4W9LC

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
140
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 35
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9lC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9lC01
4B9KC 4W9JC 4AWJC 4W9EC 4BKTC 4B95C 5LLIC 1LQBC 4BKSC 3ZRFC 3ZUNC 4W9KC 1VCBC 4W9DC 4W9LC 4W9IC 3ZRCC 4W9GC 3ZTDC 4AJYV 4W9CC 3ZTCC 4W9FC 1LM8V 4WQOA 4W9HC
chains in the Genus database with same CATH superfamily
1I9RL 5KVFE 4IRSB 5HI4C 1J8HD 4TNEA 1KTLA 2VL4A 4WWKD 3IM1A 5DHMC 3FQRB 3EYUH 1MREL 1ED3A 3CN1A 1BFVH 1DQDH 3CQFA 3D12B 1NKGA 3GT6A 3LKSB 2V3EA 3FKUS 3RDTC 5K39B 2GITB 2FWUA 3CN3A 3WEXB 4GY4A 5E2JA 2PWGA 2AQQA 1EO7A 2XQYK 3NCCB 5AKRA 5I0DA 4OD2B 2QT6A 1DVFA 1FRGH 4A7GA 3CVCA 2VISA 2KQMA 1IGFL 3HBPA 1RURL 1P4LB 3B4NA 3NJIA 4U1KA 3K80A 3HVNA 4XCCL 3DX3A 1OP5K 1G43A 3JTSA 5JHDE 4TNFA 1UXWB 2EKSA 1FL5B 5HHOB 2R4RH 3WFEH 3GHEL 2DLIA 3MCKB 4YE0A 3TU6A 2VL5B 3MI6A 3LJ3A 4JO8A 1IC4H 1OGTB 3GRWL 1BAFH 3HG5A 4QRTB 1UZ8A 3BEWB 4HJTA 5B4MD 2ENSA 3DX6A 2VDRB 3EFDL 4U31A 4R7LA 2V9TA 4HWZA 2Q76B 2EH7H 1F58H 4GI8A 2HTKC 3BE1H 4NQSA 2YBRB 4XNYL 3RWIA 3A3YB 5I15L 2F5BL 5KS9B 1B6UA 1AQKL 1OM3L 3LEYL 2DI9A 1IFGA 5DJDB 2WZPA 3TT3H 4YAQA 4N90E 3WNIA 4WI5A 1QVOA 3O6FC 3MREB 3QWRD 5EPMB 4UTAL 2W9DH 3HG2A 3OF6A 1ZSDB 1O9WA 3HIZA 4DFHA 4G6FB 1FVCA 1S7WA 3MA7B 3BQUB 2EDLA 5TGBA 3LVEA 3BGAA 1FYTD 5KSVB 4KJYA 2VITB 5JQ6L 1YYLH 5KVDE 4ZXBD 3TZVB 3QCTL 4ANVA 3VXME 3N5AA 3HTLX 1GS8A 4EBQH 5F9JB 4IBYA 4OLYL 4D8OA 1VEOA 1L3WA 4N6QA 1KJMB 3MRNB 4WSGA 3D05A 1SJHB 1UT1A 2C26A 2NZIA 1OGSA 5C7XH 2WXGA 3FOMA 5T1DH 4MAYD 1P5UA 1FP5A 4NFDA 4FNSA 2GT9A 3MOQA 4XWGH 4XR8C 5BV7C 1NAKL 1QNZH 5DSCA 4WTQA 3N85L 4OFPA 4PHZA 4YHPA 3K8MA 4HIJB 4DO6A 4W1TA 5D7SL 1T20B 5H37A 2DQEL 2WLYA 4MXQC 3HRPA 4JPSA 1M56B 1T83C 4APQA 2WW8A 2O5ZH 5B38B 1Z1WA 4UILH 1R19A 4KOCA 5J6SA 4PJ5D 2X05A 3APDA 3EW3B 4PRPE 4DVRH 3HLAA 4P3CH 5TFSL 1JRHH 4WO0A 4ABVA 3N1FC 3EHBB 4N8VB 1SLVA 4ICXA 3CDCA 4R8WL 3WDIA 1QATA 2XX1A 2ZKWA 3D33A 4ZG1A 5D7IF 1ZS8B 4H8WC 2CKNA 5IFHL 1BJ1J 5CCKL 1KB9J 5CKAA 1S7QA 4KK6C 2OMWB 4BWWA 3QNZB 4OF7A 3FT3B 4UNIA 4Z18A 4C56B 2H3XC 5JHDD 4NQXB 4YL9A 4JANA 4TSBL 5AW1B 4V1DA 5DQJA 4TUUA 3CN0A 1FIGL 4PJ9A 3NZ8B 3TVMA 4JPVH 3X1GA 1ZWIB 2NZ9C 1DE4A 1TLKA 4OT1L 3SYQA 1N5YL 4Y9EA 1D5IL 4RLDA 4PJ7B 4PJAE 1EEYB 4JG9A 3V4VH 2CU9A 3EG9A 4LSSH 3UBGA 5L6YH 4DUWA 4A67A 3WO4B 2LLLA 3GBMH 2VR6A 2APBA 1TETH 2XTSA 1NCNA 3PJNA 2EXTA 1YEWA 1RMFH 1CD1B 1QSED 4FCAA 3TLRA 2NY2B 4DGYH 1I4FA 2IPUG 5JW3H 5KVGH 2AQ2A 4TL5A 3QQXA 4HGWB 4N90D 1KCUH 2H3NA 2B39A 4PJEB 3D0LA 4HXAH 5F6IC 4IBVA 5BMFH 1E67A 3G08A 5G4MA 2YD3A 4X8XA 1AGBB 3ZSSA 3BAWA 3WMSA 5KS9F 5CZXD 1LP9E 4ENED 4I3SH 3L4WA 4C8XA 2FO4A 3QUZA 4FTVB 1DQMH 1IKFL 2W60A 15C8L 3M86A 2GC7C 3VSVA 2VSKB 2P5PA 3RGBA 4XMKH 2OZ4H 5C86A 4N20A 4QAWA 4WJ5B 3SGDH 1ZLVH 4PUBL 3VXMD 1RUQH 1OT2A 5MEQB 4U6HA 1GOHA 5IEHB 3S97C 1SEQL 5TE6L 3G04B 4UNVA 1IL1A 1DEEA 1U93A 1ZHBB 2DJMA 2FWOB 3FO2A 2ESVE 3ZT7A 4AYDC 3UTTB 4FNLH 1S7XB 2DJ4A 4BK8A 3ULUC 3FQWB 4DTGH 5BXFA 1ZLUK 1FHGA 5KWYC 2A0LC 4BUGA 2AABH 4R83A 5D93C 1BXAA 1ZTXL 1MZYA 2DL9A 1AY1L 1OLZA 4MSWA 2V6HA 1J5CA 2DQGH 4BUHA 1OTSC 2IWEA 4ZMAT 3RUGE 4P9ML 1OGAE 1R3LA 2I9LA 2NDFA 2UVEA 1MNUH 4QRFA 4M7KH 3P73A 1IZKA 3ISRA 1JZ5A 3VXRE 1K5NB 1NCCL 2DD8L 2APXA 2Q3XA 2F58L 3CFKA 5FF6B 7FABH 1REIA 1QR4A 4TSAL 4XRCA 3T2OA 2NY6D 3JUZA 1N64L 2OW7A 4OLXH 5LNGA 3D07A 3FAWA 3E2HC 4JO1L 3HAEB 5JXAL 4XAWH 1IVLA 4ORGA 4PB9H 1IQDA 4HCGA 1JYWA 1NCAL 3PGDB 2Y6SD 2OX5B 3VQ1C 5C1MB 3WFCL 5IB3B 2WJ5A 3U82B 2ZOTA 4UQ2A 4L4TB 1C7SA 5EUOB 1F4HA 4UDUA 3ABGA 3RA7L 4I18A 1G84A 1AG0A 1FA4A 4YUEL 2OBGA 3WMQA 3UFIA 1U8PA 4PV1C 1ZVSB 1XSKA 4ZFGL 3DK2A 2I85A 3P9WB 4XPBL 3QIWB 1KLFB 2VMCA 2ZPKH 4EEEA 2C7UB 2NY1C 4K7PY 1RZ7H 5CEZE 4UAOB 3FRPA 5AOMA 1UB5B 2BSBA 4FHBD 1BZ9A 1J9CT 1XF5B 3QZOA 1U8NB 3A47A 4MZIA 4Y5XC 5DVLA 4GLRH 3WIFA 5TK2A 4XXDA 2O6EA 1XBRA 5DEGA 3O6MH 1FVDA 1GIGH 3LVTA 4LCCB 4Z7UE 5FECA 4DZ8A 4XP5H 4PJ7F 5SWSB 2Q8AL 3CMOL 2OR7A 3GKWL 4JJHA 3W57A 2JCCE 2WQVA 1NEPA 1F11A 2XXFA 1RK0B 2GHWB 2O26U 4FHJA 4QHNB 4EI0A 1H3TA 4NPYB 4XMPL 5EZIL 4X8JB 1JERA 2KL6A 2YPVH 2PWDA 1OLLA 4JG0H 3HHSA 2EE3A 2NLJB 1OPGL 2BVQA 3HFFA 3P4OB 1KGCE 2Z31D 4DK5A 4HCIA 1ZE3H 3QCVH 2W92A 2H45A 1UOKA 4ZOCA 3NT0A 4HKZA 5AB2A 5I23A 3HE7C 3OXRA 4FEIA 2F53E 3EYQC 4WKZA 3TYGH 4JKPL 2LVCA 3IU3B 3RPIA 1JF1B 1N18A 5FAAA 4G9DB 2BRRL 2X1XR 4FXGB 3H3KA 5CP7A 5IMOB 4WSJA 4JY5H 1YN7B 4G7QB 3VWJD 4N0RA 2PKDA 3QRGH 4NENB 3VWKD 4JGNA 2G5BA 4IHOB 4GT7A 1JF5A 4OD1H 2L7EA 4I77H 4Z77B 4UV4H 1PZ5B 5C2BL 4GUPB 1I85C 1T0NA 3ATFA 2KZBA 4HWBH 2XPGB 4JPIB 3FO9B 4ECNA 3PNRB 4PCSA 3B9KA 4JGHA 2IXQA 4RH4A 1XF3B 3X14B 1RUMH 2ALWA 2IG2L 1X7QA 3R7RA 3T2LA 3MRBA 3T2NH 1TCRA 5I6MA 2VIRB 1PEZA 3VFOA 3EDKA 4X4XB 3VXRD 4AENA 1IBDA 4P23D 5IT2L 2CLRB 2IPTH 2WXFA 3O6KL 2BY2A 5CCJA 1OALA 1BQLL 4QPEA 4ZFOA 3KWWB 2N56A 4NCC2 4WTXA 1AYOA 5AB1A 4IHBA 2BFVL 2J20A 4J6RH 1TKWB 1GTFA 3G5VB 3GMOA 4H8PA 5E2VH 1VERA 3BP4B 3ZX1A 1BFOA 3P3RA 