1VCBC

The vhl-elonginc-elonginb structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
142
structure length
142
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PROTEIN (ELONGIN B)
publication title Structure of the VHL-ElonginC-ElonginB complex: implications for VHL tumor suppressor function.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 1999-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 1vcbC01
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 1vcbC02
4W9LC 3ZRCC 4WQOA 4W9JC 4B95C 4AJYV 3ZRFC 4W9EC 4W9CC 4W9HC 4W9KC 1VCBC 4W9DC 4BKTC 4W9GC 3ZTDC 1LM8V 1LQBC 5LLIC 4B9KC 4W9IC 4BKSC 4W9FC 4AWJC 3ZUNC 3ZTCC
chains in the Genus database with same CATH superfamily
3SYOA 3V9CA 3VXSE 3HG1D 4JFZL 2OXHB 3MOBH 5E8NB 2WYIA 3N1PC 2BY0A 2WXHA 4FFTA 2R51A 4ZXBA 3U7AA 3WEXB 3H56A 2HRGA 4ZTPH 4NRZA 4X4YA 5FKPB 2GAZB 2AS5M 1MH5A 2EVIA 5IMMB 4P4RB 2F58L 1ZHLB 2HKHH 3IK2A 3MROB 4LCWB 4X6BA 5EBGA 2X6MA 4JL2A 1T83A 5D1XE 4HKBB 1KWKA 4FG0A 5D2NE 1VZIA 4YSPA 3VTMA 4H2CA 4UTAL 4OT1L 2ADJA 4V2BA 4WK2B 1PG7X 1VGKB 1WT5C 2IXQA 3JT2A 3FT2A 4AIEA 1A0QH 1X7QA 4IKLA 1FNHA 3DX9B 1QTSA 3HB3D 4DIXA 3BH8B 2CGYA 2JJSC 2R56L 3FHQA 2QMKA 3EXJA 2EDMA 4QDGA 1PDKB 1W72L 2NXZC 2QZ5A 4HFWB 2HJFB 4NQCE 1E6JH 5BPPA 1UXLA 5CMAA 3TCLB 2UX7A 3RUGB 4AV4A 1JFHA 1XIWC 4BSVA 3EGXB 3GBEA 4AYGA 5KBPA 4HH8A 3EH5B 1NBQA 5C0CE 4V1DD 3GSWB 4QXGL 1JTPA 1SXSA 2AFNA 2Q2EB 3IAPA 3GSOA 1RZJC 1CI5A 4HFUL 1EJOL 3AU0A 1MRDL 3EJZD 3ZE2F 1B6DA 1HTYA 1J11A 2C7UA 1G7HB 5CKAA 1LO5B 1X5LA 3VFPA 2OMYB 3OZKA 5B1CA 3CH1B 3QSKB 1MELA 5HGHB 4DEWA 4Z78B 3EDJA 3UBFA 4F2MB 3FO1B 2QPEB 2G9HB 1MLBB 2EYSA 3GI8H 3V0FA 2IQ9L 4DQOH 4ENEC 5E9DD 1TEFA 1U3ZA 2ISDA 3ZHFA 1HINL 1CUOA 1ONQB 4X8JB 1UA6H 3IJ7A 3MCKB 4KTEH 2R1WB 4K0OA 5EU3A 4EPSA 3CFKA 5C97A 2R0LL 4L3CB 1Q0XL 5IMKB 5JA9A 1VEPA 4NQDD 4R0LC 4X6DB 4F58H 3T4YB 1O5DT 3MGTB 5L2KD 4OZ4A 3ULVE 2XV0A 1IGJA 1PL3A 8PAZA 4WJG3 4MDJA 1J8HE 4GMTH 1P6AB 5D7KE 1GYUA 5KYNA 2J88L 4XB3A 4EVNA 1A7NL 1AD9B 2ZT9C 2E86A 4DKDC 1Y0LB 1BD2B 3PAVA 4GBXC 2LOEA 1NUNB 1ZHBB 4K3DH 4PJFA 2XPGB 2FO8A 1U8CA 1B4RA 4PJGA 3SE9L 4XCNB 5F6IC 3DX4A 2BRRL 3ZDZF 4G80A 4L1LA 4YHZL 4XVSH 4WGVB 2PPAA 5LGYA 1CLOL 2DI9A 3CMOH 5C0DB 2YA2A 4EDXB 2Q5BA 2ITDA 1ORQB 3SOBL 1I8MB 1AKJD 5FYJD 5GSRA 3VRJB 1KBWA 3BP4B 4L05A 1JZDC 4P57B 4YE4L 5DK2B 1G9MH 4QRPD 1LP9B 3UTTD 4HW6A 2E75C 2AK4E 2WQSA 5F9DC 4IQHA 3O3DA 1WD9A 1V7ML 4EIBA 1U3HB 2X4QB 3ESMA 3FFCB 1QFWM 2FJGA 2PYED 5BQ7B 1LK2B 1BXXA 1OEZW 2BNUA 2PCXA 3ECVA 3MLTB 4AYEC 1S7VA 3ZHLA 5IB4B 2P24B 2D9QB 3WG7B 4M7LL 5L8KB 3GMQB 2WZPA 1EAPB 2HLAA 2OMBA 1OSZB 1WIOA 1OP9A 1SVBA 3VXUD 2W9EL 3L95A 2I69A 2JB5H 1CK0H 3HG0A 3GIZH 4I77L 4RWYL 4W9IC 3S9DB 1EVUA 2JELL 3MRPB 5HP5A 4OD2B 2A6IA 3TX4A 1T2QL 4JFUA 3BWZA 4QY8A 2LTQB 2H45A 2VUYA 2PXYD 3TZVB 1PPIA 2WM0A 3NACL 3V5KB 4NUGH 3RDTD 5ETUA 3MKGA 4PJ7B 2IWEA 2J5WA 1E0OB 1YQVH 4F1SA 5FGBA 1F58L 5DEGA 4KTYA 4NENB 4PG9A 5K1JA 3MRGA 2IC2A 1GXEA 3F6LA 4DP6X 1KTLB 2XY1A 1VF5C 3NIGF 4GW5A 4MNHB 1AZRA 2SEBA 4KTGA 1LEIA 3MRNA 3IFLH 4P07A 4TSAH 3WD5H 2R0WL 1QTPA 3TESA 4WHDA 3B2XA 3M17B 3NCYS 1PNDA 4X6CE 4WGWB 1Z9OA 5IJDC 1SHXA 1BFVL 3MN8A 3HJ0A 5ID0B 4H1LA 5BRQA 2XICA 4GJTB 4JRLA 1LK3L 3VA6A 4WNQA 2CR3A 3GSQB 1YDPB 2CKBH 2VQ4A 4FYSA 4DK5A 2X10A 4A2LA 1T7VA 3VFSB 4F57H 5AALA 4PB0H 3HUJA 3BP7A 3GGWA 4FI8A 1S7QA 2AKRB 2NZ1A 4LLQB 3SDYL 2VLRB 3ZR6A 4UQCA 3NP4A 4LOEA 5F0MB 1S9WB 1Y18A 4IOIB 4MD0B 1JV5B 3HW7A 3KLDA 3LH2L 4PIBA 3VSQA 3VXOB 2CQVA 3RY6A 2CBQA 1SHSA 5GGTH 2FLRT 2PP8A 4PJIA 5BOJA 5IUCA 1NCUA 2GKIA 3NZ8A 4P4KB 4UQ3B 1YHPA 5T1KA 3DX1A 2JLLA 4XXDB 3QNXB 5FYKU 4R4FH 4JPQA 4KX9A 1N64L 1C5CL 3QZPA 3MBEC 1YEEH 2CUIA 1ZV2A 4A7TA 4KK6C 3GJFK 5TE4H 3ZKNC 5IHUH 3L2MA 5JZ7C 1OB1B 4Z7NE 3OKEA 1AGFB 1C8QA 2EIDA 2ZG2A 4JFDD 1DJHA 2XUWA 4B27A 2BOBB 5EC2A 1VSCA 1RFDH 3FXIC 5DHVA 1FV1B 3T2NH 4KO9A 4KK8C 2Z93A 3NCJL 4DNLA 2P8PA 4FNPA 5TK2A 5F88A 3FCTA 2CO3A 3HFMH 4QLRA 3F05A 5HHXL 2GFBA 4QHNA 1AR1D 3H4HA 1S7WB 1IKOP 3RGVA 5GRVL 3UOAB 3UZQA 4P2OA 3UMNA 3TJEH 4GRMB 4HGWB 2EVHA 5JHBA 3ABKB 1JERA 4TUKH 2AEWA 4BFJA 2GIMA 3ZMRA 1BZOA 1TKWA 2CDEA 5GGSY 4ZD3H 3AU1A 3UMTA 3U30C 3NPSC 1HNFA 2DLIA 1MWAL 3N41B 3BZFB 5INDB 2F74A 3FU9A 1FVCB 3VWJB 4OV5A 3F7PC 1AG6A 3CHQA 2BOCA 5E56A 5HYSA 3DX2A 1XT5A 1J1XL 3G6AA 4ONHA 3TBYA 3RZWA 1GCYA 4JFVA 3AMLA 2HN7A 3O4OC 5DJYB 4Y5VC 1CGWA 4PJAB 3X11A 3RI5F 5I24A 1OCWL 2L7QA 1NGYA 3M1BB 4DT2A 3QQ3B 1N19A 4K23L 4PJ5B 1OWRM 5J12C 3EHBD 3NCMA 3JTTA 3D12B 1CIUA 1NDMA 3FF7A 1XZ0A 2DQFB 2WVVB 3MV8B 5BS0E 5JW4R 3QFJB 2ZX5A 3S37X 1AXSA 2ZAHA 4IU3B 3X14B 3DJSA 4POYA 3P9WB 4JRXE 3DHUA 1J9CT 1PVHA 1L9NA 3OMIB 2WNKA 3DPBB 3RQ3A 3CPLA 5DI8B 3ATAA 3K8LA 4ODSH 5GISL 3D07A 2X5PA 2WXRA 3U9UA 1CYWA 3DXAB 3AXLA 3DROA 4PVLA 5L4IA 3VGAC 3BRDA 4XXWC 5E8EB 1T4WA 5J1AB 4DKFL 2HRLA 4FHJA 1P5UC 4LSQL 1DVYA 4FP8L 2ALAA 2ZP9A 1XV8A 4QRUA 2OX5B 4U6HA 5E08L 3ULVC 3OQRA 4L29A 3VXNB 1JVKA 3DPDA 1CF8L 2JLPA 3N1MC 5EBWA 2WZPD 3MLRH 5DUBA 4JK0D 2WKOA 4M62L 1HFUA 4DHLA 5D7IF 1ZDQA 3EYOA 2H7WA 2GTWB 3G6JB 1JYNA 1FVDB 