 1DBKL 1J12A 3MA9L 4CMMA 3CFNA 1I1FA 4U33A 4MJIB 3QBTB 5E7FA 1SEBA 1M42A 2NXZC 1U8LB 4CC0A 1HILB 4Z9KB 4KI1A 3ZHNA 1IKNC 3MRDA 1Q9WA 2NYYC 2NR6A 3GJFH 4K3HA 4MMYA 2R29L 1SBSL 5DEFA 4MJID 2QPEB 5T3ZD 1A6ZB 5J8OA 5IQ9A 2SODB 2ICWI 3QISA 3VSTA 5I73B 3IXAB 1DQVA 3WNKA 1QLEL 1WUNT 1X5HA 4D7PA 4P57B 1GZHC 4AGMA 5AG8A 2JSFA 1MCNA 2NY2B 1DSFL 3K5SA 5HD8D 2Y24A 3BZ5A 3HI1A 2CRMA 4F2MB 5CCJA 1A66A 1KYUA 1HQRB 3MA7B 4ERSH 3HG5A 4L05A 4LVOC 1FO0L 4M7ZB 3M1BA 5D93B 4ODHL 4UT9A 2EVHA 3HI6L 3ZE0E 2NY2D 3IFLL 3LIZL 5ADPH 2Z4TA 4APXB 3MOAH 5JQ6L 1W0WA 2C9VA 2YPLA 1CDJA 3DETC 4JS7A 3SY6A 1QG3A 1IFHH 1Z9SB 1I9JH 2DJSA 3F5WB 5EC1A 3V5HA 5KSBA 1N59A 4URKA 4FQPA 3KEDA 3P4NA 4X6CB 4DN4L 3RJQB 5I23A 3OB8A 5AOZA 2YD0A 4UDUB 4X50A 4KPHL 5F6IC 5DK0A 1KELH 2PCPB 2YXFA 4N8PA 4XCNB 2EAEA 1AJ7L 1HWGB 3HPJA 4JREB 2Z7WA 4N2AA 3IAPA 5IY5B 1JGUH 3MROA 2HX9A 1B3IA 3LMJH 1A4KB 1EV2E 1EZUA 4FL4B 5FDYA 1IAMA 4ZX3A 1RPKA 5BVJA 3WFBL 1MAKA 2X4RB 3CVHH 2A6KA 2CD0A 2RQEA 1TETH 4W4OC 5HHNB 3C12A 4QHKJ 1WDAA 4AQAA 5IQNA 4FNUA 5IHHA 3MYZA 3O2DA 3PAZA 4MX7A 5E23A 4PM1A 4NQDB 1Z5YD 4JHAL 3VFNA 2B1AL 3C60D 4HH9A 3MRCA 2GAZA 4PS8A 4BZ1H 1OANA 2QVTA 3LKOB 3G5VA 1KCLA 3GMLA 1L9OA 3MOQA 3P73B 4GRMB 2AW2A 3W9DB 1CFSB 1CDIA 2D0FA 4FF9A 4P9HC 1UOWA 4QRSA 3LSOB 5F97E 4NQDD 1JPFB 1L3WA 4L18A 3QPXL 2G9HB 2J44A 3IMSA 5MENA 3S8GB 5FGRA 5I1CH 1NGYA 1MFVA 1HZHH 2VLKA 1MRFH 1Q9OA 3MV9E 5GGVH 2OMWA 1W0YT 5EN3A 1BHGA 1FV1B 4LXFA 4OJFL 4IBQA 3VXPB 5JPNA 4A7GA 3ZRCC 3WHE1 1PLGH 2YAQA 3A3YB 3T1WA 1MCJA 3IETB 5IHZA 4DEPC 3U4EB 4LP4A 4G8GB 4WU5A 4MLIA 4LARH 4XMLL 1I1YB 4UT7H 3H0TA 1G7IB 1QFHA 5B1BB 