1VCBC

The vhl-elonginc-elonginb structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
142
structure length
142
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the VHL-ElonginC-ElonginB complex: implications for VHL tumor suppressor function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PROTEIN (ELONGIN B)
total genus 35
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 1999-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 1vcbC01
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 1vcbC02
4W9FC 4W9LC 4BKTC 3ZRCC 4W9DC 3ZTCC 4W9GC 4B95C 1VCBC 4WQOA 4W9HC 4W9IC 4W9CC 4W9EC 3ZRFC 4AWJC 1LQBC 4W9JC 4AJYV 5LLIC 1LM8V 4W9KC 3ZUNC 4B9KC 4BKSC 3ZTDC
chains in the Genus database with same CATH superfamily
3RVXC 1PGRB 3T65B 1ZA3B 1ZOXA 2BNRD 3K2UH 1HYSC 3H9ZA 2JNZA 1Y7VA 4LP8A 1CF8H 3CNKA 4ORGA 3UAFA 3D69B 4KQ4H 4N0YH 5I6KA 2DWTA 2NLJB 3VW3H 5E51A 3LZFH 3M7FB 1RHFA 4XPFH 3BEVA 3BWUF 4M6OH 1KTLB 2MFNA 1JF6A 1NIAA 1T0OA 3RZCD 5LGJB 1BMZA 3M8OH 1UWEH 5ENWA 4I1PA 3L4ZA 4WHDA 1K9TA 3NJLA 3PDGA 2C4FT 3OZ9H 2WAHA 4PBDA 3NFSL 2JK5B 5HI4C 5JPMC 1I75A 4KMTH 4XMTA 4ZOEA 3H9YA 4JZNB 3IAGC 3QO0B 5CBEA 4EOWL 2Q1EA 3VQ2C 2CO7A 3MCG1 4AXWA 2X6VA 3LZPA 2A9MH 2ATKB 2QPEB 3ES6A 1AQHA 3LX9A 1Q1PA 2XRAL 4GMTL 3E3QC 3C5JB 2EDMA 3QXUA 4ZFFB 1D5BA 1UOLA 3KCPB 1SOSA 2CCVA 2VXTL 3B2VH 4BZ1L 2X7LB 1EZSA 4J1UA 3KPMB 1XMWA 3P69A 4P5MA 5DFTA 2X4RA 1WZ1H 3QPXH 1O6TA 4ZX4A 3HA0A 3GLZA 3QCVH 3TZVA 2KPWA 1U95B 4LVNC 1CYGA 3S34H 5E9DB 1S9YB 3DURA 5C3LD 1LJMA 2A6JA 1W9XA 4HHWA 1OM3H 4OLXH 1KJ2H 4FQHA 1OAZL 4E2OA 4KRNA 4AE0A 2JLPA 3NG5A 3CLEL 4MS8C 4GUOA 4U1JA 3I2CL 3GPEA 3PWLA 5DEFB 3BOVA 5AYUH 5KBMA 1TFHA 5GS0D 2Q10A 3RNQA 3FN0H 4IS6A 1WJ3A 3D0LA 4GG6A 5AAPA 1F4XH 3BZ4B 3WKML 2OCFD 4W4NA 1W0WB 3VCLA 5I1LA 5JOEA 3CD4A 4N1EA 1A3ZA 3FU8A 2CU9A 4OTXH 3H7BA 3NZSA 3H1ZA 4A68A 3HC0A 1BQKA 5KN5A 1O0VA 3IXAA 4FFYL 3WIIL 4NSKB 2JIXD 3VMNA 4IRJA 2HT4D 4OCRH 5CWSA 1SYVA 1HQRA 3V4VB 1KLFA 3LNFA 1S46A 3N3EA 4MB4A 4C83A 3QJQB 1ZLDA 4B9YA 1N59A 1DN0B 2ZXWB 4OUOA 4ZTOL 2CH8A 2PWDA 3GIZL 3QEUA 4FNPA 1YN7B 4E36A 5E6ID 2V9QA 5DWUL 5B7EA 2FR4B 3UTSD 1S9WA 5DRXA 4OLVH 4PJFB 4AVKA 2J1ZA 2GTWB 2C9WA 4XOEA 7FABH 3PUUA 4XCEA 4APXB 3MFGB 1ZE3H 3B2PA 3LS5H 4PJ8C 3HZMB 3L4XA 3WO4B 3MV8B 3S37H 5GRJL 32C2A 4MXWL 1WAEA 2J1KA 5EOQH 1VB9A 1A6PA 1PKQA 1IBGL 1P7QA 2DTML 4NRXA 3INUL 4L9LC 3HE7D 5IM7B 5F0PB 3GI9L 4NQXA 3U0PB 2Q2LA 4PGEB 4L18A 3N43F 4XRCA 2X1QA 3AGVA 2WCSA 5CP7A 2ZYSA 4AC4A 1TTAA 4C55A 5JPNB 1TIUA 1OE2A 1MUJB 2Y69B 3ZHFA 4JPIB 1WT5C 3NJFA 2FBRA 4UDTA 4NBYB 2HVJB 4KHTH 3SBRA 4D0BB 4X6CB 3QYCA 1ILUA 1Z9LA 5JIIA 1MHHA 2Y06L 4XXWC 3CWGA 4HUMB 3IRPX 5FYKH 4TPRH 4L1TA 1INDL 3VXUD 4HOWA 2DD8L 1QNZL 4XC3L 1BM3H 4YSRA 1CFSB 2HG0A 4U1LB 4AG4L 1Q9KA 1C5DB 1MCRA 3PQYB 4Y5XB 3VXRD 4RGOH 3ZDXE 2FBJL 3QDJE 3PS6A 4FKEA 4WY7H 4NDMB 5DMJB 43C9A 3DV6A 5J8OA 4O9HL 1CCZA 1KN4H 2AEWA 2FLRT 3W0WE 4AENA 1L6PA 1USQA 5DJ0B 1D6EB 4KRPB 5F9OH 2AJ3A 1YNTA 4KZEH 1K3IA 1LILA 2VN4A 4CNIA 5I0DA 2KS0A 2QFRA 1AANA 4OF3A 2EDJA 3EJQA 4E5XG 3HE6B 1L5GB 1T1YA 1MCEA 4PJEA 3HMXH 2AW2A 2GABA 1QFWL 4QYOA 4S1QL 2A9AA 4WKZA 1RUAL 1W0VB 4JFFB 4XWGH 5JHBA 4YHPB 4GXUM 3CZFA 3HE7B 3K6OA 3O6ML 3VTTA 1UUSA 2WXRA 1Y07A 3A4DA 3TIEA 1FZKA 4QRSB 2NY5H 3ZHKA 3QO0A 3CUPA 4AMXA 1DEEA 4WWKB 2YRBA 1BVOA 1MY7A 2UX6A 2G60L 5C6WH 3GF8A 3W82A 1UD5A 2PABA 5DD0H 3CN0A 2DRUA 3D07A 2GFBA 4W4OC 2LE9A 1GIGL 2WN2A 3EFFA 5DRZB 4AQ1A 2P28B 4DKDC 4IGBC 3OLEA 3UG5A 2CNZA 4LARH 2ADFH 4ILDA 4PLNC 1MPAH 2W81C 4PJ9D 2OZ4H 5FO9B 1XH0A 1K2DB 1F58H 3HAEA 4O2CA 3FCBA 4HUVB 3WUZA 2BO0A 3IGUA 3IJEB 3HN3A 3T8XA 4I3SH 3BJ91 1BG1A 1DBBH 3HE6C 3H42H 4QRBA 4YSUA 5CCKL 2NY2B 3Q7JA 1I8IB 3FRPA 4EIGB 3RVXD 2ID5A 4PRHB 2YARA 4YAQA 3IAQA 4L8SC 2AQNA 4M93B 3LRKA 4R4FL 3VXMB 1JGUH 1J0HA 2SEBB 3AQXA 1MI5E 3EDKA 3Q6GL 1E65A 5JW5A 4MAYB 4JRLA 3IGAA 3L81A 2D4FA 5D71L 4YSQA 3QDGD 3HW7A 4YHYB 5HHMB 4X7EC 3KPPA 3T8MA 1K4CB 5LCVL 3ZE1E 1MAJA 4OZFG 4ZODA 3DMMD 5IBLD 5C0CE 4DZ8B 2JH2A 5KUMA 4PUBH 1DANT 1Z0MA 3BCDA 4Z7WE 3N42F 4R7LA 4N5UA 4JCWA 5GZOD 2Z7UA 4FNLH 3WFBL 4FXLA 2ZSVB 2IADB 2YD4A 1CZ8H 3EO1B 3SPVA 2OZ4A 1ZVYA 5AW8B 1J5DA 4DO5A 5ALCL 2EIMB 1JDAA 4YIQA 3NJKA 2BNQD 1S7XA 4BFKA 3KGRA 4QXVA 3B4NA 1A7QH 2QVFB 1QBLH 2VMCA 1WS7A 4J39A 5C86A 2NY4B 2DF3A 5HD8D 3GSNH 3TO2A 3US1A 3EIFA 2FWSA 3O41B 2XWJB 5FDWB 5TQ0H 4NQCB 5F0LB 1RIVL 1PY4A 2YMTA 4YE4H 3PIQA 2CDFB 2DQDH 1AXSA 2FJHB 2FHBA 3F7QA 5E9AA 1XEDA 2V2WB 3CVBA 2HT2D 4Y1AA 5F7KC 2AJYH 1QRND 1BBJA 5E6ZA 5CINL 1JERA 2JV6A 5CIPB 5C0GB 2BSBA 1CYXA 2Y5TB 5IOKA 2F58H 3JV4B 1OB1B 4LCWB 4F8QA 4G7YL 3SDDB 4J5VA 3OX8A 2ESVD 3LH2H 1U8MA 1T20B 4YSDA 4KI5D 1K72A 2AV7B 5GS0H 2JCCE 2Z91A 5J6GB 1USZA 2VW6A 5IJBC 1MG2C 2WSKA 3ABKB 4JJ5A 3O45B 3U82B 4OZFB 5BOJA 3DVGA 3FONA 4JZOA 2JK5A 1HSBB 1WBZB 4GSQA 2YD3A 1IAIH 2IFFH 4WI5A 1FN4A 2XYBA 4X7DC 1KPVB 5JDJA 3VRJB 3EBIA 3HZ3A 4PJXE 2YPVH 3CQPA 2HKHL 4Q9RH 3Q8AA 1PX4A 1UD3A 3ZKJA 2XACC 2FEDD 3MRQB 5K69A 5FYJE 1KBGH 5EBGA 5EOCJ 4XCEB 5T1KB 1UASA 3F85A 3SYCA 3TVMA 3SPCA 4ADJA 1S9XB 