2H32B 1RZKH 3BGFC 4OY9A 5IQLA 2G9KA 4WWKD 6TAAA 1F6AA 1PIGA 2W80C 4LESA 2NY6B 1OP4A 3O8XB 4B9YA 4JGHA 2XG5B 3POHA 2H8PA 1ADQA 3QEUB 3WEAA 3WDHA 3SPGA 3TA3B 4UUJB 2VDPH 4GAGH 2VC2B 2BWQA 1ZJBA 1XGZA 2WAQA 5EIIB 1P7QB 5I0VA 1QUNB 3CE1A 1I4FA 4KPHL 5BZWB 3WTUA 2NY1D 1EXUA 3STZA 3KCPA 1I53A 1JPGB 3MI6A 4AT6B 3ARGA 3IMTA 2IGLA 1ES0B 2WIIA 5F9JA 3FCBA 3QK0A 1CE6A 4V1DB 5A16B 3VYNA 4YXHH 4L8CB 1G9EA 5I19H 4Q6IB 1R3JA 1DTUA 5DLLA 1AANA 3JWOC 1MVUA 2JXMB 1AAJA 1FH2A 1HSBB 2D31A 3HMWL 1JV2A 3WUWA 1WFJA 4PBXA 1PX3A 2XN2A 1T20B 1KIRA 1BYNA 1BVLB 4ECNA 4CVZB 1KV7A 3UBXA 1LO2H 5LQBL 1EAJA 3PPSA 2BZCA 4H8HA 5I8EB 2D7OA 1YSOA 4BH8B 4ZDHA 2KL6A 2MCPH 3TBSA 1ZIAA 3FTUA 2AK1L 1HOCB 1I85A 2R29A 3UC0H 3T3PE 1V05A 3SDXF 1DFBL 3SKMA 5E95B 1ZANH 4PJCE 2WO4A 2IGTA 2D7PA 3ARQA 2ILLA 1L0QA 4RRPM 4NT6A 4N9GB 2HG5A 3DRQB 3LY6A 2QZQA 3FAWA 4KI1A 1V3JA 2Z92A 1OSPH 3CZEA 3TV8A 4JFPA 4B5ZA 2Q76A 5ACZB 1CG9B 3MRHB 2OYKA 2GQHA 2EEAA 4R4ND 4WUKH 5ANMA 4AQ1B 1RQ5A 4PGEA 5KVGL 3EXLA 2Y2TA 2EDHA 4HVBA 1EHNA 1KTRL 3BUTA 3MUJA 2Q7AA 4LSRH 4PEEA 4XC3L 3CV5A 2VWEE 1G7PB 3SGKA 1YJDC 4IBZA 3VWKB 4JRYA 5T1KD 2H1XA 1GW6A 4PLKC 2R1YA 1QW8A 3C60C 3FHEA 2NW3A 4FEIA 1JNNL 1HCYA 2PPCA 2XWZA 1M7DA 4KY2A 4U7KA 1BVZA 3CQFA 2EDQA 1M7IB 4HCRA 1NMBL 5I30H 2CSPA 1IC7H 5IHBA 4C56E 1WFMA 4ICWA 4FLQA 4M1GH 2NQCA 3IFPA 3OB0H 1EAQA 1XD0A 5K5YA 5SV4A 1NICA 2P5PA 3KPQB 5E5LA 4LFHG 1ZVHA 4I9WD 5IB3B 5GJTH 1JN6A 2W0PA 3CXHK 1RL1A 2BY2A 3PABA 4FQCL 4TPRH 1W91A 4KVNL 3VD3A 5J0BA 4QRPB 1DVFA 3UTTB 2NZ9C 1RIHH 4X98B 3JWNE 4KZEH 2EDBA 3RGVD 4MA7L 4BUHA 4P2OD 2XI9A 4U7MA 5IIEB 1SVCP 4O02L 2H26B 2DLEA 3MR9A 3O81A 4F15B 4WFHE 1QSEB 4UIMA 4BFIB 2JKNA 4YIQB 2IBZX 5I75C 1SMOA 3IMRA 3EH1A 4J7RA 5HI4D 3JV5A 3KE0A 4FCHA 1U21A 4X0NA 4I2XA 4DERA 4XHJD 4TVPL 4YH6A 3NSYA 1TMQA 3IPEA 4P2RB 5AKVA 3FBQA 1HHIB 4NJAL 3V9FA 2C3VB 5ID1A 5CGYC 2DQCL 1KIQA 2BO0A 3T3ME 5DFAA 2VDML 4XX5A 4OGYH 1J0YA 2ESVA 3F7LA 3GNMH 1E9OB 4JKPH 5F7EL 4AM0B 4PTTA 3CCHB 2EJ1A 3BVUA 4PWFA 2DLHA 4EN3A 3ZTEA 4ZX3A 1VENA 1DBAL 3RIKA 4F5CE 2J2ZA 1PCXA 4WHYG 3HZMA 2AQNA 1T2XA 4H88L 2R23A 1XAUA 1UM6L 3GFUA 4NUMA 4XP4L 3VFOA 2IPKA 4F93B 1LQBC 5C0RL 5EOCL 1E6OL 1U4EA 4CRPA 3PREA 2K8QA 2P26A 1UC6A 1KC5H 1USZA 3P9LA 5JYLA 3Q01A 5SX5K 5LBGA 4QNPF 5ADOL 3JTBA 1ZHKB 1F11A 2BNQE 4DKEL 2WBXA 2YUXA 3VM5A 4EIZC 4UV7H 2XWTA 4ZXBB 4LIQH 1E7VA 3MCG1 1S2EA 2BNRD 3AACA 2EABA 4NRZB 4QRBA 1NBVH 3FKUS 3K80A 2H3NA 3QRGH 4TULL 2A83A 5JUEH 4X6BB 4G5ZL 4PS4L 4NGHH 1OO2A 1NWPA 1A6UH 2XWDA 5JNYA 5KVEH 1PX8A 3QUYC 4H20L 1HXKA 4FGMA 5HD8D 2BW5A 2IXQB 3FT2B 5DGQA 1X7QB 1OAQL 5H37H 3VTAA 3PFUA 4G6MH 1KXVC 4CU6A 1LWHA 2JCWA 2NY5L 1MFBH 1W0YT 1ID2A 4DGVL 3BPNB 1I7TB 1LDPL 3P2BA 1PZBA 3QNZB 3RL1A 3KPRB 5KVFH 2FYYA 1MFAH 4AQ8C 3ARGD 3HHRB 4IIQA 3IGLA 4HAFA 4BSVB 1VFBA 2YC1A 4LF3A 2V9UA 3GSNH 1MFDH 3C5SB 3ARXA 3JUZA 1J48A 2BVOB 1ZEAL 5E99H 1MY5A 3KLHD 3QXTA 2C7UB 3C8DA 2NTFA 2FX7H 5BMFL 4HSAC 4A7GA 1T22A 3VFPB 5KBLA 2IPTL 2WYZA 3IJ9A 3HE6B 1OD9A 4JFXB 4JG0H 4LKCB 2DEXX 2RMNA 2PWDA 3MOBL 4YFLI 5JXEC 1T3FA 2EDEA 2EYSB 4JFHE 4PJDA 2DJSA 4ZTPL 5HYJA 2L8AA 5F1IB 8CGTA 5PCYA 4PRHA 1X5MA 5DQJB 5GGRY 4KMQA 2DMGA 2HKHL 1I8LC 4XP1H 4ALAC 2IFGA 3RTQC 4E41A 2APFA 4AKPA 4B9FA 1OD7A 3RWDB 2VDNB 1A0QL 3CVIH 2C34A 2Y72A 3C8HA 2XKUA 3KYKH 2X4UB 3NCXA 5D4QA 4XCYA 4P9MH 1IGJB 2Y5TA 4JRYD 1ZLSH 1UT1A 5TDNB 1ROCA 4GP4B 4YPJA 4CGUB 1PIFA 4YHLH 1E6JL 4G1EA 1IBZA 2TAAA 4HH9A 3PWVA 5A2KH 3AS3A 3VXRA 1NINA 2GUOA 3PL6A 3LQAH 1KGCE 1LEKA 4F3FA 3JV6B 5G2NA 4RFEA 3MAWA 4A55A 1WAAF 3WTSA 4Y16D 4QWWD 4G80B 1I9EA 1RERA 2HT2D 4G7VL 1H3WM 2YRBA 4X7FC 1YEGL 2ITDB 4S1DC 2V7NB 2VUOA 2BM3A 4YDVB 1CGSH 2YD8A 1XBDA 4GEJA 1N6QH 3WCYA 5D55A 3IMSA 3CN3A 1DVFD 2GTQA 4LGPB 1GZHC 1T7ZA 5ICXB 4BZ2H 1S7XA 3O3DB 4X7SH 3GI8L 5IJVA 5IKCA 3B3IA 4DQOL 1WH0A 4M7ZC 2LFEA 1TPXB 4KK5C 5FOJA 5GSVB 3QFGA 1JBJA 3JWOL 1UA6L 5C7XH 4KTEL 2NLJA 4XHQA 4GI8A 1FGVH 3QUMA 5SWQA 4ZTOH 2Y23A 3I84A 2F18A 4D9LH 1ZE3H 3WN6A 3MXWH 4X8XA 3IDYC 3L95B 1IL1A 4F58L 5C70A 1NCOA 2DQIH 1OP3K 3BEWB 1Z5HA 3JQOB 2Z31B 4IRSA 4ATTA 1JFQL 1JK8A 2FNBA 3U0TB 1HNYA 2Y06H 2Y5EA 2ENQA 5DVKA 3GMMA 3TN0C 4HHAA 4TTDC 1S9VA 4QY8B 4XNYH 4GMTL 5SWZE 1UD2A 3WS6A 2Z64C 4N2MA 5ETUB 5FWRA 4EN3D 5BVPH 3AREC 1NOFA 4ZYKA 3NQIA 4PJEF 4K3DL 5CCJA 5DJAA 5DEGB 3GHBH 3DETC 3ETBJ 4PG9B 2A77H 3JWNC 1ACCA 2X44D 1PGRB 2VDOB 3CMOL 1LEIB 3D4GA 1AJ7H 4Z7VE 3VACA 1WO2A 5HY9A 1Z1WA 2ZICA 4N2OA 1G9ML 4Y5XC 4KOCA 5MERB 3TBCA 2VSKB 2EKJA 1XL6A 2KLRA 3B6SB 5GZNA 3QWRD 3WJLA 4FEMA 3FO2A 4H1LB 3VXQA 3ATBA 4P23B 2XWJA 4B41A 3L3OA 2QMJA 1QLEB 1JPST 5CN2A 4UZGA 1KIUA 1CD0A 1YPZE 3BP7B 5B3JF 3PLYA 1ZS2A 1SN0A 4QKTA 4ZUTB 4U0RC 1YY8A 4RZCA 3FFDA 2D3LA 5EULV 4IOFD 3M1CA 1I1AC 4P2QB 1Y18B 3AC0A 2JB5L 1CK0L 3FAXA 1QA9A 3GIZL 3OAUH 4KZDH 1G9NH 4G42B 4G8AC 3JYBA 2G5BB 1BVKB 4K7PY 5DO2D 3K2MC 3ZDYB 3JV4A 1E4JA 1UENA 2EIZB 1ZA3A 4I5BA 5L0QB 4X5RA 5F97E 3ZE1F 5E8OA 1W2KT 4JM2C 3MRJA 5T1KB 4R83A 1YQVL 4U6XA 5KVMC 2CMRH 1NM4A 4Z3TA 4TNFA 1Z3RA 2ED8A 2IMMA 4E0RB 4MXWH 4KROB 3GJFB 3KBFA 4ANKA 4W81A 4POZD 4WKZA 