3UO8B 3FQYA 5IJKC 2Q7AA 3DYPA 5FO8B 3S3CB 2GPZA 1Q0YL 5ID1A 1F8TL 2R23B 3OKEA 4MA7L 5T3XE 3RVWD 2WV3A 3BWAB 4G8GD 3GIZH 2UZXB 3RWJB 5BOJA 4EI5B 1CFTB 3PPSA 2XQYK 5FV2A 2R8SL 1E7VA 3BLPX 3PIQA 1QRKA 3W2DL 1PAZA 3ROLB 2DLHA 3GSVB 3HBPA 1B0RA 1T0NB 5K59F 5J3HD 4KJYA 4XPAL 4M62H 1UACH 4M7JL 1KPUB 4WV1A 4EI5D 1N10A 1RJLA 5JHDA 1I9RL 1U6AL 2X3BA 5EIIG 1YEIL 1IKOP 2AJSL 3D05A 3PWPE 4JDZB 1JF1B 3CPUA 3SE9H 3BKMH 1A5FL 2RTTA 4U6YA 3NIFE 4Y4FC 3TC9A 5BPPA 4IU2A 35C8L 3FRPG 1IKFL 4AGPA 4MYPA 3ZJAA 3KLAB 2X3CA 3OF6D 5TFSH 3CFIC 5KVGL 1U8KB 2VDRH 2M1KA 2XSKA 1K5NA 2L7QA 2K6WA 4LGRB 1KTDB 4MJ6B 4NM8L 1BF5A 3BDYL 5KOMC 4KNSA 3FB5A 2Y36H 4AVHA 4JLRB 3MNVA 3QI9C 3C6SB 4JY6A 3MSPA 3E8UL 4PCYA 4RGOL 2OL3H 1J1PL 4GKSA 5KWYC 4EDWL 3CDZB 4UQ3A 1V3MA 3V2AR 3EUDA 4PJFE 5AKTA 1HJCA 2PF6A 1BPVA 4LAQL 5EH1A 1NDMB 5JHLL 3N1MC 2HKFH 4KRPB 1JZ8A 1NUNB 3VVWA 4QHLA 3LPGA 5DD1L 4AUJA 3Q13A 4M6OL 4K5NA 1YPZE 5ESAA 1MW0A 2BVOB 2ZX6A 5BJTA 5C9KA 4IBZA 3VFUB 5GS2H 2OM5A 2CUMA 2VB5A 4EBQL 5FECB 4IRJC 4KRPD 5BZZA 4N68A 4ALAL 2DYRB 4UTAL 2QR0B 4LOFA 4Q97A 4MB4A 5E8PA 3ASOB 2NY0B 3BPLB 2ZG3A 4GP8B 2I85A 5IBLD 1P9MC 3JVGA 1TYJA 2BCKB 4KDTC 1L5GB 1T1XA 4PJCA 1TVBA 4YMPA 5AOJA 4KAQH 1AY1L 4XT1C 4DO6A 4NQEB 3DX8B 4KKCC 4OLEA 1WD8A 3SBPA 1E28A 1A65A 1KNOA 4XOBA 3VDAA 2NY0D 2YA0A 5ILTH 3ZE0F 4GQZA 4E2OA 4KJQC 1NBYB 3OR7A 4DZ8A 2BY1A 1A9EB 3G3LA 3BGFB 1KY7A 1Z3GH 5I18L 2IH3B 1RIVL 1FNEA 1XGQA 1HDMB 4NQED 5EBGA 5AALA 3ZTDC 1FDLH 2CDGB 2Q3ZA 1QZNA 1G7QB 4PHXA 2O1AA 3EHBB 4IK7A 1HXMB 4PJDB 4XXDB 2NY7H 4F80A 3FQWA 2WWKO 5AVVB 5FHAL 3Q06A 1AHMA 1WAAA 5EN2A 1EAPB 3ZKMC 3FRUA 2AK4A 