1VCBC

The vhl-elonginc-elonginb structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
142
structure length
142
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ELONGIN B)
publication title Structure of the VHL-ElonginC-ElonginB complex: implications for VHL tumor suppressor function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 1999-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 1vcbC01
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 1vcbC02
4B95C 4WQOA 4W9LC 3ZRCC 4AWJC 1LM8V 4W9IC 3ZRFC 4W9DC 4BKTC 3ZTCC 4B9KC 3ZTDC 4W9FC 4W9GC 5LLIC 1LQBC 4W9KC 4W9EC 1VCBC 4W9JC 4W9CC 4W9HC 4BKSC 3ZUNC 4AJYV
chains in the Genus database with same CATH superfamily
3L3KB 2O5YL 6TAAA 4YHOH 1BPVA 3BH9B 1ULVA 1U8NB 1WCQA 3BRGC 5DMGD 4Y2DC 2VR4A 4J27A 3GXUB 1AZBA 3QORC 4DEPC 3G5VB 4H1LB 4M02A 1F4WH 3UABA 5F9WC 1AR1C 4N8VG 1N9PA 5KSUA 5B8CC 4BFIA 4CMMA 4XPTL 5I15H 3H53A 3SGDH 1G9MC 2NXYD 2WKOA 3R4DA 4JKPL 4FNPA 5HHQB 7CGTA 1DZBA 4UDUA 4X8GA 2EXWC 1M71B 4PM1A 5C09E 2IH3B 5C08E 1QFUL 4YIQB 4WWKB 1BXXA 1JMZA 4E5XG 1Y18A 3V4PL 1KB5A 5KVEL 1HXMB 5IHUH 1LO2H 1F18A 2VZ3A 1NAMA 5EO1B 2AQPA 1A8JH 2GK2A 1VSCA 5E9AA 1M6OA 3VA6A 5EH1A 3GSVA 5GZNA 1E8XA 5E8DH 1U3HB 4OFDA 4DN4H 2M8XA 5HBBA 4Y16A 4OBRA 4N9GA 5HYSA 4QY8A 2JKTM 2KBGA 4HMEA 4P04A 3B5TA 4X7CC 3HFML 1QRNA 4NZJA 5C09B 5I73B 5AW2B 3TM6A 3TN0C 1V7ML 5F7WC 3P30H 5E2UL 2YD6A 3KD4A 4P46B 4N8VB 3BH9A 2XZCL 5LVEA 4JHAH 4NC1C 2ZUQB 2YA0A 5ADPL 3G5VA 2YZ1A 4H1LA 4XP4H 4JEGB 2GSGB 5GS0H 4IRJC 4Y1AE 2QR0B 4M6NH 4QTIH 3WHE0 3U6RB 2KI6A 2ADGA 3AXLB 1EZUA 4E5XB 2YPLA 2BSDA 3E6HB 2X88A 5ACMA 1UENA 2JKJA 2Q76B 5HHQA 3SDAD 3S5LG 1V3MA 3LRSB 4D94A 3SODB 2ZD0A 4YIQA 4Q52A 4WWKA 3LH2L 5E0QA 4OH2A 1HXMA 2CDFB 3F6JA 2D4FA 4QXGH 5ID1B 1ZTMA 5DJ2B 4MJ5B 5GSRB 2DICA 2WY3B 4E9LA 5F72S 1J8HD 4FXKC 4Y1AB 3RBSA 2CGRH 3LZNA 1KCLA 1U3HA 3GS0A 4P23B 4OW6A 1OP5H 4F8OA 2F74B 1HZLA 2BP3A 4DW2H 1HXYA 5A6IA 2CIIA 2OL3A 1A5FH 4ELMF 2K9FB 5DJAB 4B9PA 1MIMH 5C09A 5CAYB 3K8LA 5C08A 4OT1H 4O51B 3O3DB 3DROB 4NERA 5CHNB 4AEFA 4B9YA 3T2NH 5E94A 4PS4L 1UWEH 4LSTL 2FO8A 4WU5A 3UAEA 1HCZA 2R0WH 3GJEA 1VGEL 4IRSC 4P46A 