2AXGB 4QRPB 1XH3B 2DOCA 5FCUH 1FORH 5E08H 2GBTA 1ZT7B 2D7OA 5D1ZA 3DO7A 3MRGA 4C47A 4J3OH 1SYSB 1NBYB 1CGUA 2NUTA 4CC0A 1NC4D 3CSYB 2OTUA 3GC3A 3L3DA 5K9OB 3K4DA 5I5RA 2KH2B 4P2OB 5L2KA 3CLEH 5DD0H 5B8CC 5JPNC 4GSUA 3T4AC 5CEZD 1W80A 1MPAH 1QFUL 3O9WD 3SBQA 2DYSB 4R4FL 4CDGC 4CVZB 3NJMA 4L3EE 5BCAA 1CVSC 1W0WB 4DK6A 4MHHG 4OCWH 4BE6A 4M48L 4OKVB 1G87A 3MZTA 4DKTA 1BYNA 3EJZD 3FBQA 2EVHA 4EI6B 2WLLA 4IBSA 2XRAH 2AW2A 3OZKA 2LFEA 3HRZC 5J11B 3KLQA 3ROLA 4DVBA 3SBWA 4E9WA 5D1XD 3B2UC 4Z95H 3WXWL 3S5ZA 1O6SA 1A4KB 5FOBB 5C6TH 2B1HH 3F12B 3KPRA 1WAAE 1RULH 2H0EA 5M94B 5T33L 2XCMC 3QEGL 4NN6B 4JM2B 3TURA 4WSKA 3C09C 3SIKA 3GSNL 4JKKA 4DP7X 4KQ3L 3WFDL 1KGCD 1SHSA 3NEXA 2ICCA 3RBSA 4UBDC 4FQCL 1U30A 2F5AH 2Y4SA 1OAYH 4IKIA 4FXLA 4NZTL 4IU3A 1MFAH 5FW8A 2VXQL 2F53D 3V4PA 5LN8A 1S5HB 3WKML 1J1PH 5I0VA 4G8GB 1WFNA 2VR3A 4X4MA 4QXUL 1VFBA 2IANA 3BWAB 3VI3E 4GRLD 3GXFA 4N6RA 3LQMA 4OSUH 3BESR 5H4ZA 3S7GA 3OHMB 2F19L 3U2IA 2YZ1A 3HUJA 1U21A 2NSMA 1F3DJ 1CLVA 4XCNA 2R23B 5FOJA 2P5WE 3T04D 5JOPE 4BZYA 1QR1A 1J7VR 1OP4A 4IJTA 4O2FB 4WFGD 5J13B 1JV5B 1JGVL 2Z34A 2A38A 1ZANL 4L1BA 3O4OC 2PYEE 5CIPH 3WJJA 4ADGA 1KGUA 5J3HC 4NRZB 3RLSA 4CN6A 3KLLA 3ZKNC 2M2DA 4YEFA 2WBJD 5CHNA 5CJXA 3SKJL 4EN2A 2CJUL 3S36H 3ZL4L 1LK2B 3OX8B 3MGOA 4WUUD 1LWRA 4L9LC 3NN8A 4O02A 2BVEA 1NCBH 2FSEB 1CGSH 5AOLA 3K6SB 1JPTL 1Q9WA 4N0UE 4PTUB 1ID2A 3RL1B 1IC0A 1A21A 1MFUA 4U1SB 1RJZA 3FB8A 3ATBA 1F1AA 5DURD 1DQJB 3OM3B 3MACL 4W9IC 3LNHA 5E8EA 4W9CC 3BQVA 4GKSA 1ET8A 4XP6L 2HFGH 3ZIMA 4CGTA 1NSNL 1A3LH 2EKJA 3C5ZA 4FI7A 1CGWA 1P6AB 4K3JH 3DRQB 5BRPA 3R0NA 2A9DA 2DWXA 2X4TA 4A7UA 4ODVH 4H8UA 1UGKA 4GBXB 3WU1A 4QHKJ 4HAKA 1DVFB 3W9EA 2P47B 2RR3A 2P80A 1XF2B 1PLGH 2N1KA 1S7VB 1O5PA 2YBGA 1CBVL 5FCSH 1ADQA 4PRBA 2X4RA 4ZT1A 1OP5H 3BHBB 1EGJA 1KTDA 1OO2A 1JGLL 1L9QA 2WYHA 1CC3A 3SDDA 5D6DA 1MWAH 3CZLA 3AXLA 5TDOB 2B3IA 2QSQA 3OHXB 1HTYA 2XG5A 3MR9B 3GNML 4UTBH 1WCBA 4FJ6A 4ZBJA 4YVUA 3TWCL 4AV5A 1WWCA 3EFFA 4FQJH 3H42H 4KKCC 5INCB 3DECA 2V17H 1IILE 4I8DA 5CCHE 1JL8A 3CVIH 3E9TA 5MP6L 1DCLA 2XFXA 4XC1L 3RGVC 1D2OA 3F3HA 1P69B 3VH8B 1R24A 1I7TB 4L4VA 1H8LA 2FLMA 2XNAB 2JCWA 5F89A 3QFGA 4OLVH 3MUGA 1MCKA 3IPBA 5DVOA 3QZWB 3VXSB 4YHML 2PPFA 2VDKH 2HPTA 4L8CB 2F74B 1SXAA 2GUYA 3P40A 3H7BB 1HSAB 5DMIH 3BSZL 4M1DL 4QCIA 4YHZL 1IGCL 2V3DA 2OMVA 1VDGA 2BVYA 1CLZH 4FEMA 2IGFL 1IBGH 2PCXA 3ESNA 2Z91A 4XAKE 4P59H 3RWGB 4OCNC 3KR3L 3BH9B 5DR5L 1QRNB 5DMGC 3S2AA 4PGEA 4G6AD 4GXUM 3LZFL 4NUMA 3M8OH 3IJYA 3BI9X 2P5WD 3OKMB 4XN8A 1ZHKA 1A7QL 4P3DA 3SE8H 1RZIA 5I19L 3H6JA 3EH2A 5J89A 4PJ8C 4YHLL 1U4FA 2ARJB 5HJGA 2OSWA 4M61B 1S7SB 3AFLA 1N70A 3EGDA 2V5MA 3GTNA 3WYRA 3DOSB 3VFMA 3FB6A 4UQDA 1BDYA 3VGBA 3CVBA 4PRNB 2K6ZA 4BXSV 3HNVL 4XP4H 4UOW0 1HX0A 5D1QA 1JJUA 4Y5VB 3RX5A 3EUDA 4XVTL 2TAAA 3RDJA 1ES0A 1YNKL 4KUCD 4R9HA 5E8PA 3MRPB 3VFNA 4IGBC 2B3RA 4EKJA 3CX5J 4FFYA 1DLHA 2WZ5A 5DMYA 1NDGB 4AYGA 3VYPA 4PRDB 3BP6A 2E27H 4K7PH 4O51B 4KXZH 4Y8AA 5IQ9A 4XBEL 1NWPA 5D7JD 3TV8A 4BIKA 5CBAB 3T65B 4WO4C 2X3AA 4H2AA 1BMGA 1OF2B 4ZMXA 5JOEA 1U58A 1KXHA 5IB5B 3ZO9A 2P3YA 4HAGA 1PY9A 2ZP0T 1RUAL 2OLDA 1SY6L 2DEXX 1J9QA 5C9JB 2X4UB 3QWOB 3WJMB 1MI5B 4NWUL 4DK3A 4OI8A 1MXGA 5SWZA 1WCQA 2ENQA 1EAOA 3O3EA 4R4ND 4HBCH 5E9DB 3IKKA 1UACL 4U1MA 5TH2B 3GS7A 4M8UA 2ZXWB 3BMWA 4TUKH 1PEWA 2DQTH 4DF9A 2GCYB 3QUMA 1CFSA 4PWFA 4P5TA 2EDTA 3HG4A 2IAMD 5I8KL 4NO2A 4D9RD 3DJ9A 1JNHB 1G6RL 4QRRB 4HS3A 2JELL 2XJLA 1HJCA 3TP4A 4BZ1H 4N5ED 3D1MC 1OAZH 1NEZB 2V2XB 4PG9B 1QEWB 5LO7A 3WIAA 1ETJA 3JWNG 4X8GA 1A6VH 1BPLB 4NO3B 5AWNH 3CVHB 4D8PB 4GO9A 3NSXA 3UJIH 4ODXA 2BIMA 1A22B 3OC5A 2H9GA 1FL6A 1WEJL 3O3BB 5CZVL 3MROA 4X9YA 2R2EB 5KZCD 1SQMA 2A77H 1NGZB 4W9FC 2KPWA 4GI6A 4R6UA 3SDAB 1DEDA 3ZE1B 1MEXL 1E5UI 2FYYA 3O0LA 4EDXB 4W9EC 5I18H 1HHHA 3KYOB 3UCRA 2VN3A 3CHSA 4LF3A 1UM5L 4ZMYA 1QI4A 2VXVL 4FA6A 1OARH 2CM6A 4GMSL 2XZQL 4HZLA 5D2NB 5KVEL 4XAKD 3QIBB 4TLKA 1UQSB 1WA2X 5FKAA 2OL3B 4KRPB 2XC8A 2FX9H 3QNXB 4O9HH 2OAAA 5IOPB 1PKOA 1GCYA 1Y1DA 5EUKA 3KDMB 3PS6A 2APFA 4M43H 1KYDA 5E2TH 3QEHB 1OQOA 3L08A 3BKCL 3JZ7A 4PLNC 4QRSB 5DD3H 2ZONA 1ULVA 4XH2B 3II3A 1DBJL 1MFDH 1NBCA 4PRAB 1JZ7A 4MQTB 3ZE2E 5EEYA 2AFNA 2NY3C 1DJGA 5FGCB 1AFVH 3QJXA 4A38A 5G2NA 1Z5LA 3S98A 1MHEA 3BPNB 3MLSL 1I7UA 5EIVA 1ZLUH 3T8MA 4K7FA 4R5VA 2AAAA 4K3DL 3V7AG 4K3EL 2CDEA 2V7HA 4HIIB 2EO1A 1MHCB 4Z7QE 3CFCL 4YBLC 1OPOA 2A9AA 4XTRD 4MJIE 2BZDA 5EZOL 3GSNA 1EHAA 1RSYA 1T1XB 3M88A 3EXLA 3H54A 1E4XH 1QO3B 2BC4A 1PPIA 4IK7A 2G9HA 3PG2A 1Q0EA 2JB6B 2R69H 3VFSA 4Z9KB 3HB3C 4H5SA 4OVVA 4GKNB 2ISDA 3KYMB 5T1LD 2YEZB 4MZ2A 3L3OC 1U8IA 1KWKA 5IMLA 1AJ7L 1D5BA 1QSVA 4U1LB 2E4FA 5I0WA 1BF8A 3RVTC 3MXVH 2ZNXA 1JGEB 4JO5A 2APTA 1FIEA 4FXKA 2ZOKA 3QR2A 2JKSA 4QF1B 5FYKH 1YEHL 4OM1L 1JPFA 1D7FA 4WV1C 1CYXA 1JK8A 2CKBH 2OI9C 3Q6FA 3DX7A 2ZZUT 4JFDA 4UNUA 4DPCX 4P04A 4UYPA 4Q0XL 3UGEA 4D0DB 2C3GA 3FCGA 1E4HA 4DP9X 3ZDYE 2FWSA 4S0SD 1KFAL 4Q2ZA 3VX1A 3FTXA 3P2BA 2XVGA 1T4KB 2Y2YA 2OCCB 2DKSA 3OLEA 4ENEC 4FQLL 1KB5L 3KPPA 2EEAA 4ZSOA 2X9XA 