1ZLVK 4FFWC 4DTGH 3D85A 3UL4A 2QTVA 5I75B 3FO9A 3SYAA 2FL5B 4HBQA 1KPVB 3EHBD 3VTAA 1S5IL 2WVSA 1AHWC 1YN6B 3F7RA 5I0XA 3BMVA 3LD8C 2W94A 4LSDA 2Y5TA 1R17A 2AV7A 3SDXA 3ZE2E 1A22B 3V6ZB 3IJSA 4YSAA 1OVZA 3LDBC 4FFZH 1TTGA 4AQ8C 3VGFA 1RK0A 2EEAA 1YZZA 5CGBA 1JYWA 5FYKD 5I6KA 4H1LA 4LEXL 3EYUL 1YN7A 5C0CE 4I18B 4F5CA 4PD4J 5D7IE 1JWSA 4N5EC 1U95B 2PNDA 2W9EL 3JUZA 3UIZA 5EDSA 1NAKH 2DLIA 4FYQA 4LPXA 4U1IB 1LD9A 4DKFL 3OAYH 2Q76B 4Z76A 2A7BA 1EO8H 1INEL 5C0BE 5M95B 3ZT6A 4Z77A 4BDVB 3RFZB 4NHCL 4TQPA 2MWCA 5DVPA 1ZLVH 3B5HA 3HW7A 5L88H 3H4HA 4X9FA 1KB5H 3ZDWA 1XGUA 1ZS8A 4R6UA 4WFEE 2YD6A 1OD9A 5IMMA 1CUOA 4UINL 3WHXA 1I82A 2OCFD 1KXVA 4GQ9H 5JZ7D 1JXFA 4KC3B 4L3CB 3RGBA 1OAXL 4CC1A 2N0KA 5DMGD 4BE6A 1USZA 3QFDB 2G3XA 3IJHA 4JL2A 5HY9A 1QLFA 4ODTL 4IOFC 5DHYB 3HMWL 3FAXA 2IFFH 3TO2B 1W0VA 3FUKA 3MRHA 5ELIA 3AAZB 4LSSL 5JW4M 2NNRA 3B9VA 3Q1EA 4FQIL 4K55A 1AE6H 2PXYC 4K3DH 9PCYA 1JZDC 3MBEC 2CHZA 2Y25A 5I1HL 3TBVB 5L0QB 1G0XA 4WKZB 1KBKA 3NFNB 3WFHB 3WIHL 3D39E 3GHEL 2QKIA 1TYEB 1ASPA 4NRZB 4ZFQA 4PV1C 4M7KL 2DQIL 5JOFA 4NI6A 1CIDA 4F7MB 1R1CA 1UB5B 4NO0B 4PBWD 5FC9A 3CN0A 4PFEA 3K2UH 2DN7A 5IB4B 3AROA 4AEHH 3NIFF 2BSSB 3V6FA 1DLFL 2WZPA 4JFFE 3M8OH 1EH9A 2TRYA 5DZJA 1F1AA 4F7TA 4UZGA 3IDIB 3MRRB 3CXHJ 3CFTA 3NFPA 2WOYA 4NO0D 1WITA 5IGXH 5KJ7E 1NCCL 1S7TB 2R4SH 2VXQH 2J43A 3Q8BA 5HDOA 4ODUA 2EUVA 3LAFA 1J8KA 2AJXH 4HJ1A 3OKDB 4OCWL 5B1KA 2XPYA 3VXUA 3GIVA 1T21A 2O93L 3KR3H 3BOVA 2VISA 1ADQL 1J05A 1LK3L 3DO4A 3U9PL 4XNXH 1FZMA 3D5OF 1ZGLP 2X0UA 1B4JH 2FHFA 2XN1A 3OQ3B 3ARSA 1RJZB 3DVGB 2B59B 3QS2A 4PJFF 4UIMB 2VAAA 1AOHA 4JFYB 3DX7B 