2CU9A 1QVOB 1HZHH 1NGXA 3SB3A 1T1XA 3G5VA 4J6RH 3OKEB 3IFLL 4TSAL 1KXQA 3AWFA 4NIKB 3FZUD 3WD5L 3WHE0 3V10A 2CIKB 4NIYE 4TS6A 3WNMA 5DHVB 1PKOA 4JZJB 5D2LF 2MCMA 3HFFA 2E3VA 5AZ2L 3X2QB 3DGCR 3MX0B 5J3HD 2P8PB 4JQVA 5IBTH 5F88B 1URZA 2RGSA 3L7EA 3V5DA 4UM9A 1E8XA 4QHNB 4I0CC 4AYMC 2EIBA 4FXKA 5I74C 3B9VA 1GGTA 5T3ZD 1NFDF 2CKBL 4X7EC 3PF2A 3UZQB 3OKKA 4F57L 2NQDA 1JK9B 4N5UA 4MMZA 5BVJB 1MCWM 4PB0L 5DZAA 4E41D 4OFKA 2EE6A 1RJYA 5C09B 3TONA 3PWJA 4E9TA 2R0ZH 3RL2A 1J5IA 1KLFB 5AVYB 4AUUA 4L9LA 2AQRA 1OT2A 5FUCE 5GGTL 3EADA 2UV3A 2BOCB 5LXGH 5HYSB 1Q38A 1TQCC 4ONHB 3TBYB 5ES4B 2A3TA 1I7UA 4BGDA 4KJWD 2MOVA 2HN7B 4QGTA 3AS1A 3GUFA 3J8F7 3RJOA 3ME0A 3Q3GB 1OAXH 3PWPE 1G5GA 1U8JB 3VXRD 1YG9A 4F7MB 4QJ3B 1XZ0B 1YEEL 1DZ0A 5FM4A 5FYJU 4FNQA 1AXSB 5TE4L 3BWUF 4U1IB 4NM8H 5IHUL 4HQQH 4KI5F 4PW4A 1KTDB 4GOSA 4XZUA 3WY3A 4XCEB 3PWNB 4BEIA 3S5YA 4FTVE 1RFDL 3K91A 3I3EA 3V6FA 3GUTA 3AXLB 4GUOA 3DROB 3HFML 3QB7C 3P40A 2A0LD 3TCXA 3OAWA 5B4MC 1X9UA 1P5VA 1OZTG 4JZOA 2N1KA 2AQ3A 4RFNB 3S34H 4QRUB 1RUAH 2DJ4A 4X4KA 1HN1A 3QZWG 4TUKL 4L29B 2M26A 4M5ZL 5DUBB 4ZD3L 4FULA 4F7KA 1IILE 2HFTA 2CJSA 4OFDA 1W8OA 3WEOA 4FOMA 4MD4B 3I6SA 3AQDA 5BRZD 4IRSD 3CN4A 5IHWA 3HRZC 4PBDA 4AK2A 5H4YA 4GG8A 3HZYB 2H8PB 3QIUA 4OZIF 1JS4A 3F7KA 4N2FA 1TITA 4IIZA 4P3DA 2FZ3A 4J3VA 1XR9A 2DQUH 1I4FB 3HLAB 2DQGH 2XWXA 4KBPA 3C5ZD 1EXUB 4YGVB 3STZB 3RUGE 3KCPB 5JPNC 3OR7A 4NSKA 4S2SA 4H26A 3ARGB 2CRIA 3IDJB 2EDLA 5HGBB 2WIIB 3FT0A 4NQTA 2MTAA 5KYYA 4K94C 4I0PD 3SKOA 2RH0A 5TK4A 3QE5A 3COOA 4R5XA 1CE6B 5H35B 1EZUA 4ERSH 1TIUA 3NCFB 5IROA 4RSVA 2D03H 3U4EB 3RILA 1C16A 1MVUB 1A6PA 4WO0A 1KBKA 1P7KB 3P3YA 4ODSL 3WUWB 3O45A 2Q3AA 1G7LA 1QI3A 1UG9A 5AOMA 5HHMD 1D9KD 5GZND 1HH6A 2R27A 1PQZA 4IEFA 4K4KA 4F2ME 1BQLH 3HCVB 2Q8BH 4PWKA 4HISA 1P1ZB 3GXTA 3BVNA 4QXWA 4ZDHB 3TBSB 4I18C 1JYVA 1E4KC 1FL5A 1NEZA 3MJ7A 5D9SA 4AVKA 3IETA 3OXSA 2DQEH 3SKMB 5IQ9A 5FYLE 3HAEH 3ILDA 4JCWA 4M4RB 2XNAB 1AQDA 4Y19A 2WYTA 3RVTD 2QVMA 3MLRL 2XXMB 4WEBH 3CFEA 1WYJA 1IAMA 3V0EA 4NT6B 2NT0A 4HBCH 2Q76B 5I73B 1RZKL 2DBJA 3LQAC 4PGEB 3DMMC 4HA1A 4L4VE 4PJ9B 4X5WA 4W4OA 3S3PA 4IKKA 5SWSA 3TWCL 1A3LH 4MS6A 1RZQA 2YZ1A 4WW1B 2VDPL 3I6LE 4GAGL 1L9SA 3L16A 4NQXA 1FVEA 2R1YB 4MDRA 2CO1A 2NW3B 1RIUH 3N91A 2YFNA 2C4FU 4J39A 4FQQB 4TOYH 1QO3B 5CD5C 1R19A 3APNA 5J6SA 3HZKA 3BH4A 3WLWC 2HJKA 3FUJA 4YSRA 4YXHL 3QVAA 4ZUWA 5I19L 1WS7A 2D4DA 2PR9A 1BQHA 3IFPB 4QTFA 2OTWA 2W0FB 4Z3GA 2BRQA 1RSYA 4RGNB 1GGIH 2V0AA 3L5IA 3IFOB 4J3UA 1GW0A 2XXCB 1LP9E 5I18L 1LO2L 4CU7A 1DVFB 2F53E 4BKSC 1Q8MA 1RHHA 3E8UH 2WQAA 2MCPL 3UCRA 1XF1A 2OM5A 3F7YB 3VRIA 3KMDA 4FFZA 4U05A 3FFCE 3UC0L 1R0AH 3MR9B 1ITBB 4NKOA 1NANI 1EIBA 1ZANL 1CDHA 4C58B 4X7TB 1HYRC 1DEDA 2Z0BA 3DWTA 3KGSA 2PWEA 3ULVF 3CXFA 2ZUUA 5C0FA 4I2XB 1M57B 3X1FA 1OSPL 4WUKL 3UADA 5ID1B 3H9SE 3RYMA 1KIQB 1XR8A 1H6EA 2EDOA 4PG2A 3AXHA 4LSRL 2EH8H 1UUNA 3H7BA 1KGIA 3NJHA 3OLEA 2ESVB 4XMUA 3FK3A 5D7IA 4XBPA 4PTTB 3VUAA 5I8OH 1CDGA 4PJ7E 1TUPA 1EANA 1F5WA 2PP7A 3V4VB 3L4CA 4UQDA 1HVXA 1R1CA 1QBBA 2E8ZA 5I30L 1IC7L 2GY5A 2A9MH 2J2ZB 5IBUG 3HZMB 4OJEH 2R23B 4M1GL 2IPKB 3L54A 2ZNXA 5AKTA 3UTOA 1MCEA 2RD0A 5FM8A 3HA0A 3P9LB 1BWWA 2TRHA 5TFSH 5GJTL 3VJ6A 3VYOA 4WFGE 2X7LA 3BRGC 4TPRL 2APSA 3EDEA 1RIHL 4D9QD 4KZEL 2XPYA 1UD8A 2P47B 3EDKA 5F9WC 4AQZA 3INOA 1THCA 2F5AH 1DVQA 2YMOA 5HHPA 3NGBC 2RJMA 3NJLA 1CMOA 3QARA 4JQXC 5FUCC 3EFDH 4H1LG 2KLSA 2A83B 2CM6A 1IAIH 2Z8SA 3G9AB 3HR5A 2HXAA 4JDEA 5F3BA 5IJKC 4OH2A 1XB6A 2GSGB 2WLKA 5JNYB 3LZOA 2VRAA 2WXQA 2VLRE 1HCVA 1ILUA 5L8LB 3BP5B 4A2FA 3IBEA 1B6UA 3SDXA 1TQTA 2ZUXA 3WE1A 3U6XS 4C4BA 4WU7B 2W81C 4PRAA 4JHWH 3FHAA 4APQB 5MHSE 1CS6A 4P46A 1JWSB 5DLMH 5EDXA 1KPUB 4OGYL 3QUZA 2ICES 4UDUA 2CD0A 2YPVH 3TBBA 3GNML 4JKPL 4UT9H 3OKLA 2WW8A 2CCLA 2V2XB 5C2UB 2ZOOA 3GI9H 1NPJA 1I82A 2FYYB 3T2OA 3F3HA 4XOEA 5DU7A 3LIZA 2KZ1B 2P49B 4IIQB 1YC8A 2XDHA 4WFEE 5G55A 2NR6A 2OJ1A 4EF3A 1CQYA 2Y7MA 1GMIA 3KVQA 2J72A 4N0UA 4X6CF 3MYJB 2UY6A 1QNZH 3DIVA 3HI5L 5IROD 1NCAH 2H6PA 1SUJA 1E2WA 2Z4TA 1MHPH 4YNYB 1E7UA 1VAHA 1T22B 2MWCA 1U8MA 3LYRA 4PREB 4GI6A 5HYFA 1BDYA 4OBRA 3T8MA 3SCMC 2OYPA 3M7FB 4IBYA 4UV7L 3HBGA 1T3FB 4GLRH 4LIQL 5DRZB 5HYJB 4PJDB 2E4TA 3SDDC 4PRHB 1NBVL 3QRGL 3VD0A 1H8SA 5KTEH 3SDCB 5JUEL 1SXAA 3DX8A 4Y19D 4NGHL 2ZCKH 1A6UL 1FJ1A 3PHAA 4HS8H 2QJDA 5KVEL 1MJUH 2JJTC 4PWEA 3NJVA 4WI7A 3LEYH 2YEQA 4S1QH 2Q6WA 1TTUA 3FT4B 3UX9B 4AIXA 1GGCH 3OJMB 4G6ML 2GJ6A 4JREB 4U49A 5G4OA 5SWSD 1AXTH 4HJJL 4XCYB 3PWLA 5DEZA 1MFBL 1JDCA 4ZMOA 3RURA 4GP5B 5A2BA 4OFVA 3FUMA 4PJAE 1DN0B 4OLWH 5KVFL 3FO9A 1MFAL 2GI0A 4B9JA 4Z7NF 5HYSG 4HH9B 2ITCA 2AVFA 3DV6A 1XCTB 3DO3A 1FG2A 3PL6B 2AI0H 1C08A 1TZOA 2GUOB 4UNIA 5E4EB 1LEKB 2EUWA 2IDFA 4HULB 2J71A 5FV2A 2FHFA 4KY1H 3QFJE 4RFEB 3K8MA 3GSNL 1MFDL 4FHKA 1J05A 4WTWA 4XNQA 5G4NA 1N10A 1JWMB 3B5TA 5E99L 5LWYH 3PDOA 4JGMA 4MJ4A 4G83A 1FSKB 2OL3B 4XO9A 5DC4B 1KCBA 4PM1A 1XB3A 2FX7L 4NN6C 4EIUA 1OL0A 4X2UA 4ZMVA 1E4HA 1G6RB 3CQQA 3UG4A 1NAMH 3G04A 2EACA 4JG0L 1FQ9C 3K1KC 3DXAE 3K6SA 3LRLA 5BW7A 4K94L 4Q9RH 1S7XB 