3MHZA 4ZNCD 1HQ4B 4H8WL 3WTTA 1ERNA 4HJUA 2J73A 1MRDH 5EBMB 2ICWJ 3ZZ1A 2GFBA 1BV8A 3QUXA 3G5YB 1ACCA 4G9FB 3TIEB 3NGBB 3QB7C 1BXVA 4NKQB 3QDMB 1ETZB 2EYTA 4BCZA 1XCTA 2ZXEB 3AJ7A 1NGXB 1U95A 4OIAA 4OCXL 5IIEB 2W59A 2DLTA 3S36X 3DO3A 2IFFL 4MMXA 5IMKB 2D7MA 12E8L 1WUNT 2ZP8A 1YUKB 4MMZA 3VXNB 1X6LA 1I9IH 2A6DA 3CX2A 3DJZA 3LQZB 5IHUL 2VN4A 3TC9A 1KDJA 3S35L 4ZPTB 1KEML 4TLSA 3T6QC 5LB1A 4ZO6A 3MJ7B 2XLLA 2VW6A 2EDRA 5H4YA 1QWHA 4P2CG 3TBSB 4ADIA 4YHNB 4TL4A 2ZX8A 1PY0A 4ZTOH 3L5HA 4Z0XB 2FX8H 1K2DA 4EN3D 3EOAA 4WWNA 3T0EA 4PQXA 1QI5A 1NFDE 1C5CH 1U3HB 2JIXB 1A4JB 2D03H 2XA8L 3EGXA 5LG1A 5EIIB 2GTWB 3BDXA 4G3YL 4KQ4L 5LBGA 2R27A 3BPCB 1RVFL 1CICA 2FHFA 5F0PB 1DVSA 4DFIA 1KBGH 4I9XA 2XYBA 4X6CA 2BNRB 4K5MA 1XFPA 4URKA 1WBYA 2LU7A 3BUIA 2PYFA 3FB7B 4ONGL 4RAVB 1Z0MA 2G3ZA 5FUOL 3HS9A 1XGRA 3MX0B 4DGWC 4D9LH 4MJID 4K9EC 1CL7I 3GIZL 1SOKA 2YUVA 1JMZA 3BWUC 3SDCD 5I1LB 1Y6KR 3GHBL 4JZNB 4AC4A 4XVJL 5I2IA 3CPLA 3ARXA 3ROOA 2FB4H 4NO5A 3ULUL 4M3HA 3GMQA 3RPKA 5F7HA 1BEYH 2G2RB 4M7JL 5BRZA 4D3CL 4ZW7A 1DDHB 5K93A 4R96A 4X4KA 2Q0ZX 1HOCB 4I0PB 4XOCA 5HI3D 3VMOA 1F6AB 1EAPB 5AOJA 1H5BB 4JRXB 2BJMH 3TIDB 2VMDA 3DMMD 3HAEG 1N4XL 3QEQA 1QBAA 1G7MA 3MOAL 4HJJH 4OV6F 5HGDA 3DO7B 2B7DT 3GYRA 3D2UB 4CGUB 4P4KA 4POUB 5FHBL 5KJRL 1SXBA 3QJUB 2IQ9H 3V2AR 5HSFA 2UYLA 5E1AA 4P5MA 3GXDA 5IQNA 3PWLB 3O3DA 3BH4A 1UCBL 5JHLA 3MCLH 4JLRB 4HKXB 2YXWA 5GRJL 4UUJB 3UPAA 1TTGA 3KJ4B 1U8HA 3OLDA 4XPAH 4JHAL 4LU5H 8PAZA 5JUEL 2R1YB 2DQ6A 4BGLA 5BS0B 4DOHE 4YH6A 1G0DA 3II2A 1KULA 3I9PA 4H20L 3K2IA 1M7DA 4HKJB 3HPJB 5I26A 3F6JA 4J1UB 4DVBB 2X70A 2JH2A 4A39A 5GGSB 4JY6A 4L5FL 4S0HA 4JX0A 5AW6B 3CXHJ 3TONA 1E4JA 4ZMOA 2HKFL 3FNKA 1KPUA 1QSFE 3APMA 4RMSA 3OTTA 2FT8A 2CK0H 4RMTA 3RE0A 3DBXA 4D2NA 3W39A 4QHKI 4X7CC 4EF3A 4UINL 2XWZA 5CF3A 1E6JH 4OFYD 5AAWA 1UD6A 3LYRA 4FZ8L 2HVBA 2A74A 3TT1L 3MV8A 4MAZA 3RFZC 3EO0A 4IRZH 2VM4A 5JPMA 4LP5A 1RZGB 3PQYE 4H25B 1KLGB 2D0HA 2DV6A 4BSVB 1PG7H 3I75A 4UU9A 4XE5B 1BIIB 2ZX9A 3IXTA 1XGQB 4JFQA 4N86A 2ZWYA 3B34A 4IIQC 2BWIA 3HC4L 3ELQA 4Z6AT 1NCWL 3R1GL 4P23C 3BVWA 3MGTB 4E0RB 2FBRA 4MCNA 3VXOB 2BHFA 2CGRH 3L3IA 5DJZA 3LS4H 5ITBL 2MWCA 1TJIH 3WKPA 4CN1A 1KB9K 2HJKA 4J3TA 4GXUN 2R29H 1DSYA 5F7DA 3EJYD 1WT5C 4HS6B 4MRBA 1S7UA 1KTRL 2IDCA 4PJIE 2J1WA 3GSWB 1DFBH 1U8JB 3L3KB 5FYLH 3VJ6A 5GJTL 3L2LA 4Q9RH 3GJEB 2EH8L 4YDKH 4JR9H 5AVVB 3UYOD 3M17A 4GPVA 1R3HA 5AW2B 3RGHA 2PTUA 4PRIE 3VRIA 2I5YL 4GXVH 5JTWA 1YMME 5KYUA 3GLZA 4MDJA 1EEZB 3SBRA 5GGQH 1M1XA 1RIUH 4XBPB 1Q1JL 1IM3A 3KVQA 4URTB 2H32A 2K8QA 3ARZA 3O9WC 1TQBB 4OJFH 1MFCL 3PWPD 3H56A 2YWZA 5E4AA 1U8OB 4JFOA 1V3JA 3VTTA 4MVBD 4NZUH 3W0WB 1A6AA 2ICWB 4KTDH 5KW9L 3MFFA 4WFFD 2OP4H 2ZWZA 3MNZA 4KK9D 4YIQA 1EDYA 3O6FA 4V2BA 3MBEC 3ZGHA 2YD8A 5I1CH 4QGTA 4LP4A 2QKIA 3VXUB 2X4QB 2Y36H 1INQB 4E41A 4FLOA 4Z7VA 2AEPH 2RALA 4MQSB 3PP3K 4HLEA 3WELA 4KMQA 1AGEA 3VYOA 3WSQH 1E5CA 1EMTH 4ZUWB 5G4NA 2E8ZA 3MKKA 1O7SA 3FT4B 2AERT 1F90L 1Q94B 3NH7H 4OQTA 4AVHA 4LMQE 4F7PA 1INEL 1HVXA 5JR1H 1KT2A 4KY1H 3DX8B 4F37F 5FA4B 2D0FA 3Q1SH 2BNQB 5FKPA 3DV6B 2FECL 5DWUL 2ED9A 3A4EA 1A6WH 3P3SA 4PGBA 5LAPA 1J0IA 4U1GB 2B9AA 5DO2D 1QSFD 1L9RA 9CGTA 2B1OA 4N85A 3Q2CA 2XY2A 3NYKA 5EDXA 2J8UA 5CUSH 5I6LA 3H3PH 1BVLA 3IDMB 4O2EA 3EAKA 3REWA 1JNLL 3VD2A 3H9SB 2VWEE 2AKRA 2F2HA 3AWFA 4XX1G 5A2FA 3WEOA 2YARA 3RTQB 4BFKA 1WJ3A 4PFEA 1JFQH 1YZZA 4NYLB 2N1TE 3PQYD 3K6DA 1E6OH 3QJZA 6PAZA 3CZFA 1UJ3B 3D06A 4KHTH 5DFTA 2QDWA 3CFTA 1G0XA 4S1RL 2X3BA 1OCRB 2C1OB 3BZ4B 1MHHB 3HZKA 2W65B 3UO1L 1T7WA 2WZ6A 4BWUA 3LKNB 3IDGA 1I75A 2BIPA 3QRLA 1L7TL 5IJKA 3UTPE 3PXLA 2ADYA 3LMJH 2BCKB 1R34A 2QQKH 3B7YA 2QVFB 4Q6YA 1WZAA 1NLBH 4QHMA 4L05A 3U0TB 4EZKA 3HE6D 2DMHA 3BSGA 3FBKA 4X4YB 2JJSC 1XTLA 4AXWB 3GK8H 3E6HA 3NRFA 1WBXB 3STBA 5EOTA 3BLKA 4YFLF 1OE1A 1VESA 4X7SH 4TVPH 2ZYRA 3SCMB 3WS6A 2R83A 3HZMB 3KW7A 2Q87A 5LHDA 1K4CA 3F58L 2YFNA 3GMLB 2R2BA 3VFNB 2ORBL 4HG4J 2QTEA 2XZAH 1AIFB 3VE0A 1IBFA 1H3PH 1KWGA 4P46A 5B1AB 2FBOJ 3O8XD 3EYUL 4IBLT 4PRID 3ZHKA 1YMMD 1DQDL 2CO3A 3N0PB 1YN6B 1GXEA 1NCJA 3B9AA 1BYPA 4K23L 1NBVL 2YAQA 3FO1B 2BSCA 2P5EA 2OSXA 2Z0UA 5H35B 1NMBH 3VG9B 4G11A 1Y0LB 2CDFB 2WV3A 2Z64C 3SO5A 5T5FA 1WS8A 2CJSA 4AT6A 1DJXA 2QKSA 2H0PA 4JPKH 4LCWA 3KPNB 2FL5A 1M7IA 3WFEL 4LKXB 3CH1B 1UASA 2YD5A 2X4SB 2WVVA 1BAFL 2XZCH 1A3RH 4MXWH 5F7AA 5GRVL 1KLUA 4JAMA 4XPTH 3VXQA 4X83A 3UP1A 1NM9A 2RA1A 4RZKA 1KNOB 3V0VA 4AQ8C 3QNFA 4QD2E 1P6WA 4EZJA 2EH7L 2KBGA 1F58L 2C1PA 3BE1L 2DAVA 1ETA1 2VDRH 2CBOA 3NIFF 5E0FA 3II1A 3SYCA 4D0CA 4RCAA 5KSAB 1IT9H 2J2ZA 2YMTA 3HMWL 3TT3L 4YFLI 1G7IA 4OF5A 2FLBT 4GSQA 4Y19B 1UM6H 4G70B 5GS0H 3A4AA 3UYPA 4HIEB 1CUOA 4IOFC 1I31A 2WBXA 4BCYA 2IH1A 1PBYA 2BH0A 2H0FA 3AT0A 3KPQA 3M1OA 3RVWC 3B3BA 5AVZB 4XT1C 2BM3A 5DJYA 1JG9A 4ZPVA 1QSZA 1C12A 2P24B 3NFNB 4JG1H 5SV4A 1IGIH 3WNMA 4YHYC 3T2PA 1I9JL 3M1CA 3EDFA 2OKMA 3QZBA 4MD0A 3F6IA 4C58B 4NIYE 1CWVA 3QS2A 1MCQA 4EBQL 2XN0A 4F7PB 4YDVA 4JQVC 1OTTC 4JFYB 4NQTA 1JWSB 4KJQC 5AW4B 3W11C 4YXHL 1U3ZA 2UY6B 3UTPD 