4J6RH 4ATTA 4AKPA 4GXUM 4QXTA 5C0ND 4AMWA 1RUPH 1EDQA 4Q9BA 1NPUA 5T3XH 1S5HA 4MRCA 2C9PA 2BP5M 2J71A 4I89A 1SEQL 3DOSB 3MRGB 1NAMB 4ODXA 1YPZF 3SSGA 4AJWA 4KKAD 3VTTA 2BIOA 3GRWA 4PS3A 4S11A 3P1VA 3VI4B 2NCEA 2PTVA 4KTYA 3CLFL 4NHUB 3HZVB 1A2YA 3RVXC 1N3NA 2G2NA 2J73A 3HPLB 3TEXA 1U4FA 4UMSA 5TGBA 4BD4A 4IDJL 2V5YA 1WCQA 1DBJH 3WY1A 1Q4NX 1Z32X 3HRZB 1OT1A 4Y4HC 4DEWA 4X4YB 4G8FA 1UD6A 2BMKA 1K6QH 2LFEA 3G6AB 4KI5C 2MTPA 5FOBA 2QGEA 1NCWL 1Z9LA 3ARFB 5D6CA 5EIQA 5DHDA 3U82B 3HI5H 4Y16A 2GK0A 3LEVL 3NPZB 3VA2C 3O0LA 3P4LA 2VL5B 1LE5B 1U8OA 4MAUL 1QRNE 1CDGA 1V10A 4KNQA 5IF0B 5T8IA 2WGXA 3ARFD 3BLKA 1DCEA 4HWBA 4E41A 4JQIL 3D52A 4HDIA 4NWTL 3MLWL 1HYRC 2IDSA 1MJJA 4P23D 3S96B 2IXQA 1BFVL 7CGTA 1CXHA 3VXSD 1CBJA 1S9VB 4HLZG 3SBWC 3NCFB 5JOPD 5HHPA 2WQXA 3L54A 4FNLH 1I8UA 4ZS7H 5GRJH 4KK9D 4ONGH 2K6ZA 1Y18B 4LLVA 4EN3A 4JO4H 1YYCA 2XWXA 4NQSB 2Y69B 1CFQB 4HHGA 3OJDB 1E90A 3QORD 5CGYD 5GS0H 4BZ2A 4NLAA 3BFOA 2Q5BA 2FIKA 3AW5A 2PO6B 4ORGB 4P5KA 4ES9A 3VDBA 4IEFB 3WIIL 3FUJA 2EXWC 4LIQH 4JGNA 1FYTB 4XVTH 3RL1A 1PJ9A 1IGTA 4G7YH 3ULUD 3RY4A 4PREA 5D7IF 4KVCH 4MA8L 1A7BA 2Z8WC 1SN5A 2PO6D 3L1FA 3NQKA 5AYUH 4FFYL 3V8CA 2FLRT 1G9NH 4XMPL 5HGBA 3W37A 3VWKC 3K1DA 4HHAB 2R15A 2PYEB 2ADIB 5FFGA 3AG3B 4JRYE 3N06B 5ALBL 1JN6A 3UBXA 5CD3A 1XGPB 1XZ0A 1I7RB 2HAZA 2DW5A 4LCVA 2NX5B 4FI8A 3JTBA 5TE6H 3FUEA 1AKJD 2VAJA 4PQXA 4NC0B 3EYFA 2PYED 4FXGC 3QFJB 2YA2A 4R96B 1CB4A 2EH8L 3V6OA 1F00I 5TJWK 3BAEL 1CLZL 2NX5D 2HWZH 2H2SD 3DRQB 4FKEA 4BQ9A 2X2UA 2Q7NA 5HGDB 4B7IA 5C70A 4D9LH 2EDXA 2Q0ZX 1J88A 3BPCA 2NXYB 4HQQH 1FBIH 4GMTL 5CJXA 1QI5A 1VGEH 2QQKL 