4N0CC 4U3SB 3RZCA 5FWQA 5IJVB 1KLGA 4HKXB 3SY0B 2E6PA 3VQ1C 1QEXA 1SZNA 5C3IA 4PB9L 4Q2ZB 4TVSa 1U6AH 3HG5A 2W1NA 1MXDA 2WQVA 3TFKC 1PLGH 2EDKA 4PJ8C 2VB5A 2G3ZA 4R8WL 1CLZH 4HMCA 2A73B 3GMRA 5AW3B 1MJJB 3AUWB 5A6LA 3EDDA 5AQ0A 4YDNA 3G6JE 3MUGB 5C6PB 1FN4A 1IL1B 4YDJA 4IRZA 3KYKL 3SGJA 4IRSB 1JK8B 3OTTA 4LLVA 1SN2A 4P9ML 2CDGA 2XPZA 3HVDA 4HHAB 5EU7E 1ZLSL 1S9VB 3GMLB 1TZ8A 3QQ4B 4L1DA 1FL6B 4YHLL 3AZUA 5A2AA 2GC4C 3UJIH 3AY2A 1NBYA 5SV3A 4O9HH 4FLOA 4ZYKB 4W9EC 4XVUD 4Y1AA 1WFOA 2IWFA 3KPMB 3TP4A 3U2IA 3EH3B 4C55A 3HS8A 1N0LA 3LQAL 1A1OA 2BVUA 4U1GC 3FB7B 2B0SH 5CEXA 4N6RA 5DA0B 1I9RH 2AQSA 4ICXA 3FB5A 3PP4H 5B3SB 1C12B 2X9WA 3MRQA 3BP6B 4YUEH 3GS4A 2X6BA 1L3NA 4GKNA 5HY9B 3UXFA 1CGSL 3N44F 4GAJH 1N6QL 5H94B 4KK9D 1QACA 1KDIA 1NC2D 3GZQA 5D7SH 5HHMB 4A7VA 4MTMA 3PAYA 3OJVC 2VR3A 4WI3A 3WFEH 4BZ2L 4PGDA 4F7EA 5C0JA 3SGDI 4LDCA 4OZFG 3WUWG 4RESB 5KW9H 4BRVA 1D2OA 4N87A 3ZE2B 3QT2A 2BHZA 4JQIL 3L3OB 4AIOA 3UAFA 1YCSA 5C7XL 3WNJA 4BFBD 4XAKE 5AZUA 2XVKA 1DQIA 1FGVL 3PPEA 1R24A 5AW1B 4AH2A 5M7QA 4AWJC 1YY8B 4RZCB 4M8VA 4KHTL 3FFDB 4D9LL 1D5BA 1TTAA 5CCHE 4M93C 3MXWL 3L5HA 1XF5A 3GSVA 2YQGA 4S0HA 1BZQK 2A9AA 3EJYD 3S96B 3RPKA 2H0EA 2DQIL 4A04A 1KTBA 3BLKA 2EXTA 2C9PA 4MXVE 2Q2LA 2Y06L 3QUZD 3DUSA 2WAHA 3OJ2C 4XNYL 2P5EE 4HUXB 4I5BB 5DS1A 1ZA3B 3I2CH 2WNGA 4FMVA 5DRWB 3C6EA 1DVZA 1O5PA 3JZ7A 3MRJB 2YKKA 5BVPL 4MNQB 5E03A 2G5UA 2NCMA 2QV2A 3CH8A 2X9YA 2NR6D 2YEZB 4CBPA 1OAUH 2WO3B 2WP3T 3F65A 5D1QC 2A77L 4ZAKA 4F2EA 2QPDB 1XF2A 4WKZB 1V7NH 3KDMA 2QR0A 3BT2H 4QO1B 5F6HJ 1GTFA 4FDWA 1T1XB 4LHUD 1AJ7L 1SLWA 1KELH 4LLUB 4N86A 3GRWH 1BPVA 4JGNA 4DETA 5TE6H 4PW3A 4BGLA 1SBSH 1J5OH 1YMME 4GKSA 4PJCF 4XNZC 4HOWA 2IJ0C 2EE0A 4IK6A 1YZZA 1WAAA 4ODTH 3GKWH 3V5DB 4XP9H 4UM9B 1U8KB 3M86A 3RJQB 3D69B 4FXKB 2QGDA 3OMNB 2EEFA 2RIKA 2VQUA 3OKKB 4YN3A 5GRVK 1IE4A 3OL2A 3D87B 2XSKA 1PZ2A 5FUZH 1QSEE 3ATEA 3SBPA 2R2CA 4WQOA 3KGTA 3WAJA 4FHBD 2QPSA 4FYRA 4M4PA 4AYFB 2VO8A 3VU1A 3RL2B 4P2RE 2J56A 1KTKE 1SQMA 3OAUL 4KZDL 3KYNB 2GJ6D 3MLXL 4L9LB 5C71A 2B08A 4PS8A 3UERA 5GHWH 3PV7A 2ICEB 4ZNEE 1I7UB 1YECH 1QPXA 4M48H 4RIRA 4JANB 3NFNA 4I48A 4HWUA 2YOCA 1WT5A 3K81A 1SRDA 2CMRL 4GSRA 2AP2A 3OKOA 3IWVA 4MXWL 1OM3H 2ZPKH 1D7FA 4ISVB 4YZWA 1JRHH 4MA1C 1AS6A 1ILSA 1GZPA 3NIDB 2C9RA 5FO8A 2JJSA 5E4OA 1JF5A 1HZHL 1T7YA 3MTXA 4XZUB 1RU9H 1DQTA 2DIAA 4J6RL 3MJ6A 5F7MC 4B7IA 3GIVB 4PJEA 2EEDA 1SJEA 3ILQC 3V6FB 1HNGA 1CFBA 1M2VA 2BSED 4KJPD 4IHOB 2ZUYA 4MX7A 4CUCA 3GUTB 4L48A 3POCA 4M29A 3PNWB 4I88A 4XMPH 3WFCH 3S3SA 4W9LC 5GS1C 5HDQH 2FJFA 1AIFA 1P5VB 1KCVH 4NRYB 1SDDB 5DHYA 3TOPA 3KBEA 2P45B 3REWB 1MHEA 4KMLB 1BG9A 4H8PA 1CQKA 4NO3B 3LXUX 2R0ZL 2EE3A 3AT8A 5KAQF 4B6ZA 1VGEL 1FCGA 3P54A 3RDJA 4D9RD 4LGRB 5EZOH 4K5PA 2NCEA 5D1ZC 4PCSA 4JO3H 1OTUD 5LXGL 4TUJA 3CG8A 1OM9A 4GG8B 2V3DA 3G5ZA 2M2DA 3QIUB 1KIPA 4K3GA 3OLDA 1OGAA 4HAGA 4P3DB 4Z23A 4HJTA 1ZDSA 4M5SA 2GSIB 5E5UB 3IRCA 3UEQA 3AG1B 4Y1AD 1OAXL 3KPRE 4JM2F 3OXRA 4XGZA 2XWEA 3NFPB 3OR7B 4IBTA 4H26B 2EXWC 4NSKB 3D2UA 1L5GA 3LOWA 4R0LA 3MRKA 4S2SB 5DRXB 4BQ9A 1GPOH 2D2CC 4LAJH 4Z5RB 3SKOB 5A43C 2E9WA 3BW9A 4NM8L 3VRLE 4HQQL 1IAOB 4K9EH 4KH9A 5BV7C 4CJ1A 3GXIA 4KRNA 3UACA 4FZEH 4Z7UB 3V4PA 2XXFA 4NNPH 4M8RA 3N3EA 1B4TA 1DJXA 1KYDA 3O45B 1JD7A 5CF3A 1G6VK 4OKVA 4Y8DC 2VITA 5FF6B 3T1FB 1HH6B 1PQZB 2YJQA 3VGHA 4N5EC 1BQRA 2UXFA 1E30A 1VEMA 3BVNB 3L3GB 1U92A 1FL5B 1OGSA 1NEZB 2HLEB 2W38A 3MRBA 4LPUA 5D9SB 1CO1A 3S34L 1RUAL 5TGBA 4MJ2A 5IQ9B 5D2LA 5AW5B 2FWUA 3CIAA 2EO9A 4OF0A 5EU7C 5EC1A 1KZQA 5C7ZA 1J87A 4DP2X 3WNIA 4NP9A 4Y4KC 1H3UA 1NFDA 4BQ8A 3FTWA 1A9EB 3ELQA 3L9YA 4UTBA 3U4BH 4X5WB 4YGAB 4LLWA 4DEPB 5IV2A 5SWSB 4AYID 2PPDA 4GSXA 1UKTA 3EYFA 4NCDA 4YSDA 4YHOH 5CEZE 3QULB 3O3UN 3C09B 4GXVH 5EPMA 4LU5H 2CGRH 2MNJB 4J3OG 4NQXB 2HVKA 1FVEB 3VDAA 2DQUL 3MO1A 4CADB 5JOFA 5KSAA 2DQGL 4ELMB 1KYAA 5T5FA 3TJHD 5K93A 1R47A 4NAJA 4KNQA 1P4LA 1B0RA 4GRWE 2NY2C 2CIIA 4ZAKD 5JLZA 4RBPK 4KFMA 5CBAA 1VESA 4WWID 3OC8A 2PCPB 3NSXA 3MJ9A 4HK3J 4ERSL 4RGMB 1P84K 2D03L 3WNLA 2VXQH 2Y2WA 1BQHB 4KXDA 2A6DA 2MTPA 4BKLA 1JZ3A 3IFNH 3KL0A 3S5LA 4EI5A 2GPZA 2ZXCA 1ZWIB 1X5KA 3ISYA 3C6SA 3OAZH 2IFFH 4QRRA 3ZYOA 4CVUA 1BQLL 2Q8BL 4DF9A 4Z3EA 4Y9EA 4MAYC 1RHHB 3CFJB 3VRIB 1KSRA 4O02A 4JAMA 4PQXA 2BS8A 3L3JA 2DQEL 1MLCA 1NCJA 4IBSA 4NKOB 2GUYA 1OPOA 1QFHA 4IMLB 4TXVB 4DVBA 1JF6A 3CVHA 2FNWA 5BCAA 2W0LA 3CFIC 4GAYA 4WEBL 4NQSA 3II2A 3QFDB 4D8PA 4HBCL 1QASA 1BZ7A 4JFYA 1UJ3C 5DCCA 4PBVC 4Y9GA 1UH4A 3T8XA 1FNEA 2WZ6A 1GKOA 1TJIH 3ARSA 3GD1C 1T4KA 4APXB 1A3LL 3TEUA 1CDCA 1T0MB 2XVBA 3H7BB 4HAKA 4X0KB 4DESA 1TLMA 2G0KA 2BSBA 5D7IB 4NM4H 1TQSA 3CHSA 4XBPB 3TNNA 5GGQL 2CRMA 1DVXA 5HHOB 1RIUL 3RNKA 3ARDB 1T1ZA 5F8RC 1ZXKA 2QQQA 3ZZLA 4TOYL 2X2HA 1FNGA 4OZIA 1NMCB 2CGZA 5GRJH 3I6KA 1AC6A 2NXZD 3QZOA 1KTJA 4Y8AA 2FR4A 2C1PB 4ZQKB 1W15A 1ORSA 3ARFB 3P9MA 1GGIL 4QF1A 5GQBA 1NGWB 5ABDE 3LZPA 1H5BC 4KMTH 1JOIA 5IJBC 4ZUVA 3VXSA 2HFGH 4LSDA 3MBEA 3NEOA 3E8UL 1HXYA 1QSFB 2EO7A 4K73A 1WZMA 4X99B 1JXDA 4FNUA 4RNRA 4L1SA 1UWXK 2AEOA 3KZ8A 1ZS8A 2Y69B 1XCQA 