2H2PD 2WNWA 3M7OA 1ID5I 4FX5A 1NLBH 2Z8RA 3HZVB 4MJ5A 3QG6A 2AEPH 1G4MA 2AQTA 5HYFA 4B9KC 5C0IA 1QR1B 2PYED 1SBSH 3ARUA 1I3RA 4WNSA 2O72A 2A6KB 2PWFA 4EZJA 1R3LB 3K6FA 2DW5A 4YZFE 5FO8B 2A1WL 3OJMB 1JXFA 4LPWA 2NZ9C 4BGDA 3G6JA 3HLKA 4IIQC 5DRWB 1TMCB 2YC1B 2FO1A 1NJ9B 1ES0A 8CGTA 1SJHB 2FDBP 4UMSA 3GSOB 3SE3A 3AREC 4M7LT 4K5LA 4QOKB 4WCYL 4JGJA 5JYLA 5GS1C 4YSTA 3U1PA 2VL4A 3PL6B 4W81A 5KYXA 2NXZB 5BUPA 5K1VA 2WQXA 5E8NB 1TITA 4HWEL 5I1LB 5D8JL 5HHNB 4DGYL 3WTXA 5TDNB 1UVQA 4LLVA 3L9RA 2WNXA 5ESVA 4K2UL 3MLPA 3EOYG 1IQWL 1NFAA 3GXNA 4YDVA 1EZVX 4OD1L 1ODUA 2R4RL 3LKSB 1IC5H 2Y7OA 2VDNH 4PVNA 5C0CB 5B7FA 4LP5A 2OJZL 4DESA 4LL1A 2OS7A 2X0WA 3L4TA 4J6IA 4M48H 2FT8A 2VUYA 4CC0A 1NCCH 4OZ4A 3S3DB 3HNVH 1IEHA 2XJKA 3H3KA 5ADPL 2E5EA 1PG7X 4P46A 3VFMB 4QPEA 4PP1C 1OV8A 1YEDB 3IBOA 4KXCA 5CNHA 3ZQWA 3ARDD 4AGNA 3ESMA 4R7DA 5DVNA 4B9FA 1K4DB 5IB4B 3M1CA 5FFGA 3NJHA 1UD2A 3MO1B 3CGTA 4WI9A 5HY9B 4XNMA 3TBWA 1JSYA 1Q4NX 4PJFF 1OGAE 1J9CT 1KJMA 4FDWA 1KGXA 1GYWA 4YK4B 1U93A 1NEUA 2BINA 2CSPA 1DQVA 3US0A 5LLIC 2A83A 2BPBA 1MCCA 3EAKA 5IVXF 3BWAB 3LH2L 1U21A 2B1AH 4HS6B 3SGJC 3ARBA 3GMOA 5LGHL 2ZUUA 5I0WA 1J12A 2IH3B 5CHNA 1O9WA 1MVUB 2W0KA 4JO2H 4PHZA 3KPLA 1DR9A 2ZXEB 3UCRA 1B4JL 4N9GB 2E9JA 3WLWC 5A6LA 3WFHB 3FO2A 3MR9A 1KDJA 3ZQ9A 5KVGH 2FL5B 2HTLC 1HI6B 2AJYL 2WKOA 3R1GL 1BXAA 3KPRA 3HAEB 2EYRA 4KY1H 1HZLA 1LD9A 1VGKA 4WUUE 5T1KA 3MZTA 4KROD 4WHYG 4AL8L 5KYUA 3RBGA 2TSAA 1FSKC 2OR7A 1KGUA 3NIFF 5LBSA 1IM9A 2B20A 4JEGB 5T5FH 5IR1A 4H2AA 2VDQH 3BUTA 1LO3H 1GY1A 3N1PC 4JKNA 1TPXC 2AJXL 3QUKB 1K3ZA 4MAYD 4Y9EA 1C7TA 5DK0B 5IB2A 4NQEE 5E2TH 1YECL 3QC6X 2YRLA 2YZ8A 3O4LB 3QUZB 4AEIH 5ESQA 1KCUL 5E4EB 4MDIA 2J4WH 1X9UA 3QI9D 1B9ZA 4JJ5B 4K5OA 1BEYL 4IKJA 5FM5M 3WU1A 3PDOB 4GLRH 3RU8H 1CGUA 4GS7C 1WFJA 3L48A 4RMSA 5BZDA 1IBZA 1KGWA 4JFQA 4NNXA 1UFGA 2BVPB 1NUDA 3RDTD 5D7IB 1JF1B 4O2EB 1NGQL 4MHHI 2XV0A 2NY1B 4LAJH 3D9AH 3Q6GH 1YPZA 5CP3A 3NZ8B 3L7EA 3P3YA 4OUUA 1P5VA 4X9IA 4L5FL 1S5IL 4ONFH 4GW5B 3EOTH 5I0VA 3PWUA 5MHSD 3RGVB 2WSPA 1C5BL 3BO8A 4S11A 3DYMA 3OXSA 4N0FB 5JNYA 3G5ZA 1PSKH 5I6XC 4Q6IB 5GIRA 4B9GA 3KW7A 2NR6D 1SEQH 2VTFA 3DXAE 5HP5A 2GUYA 4B9PA 4E9WA 1RK1B 3P1VA 1HEHC 3X11A 5LWYL 1KWGA 1R24B 1YCSA 1N0XH 5I71C 4XN7A 1I8LA 1MEXH 2NXZD 1H6EA 2OTWA 3MV7B 2AEOA 2DYPB 1RIUH 4G9FD 3T3MF 1CLZH 4QOKD 3C8DA 4L8BA 5E6UB 1XWVA 5CGYD 1ZGLP 4BK8A 3AG3B 1FI8C 4YUEL 4UOZA 4JFEB 5AB0A 2IOOA 2HLFC 3L4UA 1JNNH 1EPFA 4HKXA 4DN3L 1JPGA 1P4LA 5E0FA 4F7MB 5IP4A 4FYTA 1DQQA 2NY5L 4QYAA 3PQYD 5F7AA 3VXRB 3C5SA 3OJVC 3VMOA 4BGLA 5C6TL 4YS4A 5DURB 1I8MB 3AWFA 5TH2B 1XZ0B 3X3GL 3UBFA 3V4UL 1XF5B 1XXFC 3KG5A 2HVKB 2K70A 5KOVC 3MLWL 2DBJA 3ABMB 4QO1B 4OJFL 1DQMH 4MJID 4M43H 4PBWD 1ACXA 1FN4B 4Z0XA 3H4FA 1G9NH 5SV3A 4LNRA 5I76A 3MRKB 1A5FL 4PD4K 1XZWA 4Z76A 2CR0A 4O9HH 4OQTH 1NBZB 1Z3RA 4FQXC 2NCMA 4JG0L 5EO1B 3O3DA 2VIRB 3GPSA 1J1XL 4J12A 5FS5A 3JWNE 3DX3A 3LKQA 4F37K 1ZIAA 4BQBA 3IFPB 4F24A 4BH7A 4R5XA 3K8LA 4OFVA 5EBWB 2V2TB 4XC3H 4JAMB 1QNZH 1HCYA 5EU7C 1UZ8B 2O6DA 4LHUD 4I2XB 1NMBL 4QXGH 5EV7A 3ZE1F 3OHXA 3V9EA 1Z5LB 3BPLC 4WNJA 3JV4A 3BP7A 1D7CA 1P4IL 4O4YH 4V33A 1A6AA 3PHOB 3BSHA 3CVHH 2OMXA 2B08A 4HJ1A 2ZKMX 1U3JA 1CXHA 2X2JA 2WC7A 3CZFB 3HE7A 4MDJA 2BLFA 4M61A 4DKFL 3KH3A 3O6LH 3RZWA 3VWJB 1OPGL 2D4DA 2JB6B 2NX5A 3W0WB 3FCGA 5CJ8A 3ARGD 4Y2NA 2J6EL 3POCA 4ODXA 1ZEAH 1LTXA 4IJ3B 5HYIA 2P43B 5LKNA 2DTMH 4HV8A 4TL4A 4MXWH 5D7JA 5JHDD 3HN5A 3B3IA 5F9WB 3MRNA 2Y1ZA 4U31A 1CICA 3HZKA 4G6KH 4DFIA 2VJXA 5I5JA 3RG1C 3QHTC 4HZAA 5FO7A 3QXAA 4JG9A 3IJSA 5HHPB 1ZHKB 3RY6C 1VZIA 4PJ5A 7FABL 5LVEA 3I50H 3F84A 3NSYA 5C0AD 1J0YA 3B1TA 3QQ9D 2JKIS 1OAXH 2P5WA 3CCHB 4JL2A 4NB7A 1KXTB 4UU9B 1DDHA 4GRWB 4XXWA 1KGCD 1XF3B 2FCBA 3PL6A 4EJ1C 4ZTOH 3ZTJH 3PWVA 5DZJA 2BIOA 1K5NA 2ALAA 3KHQA 3L3GA 3DUSA 2ZUSA 4JHUA 4WEEA 5FOBB 3ZO9A 2DM2A 1BZQK 4B50A 1IU1A 4EIBA 1AGFA 2WUBL 2NCEA 2PCXA 1JD9A 3WJMB 4BUGA 2HFGH 2FJGA 4NM8L 4BA0A 3ZTEA 3ARQA 3ESUF 5L4JA 2DWDA 4GAGL 2E3VA 1TQSA 1DSWA 3KLAB 4J2QA 1BQRA 1MDTA 2RTTA 4MD4A 5DHMC 2YN3A 4E42B 4QO1A 2WHVA 1VFUA 4RAUB 5KJRL 2M8XA 3N0PB 3NIFE 3BLPX 4G7SB 4Q56A 5AYUL 1IRAY 1KG0A 5L2KA 4Y16D 3DSFH 3I3BA 3CZKA 1AXTL 3WO3B 3JQOB 1OAZH 1A7PL 4L4TB 4NP4H 2VR5A 4OCWH 4ZUSB 1AHMA 3CE1A 3BSZA 2IGTA 2N3JA 4JM2A 3RWIA 3GXPA 1MJJA 4M5ZH 3B9KC 3DGGB 1FG2A 4OVUA 3PNWB 2FECL 3NSFA 2VQ1A 4N1CA 5C0DA 4FXGA 3RI5K 1Q9LB 3WUWB 4QRRA 1F3JB 5FA3A 3EGDB 4JQXA 1TU2B 4MJ6B 1UUNA 2ZX8A 5HHOB 5FPIA 3P3RA 4FTVE 2AC0A 3LIUA 4EOWH 2BNRB 1C08B 4NN7C 1I7ZA 3DROB 3RZCA 4KMTL 5F3HB 1F00I 5AW5B 1NAMB 1IV8A 1EAJA 4QHKI 3LQAC 4H8WC 5E6RB 3MV9E 3NIDF 4JY4B 3QDJD 3NJIA 2EDLA 1B0IA 1XB8A 1UWEL 1NFDB 1O9ZA 2BSTA 4ENZA 4DAGL 3KJ4B 2YN5A 1QO3B 1GMIA 3ZU8A 4P2OD 1HK6A 4AQ8A 2XV2A 4ZNEA 4KQ4L 4N0YL 1NC4D 2F61A 4YEEA 3RWHB 2XN9E 1CF8L 5MEQB 3ZUCA 2EYTB 1URZA 5DQDL 3HR6A 1ZT4A 4M62H 5J5EA 3D06A 2EDEA 1FVDA 4MTMA 3B2MA 3I9IA 2G5BA 4QRRD 3TA3B 1MHEB 4PG9A 2GJZB 2EDOA 3BP5B 4NO5A 4XBPA 3FO9A 1ZLWH 1XGUB 4PJDA 3NRFA 4OZHF 1UZ8A 1UA6L 1F3DJ 1X5IA 3LSOA 4I87A 4JM2D 2HJLB 2ZKXA 4A37A 4AYFB 