1N19A 4JY4A 4EUPA 4I77L 5I8OL 1RK1A 4BH8A 4GFTB 1BM3H 2H8PB 5KS9B 4Z7VB 2ZUTA 5FXCH 4J3OD 3FQTB 4JG1L 1P5UB 5DJ2B 1BVZA 2NXYD 3IXTA 3C5ZC 4QGTA 3GRBA 1ZHLB 2PWEA 2P49B 3GJFA 3WLBB 4RWHA 2WUCH 2ZCZA 3L3OB 4ISVB 4WI5A 4EMZA 2ATAA 4E9VA 1UKSA 4MQXC 2HYMA 4K15A 3SDCC 2XX1A 1WWAX 2HUHA 2NY1B 5D2NA 5J6SA 4CSTA 4Q6KA 4IKIA 4WK0B 3DDFA 3QUYA 5EULV 1PKOA 4ZQKB 1FFPB 3DXAB 2BHYA 4J1UA 3CLEL 2VZSA 3L3DA 1VZGA 3G08B 4OZFB 1Z9MA 1PZDA 2OTWA 4B3VA 1X5YA 2BNUB 4TPRL 1WTLA 3HR6A 3NCEB 1U91B 3N0PB 4OAWB 3VG9C 2HLFC 2DI8A 4RBPH 3WJMA 5DVLA 1UZ6E 1GW6A 3RI5K 2X7LB 1R3JA 3V9EA 5E1AA 2B7DT 2Z92A 2GJRA 2F19L 3VG0H 2W92A 3EO1B 4NAMA 4IBUA 1CCZA 1UHVA 3GUTA 5MEQA 4IU3A 4AM0Q 5BRZB 4ZS6C 3BZDA 3QZWG 1G7PA 4K23L 3G6JE 3ZTJG 1SVBA 3ARPA 4XBEL 5MEPA 4GI6A 5IROA 1PZ3A 2R2HA 3R7QA 4F24A 2A1WH 3ZE1F 1U21A 3PABB 3QP3A 5BRZD 2WYZA 1EAJA 3EJZD 4K71C 3LOWA 4FEMA 4PWEA 4ONOA 4BSWB 3B9AA 5D7KE 3VFMA 1JDDA 1O6SA 4LSPH 3AY4C 3ULVD 2MQ3A 3P2TA 4JKMA 4AT6A 4F8QA 1CICB 5BQDA 4DGWC 1ULVA 4OD3L 3TTSA 3EXLA 4H20H 3GXTA 3BFWA 3PWVB 4LRIC 4XAWL 2CDFB 2JCCB 1J0HA 2N1TE 2B4CC 4XNUH 4B5ZA 1AMXA 4PRHE 4DO5A 4PTUB 3IGFA 4GXVH 1KBPA 1UKQA 4TUKL 3V4VH 3ULUL 1UA6H 3ROOB 1WEJH 4PJ9C 2WWKT 3MBXL 3CC5A 4OB5H 1I3RA 4JE0A 5B21A 4S1RL 3BGMA 4ANWA 3UTSE 1ZHNB 3VGGA 3HLAB 7FABH 1WAPA 3DVFA 2WO3B 3G04B 4CDHA 1JV2A 5D4JA 2JF1A 4KKLD 2BSDA 1FIGH 1V7NH 4K8RD 1NLBL 2ZSWB 4GW4B 5EU4A 1KBGH 5F9OL 4Z78B 2JK5A 2CO7A 2WQUA 3MX0B 4EZKA 3ZDZE 1E4KC 1P5VB 4U7KA 3V7MA 2Y6SC 1XX9C 3ABZA 4NQVB 2OR7A 5C09A 2A9ML 3MRKB 4L5FH 1L7IH 1UWEL 4B3EA 5KSVA 1KGIA 1OSZA 2DQ6A 4GG8B 1FE8H 2Z35B 3JBG7 2ALAA 2D7TH 5LXVA 