2J43A 2P43B 1QHOA 5I0ZA 2ZG1A 1X5ZA 2V5RA 4JDEB 5F3BB 5D1XA 3RJDA 1EXGA 1B2YA 5D2NA 1SN5A 3A6BH 3DUUA 2VJ8A 2DJMA 4PRNA 5B38G 3GSXB 3D9AH 4O51A 3OX8A 1ZHNB 2Q7YA 3L5WA 4P2QE 1CGUA 1TQVA 2ZUQC 5J11B 3RVXC 1K4DA 1MFUA 4FFVD 1BW8A 1AHWC 2EH8L 2W59A 3AADB 3HMXA 4OIIH 2KQMA 3D50A 3ZDYE 5FXCH 1W72B 1UFGA 4NQCA 1T0PB 3ZQWA 5I8OL 5DMJB 1FHNA 1KGXA 1EFXA 4DUWA 3FQYA 3QAZC 3D2UD 4Z7VF 4ODUB 1I1YB 3WMPA 4YFEA 2WBWB 2E7MA 3CVBA 3WDIA 3BAKA 5C0CA 2A9ML 1TVBA 2V33A 2C9AA 2DD8H 1MFMA 2UY6B 2YR3A 2F68X 3GO1H 5HI3D 2PWHA 5DZNA 3U7YH 2HPOA 2HFFA 2BSTA 5D1ZI 3KYMB 4I89A 1FH5H 4F91B 5TFSL 5CJQH 3DTXB 5E00A 3PJNA 4HLZG 1U8MB 1TJXA 2OYLA 2AJ3A 1YPZF 1NBZA 2X1QA 3LIUA 4LO9A 2Z91A 1CD1B 1MJ8H 2F5AL 4U6VH 1WCBB 5A2FA 3DOSB 5L4MA 3ARTA 3EFDL 2FIRT 4DK6A 4F7PA 2JKIS 5EEUA 5CIPA 1TTRA 4M1DH 3BUBA 4N2LA 4J27A 3BUIA 5HHNA 5DVLA 1FJ1B 5DS2A 5C09E 3UFIA 2E6JA 1FNSH 2HH0H 3DIDA 4HKJA 4MB5A 2O61A 5GPRA 4HOXA 2HTKC 1ACZA 3MV7B 5K39B 1BECA 3RWFB 3WFHA 3AUVA 4ABQA 4XPAH 2GJ6B 4JHWL 4ZODA 2OSLA 4IGBC 5DLML 1N6VA 2WB1A 5KSVA 1ASQA 2YPVL 4HXAH 4NBYB 4UT9L 1SF3A 1YNKH 3CLEH 4G2AA 1J8HA 3KPNA 1KB9K 2IGFH 3GI9L 5KSAD 4ETQA 4KJYA 2C4XA 1EUUA 4WUUD 3WIHA 2ITCB 5CKGA 3DV6B 2LGNA 3V0JA 1FG2B 3BFOA 4S1RH 1QFUH 2VLMD 1C08B 4NZTH 4RRPG 4P5TD 5IR1A 4KNTA 5FAAA 4G8EB 4M7KH 3QZMA 1FA4A 1M2OA 1QNZL 3T4AB 4I9XA 3IGUA 2DL9A 1RLBA 1NCAL 4XNQB 4R5TA 5GS0D 3HC3H 1MQKH 3EAKA 4G7QB 5A1AA 4JW3A 4Y2DC 4PRPA 4EI5D 3TF7C 1U93B 4L8BA 4YXLH 5I1EH 1D5IL 2HZHA 1R5WA 2NY4D 5AD0A 4NZJA 1NIDA 4KI5D 3K6SB 4JRFA 4OQTA 2AK4A 4AVHA 1MDTA 3RZCB 2ICWI 1H8NA 5J7CC 1KLGB 3EO1A 4PLNC 2PPEA 3AFLA 2APXA 1FZOB 2A9BA 5KTEL 3BAEH 4WWOA 4PY8J 2X4RA 2ZCKL 4YC2B 5DMGD 4XNMA 3WIAA 4HS8L 1MJUL 3UROR 3CPUA 4ZW7A 1ZGLM 3LEYL 1IM9A 3GMRB 4NFCA 1CGVA 4S1QL 1I3GH 4LOUD 3P73B 4PN6A 1K5WA 3ZO9A 1FN4B 1MCNA 1GGCL 1KB5A 2WNWA 1TZGH 1X5XA 3FUIA 4FXTA 4KKCC 4MCYA 1AXTL 3X1NA 4QT5B 2F7PA 2YKLH 3PQYB 4K9EC 3ZOAA 2X4OA 2K9FB 3MKKA 1NCDH 2C3GA 2I26N 4OLWL 2VN7A 3LXCA 4R5VA 3HBZA 5CFAA 2G3NA 2IANB 4PI0A 3NEEA 2X88A 1N0LB 1A1OB 1X9QA 3MPCA 4LLMA 4IKNA 1B0WA 4KY1L 4N6RB 1G7QA 3FB5B 3MRQB 2JKSA 2ZSWB 4L23A 5LWYL 2BJMH 3AB0C 4NLHA 3LPOA 4D0DB 4QXUH 4GKNB 2DQMA 3S35L 2JKLA 3VXSD 4XE5B 1NAML 4G7SB 1OSYA 4X6CA 2YD4A 5CLTA 1LHZA 5GGSA 1MEXH 3QRFM 3VD5A 3UP1A 4P5MA 4F7EB 3W81A 4PGDB 1XF4A 4CGTA 2OS7A 2BCKA 2ZWYA 1WITA 2VCOA 2ATPB 1CDUA 1GGYA 4ZO6A 1U6AL 5AKSA 3DK2A 1NCTA 2YFOA 3LDBB 3MRIB 3Q8BA 4KK8D 5CP7A 5D1XD 4YL9A 3DKHA 3LNDA 1PLGL 4NZUH 1NIBA 2GBUA 4HS3A 1NEZG 2I5YH 2ZNWA 1CLZL 1D5BB 4KDWA 2A6JB 1XF5B 3GSVB 3PG2A 2HG0A 2IAMC 4Q9CA 5GZOC 1CT8A 5HVFB 1IZKA 3RUGF 1O75A 1DE4A 3QQDA 1BEYH 1A3ZA 3MRLA 1QAWA 3EBAA 2E7HA 3DUSB 1BHGA 8FABB 2R4SH 3IJEA 3Q5OA 4OIBA 3ROLA 4NQCD 5F7AA 3K6DA 3UJIL 4G8FA 2AJZA 3QUXC 2I9LA 1EFXD 4O9HL 3RX8A 4DWHA 5FYKH 4YPGA 2ADIA 2O6PA 3SDAC 5C0CD 1SBBA 4LZKA 1YEDB 2MCAA 3QORA 5CWSA 1ZT7A 3PP4L 1F02I 1UM5H 1OHQA 1SHMA 5C3TA 5C07B 4YUEL 5AG8A 4CW1A 4AIZA 2VABA 1GZQA 3PUCA 3S8GB 1SY6A 3MGOA 5C0IA 3PHQA 4GAJL 5FM5M 4G72B 4RGNE 2GY7B 3M7OA 1KEMH 5DUMH 4WTZG 4DP7X 1JCKA 4EOWL 5F1KC 3CSYA 2VLKA 1CCZA 1CXLA 2NUTA 3BOVA 4FRWA 4F2FA 2VXTH 3WFEL 5IHZA 1RZGA 2QADC 4Y5YB 4JZNA 5E8DH 2W5PA 3W9EA 3GM8A 3BIKA 5JA8B 4XC1H 2VT0A 5KW9L 2V8LA 5F3HA 3Q5YA 4Y4FC 2OZNA 5AB0A 1NIAA 3GEWB 4J1UA 4Y7OC 2B15A 1NCHA 5F7HA 4H0HB 1NKGA 3DSFH 2YGNA 3B83A 2V9RA 1YMHA 4ODXB 5EN2B 3OMAB 2YXMA 4FKKA 1JVOA 3UYPA 5CCKH 1DP0A 1QLFA 1WUNT 5AL0A 1MWAB 2IADB 4Z6AT 1TO5A 2OQJA 2ZAIA 4G6AD 1QD0A 1OAKH 1B3IA 1HXMA 3ULVD 3WJMA 3B9AA 4UQBA 1E5ZA 4RAUA 2IF7A 3I2CL 5D7KD 2FO4B 4RIRB 2WGXA 3LRSA 1FG9C 3NFNB 3QJHB 3ZSTA 4DO4A 4F7CB 1G5AA 3T0XA 1DBJH 4HPYH 1BBDL 2H41A 2LLGA 3NSFA 1K72A 3O11A 3PP3K 3OKOB 1OAUL 2EE9A 4HIHB 1VACA 2P3YA 3KG5A 3W0WB 5BS0A 3WO3B 3LX9A 2ZCLH 1KXVA 1V7NL 1GZPB 1LP9F 5FO8B 3BT2L 2ZUSA 5FV1L 2NXZB 1BIHA 4JRXA 4OVUA 3ETTA 4M3KB 5HHQA 1KELL 2VDKH 43CAA 5T3XH 4PJEB 2Z35A 4AQ8A 4WEMB 5TE6L 1J5OL 1SBSL 1XIWB 1E4XH 2AK4D 3BN9D 4MX7B 4ODTL 3V4UH 4OLYH 2DB8A 4XP9L 4ZS6C 1A47A 2ORBH 2YSSA 4ODWB 2MFNA 4OFQA 5CR8A 3AW5A 1AIFB 1SOSA 5DHYB 4D7PA 5FUZL 2N7SA 3CXDL 3WU1A 3UIYA 5HI5C 1MHEB 2DWDA 4UBDC 1MRCH 3V7MA 4XN8A 4TUUA 1IM9D 3V0VB 2Q20A 4GAFB 4FQXA 4PJ7F 1JG9A 3ZTCC 2QELA 4IBVA 3PHOA 1XGRA 1Y1UA 1K8DA 5B1AB 1YECL 3DHPA 3BESR 2M1KA 3B8YA 3QC5X 4M48L 3RTQA 4BSWA 1KIPB 1OGAB 2DMHA 3Q43A 1IFGA 2UXTA 4E42A 4MFHA 3O0LA 4O2CA 3UGUA 3OXRB 3MZTA 1HCZA 3DVGB 5L9DH 2D2OA 3MBWA 4XGZB 1OM3L 2ZPKL 3BX7C 3GXPA 4R0LB 1DL7H 1L5GB 1EEYB 3ZKXC 1JRHL 1O6TA 5ELIA 1BXVA 1MIMH 2ZSVB 5D7JA 2H3KA 4JY5H 3IDIB 3ZE1B 5JHLA 1YY9D 1RU9L 3F01A 5CZXD 1A4KA 3ZIMA 4JFOA 2J4WH 4GBXB 4LCCA 4OKVB 4A6YH 3K7UA 2VITB 1INQB 3ARZA 5EOQH 3FONA 1A9VA 2R9HD 5I2IA 3WFCL 4XMLH 2P5WB 5F6IB 1I1FA 1YAZA 4N6QA 1AE6H 2WXOA 3ZT7A 4J2QA 1OHZA 6PAZA 5HDQL 3DK0A 5HYJE 1U92B 2FJHA 4HF5H 1KCVL 3T65A 3MRBB 3FCUB 1OOAA 5TGBB 4HJGB 1JZ7A 1ZRUA 2VW7A 4PJCA 1U8NA 2ZZUT 3CBJB 2LAGB 4MA3B 3IS1X 1GZHA 3FU0A 7TAAA 3DTDA 4AVIA 5B8CC 1GY1A 5EZOL 3SQRA 1NFDB 3Q2VA 5CJXC 1YC7A 2NY0C 2B7DT 4DGWC 5LXVA 4JO3L 5LUMA 