1DJIA 4LASL 5DFAA 4ZS7H 4QTHA 4HIXH 4TSAH 1I3RB 4KH9A 4ABWA 1PVHA 1T22B 5D2LB 4A1RA 1TZIB 2OPCA 5AL0A 1DZ0A 2A7BA 1CLYL 1W15A 2BHYA 2XWTA 3HHMA 1E9PB 3MOAL 3FF8A 4IHBA 5D1ZD 5AVTB 3ZDZB 5GQBA 2VW7A 2QSVA 3VXPB 4OGYH 4GG6F 2I26N 4AEHL 3ZX1A 2DEXX 3CVIH 4PLKC 1CB4A 4LU5H 4PCTA 3CFCH 4HWBH 1CK0L 4I5BA 4ZO6A 5HVHC 4LLMB 1IM9D 4K8RC 4Z7AA 2XU9A 1LD9B 4D7PA 3NSCA 3C5SB 3T6VA 2RQ8A 3B3BA 2ZCHH 1KN2L 1BSIA 2QTVA 2XZQL 3CZLA 4MJ4A 1QLRB 5BVPH 3GK8H 3LRGA 5C0FB 15C8L 1XGRA 4FQ2L 3UYRL 3HNTL 4F8TA 2OR9H 3CX2A 4LRNL 1JNLL 4UQ2B 4Z18A 4XVUC 2AABH 2UZIL 4NGHL 2DYPA 5JPNC 4WDIB 2XVKA 1PLGH 1MREH 4BWTA 1T7WA 2WNKA 5C0AA 4PB9L 1MWAL 2X4OA 4A2LA 1CL7I 4HJSA 4CW1A 1MFDH 3D30A 4Z7UA 3A24A 2BW5A 2JCCB 2WWOA 2P49B 3IJYA 5CUSL 4ZYKB 1T7XA 1FBIH 1TVDA 2B4CL 4HCFA 1NWOA 4XPGH 1P9MA 1MQ8A 2M83A 3I3DA 4JFXA 1QWHA 5D1QB 2Z35B 4PS4H 4GIPD 1D5ZB 3V4VH 3FUMA 1DJWA 4PJAA 2Z6FA 2FEJA 2CO2A 4KKCC 3WY1A 3OR6B 4WLCA 4PPTA 4AUYA 4GXFA 2IV9A 4M93C 1UWXK 2NW3B 1AZBA 4P46D 1TZHA 3GBNH 4G6FB 3GO1H 4BHUI 4JDVB 2ESVE 3KVDD 4PCSA 5F8RC 5E9DA 5BRZE 1AMYA 4LLDA 4XTRC 1ODAA 3AMKA 3WFCL 3WIFB 1RIHL 1G9HA 1ZANH 4G43A 4NKQB 5ABAA 5E24E 3VFGL 4FLQA 3EBHA 3WHXB 4GUPA 3RA7H 4NWTL 4CU7A 1WD9A 1UM6H 4NQDB 2VXUL 1OF0A 5FA3B 2C3VA 4LHUA 1QLEL 4J4PA 1OSYA 1TJIH 4NZRH 3NCXA 1MOEA 3WTTA 3KPQA 1G9MC 4Y4HD 2YD9A 2EIZB 4OI7A 3R4RA 1EJFA 4UDTB 4HWNA 4XMKH 1AVAA 4N8PA 3MUGB 3O8XD 4JHBA 4OIIL 5C92A 5INDA 4UT7L 4W68A 4XXDA 3IFPA 3TIDB 1R9FA 5E4AA 3A0OA 3KJ4C 2VIRA 2QQLL 2OR8A 2WWMC 2LAAA 4QF1A 2WQ8A 1DLHB 2APXA 3QDGE 1BWMA 3SHSA 1U3ZA 1F56A 4HWZA 1UJ3A 1OP5H 5IW6A 4Q2ZA 1EZVY 4Z3TA 4NNYA 4E9QA 4AQOA 5KANG 3E0GA 3MV11 2HVKA 4HWUA 3OKOA 4BFFA 4QXWA 2QVIA 4DK5A 1IGYA 5CZXD 5A7BA 3HZYB 3MRBB 4WO4B 1BYPA 4F7KA 5JOPD 2Q5BA 4KRPC 3HCVA 1MJUH 4QLRA 4BHUA 4LSSH 3D33A 2EXWD 1KNOB 2XKSA 4P2RD 3A67L 5DHEA 5BOZG 4EDXA 4YDMA 3HPLA 2WYZA 3GHPA 3EF4A 5F1NB 3OKMB 2OSLB 3B9KB 3EFDL 4HX1B 3QDGB 4RMBA 3PWPB 1TCMA 1PS3A 1DBKL 1D9KA 1IBBA 3ABLB 3I75A 4M3KB 5HVGB 4ECNA 3FT4B 1L9QA 1A4JB 4IBTA 2D3VA 2HPTA 3FQNA 2F19H 1JPST 1EUUA 5IESH 3OMNB 2LFEA 4MB1A 3ARRA 1IIKA 4YGVA 5EU7E 4XNAA 2DEWX 4HC1H 1ZVHA 5KN5B 2Q87A 1QBAA 1E7VA 3EBAA 3D48R 4HCRA 1IT9L 2VL5B 5EIIA 1EAOA 3GSWA 3QQ9C 5E8PB 4DKEL 3UYPA 1B2WH 2Z31C 3LHPH 3D0LB 4GG6B 1QRNA 5EZOL 3IN0A 2E7BA 2YAFA 3LQAL 2YPLA 3PABA 5J1SC 4NDMA 3MACH 5E2UH 5IHHA 1JGVL 1RP8A 3FO1A 3UTTA 1AGBB 4N26A 1LE9A 1W72B 2O6FA 2PO6C 4XHQA 3CVCA 1NFDA 2MCMA 1TKWB 4LBEA 3CXDL 4PTUA 2Z7WA 2IAMC 5KYWA 1LO0H 2JB5L 5J11B 2WBXA 4NOBA 3ABZA 1SUJA 1AI1H 1D5IL 2D7MA 3QQ3A 1GRWA 4NQSA 3KPNB 4OJCA 2X9WA 4DN4L 2X70A 4YHNB 3JZ7A 2DQGH 1S7VA 1B0GB 4Y5VA 3ZRCC 1KB9K 2XVLA 3JTSA 2X4RB 1CGXA 1BQUA 3P9LA 4G5ZH 4X5WB 2X4OB 4Q9BA 3QI9A 1WTLA 1U92A 2QQQA 4G82A 4F9LA 3WIHL 4HK3N 4HUKB 2NY0D 2AJZA 1X9QA 5IBUG 4ZQKA 1NMCC 1S78C 1KYDA 4G6JH 4JKLA 4OSUL 4XCNA 1SJXA 4PWGA 2NY5C 3QEGH 5AW4B 2ORBL 2CUMA 1T5KA 4LCIL 3QAQA 1NBZA 5EO1A 2VT0A 4ZG1A 1ZJBA 1UD4A 3IPBA 4RIRA 2CDEB 4Z7QF 2VO8A 1WHPA 3B9EA 4RMRA 1D5XB 2XZAH 4QTIH 4J3UA 1XF2B 3ZTNL 2E7LA 1FNHA 2H6PA 3O9WB 3P0GB 2PXYB 1AHWC 3HUJA 3GXTA 4LLMA 2ZG2A 4J3OC 3FB5A 2WLNA 3BEWB 2H6UA 1MXDA 2OMTA 4JVPA 5EDSA 2P5PA 3DX9B 2W95A 4GP8B 4OF6A 5D5ME 4IRZL 3FQ2A 3IB4A 3UDWA 4NKDB 1NCGA 3VXPA 1MRCH 4C54A 1G9MH 4U6HB 2DJSA 3V6OC 1ROCA 2J8UA 2AI0L 2DWDB 3N41B 2NUPA 2EICA 1G0YR 3HMXA 3GM0A 3QORC 5E2WH 2WIIB 2XTJC 1P53A 3CFEA 1DCLA 4URTB 3VNZA 3AREA 5EC1B 4Y1SA 5DMKB 4CN1A 3MC0A 1G6RB 5HDQL 2NPLX 1L9OA 3H9HB 4UV4L 3ME0A 3MCLL 4D8PA 2W91A 1NINA 3FTWA 1J8HE 1T4WA 4DEPB 4Y7OC 1ZTXE 4PG9B 2D7TH 4S10A 2OMWA 1NDMA 3MUZ1 5J3HD 3EJZD 1FVDB 5D4JA 3V4LA 3V4PA 1DZBA 5JLZA 1YJDL 3BN9C 4MQXD 2EYTA 2VXQA 1WWWX 1AXSB 5E8DH 3WL9A 2XHNA 1FL5A 3LPPA 3U4EA 4ZMQA 2DMCA 1YDPB 4P4KB 1M6UA 4M6NH 2EDFA 4P5KA 3H9SD 4Y9GA 1NMAL 4BUHA 3QZPA 2EIEA 3N50A 3CDFA 2CBTA 1NUGA 1S7XB 5TK2A 4EDWL 4FZ8L 3OAWA 3QNXA 1A7NH 1P6WA 2FYYA 1OQXA 4N9OB 3MFFB 3KDPB 1C7SA 2FUQA 3CFKB 3HPJA 3WEXB 3VB9A 1P2CA 3PWPD 1WV7T 1WG3A 2HUHA 5F9DC 2VJ0A 2BJMH 5HDWA 1ED3B 2QHLA 2CCWA 1ZS8B 1JFHA 2NMSA 3O8XA 3FO0L 3FT2A 3FU3A 2VDMH 2ZIDA 3ULSB 4BCXA 3ZR5A 1PG7L 5DLMH 3L17A 1FIGL 1L7IH 3KYAA 2X4PA 3G6JE 4M4PA 5H94A 3QS2A 1C12B 4HBCH 4I4WB 3QJHB 5HHOD 4F2MA 4J3SA 3S98A 3AXIA 4UQ3A 1OEZW 1I7TA 3CX5K 3O2WH 1WS8A 2X44D 3EJPA 3N40F 1EV2E 2LT9A 2B4CC 5BQ7B 2HMIC 3JWNG 3RHWK 3KBEA 4OB5H 1KLGB 5E1HB 4GAYA 4JFPA 4ISVA 4AYDC 5IFJB 1LO2L 3CPUA 2JJSA 4OW6A 1OPOA 4XT1C 1QA9A 4R97B 2B3IA 3ESPA 3Q1EA 5MP6L 4TUJB 4H26B 4Q2ZB 5E9DD 2Q2EB 5D7JC 3ZKMD 4I2XE 1BW8A 3L3OA 3JWOH 3MQIA 4R7VA 2BY0A 5FUOH 3ZT5A 4AKOA 2EH8H 3A6OA 3CFJA 4GB9A 4HXAH 1RPKA 3BAIA 4PJHE 1HOCA 2CR3A 2FAUA 1WAAE 1UKQA 4YK4C 1E5YA 3THML 1UYWH 5MEQA 1XF4B 3MCLH 1FZOB 5BJTA 2V8LA 3IPFA 2XN2A 3NCEB 4NWUL 4GRLA 4P9MH 3RIAK 3HB3B 5BRPA 5DO2D 1OARL 1KOAA 3OZLA 5AKTA 3QQDB 3T0DA 4HFWA 1DN2A 4TTDD 3U46A 4NCC1 3KPQB 5E4EC 3K2KA 5DYFA 3MROB 4G72B 3ELAT 5FB8A 1KJ2A 2PW2B 4MNQD 3LKPA 4Z95L 3S5YA 1JPSL 2VDKB 3BWUC 3RTQD 5TGBB 1VKXB 1CBVH 2JKXA 4W93A 4H8WL 5CLYA 1FSKB 4L29B 2DQJL 2WCPA 3VX0A 3EJCA 4OBSA 