2B5IB 3OWRA 3ZBMA 3M17A 2D31A 2XWDA 2ZCHH 1DZ0A 2WXHA 4GKLA 3UTQA 1T3FA 1YMHA 2YKLH 5CEZD 3D2UA 2YD2A 4PWKA 1SHWA 5AZUA 1A1NB 4U1MB 1ZT1B 4O02B 5FGCE 3BN9D 4QWWD 2BVQA 2VLRB 2YQ3A 5JYLA 1K8IB 4XWOD 4ES8A 3HHRB 3QCTL 3N85H 3BUYA 4HGKC 4WEEA 4A7VA 2Z8VC 4QCIA 5HHXH 3NIDB 2P8LA 4PW4A 5D71H 5K39A 3AQZA 3PHOB 3KE0A 1R33A 3PLYA 2CMRH 1PX8A 5IB2A 1TO4A 1ED3A 2VLRD 5I8KL 2ERJB 3G5YA 2OZNA 4MD4B 4HEPG 4DKAA 3DBSA 2XOTA 4JFHE 4Y5XC 2CM6A 5CCHE 3TNNB 5DRNB 2ZKYA 3EDJA 4CADB 2DBLH 4CN4A 2IV8A 3C2AH 5KVDH 2XQYA 2YARA 2FH6A 2AXWA 1U41A 5DI8A 1FC2D 4QY8B 3O41A 1QZ1A 1BZ9A 1M2OA 5TDPB 2P5EB 4PLJC 4LPTA 2X4SA 3OHXA 4XMXA 3WN5A 1EXUB 1LE9A 2ZOOA 4TSAL 4FABL 4OFPA 3O2VH 4GSDH 3RVTD 4PV8A 4L9LB 1OHZA 1QWHA 4UQIM 1WBZB 4UM8B 2DM2A 4AVIA 4JR9H 2P5ED 3T2NH 4BSJA 1NFIA 4Y89A 5KVGE 5IG7A 2NOYA 2VLLB 1G9MH 2N59A 1QSFA 1SGKA 4FQHA 4BFFA 4PPTA 3QHZH 4N25A 4RDQG 2AJYH 1BX2B 5D9SB 3TA3D 2BM3A 4K94H 5HP5A 2AF2A 5GS1B 4PRDA 4OBRA 3DBXA 5GGRA 4XPTL 3B7TA 5ENWB 3LXCA 4K7PY 5GSVB 1HL5A 3EAKA 1KC5H 4NO5A 4W70A 4TTGA 1ZTXL 4F2ME 4ZK8A 1ZS2A 3VX0A 1DJZA 4ECNA 1HE8A 1D5XB 3FB7B 2NR6C 1WC7A 5GGSY 5BZDB 1MAJA 1RZIB 3SKMA 5EUKA 5LNEA 5LGJA 1TPXC 1DBBL 2L4OA 1JPTL 3QWRA 3QG7H 4R97B 5IFHL 1KTLB 3KYNA 1XTLA 2WXRA 1UZ6F 3PQYB 2AITA 25C8H 1C1EH 3F7YA 1BD2E 1OKEA 3V52H 4MMZA 4AM0B 2ICES 4X6CE 5I1AA 2HCZX 5GRYA 2DJ4A 4JM2F 3V4LA 5CF3A 4HCRH 1VSCA 2PPEA 3NJXA 1E6OH 1R0AH 5GGQH 3QJRB 3ZGHA 1P4IL 3PQYD 4F92B 3G6JF 2Q8BH 1KTBA 5BW7A 1KCWA 3BKCL 3LS5L 1ONQA 1J1XL 1ETB1 3NEEA 3TL5A 4BSVB 4JM4L 1A9BB 2ZAGA 3BXNA 2HKAA 4HKBB 3IGUA 1SXSA 2P3YA 3Q6GH 2Q1EA 2NXZB 1XDTT 2XHNA 4K9EC 4H8QA 4NQDE 