2JKTM 1P9MA 4PRBB 4XMWA 4KO6A 2Q86A 3TO4D 5HXMA 5LG1A 1NM9A 5CSGA 3SKNA 2JNZA 1R5IB 4KNSA 4PR5A 4CVWA 5EPMB 2APWA 3KCWA 3MO1B 1OP5H 4FJZA 2NYYD 3H3PH 1BQ5A 3SIKA 1TYJA 4AYDC 1P4LB 4PSRA 3KWWA 4OCYH 1GPOL 3QORD 3NT0A 5KZCD 2OJZL 5CBAB 4IHBA 2A4ZA 1OK8A 4K9EL 3TN0A 4C56A 2J44A 1NLDH 2OMWA 1ZLWH 2WUBH 3LNHA 5FX3A 2QSTA 3DV4A 3RRQA 2XYBA 3BSHA 4FZEL 2A6DB 2DDQH 4NNPL 4LCIH 4HX1A 2EDFA 3S5LB 4OKDA 3I6GA 3RWHA 2YBGA 1F3JA 1HC1A 2UUDH 3QR1A 4ZG1A 2JK5A 4QRRB 3EH2A 4YLQT 1LJMA 1FRGH 2UYLA 4GUPA 3I9PA 2WANA 4G6JH 3ULUH 2BFVH 2D3VA 4MD5B 4O02B 4JAMB 2KZKA 4U31A 1OGPA 3N41F 2MQ0A 1XGPA 1TJHH 3CVHB 4FJYA 2K4WA 5HPMA 1D7DA 2A5UA 3WHXB 5JIMA 5IEHB 1FYTE 2HWZL 4NQSB 4EI0A 1QG3A 4PJAF 4CNIA 1XCWA 1BZ7B 4AX3A 1WE5A 4JFYB 4LQ1A 3U4BL 1T4KB 3BVWA 3KL5A 4YHOL 3ZUNC 3AY4A 5EF3A 2P4AB 1HEZB 4P49A 4GXVL 2YXVA 3NZUA 3QNFA 4JR9H 4LU5L 2CGRL 5EOTB 3QO1A 3TNNB 2VDLH 3D85A 5LBSA 2EC8A 1FORH 4IU2A 1RP8A 4PJBF 2FEDC 4DO5A 4HPOH 4N8CH 1ZOXA 4BFEA 5BS0D 2CH8A 1D5MA 1WC7A 5BJTA 3OR6B 1UHVA 1FNGB 4M43H 4DN3H 2ZXDA 5F89B 4OZIB 4BKTC 1AGBA 1BREA 1CL7I 1XF3B 2J55A 3QUKB 3I6KB 4JRXD 3L4VA 2VXQL 4JM2A 2WQUA 1ORSB 3L17A 2W9DH 3IFNL 5GGRA 3OB0K 3P9MB 5EZJB 1DJWA 4QF1B 1DDHB 3LNGA 1NSNL 5IQMA 4LL4A 2IFFL 2FUQA 2BNQA 2X4PA 3MBEB 1ZVYA 3C75A 1JP5A 2GK0A 1HXYB 5IB1A 4NXKA 1EHAA 4MB1A 3V9EA 1CGXA 3F12A 1ZS8B 4AZ8B 1XCQB 4CSPA 4QHKI 5LN4A 4FG2A 2NMSA 1R5VA 4QI3A 1J1PH 3GJEB 5T1LB 1DR9A 5KBNC 3I02B 2X41A 4FQXD 5F9AC 5KBDA 2F7QA 1KDJA 1ZLVH 3ZQXA 2QPUA 4YE0A 5E6IC 4O51B 3OX8B 3L5WB 3F6JA 4AMXA 4WHYH 1SM3H 2E0PA 4BZ1H 3TVMC 2HUHA 5F1SA 3H6JA 1TJIL 2X0WA 2W60B 4P5SA 4Z1PA 1V3LA 5E0QA 1N12A 4NM4L 1JMZA 3HKZA 4NQCB 3UAAA 2QT6A 3O6FC 1CL7L 3U30B 4MNQE 1EFXB 1HQRA 1LO4H 3NPSB 4F92B 2Y22A 5AAMA 4QHLA 4IRJC 4RAVB 2J6EH 3QJQB 5IFHH 3ZDXB 4HGKC 3QZNA 3ZX1A 5D7JD 3WEMA 5DR5H 3PDGA 2HFEB 5L88H 2G3MA 3TTSA 3PJSB 1F42A 3PNRB 3KYAA 3PV6A 4M03A 4Y5VB 2R2HA 2HT3C 2HFFB 2BSTB 5C86A 3BAYA 3DBSA 2R69A 1JMXA 4G8IA 5AVXB 1BLNA 4WK0B 3VI4E 3VQMA 5A3ID 1NTDA 1E27A 5J12B 4KMTL 1FNLA 3ARYA 3RU8H 2HFGL 2AJ3B 5C0ND 1NBZB 2CCVA 3MLWH 5CP3H 5FO7A 1LMIA 12E8H 5CO1A 1UXSA 2MPAL 1Z0NA 4YEFA 1P7HL 2DQJH 2HUEA 1NCNA 4BFNA 5AW8B 3VD1A 1S9YB 2QHLA 5L4FA 3WI9A 3OG6B 4QOKA 3G5XB 4IMKC 4M6OH 1SFHA 3CMGA 3U2SA 3VFVA 1TZHA 4F7PB 4MXVF 1YNTF 3MNVB 3CSPA 5HVWA 1H6TA 4R2GC 2NPLX 3A6BL 4J4PA 5AVVB 3VGAB 3D9AL 5DMKA 2BIIA 3NOIA 3WFHB 1OV8A 4RDQF 4M61B 1P5UB 5F7DA 1P69B 2OSLB 2VQTA 3V8CA 2Z4QA 4DCQB 4OIIL 1X4YA 3TPUB 5KSVB 3ZTDC 3NRFA 3P1VA 4NHUA 3MUZ1 4NXSA 1J8HB 3KPNB 3CUPA 4NPKA 2EUVA 3K72B 2AV7A 3ZHNA 1XB8A 1AS8A 5DDHA 3THMH 4B0MB 2O1AA 5E6SB 5KVDE 1Z5LA 4J12A 2UZXB 3BGFB 3L9RA 3KPPA 4C56D 1DSYA 4TTDD 2DD8L 2W07A 3KPOA 4QXTA 3GO1L 5E1AB 3NIDE 1VEOA 4HC1A 3U7YL 3T6ZA 3VCLB 1UWYA 5KSUA 3TTYA 2FQFA 1MI5E 2H0JA 1FH5L 3FUNA 3FUKA 4PRPB 4GUCA 4AQEB 3ZKSD 1U2CA 5CJQL 3CZLA 4YSQA 1BQUA 1R5WB 1CXIA 2ZWZA 4JX0A 4LDEB 5AD0B 2GJRA 4AY0A 3RKDC 3HPJB 1FDLH 2VZ3A 1MJ8L 3ULSA 1A6AB 3EO1B 4U6VL 2BZDA 2W8CA 3RWJA 2A7BA 4WFHD 2ZX7A 2ZKYA 4BK5C 3AT0A 3RAJH 4KUZH 4J3TA 4M1DL 3MQIA 4KKLD 3O9WC 2X4RB 3LPFA 5KYWA 1J86A 4XNMB 2GITA 2KZBA 2EXSA 3HLKA 1FNSL 2HH0L 5CJ5A 3SJVE 4P99A 5EO9A 1XZWA 1N68A 2ARJB 1IM9B 3APDA 1ODUA 4I18A 1X5IA 1KB5B 2HSIA 4XPAL 1NUDA 4UT6A 4HXAL 1IGTB 3FT9A 1YNKL 2NOYA 3CLEL 5SWZA 2IGFL 4OGQC 1KNOB 1QHPA 1A7QH 3D85D 4JFQA 4P8QA 2NY3C 1RVFH 4N22A 3MVSA 1IFRA 2E46A 5TD4A 4S1RL 3ZLQC 1QFUL 1JTTA 1R3KB 3DVIA 4NZTL 3TXAA 4M7KL 5JW4Q 1EXHA 4LHJB 2JIXB 3W39A 3CN0A 1G7QB 2YAFA 2H47C 2IH3B 1MQKL 3CBKB 3HC3L 2ED9A 1RD6A 1AO7E 4Q7DA 4HJ0C 4Z7UE 3C60B 4CC1A 3QBTB 3H2WA 4YXLL 4Z7VA 5I1EL 3E6FA 3UP6A 4KHXH 2GHWB 1GVIA 2WLYA 4PWJA 2ADGA 5DA4A 5DVPA 3SQBB 5GGSB 4Z76B 4CMHC 1NDTA 4P5MB 3BQUC 3WFBH 3QJXA 3EBGA 1OVZA 4DZBB 4XP6H 3TCTA 3QG6B 4M9OA 5JPMC 4JQIA 1EJ6A 5AW2B 3NAAH 2I9TA 1NCIA 1MOEA 2VZ1A 4KNUA 5CP7B 4XO5A 1YPZA 4WO4A 1DUYB 5FCUH 1T66C 1JZHA 5IBLC 5B39B 4NC1C 1FE8H 2JI1A 3HNTH 1NFIA 1PW3A 3QPQC 2EYTA 1KEGH 4M1CD 1CT8B 1F4XH 1TZGL 2H2SD 2RAMA 2V3EA 4Q4IA 1DJIA 2QPFA 3DURA 1WP6A 4NKDA 4A38A 1MCLA 2KDYA 2YKLL 1HJBC 3WE6A 5I75B 2KKQA 3C08L 1N8OE 1NCDL 3VRLF 2E9JA 5JXAH 1C5DA 1EVTC 2X9XA 5B21A 2AJZB 2E76C 2I9LB 4PLOB 3S3CB 3X3GH 5I0YA 1Z9NA 3D25B 5IQ7H 2DLTA 4ELME 1PZDA 2ZCHH 2JI2A 3P4MB 4AJVA 1FZJA 4Y7MA 3K6NA 1KACB 3WDJA 4OF3A 3JZYA 4Q6YA 5EEYA 3MNWA 1OWWA 3HTLX 4WIQA 5KZCB 5CWSB 3ULUC 2PTVA 5KOMC 4LRIC 5FFLA 2BJML 1HSAA 5EEXA 1ROWA 2OCJA 3PHSA 3WLBA 1EZVX 4QXUL 4MKTA 1QP1A 5DZJA 5ECGA 4EXPX 3SPHA 2W94A 32C2A 5C0IB 4HG4J 4YR6A 4H8WC 3IKCA 2EEXA 1JHLH 1S78D 2NUTB 2VLKB 1MEXL 3CSYB 3QIBD 5C0EA 1RZGB 4JZNB 3JVGA 4MXQD 3W9EB 3J7HA 5E9AA 3SODB 3WN5C 5E6ZA 3SGEI 5F3HB 3GYRA 1FLTX 3A67H 4J1UB 3MACL 2XY2A 3I75A 2JE8A 4BDVA 4Y4HD 4NZUL 5BZDA 4J4PD 4NUJA 1P53A 2I5YL 3S36H 2X1XR 2AZAA 3UAJA 1QLFB 4I1RA 1TTGA 1KN2H 4ZUSB 3NA9H 2OQJB 3H9HB 3U2JA 1K3ZA 1RCYA 1BEYL 4JQXA 4GRWF 2AQTA 2NNCA 3WJMB 2GSMB 2R4SL 1KYOJ 4RAUB 1DBBH 3WTTA 5A40E 5IJKA 3LRSB 2OXGB 1QFWI 4QUOA 5D7IE 2X2IA 3DGGA 5FYKL 3PWPA 5K9QG 4LARH 5HHOE 3O11B 1GYCA 4EI6A 1KGCD 