4Y19D 2VSDA 3PAUA 3TWCL 4PH8A 2PNDA 4LKXA 5CCHE 2WV3A 5IFHH 4N8VG 3NACH 5KS9E 1OP5K 3W39B 4NPYB 1OWRM 4UZUA 4ETQA 4LSQL 4P4KC 4G59C 2XZAL 4QTIL 5AZ2L 3SBPA 4ELMA 1LEKB 5IF0B 1KCKA 5D4IA 3EYVB 5E4IA 4NUPA 1I31A 4ZX5A 1ESOA 4U6VH 4DERA 5FDWA 2VWEE 4LCIH 1YEHH 2W92A 1X9RA 4PJAB 3KWWA 4IIZA 4U0RB 3SOBH 4ODTH 4GBXA 1MNUL 4Z8FL 1NPNA 5E99H 4IMKC 4RMQA 3IMUA 1ML0A 4NN5B 2YOAA 2CIIA 3LN9A 1R0AH 2X4SA 2D03L 2A4EA 1H8LA 4MA8H 3K7UA 1FCGA 5AKSA 1JZ3A 3QJFA 3EO1A 3SPVB 4X5PA 3TJEH 3GDBA 3BZEB 5I1JL 3QP3A 1A2YA 3K1DA 3VXME 2R8SL 2JB5H 2RBLA 3TWYA 3E6FB 3S8GB 3FQNB 4Q4EA 3ZR6A 4J7RA 4AGMA 1I8KB 2DOCA 3OXRA 3E6HB 4AYBA 1R3JB 4YDIH 3FUEA 1OK0A 2P8PB 4WEUD 3BP6B 3LHPL 4GW4B 1UWGL 2GUOB 5JHMA 3BXNA 5DK0A 4L4VA 2BSCA 3OJDB 2PXYC 3LOWA 4TS6A 2FH6A 2ZNWA 1C16B 4NKDA 2AQ2A 1RUPL 4P04A 4MD5B 2Y23A 1DQIA 4FNUA 2FD6L 1SXBA 4P2OA 2QHRH 1E42A 1YPZE 3ULUF 3ZJAA 1HZKA 4XVJL 4MA8L 5DJYB 3GUFA 4J6RH 3VGAC 3SN6N 4DIXA 4G8GE 1CN4A 3B2XA 4JDTL 2H2PC 5F89B 2WKGA 1XTMA 3O3BA 1NEZA 4FAAB 5IW6B 1H6UA 1TTFA 4Y4FA 4OFYA 5E99L 2ZTBA 3P73B 5GS1B 2BSSB 3RVUD 5F96L 3BPOC 4HALA 5TDOB 3WNPA 3SDDC 4L9DA 2IH3A 4J8QA 5JIHA 3NPSC 3QJSB 3WFDH 4ENED 3BWAA 3ETSA 4QRPE 1TJXA 3LMJL 3ZVVA 1U92B 2XQYA 3B7RL 2O5ZL 3RFZC 2MCAA 2R29H 5DDHA 6PAZA 2QGDA 4HPYL 4F9PA 2I9TA 4YHNA 1FL6A 1FC2D 2MNUA 1CFTB 3AADB 3KS0H 2KZWA 4H8WH 1ND0A 4G9FB 2WQAA 4IOIB 3TEWA 5DD6A 1LEKA 4KKPA 4NQDA 1WCBB 2I85A 1E7UA 1K6QL 3U1SH 2PCFA 3JV0A 5D1ZB 1WVZA 3QDJB 5ACZB 2P80D 4WAFA 3TBYA 1A4KA 4IU2B 2O26U 3CFKA 1JVOA 2JI2A 4QHLB 4AK2A 4OIIH 2ZX6A 4OZ4B 4GRLC 3QWOB 4JANA 1MCLA 4C59B 4IRJC 4FI8A 1QYGL 3F7PC 2KL6A 3GSWB 4WU5B 4X6BB 2QPFA 5EBLB 5HHXL 3MBEA 4TVPE 3F5WB 4O02A 1TQWA 3GRBA 3ZNGA 5IZ7A 5I8KL 1NCTA 3EH2A 4E41E 2BVPA 1DUYA 2EDNA 4A39A 3C6SB 3DPBB 1CGSH 1TJIL 4FA7B 2V7HA 1HSAB 3IE9A 4K3DL 3T0XA 2L7JA 4JHWL 1CURA 4WV1B 5K93A 4NWTH 2GHZA 4E41B 3L13A 2EZ0C 4ATWA 3B5TA 5BW7C 2YR3A 4Q4IA 2NNCA 1ZANL 3SDXB 4I9WE 1WSST 5I5RA 2F5BH 2P5EB 3PWJB 1YMME 5EC2A 3ZKXB 4BCYA 3SDYH 4F8NA 3N1MC 3U46B 4OI8A 1LO2H 4TUKL 3PL6D 3HPLB 5I9QB 2WO4A 3Q8EA 4LPUA 5DEGA 3LB6D 1Q0YL 3UZEA 5EUOB 3VXSA 5ENWB 1AD9B 2AJVH 2EVJA 2GITB 3LKQB 1OIOA 1E4KC 5A2BA 1FIGH 5D1QE 1J9SA 1PG7H 2HG5B 4P23D 3UTZA 3DIFB 3UAJD 5EB9A 4TUJA 3S5ZA 4EVNA 4F20A 5MERA 2HUEA 5IMMA 1GVIA 1J0ZA 5AWNL 1MIEL 1MCSA 1MFNA 5HGAB 1R33A 1XF5A 2KERA 2R15A 3B5GA 3M1OA 3U30C 5IVXB 1M1XA 1MWAH 3BEWA 2WO2B 3MYJA 3T2OA 2OULB 3VI3F 2P46B 1URIA 1XQ4A 4JRXB 4Y5YA 2PXYA 2F68X 2WZPA 2BMKA 2C8NA 2IAMA 4FZ8H 4YHLL 4JKWA 2C9SA 3EO0A 1VADB 1HH6A 2R27A 1S9WB 1SBBA 3RKDC 1KPRB 15C8H 4F7MA 3IKCB 3S96B 2MQGA 4FHJA 1KN2H 1HT6A 2MEJB 1XTLA 2X4QB 4JM2C 3US9A 1ED3A 1ET5A 3EHBC 3BKJL 4K55A 2XXCB 4BBWA 3FDWA 3BGMA 4UAHA 4XAWL 1YC8A 3QXAB 3CFNA 3UP6A 3CFCL 1BF8A 3AAZB 3X11B 3D3VE 4PLJC 1TO4A 4HJTA 1YAZA 4RFNB 5ACMA 4Z77A 2N01B 1UGKA 4KUZL 1C9SA 2RIKA 4BD4A 3UMNA 5IHUL 5A43C 2JTDA 5E70A 4O02L 5DRNA 3FL7A 5IHWA 4IS6B 4YWGH 5IW1B 5C07B 3D05A 3RJDA 1QAWA 5B3NA 3QZNA 2V5RA 3L2NA 4QJ3B 1BLNA 2BVUA 4FG4A 5FCSH 3UDWC 2CNYA 4R5TA 3FCUB 3EYVA 1L9RA 3T6ZA 3H55A 4X6CF 3M17B 5AZUA 3LYRA 3SE4A 4DGUA 4ELMB 5IEKB 5C0CD 2DJ4A 2D9CA 2WBJD 2VLKE 3P0YL 3B7SA 5JIDA 2YRPA 2YGQA 3SKMB 1WF5A 1JGLH 3V6ZB 2QKIC 3C8KB 3ZL4H 2HKFL 4I7ZC 4J3BA 1QWUA 4BM7A 5B39B 1QFPA 4IMLA 4AM0A 4YMPA 3Q3GB 4AH2B 4G5AA 3F8UB 4KVCH 2CBPA 3QB7C 3ZTNH 1EJ8A 4LPVA 4NZFA 5LJYH 2IAMD 4PRIA 2O30A 1OTSC 2E8YA 4FA8A 1SMDA 2IQAB 3H3BC 3S3BB 5SX4H 3HC3H 2R1WB 5ANMB 1AO7E 4PJBA 3RWIB 3PGFL 4GRLB 4WW2B 1S8DA 5IQOA 1AR1D 1GTNA 4KKZA 8FABA 1RZ8A 2GC4C 3E8UL 3H9SB 2YD6A 3T1FB 2MWCA 3ZDYB 3JZYA 2APWA 2BOCB 4TV3A 1DQLH 4ZRGA 5CZRA 1NCNA 2WQVA 3MRGB 2H4EA 3QSKB 2W88A 2FX9L 2VAAB 3QCTL 3PGCA 1AI1L 1D5IH 3ARFC 3D4GA 4LZKA 1T0PB 4YGAB 4MLSA 2XWTB 3IJ7A 3NJGA 4U1IB 4WUKL 4KKRA 3EZJB 5K9JL 2AQ3A 1IGCH 4E9TA 1NCIA 1QSVA 4HJ0D 3VYNA 2D9QB 4APQB 2YOCA 3L4WA 3G5XA 4OKVA 1EHAA 1KLFB 2G0LA 2BP5M 5G4MA 2MJWA 5T1LD 3V6FB 5EA0L 2MOQA 3QBTB 4G6AC 5DD3L 5DJZB 4ZSOA 3ARGC 4W9CC 5B39G 2G75A 4C56A 4OZGB 1CDYA 3UMTA 4R26H 2P5EA 4ZMTA 2EUXA 2B1HL 2GK0B 3ULSA 3FS9A 2P5WB 5L2JB 1U91B 2P26A 4GAGH 4A7VA 2HT4C 1NGWB 3AY4A 2HFGL 1IM3A 2QGBA 4J3VA 1AO7D 1GGUA 2HJKA 4HUWB 4NM8H 4BDVA 5AQ0A 2VM9A 2NY1D 5EBMA 1F11B 3LPOA 1AP2A 3WY3A 4B95C 3MRDA 5I6LA 1MCJA 5IW1A 3V9FA 1T0MB 1LEGB 3F5WA 3KBHE 3OQRA 4F7CA 4ATTA 2FJUB 3OLIA 1C1EL 2GBUA 4UAOC 5EU3A 2TRHA 5ICZA 4OLZL 1Q38A 1MJUL 1TSHA 1T66C 1DBMH 1DHKA 4QHLA 1I7ZB 3DROA 4IEFB 2J20A 1A4KB 3ARFA 1JHLL 2ARJA 2BDNL 1AG0A 4U1LA 3FQUA 3NSDA 2X4QA 1MWOA 4DT2A 4BH8A 2OMXB 4XN9A 4BFEA 1A6ZA 1X9LA 3FPYA 3LRHA 4FN0A 4X6DB 4YDLB 3J8F7 4AYMC 4KH2A 1I9EA 4QAMB 3OTTA 4Z7WF 1SM3L 4U1KB 4AJYV 3RURA 4UT7H 2ENSA 1I9IL 3AZUA 4ODSH 4Q52A 5C0RL 3EJRA 1L6XA 3DK2A 1SY6L 4G83A 3P11H 2NDGA 2W59A 5G5DB 3BQUD 4WWID 3VDAA 5T3XH 1ZLWK 4B6ZA 4LO9A 4P2QD 3BQVA 4Z76B 5IMKA 2ED6A 3MJ9A 2DWSA 1NCJA 2V5TA 3IJEA 4JG1H 3L1FA 1RU9H 2NY6C 2VXUH 1XCTB 1JV5B 1UM6L 1WICA 4G8IB 5IROA 4LVNB 4KRPD 5AAMA 4HGKC 4M9OA 4JO3L 2QBWA 4X4ME 1A4CA 3GKZA 3PXJA 1NMBH 4QXGL 5EEYA 5AZEH 3BIKA 1YRKA 2VGLM 