2NY5H 4Q52A 4W1TA 4FFZA 1UWFA 3VQMA 1IVTA 2DL9A 3SKOB 1OF2A 3NYKA 1LM8V 4FTDA 5I1LA 5E2WL 2B1HH 5ECJE 1NICA 3TP4A 3CZNA 1U9KA 3BH9B 2X89A 2A9NH 2XICA 2A6DB 3TCLA 2NXZD 4H8HA 1AD9B 2EDHA 3MA9H 4KXCA 2J1YA 4G70B 3AUWB 3KBHE 4QRQA 5F9JA 3P54A 3PFQA 4N0UA 3H7BB 2NYYD 3SJVA 3P9WB 5IMKA 5F71A 2FJGA 1USQA 1P7QA 2JQZA 1P4LA 2E27L 5FS5A 1SDDB 5E8EA 3APCA 1I8KB 3EOAA 3Q5OA 3QB7C 4A2DA 1F11A 2B3RA 5FR3A 1QVOB 3VTMA 1KB5A 1Q38A 3LEXB 1RIUL 4LVOB 2XWJB 1NGZB 1GYCA 4B95C 2EC9T 5EO0B 5E8OB 4POZC 3QEGH 1UD2A 4B9CA 3FUHA 2CK0L 2HRGA 1B9ZA 2EE2A 1S7VB 3ZDZF 4YBLC 4O58L 3QNYA 4XXCA 4S1QL 4V1DA 1DSFH 3ARYA 1A47A 5F6IB 1FA4A 1K3ZA 2JIXB 3ZZQA 1XR8B 1FH5H 3FSOA 3DETD 2CO3A 3O3AA 1NM4A 1J0YA 3I85A 2BZ7A 2GW5A 4ZD3L 2R59A 3HI6H 4ETYA 3IFLH 4Y5YA 1Z1WA 3CBJB 3LNGA 1XBRA 3H9HB 4KXBA 3B9EA 5SWZA 4U0RC 3BYYA 4A7QA 2JIXD 4JFQA 3BYTA 3FC8A 3NGBC 4XMVA 1ZV2A 4ZG1A 2VW7A 4ESKA 1CDYA 1QUNA 3NDYE 1NLDH 1SY6L 4G9FB 2BWQA 4OTXL 2YEZA 4B60A 4PEEA 4KPHH 5FGSA 4LCUB 3TWYA 2AQPA 1SDYA 3C5JA 4KUCD 1AJ7H 1RUAL 3GWJA 2BHUA 3QCUL 3OTTA 1RSFA 5I82A 5KSUA 4IHOA 5B4MC 3L7FA 4YE4H 4G9FD 2ZUYA 1YSOA 1AYOA 3ALPA 3QJHB 4OM1H 4AENB 4LVHB 3P9MB 4H5SA 1XV8A 4N1CA 4JPVH 2HLAB 4WV1C 1TT6A 1NKRA 3MV9A 2FQFA 1BXUA 3HC3L 1OSYA 4ABWA 3FONA 2ZAIA 2F08A 4CA4A 1NCAL 2PKDA 3LZLA 3N41F 5CP3A 1WJ3A 3DDGA 4NT6B 2ORBL 5FKPB 1EVTC 2DL2A 3QO0A 4N2LA 1VFUA 3QIWA 3U7AA 1TFHA 5F9WB 2BDNH 2WO4A 3EH4B 4LPWA 5FV1L 2GI0A 2APTA 4K5OA 2JXMA 4GUOA 1QR4A 3GB7A 4NFBA 3FCSB 3VGDA 5J6HA 4EEEA 4JQVA 4WO0A 4DEPB 3IVKB 2YRZA 3QPXH 1TU2A 3RJOA 2PABA 1F2QA 4FTVB 1AO7B 1ZANL 4LKXB 2RHEA 1PSKH 1EWHA 4FQ1L 1MLBB 4LAJH 