2PO6B 2HTLC 1NWOA 2WWMC 2COVD 3B7RL 4XWGL 2NTFB 1FNLA 1KJ2A 3QJHA 1AGFA 1YVLA 2ICWI 1SOQA 2XICA 2XTJC 1II4E 1UKTA 1VRSA 1PY4A 1ZCRA 4KKRA 1HU8A 2J6EA 4L4JA 1I1AC 2F18A 1V3LA 4Q6IA 1JNNH 1YUHA 1SDDB 4NNPH 1Y07A 3WLWD 4ACTA 3BOVA 3L81A 3BEVB 5CINH 4PJFA 4PYHA 3LXCA 3MLVH 1I8LC 1NJ9A 2BO0A 3IAPA 4MZ3A 5LDUA 2A6KB 4HOZA 1CT8A 3ARGA 3GXUB 4NQDD 1AXSB 2EVGA 4X0NA 1I1YB 4DVRL 1JRHL 3U1PA 2Z35B 3POHA 4NC0B 2BHZA 1A4CA 1DUZA 2APWA 5MENB 2CIKB 4GKZB 4H1LA 1NIAA 3ZTNL 1CFQB 4LLVA 4K8RH 2QGEA 3VGDA 3QIUA 3E3QC 1B3JA 2VLKE 4OM0L 1B4TA 4LPWA 1MSPA 2MQCA 1ETB1 1YY9D 5GIRA 3OKLA 4Z0BL 5ITFB 3WO3B 1AD9B 5BQ7A 3VDBA 2EDKA 5KEZA 2CO7A 3INOA 1DJYA 2A9MH 2QSVA 5F3FA 3QCUH 2F68X 3TPUA 4WDIB 3EJJX 4WTZG 1EVUA 2VTFA 5F7MC 3S96A 4ZMLA 2WLIB 5JLZB 4JFPB 1SGKA 3HNSH 5DD6A 3HCVB 4AJWA 3V4VL 3OVUB 3QT2A 5L6YL 4KKAD 1XCQA 2ITEA 2F7RA 3A24A 3K6IA 4Y16B 3GBML 4Y9GA 3HE7A 5K1JA 1TETL 5I1JH 1AKJA 1NEZG 4MJ5A 3PL6A 3ESUF 4R0LA 5F1NB 5JW3L 1MW3A 2ZKHL 5CJBA 4P2RA 1ZT4B 5KVGL 4LSPL 2HVJA 1A3QA 3UZVA 1I1FB 4XE0A 4HXAL 4QY8A 3QI9A 3NZSA 2B20A 4MLIA 1T21A 1RHFA 4RRPA 4YC2C 1RJLB 4PVMA 4QOKA 4LDOB 4H40A 5AD0B 3IKCA 4Y2NA 3U4KA 5EF2A 1DQML 1DTUA 5EOCH 2BP0B 1LO2H 3LRMA 3BYYA 2XVBA 1LO5A 1BQHB 4Y4HB 5DZJA 3BRGC 2ZCHL 1AOHA 4JKWA 3MCG1 1AYRA 2PXYA 1KCSH 1G94A 1K8IA 2N0MA 1RUQL 1NKRA 4R2GB 3L3JB 4G5ZH 4LSVL 4ZFFB 2F54B 5A2IH 3ILPA 4BFJA 2CA4A 2R1XA 4FNLL 2PTVA 2GJ6A 2XWBB 1R75A 2X6AA 3ZKMD 1B0WA 4JPWL 1LM8V 2Y07H 4PJ6A 3VI4E 3F04A 5CZRA 3BJ91 2QVTA 3DTDA 4WTZA 1Q9LB 2AABL 4UZGA 3SD2A 4XTRC 1UWGL 4EDWH 5CZKA 1LE9B 5AB9A 5F88B 1RU9H 3ILDA 3SPJA 1CFBA 4HU2A 3R06A 2DQGL 5LBSA 2HN7B 4P2QB 2IWGA 1U8QB 4HCRA 4XC3L 5E4EB 5ES4B 1CGYA 5E8DL 2APVA 2P1YA 5IESL 1P9MC 3WY3A 5E7FA 5C9KA 2DYPD 1HDMA 3VW3H 4M7LL 4AMKH 3UAEA 1Q0YH 4BFIB 4BQCA 4YX2H 4G83A 2X5PA 3T4AA 5D7LE 3VFGH 7FABL 4ZO7A 3P4MB 4PV9A 1DVTA 1T5WA 5DMKA 3MRMA 4OLXL 1E27B 4M6OH 4XO5A 1CMOA 3L45A 2YFOA 3F7YA 4XAWL 2ADIA 5D4HA 4Z3HA 1AZBA 4ZODA 1U92B 1ILSA 4ZAKD 3I6KB 1QUNB 3VXPB 2ZWLT 3IETB 3HRZA 2HLFD 3BZEA 1JZ6A 3RX8A 3N40F 4M02A 1MW2A 1A2YA 1D5MA 2BSDA 3AREA 1DVYA 4U2YA 4Y2DC 1BZEA 1SLWA 3V0FA 2XWJA 5HYJE 1UD3A 3VRJA 1NGQL 1R3IH 3RWFA 4AK2A 5ICYB 2ZPKL 5CGYC 3O41A 3QO0A 3IDXH 4JFFA 3ME0A 1VGEH 2ZXBA 1NOFA 4HPYL 5AKSA 1SOXA 4PAZA 1E9QA 1KTBA 4QXWA 5MEPA 1LK3H 3I84A 2W38A 3O6ML 4J12A 3NZHH 3WEMA 5BVPH 1GIGL 1U8HB 3DV4B 4LLQB 4YOKA 3NCYS 4XP5L 2YAHA 1FJ1A 3FOLA 3AWGA 2ICEB 2ZYSA 4WNJA 2E47A 3L3HB 3JT2A 4YVNA 1T0OA 1T1WA 1CTOA 3DTUB 3UIYA 5A2CA 4TQIA 3GRBA 1N6VA 3QPKA 3DPBB 1PYWB 3QDJE 1M71B 1WFMA 1I3VA 4JG0L 4YGVB 3SE6A 3V7MA 1IUZA 5DLLA 4WW1A 3KPSD 1E4KA 1A1MB 4Z7WE 1P7QB 4EIZC 4YDIH 1TZAA 1JAEA 1Y18A 2Q5BA 3QFJE 4PRHE 5ADOL 5IHZB 1AR1D 4BZ2H 3GMPA 4M00A 3KLAA 3I3DA 5KAQG 3M1BA 5E8NA 4L8BB 4JVPA 3CX5K 5CWSB 1KGIA 3V79C 4M4RB 3QHZH 4J3OD 1GY2A 4JY5L 4IJ3B 4LCVA 5DQ9A 3QRGL 3EYOB 5KVDL 1G6RB 4XOAA 1MVYA 4OD1L 1ZLEA 4UV4L 5D2LB 5LXVA 1IGYB 4DPRA 1S3RA 2X9YA 4Z78B 1P7KA 1SQ2N 3GMMA 1FDLL 4HWBL 3PWNA 4Y5YC 4N0CD 1VCBC 3RDTB 4PJCB 1D6VH 5CMAB 3KXFB 5A6MA 5LQBH 1N0XH 1Y6MR 3BAJA 3GEWB 4AQAB 3WTWA 1E7VA 1E5BA 1V3KA 1B4JH 5ANME 3SB3A 1RUML 3FQXB 3T2NL 1BJ1H 3OGCB 3WN5C 3AT8A 1R5WA 4OUUA 2ITDB 4QNPF 5HI3C 3MQIA 3RNQA 3IFLH 5D7LD 5FFOA 3UPRB 5EORH 4R3SB 1BD2A 2FH6A 5FS5A 4DJMA 4WI3A 4ZQKB 3VJ6B 3T8VA 2B8OT 3O0RH 3LDBC 3AXIA 2RIKA 3BGMA 2Z7UA 3UTQA 2KHAA 2DEYX 4TULH 5DD1H 1MJ8H 3WIHH 4C57C 2WGXA 3CC5B 2WXJA 3C6LD 5FCUL 3ZE0E 1FORL 1HSBB 1S7TB 1YAIA 1ZGLM 1FZMB 2IBGA 5FLUA 5KSUA 3B56A 1GGUA 1KYAA 4E36A 4ZYKB 5HYJD 4K9EL 4U7SA 2H8PB 2FGZA 3X13A 4ALAH 4JRYB 1PIGA 3BZDA 1MPAL 1LD9A 2ZWSA 5CS7A 1L5GA 3OLIA 2PTTA 3K0YA 4ZD3H 4OCLC 3H85A 1OL0A 3TBWB 3VNYA 1HEZA 2BOCA 3PP3H 1CF1A 1WV7T 1X5MA 2XN9B 4JHWL 4G8IA 3REVA 1GZPA 2W0KA 4MCZA 4RQQB 4PVNA 3OKYA 4NI6A 3D25A 2OJEA 3L1OH 2VAAA 4U1HB 3FCBA 5DZOA 5JMRA 2K9FB 3SY0B 5J1SC 1IGTB 4LL9A 4OD3H 4Z95L 5B1JC 3W38A 4Y4FD 4QJ5B 4GQPH 4RAUA 2CIIA 2RTTA 3Q9QA 4QYOA 2ZOLB 2Q7YB 2NY4C 2B1HL 3ZDZE 3QDJD 2GJZA 4NZ8A 5GS1A 1P4UA 4NQED 4Y1AA 4N3UA 1AHWC 1CG9B 1S9VA 4JJ5B 3ZMNA 3BKJH 3SQOL 2VLJA 1J05B 5HDBB 4C55A 3LRSA 1OCWH 2YSTA 5CD3A 5IJVA 3OKDB 5TPWH 5T8IA 5JDSB 1IKNC 2YD9A 4FFVD 4QRQB 3QFJD 4PRHD 1J8HA 4ZUSB 3QQ3B 2MCMA 3SKOB 4WWKA 1JGIA 4MDIA 1J1PL 2AI0H 2AQSA 3B2DC 1TVBB 5EEUA 1CLYH 2B5IB 4KTGA 2H2PC 3I85A 3Q8AA 4GRWB 4KXCA 3QXVA 1DVZA 4QWWC 1J5OH 5FK9A 1C08B 1FZJB 5EZJB 1N7ML 1OAUH 2ADGA 4AQEA 4F2ME 3DXAD 3VGFA 1ZGLB 5GS3A 2CSPA 1S9YA 4ES8A 4M6AA 3H2WA 1EZUA 4M6NL 5LGHH 4S2SB 5ETUA 3GBNH 3I3EA 4XZUA 3EOBA 1JZDC 4GP4B 1A7RH 1U36A 4J8RB 3U6XA 4AVJA 1RLWA 2UWEA 3EYFA 1HH9B 5IJDC 4QHMB 1KB5B 3L4YA 1J9SA 5D2LF 1JHTB 1YEDA 3GIVB 2WMPA 1A6TB 1F97A 3AM8A 2GYSA 3VQ2C 4D94A 3QC6X 3DUUB 5AW3B 2GBUA 3TJEL 4MB1A 2COQA 1CGSL 2DTMH 1QAWA 2H5UA 5HHQB 4GJTB 3SE9H 2WNKA 1WBZB 3EH4B 3FFDB 4OZ4B 4BQ6A 1X5LA 2VLRE 3ZHLA 2BFGA 5JNYB 4HC1A 3OKNB 5C07E 1AO7B 2EIZB 4Z7OB 3N06B 2LQRA 3C60D 1IAIM 5BVJA 4PLJD 5EU4A 2HFGL 2BW5A 3LN5A 1A3LL 3QWRA 3FTGB 4BCXA 5TDPB 2V37A 4K3JL 3PHOB 2FRGP 3ULVE 