5GGTH 4QTFA 4EO5A 1AZNA 2BFVL 3QEHA 3EYVB 2GSGA 2O30A 4PCTA 1SY6H 2QR0A 3QDHA 5DTFA 3S5LB 3ZT6A 3PDGA 3WS3B 5TE7H 3U6RA 1S5IH 3AXLA 4FRWA 5EOQL 3DUSB 4OZFA 4GXUM 1SF5A 2H47C 3BWAA 3CSGA 1DVFC 4EBQL 1P53A 4UV4L 2WLZA 3VD0A 4HXBH 5EBMA 2Q76A 4BFOA 5CEXB 3JTTA 5E2TH 4QOKD 3O8XD 3EFDH 3DVGA 4JPVH 1PF3A 2K3TA 3VO0A 1VPOL 4LASL 5FHAL 1K72A 4EE2A 4IS6A 1GS6X 1KC5L 4KBPA 4BGLA 2BVOA 2FLMA 3BN9C 2QVKA 4AIZB 3IDJB 3ASWA 1ACXA 3T77B 2KQNA 5DJ2A 1JZEA 5MEQB 1SEBB 1L7TH 4BH8B 4GEJA 4OCWL 1U36A 4Y1AA 2WLMA 4C4UA 1IBGL 4P23A 2F74A 2R69L 3UGXA 4XCYB 3QQ9D 4XC3H 5C6TL 2QBWA 1VFBB 4NJAH 1S6NA 3ARGB 4IOSA 4YC2B 5DJAA 1BF5A 4ZMYA 4FFWC 1OTSC 3SGJC 2WXHA 4PY8I 2VKWA 2CAKA 3WJMB 5I66A 1LWJA 2XQ0A 5EWIL 1LDSA 1T2JA 3HJ0A 4ZO9A 1I7ZB 5TK2A 4U3HA 1L0PA 3PUUA 4HD5A 4HFWB 1LO3L 4JMNA 3BVXA 4TSBH 3VB9A 3GB7A 4X80H 1RHHB 2IAMD 2H6UA 2RB8A 2Y2YA 4L3EE 4R8WL 3QFJD 3VDAA 3ZSSA 3Q8BA 3MRFB 3EYVA 3C09B 1FRGL 3ECVA 2IGFL 5HHOE 2OJEA 2CR0A 3MLWL 1HWGB 1F56A 3DUSA 4G8AC 4BQCA 3CZNA 5KN5B 3A4FA 3M1OA 1T5WB 1HL4A 2D7TL 2NX5D 3LIZL 1R34A 3VM7A 1FJ1A 3JQOB 3SBWA 2OCFD 5CEXA 3ULUH 4NJ9H 3BMWA 3QIWB 1EEYA 3CXHJ 5LBSA 3H55A 5J56B 4PVNA 1P7HL 4GMSL 3NG5A 1KTLB 2ZWKA 4B5ZA 5L4FA 4ABQA 2WYIA 4V2CB 2HMID 1RUMH 3NPSB 3QUHA 1U9KA 1KGXA 1DJXA 3L2MA 2YO3A 1SLWA 5IFHL 4NRXB 5PCYA 3IDJA 5T1LB 1S7RB 1LM8V 3ZTJH 1JGLH 3LQAL 2BP0B 5MEQA 1SEBA 4L3EB 4BH8A 2VM4A 1J1XH 4GKSA 1AVAA 1T3FA 5HHOB 3DC0A 3K2UH 4JKNA 2UXFA 3C5SB 2ZTBA 2FB4H 1SJEA 4UOQA 4RAVB 5IZ7A 2RIKA 1VZHA 2Z0UA 3ARGA 1KZQA 4JG0L 2MEJB 4LK4A 1QBBA 2H7WA 1Q72H 1F2XK 1MFBH 2IOMA 5ESVB 1F90L 1NGWB 5E2VH 3WJMA 1IGJB 3HLAB 3NJVA 5FM5O 3EO1B 4Z7NE 4AW7A 2F61A 3GLDA 4HISA 5F0PB 3OKOB 3AT9A 1YAIA 1TVDA 4YHYB 2G60H 4KVNL 1NCJA 4OCNC 4NQCE 4FG6D 1WO2A 4EZMA 4GRWH 3VXME 1B6UA 4Y16C 2R1XB 4B0MM 1RHHA 2IPUG 5I18L 3QEQD 1VEPA 1RK0B 3J27A 3CIAA 3QXUA 2YFNA 4V2BA 2R1YA 1RZQA 3CSTA 1QBAA 2X89A 1TO5A 1GYVA 3LRMA 4GP4B 3KDMB 4JKWA 4OUUB 3KS0J 4J6RH 1NIDA 1IILE 5KN5A 3GXMA 4BFJA 4DUXA 3A47A 1XF1A 4HIXH 2YAHA 4DERA 4F7PA 4Z7NB 3QIUC 4PPTA 3QIWA 4NI3A 2Y1VA 1WGVA 4ZXBB 3KAAA 5EOCJ 4HDIB 1NJ9B 4LL9A 2AGJL 2BY0A 4NQCB 3CH1B 4YAQB 3GLZA 3KJ4C 4OQTL 