3DGDA 2GY7B 5EMYA 2WVVB 4GSDH 4LVHC 4CVZA 1OO2A 1F1GA 3CBRA 3GRWH 3O2DH 1OXYA 4P2AA 2Z31B 2X05A 2GUOA 4GKSA 1TOXA 5HYSB 1OL0A 3QYMA 1IBDA 1JTTA 2CKNA 3TP4A 2C1OB 3MLRH 3T6WA 4A66A 3W2DL 1DN0A 1DQTA 2F53E 2ZOLA 4L4VE 3V0JA 4W9EC 3T5WA 4PS4L 1GGYA 4TQHA 3ILEA 5T1MA 5FLVA 1DO5A 4JCMA 2IH1A 4YXKL 3VXUB 5I6NA 4XPGL 3V4UH 1OGPA 3DVNA 4XBPB 5D55A 3UC0L 3GXMA 3S3CB 3QJFB 2XWBA 2QGEA 4HAFA 1RFDL 4YXLH 4Q9QH 1BREA 4IGBA 4H5SA 4AIZB 3U6RB 1U3HD 1IGMH 2ATPA 4I48A 1YNTB 2XQ0A 4XGZA 5IMOA 3U4BH 1T0MA 1L9MA 5D5MF 3WSQH 2P9RA 5BRQA 1AHKA 2QLVB 4HAKA 4JNXA 5G4NA 4DZBB 3MV8D 3EF7A 2RD0A 4TXVB 5K9QG 3MRRA 3HNTH 5FK9B 4AVHA 2FO4B 5F70A 3NCMA 5C07A 3UZVB 4CC4C 3L1OH 4LEXH 4JPKL 4MJHA 4IOIA 3V0IA 2L7EA 5D7LB 3WY2A 3IDMA 1E28A 2H3NA 2Y4SA 1U8KB 3Q2VA 5E1QA 5IHLB 4HWBL 3MBWB 1EGJA 2QQKH 2JTYA 5C0ND 1CS6A 4KTYA 3SE6A 3V5DB 1RZIB 4PQXA 4PW4A 3FT9A 4LSRL 5EZPA 3OV6A 2KUTA 3HI5H 4ZMAT 4M7LL 2ZAIA 2ZWKA 3SJVE 2FIRT 3EYUH 4GRLD 1I53A 5JW4R 4W9JC 1HS6A 1D9KB 1UXLA 1YHPA 1I85A 2LAGB 4J3OH 4OIBA 4N24A 5HDBB 1IKNA 1M4KA 3BH8B 3QG6B 1QR1A 4HIXL 4TSAL 4QI3A 3V52H 1SJMA 4RDBA 3Q2NA 3EJJX 3QIBA 1VEPA 1UA6H 2BSEA 3VNYA 1L3WA 3CXFA 4R4BA 4G80B 4Z78A 2NSXA 5C9JA 4FC3E 1J5OL 3ULUD 5DQ9A 1IAOA 3D3VA 4GKZB 3M46A 4S1SH 5K39B 5F9JB 1CXLA 3GINA 5B3JF 1XR8B 1RJLB 2H6PB 1G7MB 1IKNC 4XMUA 1KIRB 3V5HB 1EZUA 3ZMEA 2ITFA 4XMXA 1D5XA 3GLEA 4FQPA 5K9QI 3QIBC 1EERB 3TLRA 4WRLA 1H8OA 1CFBA 3WLWD 2ATAA 2HG5A 3GSVB 4M5SA 4PLKD 1BZOA 2Y1AA 4YSSA 1SVCP 5IG7A 3IPEA 3QRGL 4NOFA 3UCQA 3TO4D 4BQ9A 2VZTA 4PI2A 2UUDH 4KJWC 3ZRSA 3E7JA 1AS7A 4NZTL 2Y3NA 4MJ2A 1OGAB 1QSZA 3K72A 4P2YA 3X2QB 3Q3GA 4BZ2L 1KLUB 5T5FL 1X7SA 5EU5A 4EUPB 3GDCA 4LCWA 4UB0L 4JGNA 1S7VB 1TVBB 3VXTA 4ZFZA 4AE1A 4P2RA 3ARGB 3KXFE 5IEKA 1BOGA 2BK8A 1JHTA 4MZRA 1AY1L 3H4HA 5KANI 2D31A 4LSVL 2WZ0A 4W9FC 2CM6A 1B4JH 3KNBA 4NO0B 2MCPL 3EXJA 1BIIA 1N26A 4XHJC 4XXCA 5H37H 1I1AB 3L2LA 3BP4A 1YLBB 4M5ZL 3C87A 1NBYB 2J6EA 2Z7YA 3IWVA 5CR8A 1PCSA 1T0NB 3QNYA 5KBLA 2ZP0T 5I6XB 1VFBB 3ZHDA 1BZEA 3DX8B 4Y2LA 3ROOA 1U42A 2IAND 3ECBB 3HNSL 3VJ6A 1BX2B 5JHAA 5MEND 1JZ2A 2R69H 1OD9A 4MZIA 1KZYA 3IFLH 2C4XA 3TYFA 3L9RB 2XPGA 3NPSB 2Z8SA 3INOA 4YDKL 5HHNA 2FQDA 4KKBD 1EEZA 4ZPTA 4DEUA 5A40E 2P1YA 3ZBMA 3NIDB 1QR4A 2R69L 2VMDA 4BFNA 3QR0A 1W0YT 2FBOJ 3QRFM 2QTEA 3ARED 4DO6A 4J4PD 3GEWB 1TJGL 3EO0B 4FNQA 3CH1A 1MELA 3GSNA 3V6FA 2BMKB 2QJDA 4ENEC 4U1MA 4NQCE 3H9HA 2VDNL 2RACA 4NZUL 5JA9A 2UXGA 1UWFA 3MLTB 1BXVA 3AUWB 3I9GH 5HYJE 2F54D 4MQTB 1XB6A 4GAJH 2VM4A 4B96A 2WVSA 4DTGL 3RAJH 4HIQA 4ZXBA 1AY1H 2PKDA 2EUWA 1K8IA 2EYRB 3KGTA 2WXHA 1OAXL 1RZQA 2YD8A 5D8JH 1FVEB 4J27A 1MFCH 4N8CH 2R2EA 5IJVA 4YR6B 2VR3A 4PSRA 3QHFL 3ZE2B 2JXMA 2ZUVA 3N1GC 3UL4A 2LU4A 2CPCA 4CC1A 5JR1H 2BOCA 1SXAA 3NCYS 3TNMB 4XXDB 1MF2H 5E8OA 1JMZA 8FABB 1A64A 1HKLL 1OAKH 5T3XD 3V10A 2JF1A 5E94B 3SKNA 1KCWA 3VXMD 1MW1A 3QRGH 2A1WH 4LMQI 1DQQB 5F7WC 1RZJH 4J2XA 2J6EH 4HIIB 2O61A 2V3DA 5HY9A 2YSTA 1JUFA 1S7QA 1QEXA 4JR9H 2F7RA 2X0UA 1CDCA 1QNIA 1T5WB 2CJUH 3BKMH 4PB0H 3GMMB 3PCYA 3GSQB 4X8JB 2HKAA 4D9LH 1UKTA 3O6LL 2V17H 3D2TA 5AUMA 1MQKH 1TJMA 2R1XB 3EYQD 1IL1A 2FHFA 2VDOB 3HG0A 3WN6A 1AQMA 3O6KH 4JRYE 5DHXB 5B3SB 4AIOA 1BAFH 3FB8A 4QTFA 2GBVA 1BZ9A 1FLTX 3FTZA 4U6XA 1SZNA 1U58B 3MRLA 1I7RA 4MZ2A 1UH2A 2DWXA 4MRBA 3QQ3B 1L0QA 2IVFC 3QNFA 5JIMA 1ET8A 1GC1L 2UXVA 2IQ9H 4UQCA 4X4YA 3V79C 4DJMA 2EDTA 3ULUE 3VGFA 4N3TA 3NEOA 3PWUB 2AEQL 4P5KB 5ERWA 4PYHA 2WLJA 3BSZH 4WHTB 3V0HA 2GI7A 2K6WA 5AW9B 1TQCC 2DQ6A 4A7TA 6FABH 1A5FH 1G9NL 3APNA 4LSRH 1A7OH 1KGYE 4M43L 1A3QA 1JFQL 4JFWA 1T7VA 3UTSE 4O2EA 5G2NA 3GBLA 4PBVC 5JXAL 2AXHA 5I1CH 1A1MA 3K0YA 5F88A 1GMEA 3MLXH 1UOVA 4TNWK 5BZDB 1SDDB 1TQBB 3HE6D 1UXWB 2WZAA 3OAZH 2ZX5A 3II3A 4GG8B 3L1OL 5DA0B 5J57B 3LNGA 5F9AC 5C6TH 4X6FB 2AQQA 1FG9C 1MRFH 3KL5A 3QJXA 5HHME 2YXMA 3A4AA 1NAKL 1YY9C 2C9XA 1E43A 1Y6NR 4KNSA 2WP3O 2JIXA 4UOW1 4MNQB 3EH3B 3IDNA 4TTDC 4WFEE 2P24B 4XBEL 4LCCB 1XIWC 3T4AC 5DO2C 1YQ2A 4JMXA 5EEZA 2I69A 3G7TA 2CRZA 2ITCA 1CWVA 2Z31A 3I85A 2UY6B 5I28A 4AT6A 1NEZG 1RIUL 3POHA 3UP1A 1OTTD 1I8LC 1VEOA 2UY7A 2ZX7A 4X7TB 5A2KH 3IGLA 1W2KT 3QAZB 1N0XL 1NBQA 1OB0A 2Y0SA 4FKHA 4PGCA 4ABUA 2F1AA 5IB1B 4GRWH 5JXAH 3RDJA 5BOPA 1KXVA 3IDIB 3QIWD 5L8JB 5AVRB 4A63A 2RA1A 3ZE0E 1J11A 2ZCKH 3P40A 3DX7A 1A7OL 3TH4T 4FULA 5FYKD 3KWXA 3W2DH 4GLRI 1AGCA 4JY6B 2ROXA 5LCVH 2ZWSA 4PJ7A 3AG2B 3V95A 1SDYA 4Y4HA 3M6DA 5FO2A 1M6OB 1KLGA 1MSPA 4I9WD 2ENYA 4JVWA 4OLYL 3VWJC 2J8UF 4KOCA 4OD2B 4AKQA 1JYVA 1TF4A 4G9DB 4ADIA 4HKBA 4UV7H 1NGQH 3MBWA 5FLUA 1TVHB 4KJYB 4TSBL 2GSGB 2IANE 3QGVA 1ZVSA 1EFXA 1UQSA 1UJ3C 2OMVB 4PWEA 5E1AA 5KWYC 2BP0B 3F7VB 1VZGA 1D7FA 3HUJF 4GP5B 1F58L 3RWHA 1VGEL 3GS7A 1MLBA 2QVMA 2V17L 2ZXCA 1L9NA 1JNJA 5T3XL 3LEXB 1P2CB 2CJUL 4PB0L 4QHPA 1MPAL 1H9DA 1T1XA 3NAAL 4PJHF 4NC2B 5E9NA 3SE9L 3VMPA 4CRPA 1MFUA 2FQEA 5GJSH 5IMOB 1FRGH 1S78D 5KBKA 3NZ8A 1AQKH 2YD0A 3OKDA 5E2TL 2EJ1A 3PP3K 1EEUA 1T0NA 2Y5QA 3QNYB 1YYCA 1KFAH 4RLDA 3TCLB 4AV4A 1W6LA 3O3EA 3I02B 4JN1L 1A21A 1FC1A 2EVHA 4Z3IA 3V9CA 4JRXE 4JDEA 2BNRA 3WJJC 1JRHI 1G1YA 1IZJA 