1RCYA 4RFNC 2X6MA 2FQDA 4ODVL 5I5IA 3JV4B 2FE0A 3FUFA 4P2YA 2YS4A 4XMZA 5L8JB 1FYTA 1UGNA 4LGPB 4Y9CA 5D72H 1A7PH 2CGYA 4H4NA 4N2IA 3CFDB 5MHSE 4KTYA 4F15C 4ZXBA 5I1KH 4XOBA 4Z7NE 3LXAA 1JGDB 4EXKA 3LKOA 5E6ZA 3OJDB 5TK4A 3ECBB 4XPHL 1RFDH 3RU8H 5BW7A 5CBEB 2O6FA 5TE7H 2BNUA 4UTBL 4NQVB 2OMXB 2EYRA 2HFEA 5DO2C 4MAYA 1UOVA 3HHMA 4FQJL 2DIBA 3H42L 3VM5A 5LCVL 2EAEA 3DROA 5CEZL 1PX8A 2BSSA 2V17L 3RZWA 4ICWA 5DYOA 1WF5A 4AYFB 5DEFA 4XCEA 3I50L 5HPMA 1U3YA 5C08B 4DEPC 2OYMA 3P77B 3CZUB 1BM3H 4DQOH 1LDPH 3T4YA 2JSFA 3UYPB 1NM4A 4PJ5A 4X5XA 5I74C 3TEUA 3MNWA 5K1NA 1W6LA 3QSKB 5IB1B 5D93B 1CLZL 4EQ3A 1YPZB 3QA3B 3FZUD 1SJVA 5HDBF 4RA0C 3LB6C 4N0FA 4FZEL 4G6KH 2X4PA 4P59L 5GZOA 4GW1B 4OKDA 1MIEH 2I26N 4Y4KD 5AL8A 4PY8J 4H26B 3K3QA 3M8OL 4YO0B 3QJFA 4YDVB 2Y69B 5JIPA 4Q8BA 3SE8L 3IRPX 2AJSL 3OQ3B 2IFGA 2XWTB 2ZUWA 4GRWF 1HHGA 5JHDA 3FU9A 3GS0A 1WFIA 4NSKB 1URIA 1Q0XH 4D9QE 3PV6A 4RFOL 3D4CA 1SMOA 5D6CA 4MNQD 1M9SA 2OQJB 4K8RC 4FL4C 1A8JH 3F5WA 3UAAA 2W0FA 1W8NA 2BOBB 2V5SA 5GGSY 3E2HB 3NIDE 5LGYA 3NACH 1NC2B 1IQWH 2K7PA 4OGYH 1TQCC 4ZJ9A 4XP1H 1ZVYA 3BAEH 1W91A 1ORSA 1UHVA 2OSLA 43C9B 3UADA 3VGHA 2BOLA 2YPLB 4RRPM 5ISZD 1SPDA 1ZD6A 2ZAGA 3CLWA 2VLRD 3A23A 3MJ8A 5I1JL 1B90A 4HEPG 4K7PL 1G7QA 5H37H 5KBNC 1QSEA 3OJMB 4PJBE 5C07D 2Y7SA 4CVWA 3QR1A 3SKNA 2J1ZA 3KGUA 2Q3ZA 1U42A 2YN3A 1CYGA 3WNOA 4E9RA 2NY1B 2OXHB 2GTZA 2A83B 3LKRA 3U0WH 2R1WA 4Y9BA 4CNIB 4Y5XB 4IOSD 3E7JA 3QC5X 3QXAB 4HBCL 2AHIA 3MA9H 3L7FA 1K6QL 4MCYB 4Z7OF 3KWVA 4G8EA 2V5YA 4ZO9A 1UB6B 3HR6A 2LLNA 3I02A 1DQIA 2DQTL 5IBTH 1U8KB 1E2WA 1DQQA 2RQ8A 2VB5A 2ATPB 5MHSD 1NL0H 4PI2A 1A5FH 3BVNB 3CZGA 4OLEA 4ELMB 4OUOA 5E6YA 1MFNA 3E38A 3BDYH 3HNTL 5HHPB 5L2KE 3ZVVA 3CXHK 4UT9A 2XIBA 4PB0H 3JT0A 5IFAH 4UT7H 1TR7A 3H4FA 3UBXB 4MNGB 2EUZA 1LNUA 1RJYB 4BZ1L 3L54A 2HX8A 5TDNB 1V5JA 1R6VA 2QPSA 2A99A 2LOEA 5IEKA 4AKOA 4CSPA 5EU5B 1CE6B 2AP2A 3BX7C 5AWNL 2BVTA 5HD8D 1Z9OA 1JZ3A 3BUPA 3C08H 3IMUA 2VWEC 3HE7B 4LLUA 2YAFA 2NPLX 2P46B 5E6IC 1G7HB 5HYQA 4ANXA 3QO1A 2A77L 4DEWA 4WGKA 4F9LC 1YLBB 2C34A 1INDH 3UP6A 4N2GA 4IKKA 3RJQB 1I8KA 4MJ2A 2UV3A 3PIQB 3GXNA 5HYSG 1CVRA 5K9JH 1R5VA 4TSCL 4NUJB 5MEOA 3DVIA 1ZIAA 2A6IB 3A6OA 1JPGB 2H47C 1UA3A 3K71A 3OGOE 3ULUF 3HI1B 2WTRB 2FJFA 5C6WH 1KYUA 3ARDD 1F56A 2EEXA 3FAXA 4X4ME 4F7EA 1MUJA 2FX9L 4O9HL 2IANE 5DQDH 5IKCA 4GIPD 5T1KB 3VMNA 2UZXA 1EZVY 1YPZF 3P4NA 3HUJE 3MYJB 2WXMA 5E2TL 2R9HD 3ATDA 2UX7A 1HWWA 2VC2L 3ILPB 2EE0A 4JN2A 1MFDL 4D9QD 3ARFC 2D9QB 2GJ6B 1YNLH 1R5IB 5FYKD 4WNSA 2C8NA 1SM3H 1R9FA 4W6XB 3TN0B 4X7DC 2QELA 2LVEA 2LFGA 1PLBA 4ODBD 1UD5A 1ZK9A 4W68A 3TCXA 4P9HC 1J86A 4AQ1A 2AK4B 4I2XE 4MJ4A 3ZZQA 1KB3A 4XHJC 5DGRA 5FO8B 4WI4A 1TVHB 3GMRB 1G9EA 1A7BA 1YAZA 3QQ9C 1MVUA 3KYKH 3RZCB 1NGPH 3CLFH 2JKXA 2I07A 3FRUA 1I3UA 4NM8H 3C5SB 4JFHD 3NSDA 4X99A 3GO1H 5GSVB 4KKQA 2YGQA 2QJDA 4UV7H 4IRJA 3SDXB 3RPBA 4JDVA 3RB5A 1YY9C 1WZMA 5B8CB 5DZAA 5JPNB 1OT1A 3KWTA 4RGOH 2Q8BH 2WBWB 1BOGA 3U4BH 2WWKT 4M62H 3K6FA 1E5AA 5IW1A 4O58H 1T04B 5HYSA 1LP9A 1W9XA 3KD4A 1FHNA 1ONQB 2BZCA 2V2TB 2PW2A 3CWGA 5H2BB 3PU7A 3NAAH 1QKZH 1G4RA 3STLA 4HJGA 4MD4B 5FYJH 4HJSA 2Z31A 3MLWL 2ADFH 4XN1A 1XB8A 3QJQB 3TA3D 2W81C 2WXNA 1JYNA 4LLMB 5HGGS 3QUYC 1MF2H 3DVNB 4KKAC 1JNJA 1S8DB 4IEFB 1KEGH 1HXYB 3NJHA 1PZSA 3ULVH 4U49A 1M05B 4YDJA 3L9RB 4PJGA 3QG7H 2HT4D 1XGTB 3P9LA 2J8HA 2CKBL 2K3HA 3NESA 3QE5A 5AYTA 8FABA 5JOFB 2XWJB 1CE1L 5I1GL 3C09B 4KK5C 4L29B 2EUWA 3S88H 3E6FB 1CO1A 1BZQK 2D2OA 1F3JB 3VWJA 5ESQB 5HHNA 3B83A 4UT6L 2WCPA 3MU3A 2NY0C 4NZFA 3VWKA 2AJZA 3MTRA 2ZWNA 4HOMA 5DD5H 1DZ0A 2BPBA 1NIBA 3HBQA 5C0EB 4PREA 3D18A 1SVZA 3IJHA 3B2MA 5CSZB 1CXKA 2FUTA 3D3VE 5I66B 3RNKA 3IF1A 2JWYA 5IHWA 4GYBA 1VADB 4I89A 3JQOB 3AG4B 4M29A 3I6GB 1DLFH 4PY7A 4YSOA 4ANUA 5I17A 4BK5C 4XNUH 1ZA3B 1F8TL 4WU7B 5BO1H 2BCMA 3VXRA 4RSYA 3UEQA 4P23A 1I9RH 3KEDA 2MCAA 4P3WA 4UB0H 1CFTB 3OWRA 3PXHA 1A9BB 1BMWA 2P8MB 3V6BR 3O4OB 4A7SA 1MREH 4LCYB 2LAAA 5AALA 4LLWB 4ETQB 3GLDA 2YO3A 4JHZA 3VGAC 1BQHG 3CN2A 1VFAA 3QNYB 4KGLA 2J56A 2P42B 2X1OA 5DC4B 4L9LB 4PGDA 4GOSA 4HG4K 4ZTOL 1GW0A 4IU2A 5IROD 4WLCA 2CUMA 5CGTA 3ZTEA 1HAWA 3DUHA 2DMKA 3V5DB 3BP7A 2JLLA 1NC4A 2VN7A 4I5BB 3V6ZB 2YUZA 1WPCA 3L5JA 4OAWB 4ZW8A 3STZA 3UROR 2WQWA 3U1SH 4XVUC 3UERA 5IY5B 1WHPA 4E9XA 3GRWH 3O2DA 3N50A 2IQAB 2BS71 3UGUA 4LCUA 1HYSC 3CDGB 3KS0J 3JWDC 3NCEB 3GUTA 4DP0X 3WAJA 2B14A 7PCYA 1X4XA 3P0YL 4LOFA 4Z7UA 4XO9A 4D9LL 4JM4H 4Y88A 4ZAKC 2VT0A 4IOIB 1TZIB 1U2CA 1QPPA 2F5BH 3RVXD 1JXJA 1XIWD 1R47A 2JTDA 3LEYH 4AL8H 1B0GB 2FB4L 2NNFA 5D1XA 4OV5B 1BVNT 3KLHD 1M6OB 4NN7C 2A7BA 5EZLA 3P3UA 5CILH 2OMBA 4Q4EA 4AH2B 1PD6A 1SJEA 3CXFA 1CK0L 4UM8B 3SDXF 3VXTB 4K3GA 4RA3A 4JQIA 4Y2OA 5DJ2A 5KN5A 4KJPC 1RK1A 2L7QA 3GBEA 2BJML 2L7UA 1Z9MA 4EZMA 2WINB 3QDGB 5IGXL 3ILQD 4HJJL 3RGVB 2F53A 3SHSA 3UTZB 5HHMB 1CIUA 5A2BA 2G2NA 4JZOA 1BHGA 1ZMYA 3GTTA 3CNKA 4GRLA 3OAYK 1FL3A 1T5XA 2OJZL 5DS8B 2ZAIA 3P3TA 1AG6A 3OD3A 4LNRA 3DX4A 1X5FA 1KIRA 2QR0B 4NLHA 4NKIH 4XCYB 4XPAL 4RGMB 1HQRB 4G5AA 4NJAL 1MCDA 4LU5L 