5HYEA 1XH3A 3L4XA 1V27A 3BO8B 1D5ZA 2WOBA 1HH9A 1P7HL 2CPUA 4OFDA 1CD0A 1NA8A 3C5SA 4Z3HA 1D9KA 4M1DL 4LLMA 4MB1A 4MZ2A 3TBWB 4FTVD 3OXSB 1AO7D 1RPUA 4YAQB 2HVJB 3MHZA 3OKOB 2GK2A 4XMLH 1PW3A 1SPDA 3N3EA 5I6OA 4QTHA 3SY0A 5HYJE 5J9PB 3T4YA 3KHQA 1MI5B 3TH3T 1NDGA 3STLB 5HI5C 3WMSA 2WCPA 2W65A 3B9KA 2VN3A 1XCTA 3QQ3A 2DQMA 3V7AG 5EBMA 3OG6B 4CSSA 3ILPA 3BZFA 5K9KB 2FATH 4M4RA 2R8SH 3QWNA 3W2DH 2Y07L 2LR4A 2R7EB 3D08A 3NQIA 2YMOA 4MBRA 5IMOB 3PDOA 4PYHA 1MI5D 5FOJA 4X6CF 3JVGC 4XPAH 4NIKB 5TF0A 3FO2A 3I9IA 2J3SA 4PJDE 5FUOL 2VERA 5IW6A 1I8MB 1I9RH 4JRWA 3RHWF 2AJSH 3MNZB 4HIEA 1HEZA 4RSVA 2ODIA 4R9HA 4TNFA 1JGDB 1BJ1J 2VDOB 1F6AB 3FMGL 1A5FH 4OZ4B 5E1GA 4IYKA 1I7ZA 5ABDE 4QRUA 5JTWA 1M71A 3TASA 3VGEA 4W6XB 2FEDC 5AD0A 1EMTL 5FYKE 4PI0A 1VGKA 3HE7A 1QR1B 4DQOL 2QKSA 2HJLB 4Z5RB 4XE0A 1WIPA 5KVGH 4GKNA 4HAGA 1GZQA 4U1GC 1T5XB 2Z7UA 5CSZB 5DUML 1FSKC 4FFVC 3CCHA 1MWAB 3QQDB 3WXWL 2CZNA 2WXMA 1BYPA 2YD4A 5T5NF 2WVUA 2FHCA 1JGIA 3BDYH 1I8IA 2KKQA 4OFVA 3UC2A 3AITA 3GHBL 4KQ0A 1PG7H 2H0EA 2CRIA 3KXFB 4Z7AA 4IRJB 5HDRA 3VA6A 4OGQC 2A4CA 1N68A 4OLYH 1KJ3H 1F02I 4LAQH 3RWCA 1SN0A 1S7SB 2RBLA 3HKFA 5DZNA 1J9SA 3EYOB 3ZTNH 1T0MB 1JVOA 2CJUH 1XCWA 1W91A 3KXFD 5ANHA 4IRJD 4Y2LA 3HHMA 2B2XH 2WTRB 4M6OH 2ZD0A 5EU6D 1K72A 4W9CC 2CA4A 2ZYHA 3EGSB 3AGWA 5FKAA 4EBQH 3OXRB 5F0PB 4UTAH 2J57A 3LYRA 5EZLB 3GXUB 4OCSH 3KD4A 3FXIC 3GSRB 4KKCD 3DIFB 2NY4C 3GXFA 3RAJL 2ATKB 2EINB 1D5MA 4U6XA 4ZPTA 1HWHB 5F7DB 4KJQD 1CK0L 1WWBX 2UY7A 4HKJB 1MZZA 1X5LA 1AY1H 2HA1A 3L9EA 3RWEA 5ICZA 2ZOKA 1NFAA 4MCNA 1DVZA 1KXVC 3EIFA 5CINL 5I18H 2AABL 4MNGA 2RFXA 3GMNA 2KH2B