3EG9A 2RB8A 1H8LA 3B5GA 3QI9A 1J9SA 1VACB 1A3QA 1OALA 5BS0B 3AABA 5FYJH 4LEXL 2FAUA 2CLRA 1S7SA 1UM5L 4V33A 1UATA 2HX7A 2IEPA 1MRFH 5EBMB 3RY4A 2VXUH 1RZIB 3G5WA 4Z3FA 4KTDH 5B22A 3TIEA 4Z77A 2ZONA 2BP0A 1U8LA 2IBZY 5DUML 2VXVH 1KEML 2HTLC 3Q13A 4XOAA 5FDYA 2VXTL 2V17H 2ZJSL 5E8DL 4C59B 1CDYA 4JPKH 4XC1L 5E8NA 1QSFE 4QRAA 2J7LA 3NK4A 2YSSB 5DXWA 1KCUH 25C8H 5FFOA 2GAZA 3B56A 3DSFL 3N44B 4P4RA 2DWDB 3MROA 4JFEB 3ZIYA 1QBAA 3SCMA 5I1KH 1WSST 3BWSA 5CCKL 1E4WH 2NXYC 1VGKA 5EU6B 4NX0A 2E7CA 1OAKL 4PJHE 5LJYH 3BO8A 1XGRB 4DW2H 3HE7D 1NIFA 1NFAA 1K8DB 5SWZD 3RTQB 2HRHA 2H9GB 4M00A 2MMXA 1PF3A 4P04A 5DFVC 1G7IA 5SX4I 1DBJL 1UEYA 3F2LA 4E42B 4HPYL 5DRNA 4O2CB 2HVBA 1R3IH 2J6WA 3PS6A 1BAGA 5FEBA 4JE0A 3IS0X 1G1CA 5DJXA 3ZTJG 4CC4A 3EGXA 1MNUH 2TSBA 3P77A 2ZCLL 4LEOB 2B4CH 2YEVB 4NB7A 3GSWA 2WXNA 1REIA 4KJQC 3GHPA 2VDKL 1A4KB 4NO5A 5T3XL 3CFMA 3WS3B 1G7HA 1C9SA 1LO5A 1E4XL 4Z0BH 2OMYA 2I07B 4H0LC 3U83A 3TM6A 3V4UL 3FONB 5HGHA 5I2IB 4Z78A 1Q9WA 4OLYL 1O9WA 3FO1A 2FRGP 4PLJD 1I1FB 2G9HA 1MLBA 2ORBL 4B9CA 5E4AA 3QA3A 1NBCA 2FJHB 2CO6B 4ZMPA 2H0PA 1NL0H 1S7UA 3VX0A 2BH0A 4WO4D 4JO8A 1ONQA 3CFNA 4X8JA 4FABH 1AZUA 1J0JA 1Y6NR 3MCKA 2XJLA 1MRCL 1U8NB 4E9LA 3L13A 1TLKA 2QSVA 5H2BB 2PO6C 4U4BA 3SN6N 2X0VA 3WSQH 1U42A 2C9XA 3HC0B 1L3WA 4M7ZB 4O5LH 2WZAA 3S8WA 1OAYH 3MV7E 2CPCA 4L4VA 3JVFC 3GBNH 4HIQA 1VADA 1XEDA 4X9HA 3MGTA 3FQUB 4PVBA 1TJMA 2VDPB 4WHTA 2WBJD 2BP8B 2RFXB 3CK0H 1MPAH 4G11A 4PJ8A 1OZUA 4PR5B 3LQZA 4BXSV 4PU2A 3ZMEA 3T5WA 5L9DL 2EDTA 1AD9A 3IDYB 2EH7H 4X42A 3X1EA 4XB7A 1BJ1J 1DL7L 1Y0LA 3KWWB 1D7BA 4BXVA 1ZHBA 2AXHA 3B34A 1MIML 5GXBB 2CLVB 5DURD 3TN0B 1DVUA 1OTTD 2BY1A 2OMWB 4XCNA 1IV8A 5TE7H 3VI3E 3W2DH 4AJYV 4IBUA 3DV4B 1M7XA 3Q2WA 5B7MA 1DVTA 5DFWH 4ZW8A 5C0DA 3BZEB 3AREB 2J4WL 1MAJA 4EDXA 2YS4A 1ORQA 1I8MA 5JO5A 3RWHB 4A6YL 5T1JA 2G2PA 3L1FA 2DLGA 1F3JB 3BP4A 2L4OA 4P57A 5DK2A 5EOQL 3CDGB 2JK5B 2N01B 3TEXA 3VB8A 4XMLL 2F53A 5HSFA 2UYLB 4GUPB 1WAEA 1AE6L 1RJZA 3TC9A 3JTSA 1ZV5A 1U3HA 2X4QA 4HF5L 3FFCA 5T3XD 3NJXA 2VDNH 1FPTH 2ZOLA 1LMKA 3FB6A 4L8DA 1LK2A 1XGPB 5EZLA 5IEKB 3FH8A 1S7TA 3BQVA 3MLTA 4Y5XB 2YA0A 5I6PA 2Q8AL 3ECBA 3V5HA 1AZVA 4MNGB 4WW2C 5IB4A 2P24A 2YD0A 4WAFA 3UAJD 3QW9A 1G7JB 3GMQA 4GG6B 1I7RB 5KS9E 1LYQA 1GS7A 4N0FA 4JL1A 2K4AA 3H9SA 4FLRA 2MQGA 4OD1H 3V0WH 1A4AA 4UOZA 1OTSC 1R75A 3QXDA 3Q06A 4DP8X 3PQYE 5IY5B 2OP4H 1XBRA 4DFHA 4YBLC 4U0RB 3Q44A 3OF6A 2CAKA 2VMJA 3PWPD 3TZVA 3V5KA 3D85B 4ELKA 1EBAA 3H3PL 5IMOA 1PEZA 2IANE 3VU2A 4B9GA 4EUPA 3QI9D 3EFOA 4JFDE 4FQPA 1Q90A 4OCYL 1CLCA 1T2JA 2YOAA 4AVJA 1WC7B 5BJTB 4NENA 2NX5E 1LE9B 1F4YH 4TQIA 3N0PB 1AGBB 3V95A 4EZMA 3VFWA 1NLDL 2FDBP 1KTLA 1MCSA 1RZ7H 2WUBL 1BFOA 4QGYA 4YLBA 1GOGA 3EOAB 2BS71 5AEAA 2DDQL 4JM2B 4RH4A 5GGRB 2IQAA 4FTVD 4LCIL 1V8HA 2FBOJ 1E2ZA 3OJDA 3N5AA 3SSGA 5LG6A 3HB3C 1F3DJ 3FB8B 5D1QA 2BNQB 1CR9H 2X4PB 4AQOA 1FRGL 2BC4B 2GK0B 2CO4A 3P0YH 3D48R 4G6JL 5ID0A 3ULUL 2BFVL 2DIBA 2D7MA 3LVEA 3GTVA 1K2DB 4YHKH 3GSQA 1YDPA 2AJXH 4CN1A 3VFSA 1TJHL 1JPFA 3BVXA 3BKMH 3OBAA 1R5VB 1KMGA 2VGLM 3MOAH 2AJSH 5I9QC 1D5ZA 2Y7SA 1BG1A 3GLAA 4UQ9A 4F8TA 2VLRA 5I74B 3PY9A 4IOIA 3VH8B 3EJZC 1KTCA 2X2YA 5CZRA 5B39G 1JV5A 1FC2D 3VXOA 2V9TA 3KWXA 3OKNB 1NPNA 4N20A 2BLFA 4JR9L 4FXGC 4BFFA 1UASA 2KC0A 4OM0H 4OUOA 1BMWA 1M05B 1M6OA 2VDLL 4UQ3A 2YO3A 3G5YB 1FORL 1QNIA 2OTUA 1ID5I 2XQBH 3GRBA 3QYCA 4HPOL 4N8CL 4PH8A 4XXDA 4QHLB 2YD5A 1E8WA 4M43L 4DN3L 3DO7A 4NERA 1GSKA 5EORH 3ZT6A 4KVPA 3QP3A 4P59H 4H1LH 5C07E 2R2HB 1ZAGA 3EW3B 2W9DL 1Z9SA 2AVGA 5GGUA 3BD3A 1BLNB 4Y89A 5EU4B 2BOBA 1JNHA 1E27B 1QLEH 1WCQA 2ZXGA 4JEGB 1H15A 5FO7B 1L9OA 4QEGA 3S4SG 5D93C 4BCXA 4B9PA 4U2ZA 4OZGB 4NN7C 1S7WA 2CJUH 4FX5A 1BA9A 2WWKT 1E67A 4GKLA 3GLDA 5FYLD 4QOKB 2HMIC 2O5ZH 5DD3H 1TZHB 2GEEA 4LBEA 3QJUB 3QPKA 5I5MA 1J1PL 1LGVA 4GQRA 2E4FA 4RLDA 4G8GE 1TFPA 2QVFB 4A2MA 3NJGA 5GS1A 1OIOA 1SM3L 4BZ1L 3BZFA 5INDA 1MCKA 1FVCA 1QHQA 4YHYB 5F7KC 1AZNA 2XG4A 2WO2B 4GY4A 2L7JA 2B9BA 3WIIH 1HE8A 3N40P 4NHUB 4QYOB 1IU1A 3ERXA 4N8PA 4PJAA 4OM1H 3VB9A 3M1BA 1LO4L 3CQPA 5F70A 1SXBA 4FQJH 4BD4A 4F80A 1VERA 2J6EL 3QQ3A 5IFHL 1SQ2N 5D1ZA 4U4IA 2YRZA 4K8RD 3HRZB 3HPLA 4B9ZA 3KPPB 5J4MA 5DHVH 3LNFA 5DR5L 3W0WE 3U0PA 5L88L 2W92A 3KPOB 2R39A 4QXTB 3IEAA 3GSNB 3SE4C 1NGQH 4IU3A 1VKXA 5IVNA 1JGLH 2DLFH 4PJBA 3DPBA 3DDFA 3W82A 5JPNB 4UI2A 2NNAB 5DYFA 1WQVT 3RU8L 3KXFE 2ZCZA 3MLWL 2F53D 3DXAA 2BPBA 12E8L 2YAMA 4GQZA 3KHQA 3QUHA 5D6CB 4I85A 4G9FB 3ULSB 3LHPH 1U3HD 5L7XL 2DQJL 2PXYC 3FFCD 4TSCH 2OMZA 4ZUUB 3RWJB 3RDTC 3LH9A 4M6OL 4BQCA 1MNNA 2OX5A 4P9HH 5FO9B 3VFNA 3ABMB 2FX9H 3DVNA 5E51A 3VXNA 5E24E 3GXDA 5F2FA 5EO9B 5CGBA 4N90E 3I85A 4I18B 4A7SA 1A14H 4KU1A 2H32A 1IGFH 4NAQA 1FUNA 5TTRA 4GNKB 4E5XB 2B4CC 3NSCA 5B3JE 4HBQA 3W3BA 3OF6D 4R9HA 2VDRH 3TZVD 3TA3A 2YPLB 1OGAE 1NC4B 4UUJA 4LNRA 4Y4KA 1P7QA 3AWGA 1QUNA 3THML 1WFIA 5JQHC 1A1NB 1N18A 1EX0A 2WQXA 3IDNB 4AT6A 3S8FB 5AW7B 1BZ9A 1WF5A 2J20A 1ES0A 1BV8A 4GXFA 3UYRH 3WYRA 4X8CA 3FT1A 5A16A 4OJAA 2WCGA 5F9OH 4L8CA 4OAWA 1LWJA 4JKNA 2AEIT 2XKSA 2ICWA 2VMEA 1TNMA 2JXMA 2WJ7A 