1XL6A 2PCPB 5CKGA 3K6OA 5ICXB 5BZWA 5G5DB 3D3VD 3IFPB 3N85H 3WE6B 2HJLB 4AZ8A 1R3KA 1CDBA 4N2OA 5D7SH 2WBJA 1P5VB 2GJRA 2X88A 3D34A 3DIFA 4FJZA 2IGLA 5B3JF 4OZIB 1ZDSA 3D39B 2WQAA 3CDYA 2XWEA 2WXOA 3RKDC 4IMLB 1M2OA 4WUUA 4FA7B 4PJ8B 4L2LA 5FYLD 3N2JA 3O11A 1MG2C 3LKQA 2CM5A 3IGFA 1T1YB 2FECI 5JW5B 3ZHDA 2OMZA 1E6JL 3MRFB 3UJJH 2JJSA 1I3GL 1PLCA 2J12B 5LJYH 4J4PD 4NQCB 3U7WH 2VZOA 3H0TA 4IRZL 3L95A 2BHUA 3ERXA 4MNHA 3X3FH 1W72L 3BIKB 4JFXB 2VABB 4GW4B 3V4PH 3ZTCC 1PG7L 1N0LB 3DSNA 3I6LD 1WG3A 3K5SA 4IGBB 4JFUA 4M03A 2YAOA 1OWRM 4JY4A 1FN4B 3PWJA 4J3XA 1N5AA 2O6DA 1IC7L 1BYOA 2KDGA 4DT2A 2CNZA 1FIGH 4WO4B 4OCSH 5E9NA 1K4DA 2X7LB 3EYSL 2J55A 3V4VB 2FTAA 4WU5A 3V0DA 2CGRL 1NBZB 4OT1H 3LS4L 4ZW5A 4P49A 1TJIL 4L1TA 3OZ9L 1O6VA 4G8FA 2R29L 4JHBA 4QHLB 4U1IB 1LL1A 1JIBA 1Z66A 4WW2A 4HUXB 3MJ9L 1S6NA 5DK0A 1TVDA 4WWOA 1DFBL 1AZNA 5HJ3A 4XVOA 4B60A 3BIBX 3CK0H 1URZA 3BKMH 1EFXD 3C6LC 4ATWA 2CCLA 1R0AL 5A3ID 1VEMA 2W8CA 3RBGA 4Q9RL 1BJ8A 1IEBB 1UZGA 4JR9L 3BMVA 2OMYB 1WD9A 5JORA 1WAAA 2VMEA 5BZZA 4JJOA 1AS7A 2J4WH 4YDLC 2DWTA 4PY8I 5C09B 3GXTA 3T5WA 3QORD 1DSFH 1AP2B 3SE4A 1JI1A 4H44C 3VFUB 1YSOA 1IKFH 1OSYA 3JV6B 5AOKA 2RB8A 4OJFL 1UEMA 1M9WA 4I4WB 3QUGA 4UIMB 1CF8H 1NGYB 4KNTA 4NZUL 4F7TA 2CLZA 4KTDL 4B9ZA 5ICZA 3BDBA 4MMYB 2OP4L 1S78C 3VI3A 4XO8A 5HGHA 1XH1A 5IJBC 4M3KB 5E5UB 5JIKA 3BJLA 2FR4A 3AQZA 3FB5B 5TE6H 1BZDA 2YLKA 3UJTH 5KBLA 4LRIA 2WXHA 3U4EA 3KDPB 2CO6A 4B9YA 1EMTL 1GCFA 4B0MB 4GS7C 2Q6WB 2AQ3A 3GTVA 1CN4A 1ADQH 1JHLL 3I9IA 4X6DB 5I5JA 5F7WC 2FHCA 4Y89A 5DRXB 4ZSOE 5JR1L 3DBSA 1AY1H 3WNJA 2YA2A 3Q1SL 2FEEL 5GS2D 2J21A 4L8SA 4TTDC 5FC9A 2J1KA 1Q90A 2IADA 3EGSB 3HPLA 3OLGA 4P9MH 1A6WL 2ERJC 4Q6KA 3ZQXA 2A6JB 1TJXA 1U4EA 2AQRA 1JV2B 3MV7D 5BZDA 3IGKA 4AQZA 3NIGE 2KMWA 4OZIF 4I13B 2CUHA 4N0UA 1CIDA 5CUSL 3H3PL 3TO4D 4M8QA 3IDJB 2NY3B 1FZKA 2I9TB 5HDWA 3K0WA 5D7JA 4DERA 3UDWC 3LOWA 3VFPA 5DFVC 3UX9B 2VW7A 4IRSD 1KF9B 5AUMA 3S5LB 3NPZB 3ES6A 4JO1H 3TO2B 2ED8A 1E6OL 1NAMA 3MUZ1 2BMKA 3PJSA 4N0FB 1PIFA 1CPUA 4AG4L 1I8LA 4L3CB 3WFCH 4LHJB 1JS4A 4YBLB 2EE9A 5KYNA 4X5WA 3T0EE 4B50A 3RA7H 1Q9KB 1ZVHA 5D8JL 3A21A 4LRNH 2FO1A 2IAMA 2JJWA 2YRBA 1WIPA 1XHHA 3UBFA 1GA2A 4C56E 2Z0BA 4XPBH 1MCWW 1FFQA 3G6JB 4U05A 5E00A 5HHOD 2K7QA 3U0PA 1MY5A 4X6CE 3K6NA 2F15A 3GK8L 3HB3B 5E5LA 3L5WB 4PR5B 4BKLB 2V33A 1H3UA 3NK4A 4X7SL 4TVPL 2H6PA 4P0DA 1DCEA 3L3OB 4PJ7E 4F93B 1T3FB 1SUHA 2N7AA 1IAOA 2CRIA 2Q8AH 2VERN 3FQ2A 3HS0A 1AGCB 1HNFA 2UWEF 2OW6A 1H3PL 5CEXB 4TTGA 5DRWB 4OJCA 1WWWX 4XMLL 2RH0A 1XGPB 4WV1B 4PP2A 4F20A 1HH6B 2OI9B 5BRZE 3TVMC 5GS0D 4FFYH 4XP9H 2V7NB 4NRXA 3CH8A 4ZUVA 1S9XB 4PJEE 3ZKJA 4JZJA 4QRUB 4XGZA 3WFBH 3O4LB 4JEGB 3Q5YA 4YNYB 3RWEB 1JRHI 4G6FD 2OXGB 2YMOA 3QEQE 5ESAA 1TQVA 4JGMA 3LKPB 3ABKB 4F8NA 2ED7A 5ID1A 2NXZC 1N67A 3BQUD 4FFTA 1TTAA 4JPKL 5F9OL 4K94C 1O5DT 1TTCA 5F6HJ 3WY2A 3KMDA 1MAKA 2E9GA 5G55A 4B9PA 5L4JA 2ZX5A 3RWHA 3PE9A 3VXMB 3TZVD 2X2HA 4G42B 1JPSL 2XZCL 3QUMH 4MXWL 3FF7A 4U7MA 4XPTL 2DWEB 5BJTA 3GGWB 1NPNA 3KYNB 2ADJA 1Q38A 1IEAB 4LSRL 1QA9B 3QUZC 2ZKXA 5C2BH 3AS3A 4DO5A 1N68A 4O2CB 2WNWA 3RX7A 1H6UA 2AJYH 5DC2A 3CUPA 1IT9L 4XO3A 2YPKA 4KKBC 5B3SB 4X6BB 4X6DF 1PU0A 3V10A 4OBRA 1EDQA 1KIQB 2IG2H 4YZFF 4A2FA 1J8KA 1IZJA 3L2NA 2XUWA 4QHPA 4Y4KC 5E2WH 1BM7A 2QHRL 1AACA 1A6ZA 2P7TA 1RP8A 2BSTA 5FM8A 5C0BB 3BAYA 3RZCD 2CD0A 1PF3A 1HL4A 3O6KH 4HSQA 2R2HB 3FONB 1M3IA 4P4RA 5I1IH 2GVYA 3IJEB 3LEXA 5GGTL 2UXGA 4PRPB 3AROA 3BVTA 4PV8B 4PLKC 5I8EA 1FAKT 2JLPA 3EHBD 2FJSA 3MV8E 4CU7A 2GK0B 2J88H 5EF3A 3PDGA 1P9MA 3MLTA 3MAWA 4F7CA 3AGVA 1JN6A 2Q3AA 4M8RA 3SPGA 4DGUA 2NNCA 3SE3A 3UC0H 3LPGA 3LNDA 4MX7A 5T1LA 5EU7E 4L0YA 3D8MA 5GGRA 3SGDI 4DP1X 5E1GA 5DJ0A 3U7YL 1G7LB 4C56D 2AMUA 1AQDB 4L4TE 4C83A 1DANT 5EUOE 4AM0B 2O1AA 3QQDA 4LIQE 2YQ2A 3PWUA 3RWJA 4H88L 4CADA 1AZVA 4HXBL 4WHTB 4DSYA 3NCJL 5DZVA 1JNNL 2DQFB 3W9DB 5E6RB 2NXYC 3IDNA 4N2AA 4U3SA 4ABWA 4PJAB 1SLXA 3G6JF 3ULVC 1U8CB 5KYWA 5EU6B 1C5DA 5IW6A 1G1YA 4MJJA 3S34L 3JWNH 3LV3A 1ZHLA 3Q01A 3WXWH 5ACZA 3VCLB 3ZKQD 4I18C 2NY2D 3L3GB 5BRZD 5SWSE 4WF7A 1SXZA 1HILB 4APXA 5F1OB 4LKCA 1RHHA 4ELKB 2HFFB 3GSNH 4K8RL 4KWUA 5GRXG 5KUMA 3H2PA 5TF0A 6TAAA 4G1EA 1EJOH 1KTJA 1LP9B 2KLRA 3AVEA 5EF0A 2MOQA 4HUUA 4FQCH 4OGXL 5F97E 1NDMB 5I16A 1GZQB 4FTVD 2CDGB 2GTQA 2YXMA 4UCFA 3W81A 2VXQH 3BT2H 3WKMH 4CW1A 1TU2A 2Y1AA 2F0CA 5LGKA 3LIZA 4Q9BA 1VKXB 4MA8H 4LVOB 2F19H 1YQ2A 4WNQA 3OR7A 4QJ3B 1U2HA 4Z7VE 2ZAHA 3FCSA 3G3LA 1MCBA 4BSJA 5EBLA 4UYQA 3HNSL 4EUPG 2ESVB 1XB3A 4EN3A 5CIPB 2PWHA 2Z4QA 4WRLA 3UTTD 5CLYA 3MRQB 3UBXG 3AMLA 3BUBA 4HS8H 3FFCB 4A2GA 1ZS2A 4JKMA 3QJOA 2E86A 4A2LA 2VZSA 3MJ9A 3QG6A 3GDBA 5IK3B 1QLFB 3HN3A 3NABL 3RFZB 2Z1KA 3ABMB 2OMTA 2GUOB 5JO5B 3SKJH 3ISYA 2C9QA 2NW2B 2WTOA 3N9GL 1TF4A 2QTVA 4J3BA 3D0VA 2NY5C 1EAQA 3AG1B 3RUGB 1TQUA 3QFDA 3GD1C 1OGAB 1YG9A 4U4IA 1BIHA 1JPTH 2ZCKH 3GSUB 2EACA 4IIQB 4MJIA 4MAUH 1FO0A 1Q9OA 3C5XA 3Q0HA 3R18A 3SDCA 1WIOA 4DGVH 3KPLB 5I6OA 3MACH 4I0KA 4XP6H 1KCSL 1NSNH 5DJAA 1QNIA 1H6EA 1OB1A 1OCOB 3R7QA 