3TX4A 1LP9E 3FFCE 1HVXA 1KFGA 2XNAB 3EYQC 4N8CL 3BLBA 4GKNA 4UT6L 4JMNA 3QFGA 4XNQB 1Y1DA 1WA0X 3UGUA 5KVGL 3HMXL 1JUFB 3IETA 1HCVA 3T0EC 2LVCA 4JZNA 3VXTB 5GRXG 1CUOA 1DBAH 3Q2WA 3RWGA 4JO2L 4GKSB 4PGZA 2OCJA 3GUTB 4AI7A 1C1EH 1C8QA 2CKBH 2JQMA 1DJYA 2VABB 1QZ1A 4FFWD 2VXSH 4CVZB 2AQ1A 4NZUH 2WQRA 2WVUA 2EE3A 2D7NA 2YBRA 3CXHJ 3LQZA 2EUZA 1YJDC 5DZNA 2WVTA 2CRIA 2EDKA 4HSQA 3ZDXF 3CFJB 3IYLW 1RLWA 1LNUB 4ZAKA 3II1A 1A6UH 1M56B 1UB5B 3STBA 3IGKA 1WUZA 2YKLL 5IJVB 2ZP8A 3K5RA 4O2CB 4HUVA 1JZDC 3MBED 4MAYC 4NBXB 4AUUA 3GMNB 3V0WH 1FVCA 2Y1VA 1Y0LB 3DXAA 1NCWH 4YC2C 2E7LC 2AKRA 2OJEB 4NRYA 3MREB 3IFLL 3MU3A 3H8NA 3KPSB 3AS2A 5DD3H 5EU6B 1SHSA 4R9HA 2VLRE 4QRAA 2NQDA 5EA0H 2BXZA 4AQAB 2XZCH 3OJDA 1YMMD 2OYPA 1ZJAA 2K4AA 4M48L 1C12A 1T03H 4XE0A 1S9VB 1IC5L 2WXMA 5DUPH 1DDHB 1IGCL 3GI9H 2L04A 3S9DB 1A0QL 4WUKH 3CBKB 3QUYA 4K3JL 3GHEL 4M6MH 1N3NA 3T9WA 2FX9H 3PFUA 3ZKSD 4GG8A 1J8RA 1M7IB 4GAFB 1HSAA 4P8QA 2NY0B 4OF0A 1OY3B 5IROC 4NT6B 4Q6YA 3GSRA 1JYXA 3HG5A 3PPEA 1NL0H 3ATAA 4DKAA 4TN9A 3MRFA 3S3SA 4CNIB 4QKXB 4YPGA 2CIKB 5EO9A 4X98B 3QIWA 1EVTC 3VI4E 4BZ2H 2K7QA 3DX4A 3SOTA 5LN4A 4L2LA 2PTUA 1VESA 4ODXB 1FGVH 5DWUH 4NQCA 3EJYD 4OLWH 1DVXA 2WKOF 4IU2A 3D18B 3A6CH 2FQGA 4HZ1A 4LMQE 2AITA 1SBSL 4PJXF 3BVNB 5D9SA 3ARXA 4M29A 4G1MA 4PTTA 1S7WA 4Z7NE 2A38A 3QIUB 2ENPA 2Y7QB 3WS6A 1G7JA 4A6YL 5F3HA 2R2BA 4S1SL 3ZL4L 1U8IB 4B27A 4IQHA 3BPNB 3RKDD 5KUKA 1WWBX 3RFZA 4F80A 4OD2A 2W8CA 4ACTA 4Y5XC 5E8EB 3WE6A 4ZZFA 3QNZA 4DZ8A 1G7QB 1BJ1J 3GMMA 5GSVB 5C0DB 2UYLB 5DU7A 5C09D 1FF5A 5FDYA 2BSSA 4G8GD 4K5MA 4D8OA 2BRRH 4IIQA 1UFUA 5L2KD 1BOYA 1HXMA 1QPKA 4N2EA 1VADA 1NEZB 1IGIH 4KO7A 4A7UA 2GJPA 4ZW8A 1S7TB 4M7LH 5JA8B 1OALA 4I85A 1FZOA 1GYVA 3N43B 2VRKA 3VGBA 1FDLL 2P52A 2RB8A 2ADGA 4PGCB 4L9LA 1BD2E 2F58L 2WYIA 3O0RL 5I16A 2X1OA 1K8DA 2E59A 3ZRFC 3M45A 3LS4H 4GMTH 2X12A 2R2EB 5CJQL 3BKJH 2OKMA 5HYEA 1RUKL 3VFPA 4B7IA 4E9YA 3DIFA 2X4UA 4PVMA 2XG5B 1FNAA 3D4CA 1THCA 3FFCD 2I5YL 5D2LA 2BWIA 1KXVC 4V1DA 5IOPB 1I4FB 4ZNEE 2X2YA 2DKMA 2P3YA 1B4RA 5D5MB 1M7UA 1I8KA 3WXWH 3W5NA 1AC6A 4X5QA 4PV8A 1GZQB 4KKNA 3B9VA 4Y4KB 2OCCB 4LKCA 2YGNA 2VABA 1UXWA 3L3GB 4NO5B 3HBPA 4NXSA 3VFSB 4XODA 2X6MA 5AWNH 3LIZH 3RILA 4E5XA 4BXSV 2NZIA 4FRWA 1MW0A 5E6IB 2VNCA 4WZ9A 5L4MA 4QRQB 2F8OA 1DP0A 1U36A 1HL9A 4PUBL 4GRWF 1Y1UA 5D7LE 1HKFA 2V7HB 1H6TA 1JZIA 5KVDE 4G43B 3QZWA 2CA4A 4ERSL 1DUYB 3V2AR 4ES8A 1FYTE 4I3RH 5DQJB 3FH5A 3O3EB 3MBEB 4WW1B 2NT0A 3MRMB 1CR9H 4QGYA 5HDBF 1CXEA 3O2DL 2EO7A 2VXVL 5AOKA 3ULVL 1D6EA 4FQIH 4GSDL 4OZGE 1KV3A 3RUGF 4U6XB 4KVNL 3VGHA 3MRDB 3WV0A 3I3EA 4KROC 3BPCB 3P3SA 5JHLH 4KU1A 4H2CA 2K3HA 2Z3FA 3STZB 2Z35A 4P5RA 1A4JA 4RISH 3FW6A 4CU8A 1F3JA 1IFRA 1RU9L 2OQJB 4GMSH 5E1IA 2DV6A 2VSCA 3QWNA 1A1OA 4K8RD 4ZO9A 5E8NA 3DO3A 1FPTH 2OBGA 2OZ4L 2X40A 4HMDA 1S9VA 5BS0D 4OCSL 5DA4A 5A2JH 5ILTH 1WD8A 2R0KH 1UJTA 1QYGH 3PRZA 5C0AB 4TTGA 4S2SA 3S4SA 1EBAA 1KENL 2FJFB 1IC1A 1KT2B 4HMEA 4Q0XH 2F54B 2RFXA 2FATH 2I24N 4IBSA 5E1GA 5C0BA 1RZPA 4MJIA 5T33L 3G5XB 1NCDL 4OKVB 5L0QB 3A5VA 1WLHA 1FWXA 4PRNB 2B3RA 3OAUL 3K91A 1VCBC 4NQVA 4Y4HB 2ZCLL 1PZCA 2OTPA 1JL8A 4JM4L 4FLOA 4KITB 5JHDE 5GS2D 1IBFA 1DEDA 1Z7JA 2ZWNA 3KPRB 4FZEL 1DUZA 2D8KA 3ARDC 3HC2A 5L7XH 3OM3B 4PY7B 1ZHLA 3Q13A 3G6AA 1QFWH 3W0WD 2D0HA 4UF7C 4XVSH 3LVTA 4QNPF 2FX8H 3ISYA 4LCUA 3W9DA 1S7SB 3GJFA 2HSIA 4R3SA 2W9EL 5TDPB 1CL7H 1E27A 5AVZB 5I2IA 4R96B 5IQ9B 4LL9A 3JV5A 3PJSB 2EDHA 5SWQA 1KJ3H 2ITCB 2ZUQB 4LSTH 4S1DC 1R17A 5F9OL 1I82A 4G7VH 5AW1B 4BK4A 4CILA 1UOKA 2QKIB 1GYAA 3SQBB 4WTXA 3LDBC 3QUXB 1H19A 3LNIA 2UYLA 1DQKA 3HLAB 3ARVA 4WI0A 1ZGLB 3FU0A 3QNZB 4AG4H 3GSUA 1F90L 1URLA 4IHOA 2IMMA 3S8FB 1HTYA 5GISH 4B7LA 4ALAL 4B9IA 1R3HA 4F33B 1N2RB 2B1HH 2D2OA 4JO1L 1JAEA 5FYKL 3P9LB 4IEFA 1UB6A 4G8FB 1N8ZB 3IVKA 5IVOA 3C8KA 4PVBA 1G7IB 2DM4A 2WINA 4GO6B 4R0LB 4YHYC 3MRPA 4F7PB 4FF9A 1N5YL 1R3IL 4ODUB 4M7KL 4PTTB 3QJVB 3BPNC 5CFHA 3NBNA 4BCZA 5D7IE 5L8LB 1TKWA 4KDVA 4LBEB 2HN7A 3L1GA 3O6FD 2WK2A 2BY2A 5KS9B 4WO4C 1GZHC 4YFEA 4X42A 1JXGA 4X7FC 3RKPA 4YOKA 4E41D 1XR9B 5HDOA 3RVWD 8PAZA 3LEVL 1JYNA 1QUNB 3C2SA 5LQBL 2H8PA 1JTPA 1MLBB 1PAMA 4MYPA 4MXVE 4F7EB 1H5BB 4U6TA 5I6PA 4HIEB 2X1WL 4JX0A 1UXMA 2P8LA 3VSUA 4QRFA 4H40A 1XBRA 3TJEL 5GRJH 3W3BA 1XH2A 2BERA 4BSJA 4Y16C 1ETJA 3UX9B 4IU3A 4POZD 1P7KA 1L0PA 2D03H 3E2HC 4OBRA 1T66D 3AT0A 1TT6A 2L3BA 2BVQB 2X2UA 1HHHB 4MA1B 5DRWA 2C26A 2Z0BA 2IPUK 3IFOB 3TF7C 3PDOA 3WFZA 4OLVL 4HYTB 4P5TC 4XPAL 3Q0HA 3UXFA 2IDQA 4DP4X 2A6KA 2W80C 4U6VL 3SKOA 1OE3A 1OP3K 2FYVA 1JGIA 3GIZH 4HZLA 5TD4A 4C47A 2I60H 4MMYB 5I1KH 2ADYA 2HWZH 4NIKB 3OHXC 4WFHE 1IBYA 4GFXA 3NACL 3GTTA 3OF6D 2E56A 4KVCL 4JRXA 4Y5YB 5I16B 5FKAB 4ZUVA 3SPIA 2FH8A 2VQ4A 5F21B 3OMAB 4NJAH 3ZMNA 2PTTB 2JWYA 3VD7A 1MIMH 1BECA 4FQXB 5KBPA 2V3EA 4E9VA 4RGMB 2BHUA 3KGSA 1F6AA 3PGDB 4RIRB 3MR9B 5D7LD 1UB5A 4KKAD 1JZEA 4H8HA 1ZA3A 1I1FA 1NCBH 1NFDE 2HLFD 3SGKA 5DK2B 4FXKA 1HJCA 3BUQA 3FUJA 4F58H 1P4UA 2Q3AA 4WJG3 4QHMB 1DQJA 4JS7A 3MV9B 1XIWA 3T4AA 5CF3A 3GJFH 3HRPA 3LNHA 3L3DB 2B9BA 3QI9B 5C09A 1LO5B 2N0KA 