1HSBA 3C5JA 5LDSA 4WFGD 1PY0A 4WI2A 4LLDA 3K74B 1AG0A 1FDLL 4CVZA 4Q0XH 3B7RL 2Q7NA 3N43B 2P5WE 3BUYB 3DC0A 5I8EA 1OLLA 1HOCA 2ENPA 2COVD 3RAJL 4KUZL 2WNXA 4TYUA 1XAKA 4XE0A 3HIZA 3K3QA 2FECL 2PW1B 5AYTA 5J9PB 1U2YA 1A4BA 2VLRD 1ADQH 1CZ8H 2X4NB 4N9GA 4UM8A 3DRQA 1VCAA 1NFIB 5I1IH 5ACZA 2EYTB 1XSIA 4XPGH 1MF2L 3MRHA 4QTHA 5KVGE 1JL8A 4YBHA 3CZFA 5MHSD 5JORA 4XMVA 1YNTA 3HG2A 2AQQA 3MREB 4WJ5B 1LILA 4N3TA 3WE6B 1BXAA 2C9QA 2P5EA 4P4KD 2ZOUA 3VWKA 1A7QL 4MVBD 1C5DB 1U8IB 1AR1C 5FKAB 1CIDA 1RVFL 3P30H 2APVA 4YDZA 2RTTA 4UMSA 1CDIA 2QGBA 4WI5A 1U3NA 2FQDA 1UJ3A 4WFED 3CLFH 3OHMB 3F83A 1HAUA 4C47A 3KDPB 3VW3H 1JDDA 3MNWB 1KBPA 3KS0H 5DC9B 3ZXAC 1J0IA 3RGBA 4JCLA 2I32A 5DURB 2B39A 4A2EA 1GH7A 3WLBB 1W0WB 4H25B 2MOGA 4I0KA 4I4WA 3UTSE 4OI9A 2R29H 1I8AA 2HYMA 4YR6B 1G0DA 4AV0A 4KHXL 4W6XB 1CD9B 3IKCB 1YMMA 4PRIA 2ZXEB 4NZ8A 5C0AE 5IB3A 2NUPA 4TL5A 1BQSA 4QRRE 2QVIA 3ESUF 1L9PA 3MA7B 1DQVA 5DHEA 3WFBL 7PAZA 3LKQA 3VXMA 3LPGA 4JHUA 1KXHA 2K8MA 4M6MH 4XP6L 4AGMA 1R33A 2A38A 3O2WH 5IIEA 2H26A 5C1MB 3NAAL 3MNMA 3EHBC 4NYLB 4J3OF 2QBWA 5LAXA 4BFIA 3DX3A 3S3BB 1G84A 1DQQA 1H5BA 4YIQA 2X3CA 5FCUL 1JGUH 4JMNA 1S9KC 1PLAA 3OM3B 4OGAD 1FE8L 2ED6A 4TVPE 4WFFE 5C2BH 1E5BA 3HNTL 5F9WB 1TQWA 2BSCA 2X1OA 4P2RA 1KEGL 2D0GA 4LQFH 3II1A 4FI6A 1F4XL 4AL8H 1ADWA 4YXKH 4AI7A 4FG4A 3VWJD 3NGBB 5D7LE 4HIJA 1N4XH 5EWIH 2JWYA 5LLIC 1JTOA 4HCRH 5C6WH 4RGOH 4ZNEA 1UWFA 1J8SA 2WQRA 4A2HA 5JXAL 3X3GL 4AM0A 2IH9A 3DGGB 5IQ7L 2FWOA 2ZCHL 4MRCA 2QGEA 4PJ5D 4L1BA 5D1ZD 4HWZB 3P2DA 3FQXB 3EG9B 1OARH 2EZ0D 2MRYA 5ICZA 2CO2A 3QI9B 1A7OH 4OCSH 3FCSA 3MU3A 5FW8A 2A4CA 1W0VA 1UKSA 3QFJD 2DBLH 5IREA 5I1LA 1AHWA 2CLRB 2ZIDA 4X9YA 1S7SB 3D0AA 1KLUB 2B20A 2X38A 3FQ2A 4F9LC 5TQ0H 5JYMA 2W9LA 1W16A 2BP0B 1U8LB 2VL5B 4GW1A 4LXFA 5IVZB 5JR1H 4WWKC 3DXAD 1JHLL 4WDIB 1PNCA 1ZHKA 2WOYA 3VSUA 5IVXE 2UX6A 1CTNA 4NUQA 3QZWA 1IO4C 5HYQA 1C8PA 1OQOA 3A67L 2NY1C 3K6FA 5FGBC 3UPCA 1H9VA 1XH2A 4QD2E 4HCGA 4M02A 4ZFOL 5CSZB 1EA9C 4G6FD 2VJ0A 1K5NA 2IH1A 4TQ8A 3SCMB 4KC3B 4N5ED 4RMBA 1F13A 1KN2L 3O6MH 3OHXC 1Z5YD 3NA9L 1JD9A 4EJ1C 3SDDB 2ERJC 3PRZA 3BO8B 1JI2A 2NY6D 2WOBA 3O8XD 4X6FB 3CU7A 4HWEH 1DBBL 4XN4A 2AEQH 2HLFC 3G7TA 3TA3D 4HOMA 3VH8G 4JO4H 1G7IB 1I7TA 1P7QD 5I17B 1G1KA 3QNZA 2Y24A 2EDWA 2ETWA 5DRNB 3KPRA 5LO7A 1YNLH 2E8YA 5SX5H 4PWHA 3WNOA 5I8KH 5E2VH 5DJXB 2HJLA 5GRUH 3ZDXE 3ZN6A 1HWWA 5FYJL 3P77B 3HHSA 4MQ7B 2AAAA 1LO0H 4RQQA 3EGDB 5CINH 3TH3T 1MRFL 1U91B 2VXUL 3C5SA 4ZOCA 2XVGA 4KTDL 1GJIA 2BVOA 2YZ8A 3FU3A 2R0KH 4NO5B 3TEZA 3AM8C 4Z7IA 4R4NC 3RY6C 1E3XA 2VXVL 3ZK0A 4P2AA 2BVPB 2PCFB 2YQ2A 4JBSA 3HE6A 4JFXA 5L0QC 4OCXH 4BH7B 1H6FA 3IXTA 1Q9WB 4LKCA 2XA8H 4JPKL 1AD0A 2J73A 2Q10A 1ZVSA 2JH2A 3ZHDA 4AC4A 4MMXC 3ARUA 4DOHB 3Q05A 3QA3B 5CUSH 5F1IA 1KCUL 4JPSA 25C8L 3IM1A 5DQJA 4XAKD 3TT1L 1S7UB 3QJVB 4NN6B 3MJ8B 1TMCB 5JPMB 3QXWA 5I1KL 2ZXWB 2ROYA 2WXPA 3T6QC 1CYGA 3R18A 2WQWA 1E4WL 3SBWA 3PJLA 3RWDA 1RIVH 5JMOC 3GC3A 4XN7A 3WL9B 4L4VB 5A2IH 3KH3A 3LCYA 1DLHB 4DW2L 1VADB 3QR2A 2D73A 2X4UA 4EN2A 1RULH 1PZUB 2P5ED 4E9XA 3IYLW 4MCZA 3VWKD 3ZTNH 3PXHA 4IKIA 1A6ZA 2Z65C 4WHTB 4PJ8B 5H37G 5TDNA 1GAFH 3P4OA 3LQZB 3RGVC 3FTGB 1JZIA 3KH4A 4P2OC 1R3IL 1PCSA 1A4CA 3LMJH 4PCTA 5AVRB 1RMFH 3VI4F 4ORZC 1BM7A 4JKWA 4QAMB 1MNUL 1T6WA 3GSRB 2B4CL 3JV6A 5F7BA 5DWUH 1J18A 5HI4C 1FFOA 4XHJC 4TF4A 2G30A 3BSGA 2E74C 2N1TE 3C2SA 1QW9A 2B5IC 3QPXH 3SKUD 2I7SA 3HZVB 3QYNA 3D34A 4PRPE 3MUHL 5EUOB 3TBTA 5IQNA 5T3ZH 2LU7A 2V7NA 4NOFA 4Z0BL 2F2HA 5JO5B 4YDVA 5JHDA 5AYUH 1MCIA 3EKCA 1T89A 4U1GB 4ZZKA 5L6YH 2VNCA 2F53B 2N4IA 3RP1A 1OCOB 5ICXA 1OOWA 1RJZB 1RK0A 3FYEB 5DYOB 3JTSB 3TJPA 2W91A 4ONFH 2EXYD 5EBLA 2Z7WA 4NDMB 2ZOLB 3FT3A 4XCCH 5GSVA 1NL0L 3FB6B 4L8DB 1QSED 1NCGA 5EU5B 3FN0H 5EZLB 4FABL 1EJ8A 1S7TB 2XN9E 3QCTL 3V5HB 1L0XA 5C9KA 3ECBB 1OSEA 2O30A 2CE6A 4P2RD 3WSQL 2OCFD 2WBKA 1ND0B 4NI6A 3E0GA 5AAWC 4N0FB 1OAYL 3W1ZA 2BVYA 2BINA 1PZ5A 3BPCB 3DBXB 4HSQA 3GBNL 3H9SB 5C08A 4AYBA 5KN5B 2QSCH 1AZCA 3BEWA 4UQAA 2Z31A 3AS0A 5AWNH 3U0TA 3QC6X 1EEZB 3QXDB 3HS0C 4ABVA 4JO2H 3CK0L 3CDZA 1MPAL 3NIDF 2VR6A 3GLEA 2R2EA 2VLLA 2ZXBA 2MNUA 2XTLA 4M93B 4ELKB 4E5XG 5JW5B 5IMOB 2IAMA 2EH7L 2MPVA 3NJKA 4EUPB 3EFOB 2YUWA 1X5AA 4ODBD 4LSPH 1Y7VA 4QJ4B 5B7EA 1HI6B 3IAQA 3VFWB 3W2DL 3AQYA 4NZRH 1BFOB 4XWOD 5F21B 2H5UA 2VOTA 3ZQ9A 5HD8C 2IQAB 2XVLA 4HHWA 2EO1A 3OJDB 3SDAA 4JO1H 5IB5A 4XPFH 5MERA 2Y4SA 5D1QB 3QUMH 3B6SA 2O4EA 1HX0A 2VKXA 4ZXBD 1SEBA 1JCVA 3NIFB 2VDNL 1FPTL 4N4YB 4P23A 3HN3A 5ABZA 1QX1A 1ZA6B 3QDGB 3D3VB 1JPFB 5E23A 3LD8C 3L9BA 5EF1A 1D5ZB 4XNZB 4Z9KB 4FQLL 1ED3A 4ZUTA 1UCTA 2YLKA 3MLPA 1JVLA 2DV6A 1CFSB 2E5EA 3KLHC 5KEZA 1MAKA 4OJCA 4P2QA 1HU8A 4N2EA 2YAEA 4OD1L 4R84A 3R7RA 4G42A 3V0WL 2EDDA 4L0YA 2G5BA 1BVKA 1PJWA 2OP4L 5EO1A 1YEWA 4I3GA 5G5DB 7CGTA 1UVQB 2EIZA 1AYRA 3EYVB 1M6OB 3KPRD 2LW3A 3TV3L 2OTUB 3RKPA 2YQBA 4Z7UF 3L4ZA 2Y3NA 1T5WA 1AP2B 4N3UA 3IXAA 3P0GB 4NQEA 2VE6A 4E0RA 3DO7B 3GJFA 3TNMA 4NKIH 2MIZA 1PAZA 1RZ7L 1QVOA 5EF2A 1IKFH 2EDYA 4I3SH 3IGKA 3MRCA 4P2YA 2CHWA 1Z9SB 5GGUB 1FFNA 3F85A 3RWGA 1E43A