1UZ6E 1DUYA 3SO3C 4DQAA 4CVUA 4F2EA 4FMVA 4G5ZL 1N6UA 2V2WA 3P0VH 3DJSA 2B59B 3B9KC 4MWFA 5F21B 1NMCC 1BBJB 4AL8C 1PJ9A 4P48A 3UAFA 3DMMA 3THMH 2DWDA 4QRPE 1T7XA 3UZQA 4BFGA 4EI5B 1KN2H 4AW7A 2NW3A 2VOTA 4L4TD 1RIHL 3FU7B 4N3TA 2A73A 5AOZA 1CBVH 1JOIA 3FHAA 3NCBB 2V0AA 4IBQA 3AW5A 2E9IA 4EDWL 2EE2A 3BWUF 4EUPA 2SODB 2VRAA 3QRBA 3FT2B 3QH3A 3QIWD 1GVIA 3GSOB 3MUJA 1G9NH 3QRFM 3GNMH 1XT5A 3O9WB 1E28A 4CAGA 3VW3L 5D1ZC 4XC1H 4YX2L 5JIMA 2UZYB 4I87A 4MQ7A 4PJAF 3VFGL 5SWSD 32C2A 3OMAB 3MBEB 4ISVB 5C0IA 2JF1A 2HLEB 2JCCB 4JQXA 4TQEL 2VUYA 4M6OL 1FFRA 4BFEA 4NWTL 3TGXA 3MJ6A 5FUCE 3NJGA 4NP9A 4P9HL 1IGCH 4XX1E 4JDZA 4Z8FH 5HI5D 3MSPA 4UOJA 4P57B 4CSZA 1DP0A 3EZJB 3N55A 4OFYA 1LP9F 5DR5H 1FWXA 3HZYA 4N1HB 3LZFH 4G1MA 4FNUA 5EOQH 1R3IL 3SBWC 2DYRB 3T3MB 2GB2A 3S48A 5L8KB 4UNTA 2HRLA 3IDXL 3L1EA 3M7OA 2BWQA 1VGEL 3OAYH 3C8KA 5FO7B 1K5WA 1LEKB 1TTBA 3DX9A 1KPRA 2XSKA 3IFNH 3KPMA 3MBWA 4PWJA 3HC2A 1LK3L 2FUQA 5BVPL 2J71A 3IMTA 2X6BA 1SN0A 4M5ZH 1MZZA 1TENA 3ZQ9A 1L7IH 4BH8B 3SY6A 3IJSA 3LZPA 2WB1A 2Z8SA 2AV7A 4BYHA 4HFWA 4I48A 4L3FA 1KTKE 1UVQA 5DJCA 3GINA 2JKRM 5CFAA 4E9LA 2XWXA 1L9PA 2ZWKA 1V27A 2ZSVB 4A6YA 5EB9A 4FAAB 1F2QA 5DK2B 4BXVA 3ML8A 3WS3B 3B5GA 2X28A 1DJWA 4BUQA 2LE9A 3LNGA 3RUGF 2BP3A 2IWFA 4YDIL 4RNRA 3QAZC 5F3BB 1PKQA 2M26A 4P8QA 1I1RA 1ZLWH 2GSGA 1RUAH 3ZMRA 1SY6H 4LZKA 3VFVB 3WJJC 4N9GA 1D5ZB 4PGCA 1ROCA 4B9KC 4FGMA 3RILA 3UBHA 3VO0A 5I1DA 3EDJA 4G7SB 4WUKH 1LEIA 5CJXC 5GRWA 1BZ8A 1HNYA 3S3BB 5B22A 1AZCA 2LLGA 3QHZL 4QRPD 4HHAA 2PF6A 2VJXA 2G75A 3N41B 3PWPA 5ALBL 2ENYA 3EDDA 5T1MA 3G5XA 5F2FA 1HKFA 2FATL 2G0LA 5IMMB 3QBTB 2Y24A 4HZAA 1A1NB 1OAXH 3X11B 1G6RH 4AYEC 2XQBH 2FYVA 2JELH 2OJ1A 3RVXC 4A7TA 2GW5A 4TQPA 4P2OD 5M7QA 4A68A 5D7KE 1D6VL 3ZN6A 1IFRA 2MEJB 5LQBL 1N0XL 3KLHC 3KLKA 4XWOC 1B4JL 4L3EB 5J57B 1BVKA 3C5ZC 3ILEA 3VFWB 3ZY7A 5JHBA 4OBSA 5HXMA 4YHOH 1L3NA 4KDTA 3U6RB 1FNSL 2NX5A 3IFLL 5KTEL 3POCA 4JVWA 3GSQA 1G4MA 3LRHA 1BXUA 1BMZA 2A1WH 4PPTA 3O0RL 2V9UA 1CZ8H 1WA1X 2Y7QB 4Z7UF 3SQBA 1QSFA 4TULL 5DD1L 1MJ8L 3WIHL 1ND0B 2O61A 5DA0B 1FPTH 2ENPA 4JM2D 2JCCF 3SDDC 5D6DC 3VXSE 2OFQA 5HDLA 3B5HA 4WEMB 2C3VA 3K8KA 7TAAA 2QQLH 4YDMA 2HMID 3RWCB 4CJ0A 3JWDL 3HC3H 4DKFL 4PJXB 4AVKA 3N04A 1BZ7A 4BSWA 3V5HB 2H32H 2VC2B 4G8GD 2D7TH 2FGWH 2WP3T 1CURA 4A1RA 2DM7A 2DIJA 1E42A 1T6VN 2J25A 3L6FB 1CDYA 3HG3A 1QRNE 5FM5O 2Z92A 4ZD3L 4RAHA 4NKMA 1DBJH 5AVUB 4HUVB 3UL4A 3DOHA 2P5WB 3OKKB 1XSOA 4U6YB 4WK2B 5PAZA 5I8CA 4YHYB 3CFIC 1HI6B 3MLSH 4CMMB 2PYEB 3EH3B 4OD3L 2J7LA 3HE6A 1YMHB 4PJHB 5DI8A 3CGTA 2N4IA 5AKTA 1H15B 4OQTH 2VR9A 2YK1L 1JZGA 3QULB 4HJ0D 2E3VA 5DHVA 2IADB 4U3XA 5C8JA 4PJIA 2YJLA 3BKJL 5MERA 5C0GB 2XIIA 1YQVL 1OCWL 1XGUB 3IBEA 1H6TA 4NNXA 5EZOH 5TPWL 1FFPB 1ILUA 2K1MA 3ZIYA 3D4GA 4MKTA 3D69B 1EO8H 1PAZA 3CCHA 1B3IA 2PETA 3C6SA 4HMDA 4FFZA 4GAFB 4LSDA 4X98A 4XNMA 5F6HI 2CO1A 2XTJB 3O8XA 4YFDB 1KELH 4PRIA 1I1AB 4QXTA 3W82A 1YMMA 4XB3A 5BV7H 1CLYL 1U91A 1ZHNB 3MRJB 1OAUL 5D1QC 1M2VA 3GFUA 1XR8A 3MFGB 3VFRA 4FP8L 5IVNA 1A1OB 2PPDA 4JFZL 3S4SA 4PWHA 5E9DE 1BF5A 2CKBB 4TV3A 4NKOB 5LGHL 2Y5TA 3DWTA 4GBXD 4GEJA 3GBNL 1YEHH 2OULB 1TO5A 1FFOA 5D7KD 4JE4B 5CGMA 3KL3A 3V6FB 5A3IC 5D96B 4Q0XH 4F80A 1S7RA 3SKUD 2LU4A 2MSPA 4F7MB 4W4NA 3CFJB 1KFAH 1P0SE 2VE6A 3QXTA 2E7HA 5I76B 3L17A 1TZHB 4KTEH 3S3PA 5EO9B 1FH2A 2UZPA 1CD9B 3ARGD 3DGDA 3MV9A 3SE9L 2NR6D 2XHNA 2D31A 2GBVA 5DT1L 1HHJB 5EN2A 2HG5B 2NNAB 1MCJA 5D5MB 5I1EL 2VXUL 4P5TC 3RWDB 1A66A 2BSED 3T1FA 2HZHA 1UH2A 1IX2A 1YDPB 4R26H 3VXSD 3OAUH 4TUJA 3ZE1E 2WQUA 12E8H 4CC4A 4X0KA 1E9OA 3BAIA 4ONFH 4OGZA 1WAAF 3ARUA 2PPEA 1YEEL 2Z93A 4OTXH 3G6DL 1BECA 4ES9A 3WLBB 1A7PL 1KEMH 4MD5A 2UXFA 1HZKA 3TBVA 5D2NE 3SJVB 4LHUB 4LAQL 5F1IB 1QRND 2L8AA 4E9SA 4YC2B 1U0QA 1E9PA 2W88A 4GXFA 4HIHA 4PJXF 3C5JB 1RFDL 3RU8L 2BP8A 1CJYA 5HGAA 4AJ0A 2SEBA 5A40E 2GSIA 3PGCA 1CGTA 3GB7B 4G3YH 4JFSA 1XZ0A 1I8IA 4IKLA 3DVGA 5HHVH 1A6PA 3ZDWA 1SEBA 1U6AL 3NSFA 5FGCE 3OBAA 5DVMA 2VZVA 4M6MH 4IRSC 4UMGA 5T3ZE 4AEEA 2WUCH 2Z4TA 1P6FA 5KG9A 4K15A 5FUOH 4M5YH 5DZ9A 5D9SB 1BM3L 3BZFB 5BOZG 3GIZH 1P2CA 5SX5K 43CAA 4PJHF 1FFNA 1LDPL 3TCTA 2ZIDA 3RG1C 2X4NB 4MQXC 3ZTJH 4NQDA 1BG1A 3Q3GB 3ZUCA 5JYLA 1GKEA 5F7EL 2WOBA 4M7JH 1TFHA 2XKNB 3ZJAA 3BCFA 2P8LB 4KUCF 3MMEB 2PP9A 1MIEL 2VZTA 4NKDB 3ARYA 5HJBA 3L4XA 3K4ZA 4FMFA 4HLJA 4KNUA 3LD8C 4Z3JA 2VDLL 2HLAA 3APCA 4GSXA 3IMVA 3JWNC 4KC3B 5T5NG 2EVJA 1EV2E 1A7NL 2NCMA 1CD8A 5DRNB 3G6AB 2OZ4A 5E9DD 1D9KA 1HS6A 5GHWL 4PS8A 5T3XE 2GAZB 3HZVB 5KJRH 3C75A 1VGKA 2G5UA 1AXTH 2RFXB 3IFOB 4AITA 1UCBH 2BIIA 1XF4A 1OEZW 3D85A 1NINA 3WL9A 3KPOB 1B0RA 1IQWL 3OKOB 4QRRD 5E94A 4EPSA 1NPUA 5GRJH 4YS4A 4NCDA 4J23A 2H26B 1KJ2H 3EBAA 3ZYZA 2G9KA 4G80B 5JUEH 4JBSA 1QQDA 5HY9B 4RESB 2OV0A 2VM3A 1MCIA 4OB5L 5INDB 1A9EB 3NFPB 4OZHB 2ZXAA 1SMAA 4GG8A 4H20H 4XNAA 5D55A 4Y2DB 3WHXA 1IAMA 2YD2A 4LVEA 3IWUA 4L5FH 4FXKC 4PJDB 4BRVA 3H2QA 5E70A 4BEIA 2DS4A 2HKFH 2YAEA 3L4VA 4UQ3A 4WI0A 3SDAD 3GQFA 2BDNH 5L9DH 2A9NH 4C54A 1AHKA 2OTWA 4G9FE 3TZVC 1JYVA 1GTNA 4KKLD 1PZAA 