3RZCC 4KWUA 4AQ1C 3IXAB 3PE9A 4ZJ9A 3UIZA 1SXSA 2Y5TA 4HHAA 5CZXC 3VTAA 2X6AA 5BVJB 2DDQL 3FB6B 1TCRB 4DF9A 5H2BB 2VXTH 3B2VL 4BZ1H 4LQFL 4R6UA 4RAHA 4LF3A 5GJTH 1E4HA 4IJ3C 1BZDA 1CO1A 1U8QB 4MCNA 1CD1B 3P30H 3SBWA 4KK6D 1ID2A 1KBVA 1MWAB 1JWMA 3WEXA 3HFMH 2GKIA 3QORA 4UQAA 4O5LH 3B3IB 3NFSH 4G9FE 5F1KC 3OAZK 4UCFA 4MMXB 1F1DA 1YPZB 2JVUA 4HV8B 1KDIA 5JPMA 3B1UA 4L4TD 5D1XB 5LAXA 4E9SA 1L7IL 3AQZA 4MHHG 4H4NA 4AW4A 3QWRD 5DLML 4N1HB 5FYKU 2IGLA 4M6OL 4EI5B 1B3JA 3ISWA 1U8NA 2WZ6A 5D96B 3MCYA 2HJKB 2O6PA 3LZFL 1MIEH 3GBDA 3OKEB 3PPSA 4HUWA 4KZCA 5T1MB 5AKRA 4ABVA 2NQ3A 4WI0B 3IXTB 3C5XA 4DVRH 3V4PB 4Z7OF 5DWPA 1NFKA 3O4LD 1QTPA 3QUZD 3KWTA 2AK1H 3EOAB 4R7NB 1EXHA 4ZMZA 2HFEA 2VCOA 5IT2H 3KLHC 1JCVA 3VI4A 1A7NL 1LQBC 4N2FA 3SD5A 2ZXBA 3NQKA 5IB2B 1V54B 3SQRA 5EHFA 4Y19B 1TEYA 1NMAH 4OGZA 1PKOA 3Q2CA 3HBZA 4YBQC 4H88L 2CKBA 1EHNA 4TUKH 2XCMC 3FRUA 3SDYL 1N7MH 1FZMB 1CTMA 1MCWW 4N4YB 1YY8A 4PY7A 5I26A 1A6TB 4AW7A 3FFDA 4ZMPA 1I7UA 4LNRB 1OTTC 4TNVK 4F92B 5I76B 2OZNA 3CDGB 1YN6A 2AXWA 4YHIA 4Y16A 4YDJA 5TE6L 3T09A 3A23A 4PMEA 4PW9A 4D0DA 2HX8A 4K3DH 4PRNA 3DX9A 1CGSL 5CHNB 3Q6FB 5IKCB 3GS0A 4L8CB 5HHQB 3AACA 3BXNB 1Q1JH 4L8DA 3RUGA 3NIGB 1T21B 2OP4L 2PMZA 1WRFA 5EZIH 4XC1H 2CO6A 5KVEH 4JQIH 4MQ7B 3CIQA 4UU9A 1IJ9A 3ZYZA 3T08A 1WQVT 4NN7B 1JNHA 3JSSA 4NP9A 1UD6A 4JBSA 2ERJB 3BE1H 1YMMB 4GIAA 2E7MA 3QXTA 1K4DA 1G9ML 4OR1A 3TO4B 2BVQA 4HH8A 1HN1A 1Q0EA 4F3FA 2XQBL 4OZHE 1ZT1B 2DYPD 2PP9A 1XGPA 2UZXA 4QHNA 4M56A 4NSKA 3CVDA 5I8CB 2WXPA 3DRTB 3KM2A 1WO2A 1YEEL 3JWDH 1GW6A 1QKZH 2P5WD 1EVUA 1VACB 3V6OA 2O5ZH 1P1VA 1EDYA 1R4XA 5ABDE 2F18A 2IXQB 4LFHG 3AU1B 4N5EC 3SGJA 3U1QA 3TT1H 2LLGA 4YEFA 3N41F 3U7WH 1ZWIA 2YA1A 2ZG1A 1Q8MA 3B2UD 3MXVL 4NHCL 2X38A 1AFVL 2ZSWB 2HH0L 4OSUH 1RZKC 5CSZA 3TPUB 3ZIMA 2HN7B 2NT1A 2CLZB 3MJ7A 3TURA 4JRYB 4U3SB 1G1CA 1IGTB 3SE8H 3ARGA 1U0QA 2YGVA 3ZL1A 1B4TA 2NX5D 1WAAA 4J6RL 4G5ZL 1LDPL 1X5LA 1E4XH 2EO1A 5E2JA 2OFQA 2GSIB 3A4EA 2QHRL 4S0SD 4DQAA 5GHWH 2CHNA 1KCBA 4JFUA 4R8WL 1LO0L 2ZJSL 1KC5H 3KVPA 4IRJD 3V0EA 2NYZA 4P57A 5JPNA 3KGUA 2HTLD 2BP3A 1UWGH 1XO8A 4D0CB 3HLAA 4LVEA 1FFTB 2M26A 1KJ2B 3ULVD 3A4FA 5FWQA 2VR4A 3KPPB 3QZOA 3CFIC 4OGAC 4Q89A 5C0EB 4TLTA 1II4E 25C8L 3QEHA 1IBHA 4DP7X 1R3KA 4N2LA 1MCBA 5SWQB 1L0XA 3SE3C 3OLDA 1N10A 3L3HB 1IT9H 1MG3C 3QEQD 4XCFH 3IMSA 5F72S 4HMCA 5DQ9B 4XPBH 2R8SH 4WJ5A 1A1NB 2LU7A 2ZPKH 1HOCB 1AZRA 4ELME 1F3DH 5DJXB 4UM8A 1KPUA 3KD4A 3P3TA 4LLUB 1BM7A 1T04A 2GIMA 2ZNXA 4Z7WB 5F3BB 1DBKH 3X17A 1K2DA 4TM9A 3P4LA 2F2HA 2DQFA 4Z8FH 4N2IA 1YN7A 2C3WA 4ZUUA 5HI3D 2C1PA 4QTHB 2BS9A 5F44A 2Z31D 2NTFB 3A67H 4RGNE 1S9KC 4PHXA 2EH7H 4ZNCD 5GGSA 5CLTA 3ULUH 1M9WA 1Y18A 2GPZA 1DJHA 1RULH 3BZEA 3QVAA 2Q8BL 2FEDC 1JYWA 3TS8A 2WBKA 5FGCB 4FERA 3TWCH 3ARTA 1E9QA 1X7QB 4AY0A 1A1OB 1FZKB 1SF5A 1W0WA 1EEZB 4GT7A 4QRSA 2WZPD 1INQA 1SDAB 2FECI 1NANI 4CGUB 1JPSH 5I8EB 2OW7A 2V9UA 4ZMYA 4GBXB 4PJHA 5BQDA 4Z95H 4PJIE 2DKUA 5I0XA 3E9UA 1U8PA 5DHVH 1F4WH 4A38A 2UWEA 2ZPKL 3N06B 5D7IF 1T6WA 2EADA 2I32A 4NI3A 1DVTA 1OF2A 3P0VH 3EOBA 3C9NB 3E1ZA 3OKLB 4N0UB 5DJ0A 2WCGA 2C9RA 3VRLE 2B15A 1T80A 4KZ0A 4QMEA 1GA2A 3QEQA 4L1LA 2WLIA 1QLEH 4IRZA 4KDTC 4NX0A 2PCFB 1Z6JT 4Q58C 3RA7L 3L5HA 1KTCA 1EHLH 4JPQA 4FXGB 4RX4D 3FTXA 3HFFA 1HU8A 3S6CA 3VVWA 3MROA 3KM1A 3P4NA 3MJ9H 4HHAB 1J1PH 2CBOA 3QDMA 5ETUB 4KGJA 2BOLA 5DYOB 3X1EA 1NBVH 5GPRA 5C09B 2V7NB 4Y7MA 3I6LE 3TJHC 1D9KC 1S5HB 1IQDA 2Y6SD 4PJDF 4ZUSA 5IQ9A 3NCFB 3VGEA 1RJCA 5EOCL 4AQEA 2GTQA 4N87A 4EF3A 3M1BA 5DHVA 2YAEA 4FXKB 4YX2H 3E2HB 4PJ7B 2JXMB 3MLYH 3UROR 4FQJL 1S2EA 3U36B 3CC1A 2EYSA 4Y16B 2D2CC 4DW2H 4CUCA 3LXCA 2DL2A 5MERB 2BVOA 3KJ6H 2CQVA 2VMEA 4YBHA 5D7JD 4IBLT 3KPSE 5IHZB 2DS4A 1IILE 4ZAKD 2E0PA 4HDIA 4Y8AA 5C8JB 5DJXA 1YY8B 5E2VH 4B3EA 2Z4QB 1JZ6A 1OD7A 2KC0A 1LNUA 2O6CA 4EBQH 1OAYH 1PYWB 1JWSA 5B3JE 4AX3A 4P2OB 2J3SA 3CAFA 1FE8L 5DSCA 3KLQA 3PV7A 1U2CA 3MLTA 4KK8C 5HTSA 4DGVL 1RURH 1KTKE 4P46C 4WW2A 1JNLH 2Q6WA 4HPHA 1X5GA 2D0GA 4KX7A 2OR9L 2P44B 4K7FA 1ONQA 3VACA 4FQ2H 3UYRH 2AF2A 3RWDA 4L37A 2A4CA 2ZG3A 3GK8L 3DC0A 1RL1A 1OCCB 3RY4A 4X7CC 4LVOB 4IKLA 2OP4H 5EZIL 4GS7B 3S3PA 1J86A 3VU1A 2VE6B 3VFUB 1QRNE 5BW7A 1EWHA 1MAMH 3LSOB 3U0WH 4JJHA 1U8MB 1JD7A 3MJGX 2HZHA 1U8OB 4PJDB 5AYQA 1SFDA 4ZMOA 2AXGB 4TNWF 1IJNA 2GJZA 3BP5A 3EGXA 4HISA 2Q8AL 4JREB 1F8TL 1TQTA 2G5UA 1EEYB 4JDZB 3VGDA 3GNMH 1ZLEA 2WOBA 2YQGA 1TZHB 1H6FA 4W4OA 1U3HC 2DQEH 3TPUA 4M3JA 1T1XB 3TBYB 2YAHA 3VFOA 2N7AA 1QABA 1DLFH 5I18H 1NBCA 1UVQB 1G0XA 4X8XA 2KBGA 3HS0B 3R8BB 1KIPB 3VI3E 2NUTA 1TXKA 2CIKA 2F54E 1I7RB 3BKYH 4FNSA 1MRCL 4IRSC 4H0LC 2GSGA 3KWVA 5A16B 1U30A 5DTFA 4C56B 4IRZH 4GXVL 2FRGP 1KSRA 2LABA 2YC1A 5DQDH 5H8DA 1KBBA 3BGMB 2B9AA 4L8SB 2QADB 3T0VA 1OWWA 2Y9RT 5AVQB 3VI3B 2YWZA 4JKPH 3ZSSA 5FO8A 5L88H 3G04A 3KLDA 3NESA 4LCWD 3W81A 3GSXA 3VXRE 4WEBH 2ORBH 2J88L 3BZDA 1XT5A 1G9EA 2B5IB 2AANA 4HUXB 3ZYJA 4NAMA 1JZJA 4XN2A 3FOLA 4PCYA 4MQXC 3WIHH 1Z9PA 1CFQA 2VC2B 2OW6A 4LE8A 1I1AD 5KYYB 3ARWA 4UQIM 1KEGL 4XI5D 3OKOB 4NO0D 2EXTA 2N4IA 5GRYA 4UOW0 4LVHB 1PU0A 3DYOA 1CU4L 3QJOA 1PZ5B 4UAOB 2HRPH 3K6DA 2Z8VC 3OZKA 3J2PA 3WN5B 3IFNL 4GKLA 4P2OC 4WSJA 3RI5F 4FJYA 4MNGB 3EG9A 1QFOA 4RBPH 4PRAB 1LMKA 3T3MB 4P5TA 4CSZA 3MACL 3CSYA 3RDTA 1LEIB 1RUQH 3HE7C 3LQAH 3VXSE 1M42A 4P59H 3M88A 2W9DL 4DKEH 4UILH 5DEJA 3DSFL 5B39A 1XD0A 2GSIA 4PSPA 4FCHA 1NCBL 5KJRH 1BVKB 4JHZA 3UGEA 5A7EA 2I9LA 2CK2A 3BJLA 5HHMD 5IW3A 3MO1A 2YMXH 1B2YA 1J8HB 2PCYA 4U3SA 5HGGS 5BV7L 3KMDA 4FA6A 1E0OB 4G6MH 3ZE1B 4QYOB 3DK0A 1U8HA 1JK9A 4WKZB 1ZK9A 1MIML 2EC9U 1WT5A 3RTQB 2YPLB 1E4JA 4K73A 4U2YA 2X41A 1FORH 3VUAA 4AGOA 3IS0X 5GRVL 1QRNB 1CE6B 5I73B 2MQCA 2EE0A 3FU5A 4M1CC 2C34A 4IBYA 5DRNB 4JGMA 3HG3A 5B1JC 1I1YA 1T4KB 3GJEA 1CIDA 3MRFB 2O4EA 1IZKA 2C5DC 3OKNA 2VZ1A 3WI9A 5I30L 2D3LA 2DQHL 3DIDA 4OGXL 3BH9A 1UT1A 3UJIL 5D1XD 1FJ1A 5DHYB 5ECGA 2W9LA 2VLJA 1D5MA 3KW8A 1YO4A 2VLKD 4ANXA 1NGZB 2AXFB 2OJ1A 4URKA 1R34A 3I50L 3SDAC 5TDNA 4HJIA 3RWJA 4N0CD 5D2LE 2WXKA 1U91A 5MEPB 3AQYA 2VRQA 2BP0A 1I3VA 2PO6D 4FQ1H 1QPPA 3T3PF 1XSJA 2CHDA 2PPAA 4BRVA 3BHBB 2G75B 6TAAA 2HA1A 4RAVA 2EE6A 2IFGA 5DJZA 4WHYH 5JW4Q 3QUKA 3DMMA 1GZQA 3ETBJ 3G6JB 2B59B 3FT0A 5LQBH 2ZQKA 5IR1B 3LEVH 4ELKA 1KTLA 4X6DF 3ARDA 1H3PH 2KQNA 4NRYB 3NN8B 1OPGH 3CN3A 1WGOA 2XOTA 2BC4A 1T1WA 4P23B 1WC7A 2BVOB 4HIJB 2Q7AA 3GMPA 4LCCC 2GJ6E 2CGRL 4O4YL 5F7BA 3ZKQD 2G9HB 3VFGH 4PJIA 1RIHH 2CGZA 4I0KA 3CQQA 5A2CA 2X5PA 1S6NA 4EI5D 4TNGA 4K5NA 3GO1L 2RH0A 2DYRB 1C5CL 1DFXA 3HG2A 1TG8A 1E50A 1N6VA 2C3XA 3RVTC 2G2PA 3O0LA 5CEZH 5EIQA 3FU7B 5I17B 3FQXB 3NP4A 3TF4A 4WW2C 2FZ3B 1ORQB 1RKRA 4QDGA 1W72H 1QASA 1F0LA 2FLMA 4GUPB 4X4KA 4NPJA 4HSAC 1T6BX 1X4YA 1CVRA 1VERA 3R18A 2W9EH 4OI9A 4JGUA 3HKZA 2R39A 4L4TE 3KYMB 2MCG1 2DBLH 1CTOA 2WSDA 5BMFL 2DYSB 1ORSA 1E28B 2H3NB 4X80L 2B14A 4TNFA 2G30A 4UANA 3NZUA 3Q8CA 5FX3A 4MA3A 3ECQA 1MREL 4B9JA 4C57C 1BVLA 3HS0A 2ZF8A 3HHRB 4G1MB 1J5HA 1RZKL 2H1PL 3F7RA 4HETA 3ZT7A 4DN3H 2Z93B 4JM4H 1ZV2A 3BDYH 4LRNH 3W0WA 2ZUXA 1GCFA 3QZWB 1UM4H 3PAYA 1ZXQA 2IALA 4HT1L 4R4ND 1IIIA 4PJCE 5I74B 4F93B 1N6UA 5D70H 2C9PA 1TR7A 2XX1A 2GT9B 2ZCHL 5E8PA 3HG1A 3D6GA 3G9VA 4AYSA 5ILTL 2XXGA 4F91B 2P8MB 2YXVA 4LU5L 3D4YA 4QT5B 3LQMA 4L29A 3QPQC 1MY5A 4JFDE 1UATA 2G4EA 4HHGA 3T0WA 3VXUA 3P4OA 3E8VA 2HRHA 3QS3A 4RISL 5AW3B 3PNRB 5BS0A 1NEPA 4P9HL 3MOAH 5EC1A 2VE6A 3VFUA 4A7GA 1LMIA 4NFDA 5FYKE 1CLYH 3D34A 3WJJA 3ZGIA 4ONFL 5GGUB 1S5IH 4ZUUB 4J8RB 1PZBA 2XJLA 1BQHA 1DVSA 3QE5A 5I1DA 2JMRA 4MJ5B 1V55B 3NJNA 4GT0A 4AYEC 4LHJB 3R7QA 3FULA 4M4RA 3WKPA 5JORA 2CMRH 2XC8A 3FZUD 1PZ5A 3D9AL 5GGQH 3BGFC 3H0TA 3BI9X 3PJLA 5GRUL 2I7SA 2A73B 4AQAA 1ZDQA 3BIKB 3N9GH 3ECWA 3GD1C 1Q9WA 3IDJB 2YPLD 2NDFA 2MPVA 5EWIH 5KYYA 5CN2A 1K5WA 1PQZA 4IK7A 3RL2A 2QQNH 1OTUD 1P7QD 3D8MA 4EZLA 5AW7B 3SYAA 5IIEA 1F13A 3V0GA 3TN0C 4FFZH 1Z32X 3VH8G 2ALWA 3PL6C 2F6AA 3WJMA 5ESAB 2QR0B 4NQUA 3KPLB 4I0PD 5HGHB 3N44B 3E6HA 1GXEA 1G7QA 4HUCA 2IH8A 1WISA 3MA9H 4C83B 2JQZA 4DAGH 4HK0B 4L3EB 2YPKB 5DMYA 2WBJB 1ZT7A 1I9JH 1D9KD 1LO3L 2GHWB 1FYHB 2NYYD 3SCMA 1PL3A 4WQOA 2F53D 3GZOA 1ADQL 5HI5D 4K3GA 4IU3B 2YD2A 1SLVA 2FNBA 3KAAA 3G5ZB 2OQJA 4RRPG 5C07D 3R1GH 2V6HA 2WLMA 2GW5A 1M05B 3HOGA 5FFOA 2J8HA 3LKRA 3AS3A 4A67A 4I88A 3IJSB 3QG7H 2X4TB 1E6JH 5CU5A 5SWSE 4NKIL 2FO8A 2YA2A 3U83A 1WH0A 1XGYH 4WUUD 2C7UA 4XMLL 1AR1B 4ODUA 4F27A 3W39A 2MRYA 3Q9PA 1A7PH 2VDPL 3DUUA 5JUEH 2AVGA 1UHVA 2BRRL 3RZCB 1TTBA 2C9VA 1SQ2N 3BAEH 1P4BL 2NX5B 2NRDA 3DHJA 3N91A 2AXGA 4RQQA 1MWAA 3IBEA 4Y1AE 2D3JA 4PS8A 1C5DA 1JRHH 3RGVD 4WGVB 2LOEA 4MDJB 3RWEB 3UPCA 3GMLB 4N0CC 3DI2B 4BQ8A 5CBAB 3GJFK 5AW2B 5AALA 3ZTCC 2PW2A 5ICYB 1WEJL 4L4JA 2IEPA 3TC9A 5CBEB 3P77A 4M1DL 5CFAA 1BVKA 4Q7DA 5C0JB 4LSPL 5ADPH 2WUBH 2AK4D 3DHMA 3VG9B 1UT9A 1WFUA 2AVFA 4UIMA 2WYHA 3RX7A 1KLUA 3GLDA 4A6YH 1S7UA 2XZZA 2J2ZA 3PXLA 4ZTPL 4ESKA 5I2IB 4DQOH 1BQ5A 2XVBA 2H3XC 4MWFA 5BNXD 3QHZH 1TZOA 4AMKL 1PAZA 1S7SA 3GJFB 5GZNC 2ZWYA 1WFOA 4OGAD 4BELD 5JDSB 1ECYA 1A8JH 2V9TA 1IQWH 4FS0A 3X1GA 1HZHH 3KXFA 4OLWL 4Q14A 5IM7A 4CMMA 3NCJH 5HXMA 2PXYD 3SY0B 4DGYH 1A3RH 4AQZA 4P2QA 3NUKA 3AS0A 3ELQA 1FIEA 2F7QA 3K1KC 3MX0A 1F4YH 3D25A 1P6AB 1FAKT 4FG6D 3CFUA 1IC0A 1MDAA 1QZNA 1LLAA 3J27A 3E38A 4G6KL 5FOBA 4ZUVB 2QZQA 1RJYA 3UAJA 3Q8BA 4POUB 4FABL 1C16A 1X5AA 3OJ2C 4S2SB 3S4SB 1WCQA 3CH1B 3GSNB 3GHEH 5GGTH 3SE4C 4PJFA 1KB5A 4OJYA 4ORZC 3HI6H 1A0QH 3F83A 1BVNT 2PO6A 1TO5A 4UDUA 4YFDB 4P49A 5DJAB 5FGSA 4FLRA 5DUPL 3ROLB 1X5YA 3CV5A 2AEPL 3DOSA 2A9CA 3SDXA 4NN6C 2E6PA 1T03L 3OXRB 4LEEA 4ZPTB 3UGXA 2J7LA 2Z7ZA 1JXJA 3RWJB 3UADA 5SWSD 3RQ3A 3P4OB 2AEIT 1YNLH 3CC5B 3RPBA 3FO9B 1XEUA 3IM1A 5DHYA 4KAQL 2EP6A 2HKHH 1T1YB 1FFNB 2J57A 4PJEB 4UNUA 3FU6A 1JTOA 1QLEB 3T0ED 5HI5C 3MRNB 2HJFA 3TEXA 5JTWA 3T2NH 3ARBC 3LN4B 3O9WD 4X6BA 4IKNA 3V0WL 4FMKA 4GNKB 4NUJB 3C60B 5PCYA 2GT9A 4JKKA 1H5BA 3MNMA 4Y5YC 5BXFB 2P4AB 3P54A 2NNXA 3QO1A 2CK0L 1DJZA 2V9RA 3L08A 3O81A 3HVDA 4KJPC 5IK3A 5FHBH 3TBSA 5BPPA 4OQTL 1A14L 2EILB 3OGCB 4XNDA 4OD3L 4HKJB 1OW0A 4TNVF 5IF0A 4G1EA 2VXSL 1E4XI 4GH7B 1J8HA 3FJTA 2ZOOA 2CKBL 3MA7B 1P6FA 1TCRA 4ZOCA 3PWPE 1T5XB 5AVSB 1W80A 2DLHA 2BZ7A 3HBQA 1U58A 3GEFA 1T1ZB