1DL7L 1NCIA 3QDME 3BXNA 4N87A 4UINH 1PVHA 2X3CA 1W72B 3FF8A 4H1LH 1ODAA 4OZGB 4F92B 1W0VA 4J39A 1NL0L 2CRZA 3TT1H 1A5FL 4GQ9L 2AJ3A 1RUPH 5A1AA 3BDYL 1MDTA 3NPSC 2X1PA 4PB0L 4KRPD 2WO4A 5IFAL 3O45A 3DGGA 4AIZA 3TNNA 5FB8B 4WENB 4D0BB 3QUXC 4AUUA 4F8PA 3CU1A 3F84A 1OSZA 2VMFA 1HKLL 4AEHL 3QUKB 4X9IA 3HC4H 3N1MC 1L6ZA 1KIUB 1JDDA 4JO2H 3CSTA 3R1GH 5CCGE 4JREC 1YEFH 1SYVA 4MMXC 3ZE2B 1F45A 4NDMB 5K9KA 4FXTA 3MLRH 4MMZC 2OYKA 3L7EB 4AYMC 1HCFX 1XQ4A 3HS8A 1CXLA 1BXXA 2VLLB 4S11A 1FH5H 4AGLA 5T3ZD 3CBKB 2X2YA 3IE4A 3RVVC 1INDL 3O3AB 4HX1B 4QHUA 3MZGB 4K94L 4XI5C 1IC1A 2F7OA 4S1DC 2XG4A 4WHYH 5CU5A 2A4CA 2VLJE 2DEWX 3PABA 2DYPA 5ESVB 1GHFH 4JFEB 4BQBA 5EC2A 5BOPA 1T6BX 4ADJA 5IR1A 2EH8H 3T0EC 3PNWB 1CFNA 5DUBA 3HI6H 5C6PB 1J8HE 4Q58C 1G9NC 3B8YA 4LEXH 5ERWB 4Y5YB 3OAZK 4LO9A 4OLUH 2Y7OA 4U1NB 1I8AA 2AXFA 3CJJA 1CICC 3TA4D 2YPVA 5DQDL 4ZMZA 1MW1A 2IOMA 5LAXA 2YC1B 4ZAKA 2JQMA 1CCZA 1MFCH 1MFBH 3WN5B 2C9XA 4GQRA 3VB9A 4AIOA 5T3XD 1KCLA 3MKGA 4CN4A 4J3OG 5IJCC 5KW9H 4AGOA 4MCMA 4MGXA 3WTXA 4JRXE 1EHXA 4I3RL 1IAKB 4ZUUA 2Q86B 4GG6A 1SM3L 4DZBA 3LDBB 2IALB 3QXDA 4CVXA 1IO4C 1HINH 4H7VA 4X7TA 5CSBA 3QZNA 3TBTA 1JK9B 4YR6B 1H8SA 5KYYB 2ZUQB 1HHKB 5F9AC 5IB2B 2WN2A 1JZEA 1F90H 1TEGA 2L4OA 4I9WE 2BSRA 2AXWA 4IKNA 3CLFL 1EANA 1JUFA 2ATKA 1MCLA 4G59C 4GAYB 3IK2A 4NM8L 3V9FA 3GO1L 5CJOL 4HCRH 4UV7L 2VM9A 1MXDA 2N59A 4DGIH 5DJ8B 4P5KB 4ZFZB 2FJHA 1ICTA 1FNGB 4O58L 3K2MC 5ENWB 4G9FD 2EYSB 4M3JA 5EHFA 5ALCH 2R7EB 3GSRB 5GSRA 1QKZL 3CFBA 3QDMD 4WEBH 4PM1A 3VFTB 5JHMA 2YZ8A 1FNEB 5DVPA 5FYJL 4PJDF 3KPSA 2ADFL 5J5EA 2FQFA 3LN4A 1MF2L 5AVTB 4F57L 3H3BC 3IDIB 4YHKH 5EO0B 4LBEB 5E8OB 3MNMA 4XBGB 3ZDXE 3HZ3A 2A5UA 3ULVL 2DJUA 4W9KC 2NY4B 1G7PA 1EIBA 3FULA 2VXSH 2FZ3B 3MRRB 4S1RH 1OTUC 3LXBA 4OZGF 1AHWB 4HUWA 4WWPA 2CRMA 1T22B 4LQFH 1GJWA 1AC6A 1DBML 1TYEB 2FQGA 4AYSA 5IHLB 3S88L 1L7TH 5IFJB 2I27N 2DTSA 1HT6A 4N2EA 2OPCA 3O3UN 3DX9B 1NFDB 2QGBA 3A4FA 4JDEA 1U3HD 5IB4A 1IGML 2JIXD 5C0FB 4ONHB 2J57A 3IPEA 5ID0B 4HJIA 5AAWC 4UZUA 4TN9A 1M6UA 2OR8A 2IDFA 4JL1A 2HWZH 2A74C 4CU6A 1ORQB 3ZE2F 2BNRD 2WIIA 4FQHB 5JPMC 3IXAB 4XNUL 1Z5YD 3ASWA 3F58H 4NO0B 3HKFA 5BO1L 2VJ0A 2NDGA 4BQ8A 4CJ1A 3SPVA 4HD5A 5J6GA 5D7LA 5EU7C 4PJ5E 3T0BA 5D7IB 3TCLA 4CU8A 3CFMA 4HH9A 2D7PA 4LARL 4UB0L 4IKJA 3ARBB 3M46A 3DNKA 1A0QL 2EO9A 4Z7QF 4X6FB 4K23H 1NBVH 3S9DB 1BG9A 3JWOH 2NRDA 4S1SL 1SRDA 3Q43A 2EP6A 4OGAD 3F00A 3C6LA 4I0PD 1DYZA 1JCKA 1JZ8A 1TFPA 4WJKB 4F3FA 4JRXD 1MCNA 2NT0A 1UFGA 2XQYG 4QDGA 3U46B 3CFEA 2ZP9A 2X1WL 1EX0A 4G7YL 3D2UD 5HYJA 3U1SL 3DX1A 5A43C 3PHQB 1JWUB 3BO8B 1JZIA 3S35X 4ZRGA 3VMPA 3VXUE 3L1GA 2CBPA 4F33B 5F7LB 3SKMA 1QABA 4NRYA 4I9WD 1I3RA 4RFNB 3GXMA 2V9RA 4QYAA 2G5RA 1TDQA 2ZYHA 4KFZC 4N2HA 3B1TA 4JM4L 2M8XA 1ZTXE 4NHUB 4BFBD 4IDJL 1QSEE 4AL8L 4DOHB 4Q9CA 1FV1B 3MLYL 4FLHA 5BS0D 4YPGA 3HMWH 1KDIA 4OLWH 1IE5A 3DDFA 4Y4FA 2WNXA 1UT2A 3IDUA 2IPKB 1PQZA 2H1XA 3BRDA 2JK5A 4NAQA 5CILL 2ZCZA 1TYRA 3QDJA 4PHXA 5IG7B 2BNQE 2QKIC 4KO7A 4NQEA 1BF2A 5I0YA 1AGDA 5J6HA 4GKOA 1NCTA 1Z6JT 3GJFA 5F7NC 5FDWA 4NC1E 2X2JA 4ZFOL 1GR7A 4Z7WA 5DDHA 1B4RA 1EXHA 1LHZA 2KZWA 1PD1A 4FXGC 3KNBA 4XPFH 3QFJA 2DMGA 4PRHA 1G6VK 2VMJA 2WWKO 4YN3A 1I9JH 3K46A 4ATTA 3P11H 4TUOA 4UWQB 4GRMB 3US0A 3HC0B 4E5XG 4L1LA 1BW8A 5ABAA 3RQ3A 3W1ZA 2NNXA 1L4IA 3PQYB 4DEPB 3DHPA 3H6AA 5J1AA 2BINA 3VU1A 4ZZKA 3JZYA 4YXHH 5LGJA 3TNMA 2P52A 3MXWL 3DXAA 2XQYA 3MRLB 4NKIL 3UDWA 4XXCA 1WTGT 5I82A 3HR5B 5I74B 2W07A 2MTAA 4UOZA 2DQJH 2EJ1A 2OYPA 4E9VA 4ZDHB 4GQZA 3OR6B 5IF0B 1MWAA 5FA3A 4N2NA 1RL1A 1NFDF 1XCXA 3FN0H 4J3SA 5ANMA 4ZS6D 3MRCB 4QXGH 3HG1B 2CRYA 3JSSA 3F7VB 3WNKA 4HDIB 4UM9B 1I53A 2YXFA 4JMXA 2DQDL 5D4JA 2DQIH 2FEEI 2HYMA 1GJUA 4KMLB 2DL2A 2BRQA 1E7UA 3S37X 2JE8A 5IJKC 1RZPA 1LQBC 4FL4B 3MV11 3FCUB 3UJJL 3CFQA 5GZOD 4FQ1H 1KG0B 3U7WL 2IVFC 4X6EA 4LLDA 2O5XL 3C60A 1Y7VA 3KL0A 1HC1A 4LNVA 2Y2WA 2LU5A 1TQCB 3X3FL 2BVOA 5C0DA 3CDZA 1QASA 1T5KA 4OM0H 2FX7L 3NCYP 5IBUB 3TYFB 3V4PL 4Z76A 3KCPB 5J56B 1GGYA 2UXTA 2E7DA 4Z0BH 2G3MA 3WS6C 2OMUA 1JE6A 3FQTA 4PS7A 5CN2A 1LE5B 1EXUB 4E5XA 3W0WD 1TUPA 4OCSL 5AW0B 1FG2A 3EFOA 3U2SA 4HCFA 2VN5A 4LEOA 3IS1X 5JZ7C 4P46C 3FS9A 4EAEA 3ZK0A 4KI5C 5L4MA 3VXUD 2G4EA 4N2DA 1HXMA 1K8DB 3AY2A 4P07A 1KCRL 4ETYA 5FUCC 5AZUA 1QW8A 4AKQA 4NOFA 3NFSL 1KGJA 4JM2C 1YY8B 3CK0L 1ZV2A 4E42B 1BEXA 3BKML 3S3JA 3IT8D 3UTSA 3VDCA 2ZKHH 5DJ6A 1JWMB 2WHVA 2CAKA 4MJ6A 4P99A 1TMQA 3KVPA 4LSPH 5DJXA 4YSCA 1MJJB 1M42A 1XZWA 4O02L 1KYOJ 2XZZA 4KRNA 2BNQD 2J4WL 1NFIB 3IMRA 3WUWG 5H94A 4LAJH 4L37A 4HUMB 1DSFL 4RGNC 1YC8A 4ZX4A 2NYYD 4BH7B 2QMJA 1NTDA 4HV8B 3X12B 4HC1H 5IUCA 4DETA 4LOEA 3BUYB 3MRDA 3IVKB 1CF8L 2ZCHH 4CA4A 3H9SD 4YDNA 1U8MB 1MCSA 1I7RB 4DKDC 5E6IB 5IV2A 1PFOA 3BVUA 3RTQD 3GDCA 5J13C 1E4WH 4WK4B 4PJGE 4LSVH 4Y4KA 4BA8A 3UJTL 4ODUB 5IQMA 3W5MA 4FQXB 4F2MA 1ZT1B 1EUUA 3Q6GL 4G43A 3HOGA 2HAZA 3BGFB 4JPWH 3H9HB 4F8LA 2PMZA 1IBZA 2CO4A 1SN5A 3OB0K 1ADQL 5EH1A 1DBKL 1D5XB 1S3KH 1PDKA 4HQQH 4Z5RB 1EGJL 4G7RB 1UWGH 2ZXGA 4MNQA 3S8FB 2Y1VA 2WLZA 4RDQG 1VACB