4AV4A 4DCQB 4XRCB 5T1LA 3F7LA 3I6LD 4GBXA 4J8RB 1YUHB 1C12B 4KX9A 4G6JH 2VL4A 1EJOH 1UM4L 4L3EA 3U0PB 4ZS7H 4ELDA 4ANKA 4B60A 2CBPA 1WWWX 4J4PD 4LDOB 3FT1A 2XIDA 5JDSB 1E5AA 1KYOJ 2GPZA 5HHOA 2OW7A 1IAII 4KI5D 1EAPB 5D7KD 3C5SA 2GQHA 4M1CC 1IFHH 2IOOA 2IVFC 4RAVA 3DRTB 3HA0A 2AJUH 3T0AA 2VMCA 3OF6A 5EEVA 3C6EA 4WWKC 4OGYL 5ANME 5J89A 3PWPD 1F58H 5ESVA 5JYLA 5C7ZA 3VFGH 2AK4D 3H7BB 4ZO6A 1HKLH 1CUOA 2AJSL 1A7PL 1BW8A 1QZNA 4H2AA 1VADB 3OKOA 4WEBH 4W9CC 2M2DA 3FTVA 4G7SB 4QHKI 4J3OH 1FSKC 4BEIA 5IJKA 2H45A 3V0IA 5LNGA 1DFBL 4XNBA 2B39A 2YGOA 4S1QL 4I48B 5SX5K 1MH5B 2EC9U 4NKMB 2J72A 1RK0A 2AK1H 3DK0A 3MRBB 1NMCC 1T22A 1OWRM 3EO0A 3HC4H 4R4BB 2H6OA 4PLKC 5DA4A 3IRPX 1S9WB 3KDMA 5FCUH 3ARTA 2QHRL 1OGAD 3ZTJG 3BJ91 2GB2A 4MMYA 4CSSA 1U4FA 2J3SA 3BH8B 5IEKB 5KEZA 1UA3A 4ZXBA 3S4SA 2H26B 4HDIA 1NJ9A 1JIBA 5C3LD 2PO6D 3LV3B 3CH1A 2J21A 2C1PA 2UX6A 3K80A 4NQCA 4YAQA 4MXWH 4K94C 3VXMA 2HJKB 4JO4L 4DCQA 2R1WB 3LEVH 4XRCA 2ISDA 1B2YA 1JZIA 5DJDB 1DVYA 1YUHA 3NGBC 3K2MC 5EFIB 3ULUE 5B1CA 4KUCF 1IEAB 5D96C 3F58L 4ZFOL 1R6VA 4HJTA 4P5RA 2Z31D 1MW0A 5JDSA 4KJQD 4ZMLA 4A7GF 3D9AH 1FV1B 1U8PA 2RGSA 2YFOA 1G0YR 5GGTA 1XZWA 4UINL 3RJQB 5IFJA 5AAMC 4AITA 4G7QB 2FUTA 3DRTA 5ACLA 4X98B 4G5AA 3G5XA 4Q0XL 4YXHH 5DZJA 1QD0A 1Z0NA 5JO5B 1DLFH 4EVNB 3SEPA 3FQRB 5JR1H 4N24A 1K8IB 4X8JB 1AFVL 5FCSH 1IU1A 2BVTA 2FECL 5CLZA 1KTRL 3AVEA 4P23C 4QLRA 5HHME 2W1NA 3QCUL 1IBHA 2QPFA 3OAUH 4PWGA 1V27A 4YGVB 5I1GL 4JY4A 3D5OF 1FBIH 1MH5A 3NZHL 4NKMA 5I8CA 3MRBA 1HWHB 3MBED 3ZO0A 4R4BA 2VYRE 3FL7A 5ANMA 2KLSA 4GRWE 2XA3A 1S9WA 4APQB 1BVNT 1JHLL 3GI9H 5SV4A 2WVTA 3GBMH 1NCHA 3UZVB 2Z9TA 1A7NH 2HTKD 5H2BA 4UTBL 1OY3B 3HR5A 4DFIA 5IEKA 1TJHL 4JFWA 3BLKA 1A3LH 1M9WA 1EDHA 2H26A 1QSEE 4LKCB 4W9KC 4DP8X 2MCG1 4FTVD 1AD0A 2Q10A 5HHMB 3EDDA 5ENWB 4BZ2L 5CIPB 1DSFL 4YN3A 3PGFH 3QDGE 2HJKA 1XXDC 2R1WA 3LD8C 1IKFL 2X0WA 2YKLH 3F5WA 3IDUA 4UQDA 5DJDA 4DESA 1CGVA 4FQXA 1FZOB 1IEAA 4BHUI 3LZFH 4MJ4A 2JCCF 3WHXB 5DFVC 3HG1D 3DURB 3JWOC 3OPZH 3NZSA 3IDXH 4GRWB 4WHTA 4ACPA 1FYTD 5F70A 2PW1A 3GIVB 3SBWC 5T33L 3DDGA 4TLSA 1EERB 2XWCA 4DGUA 4J3OG 3FRUA 1JYWA 4X7DC 1HAUA 1M7UA 2W80C 1TR7A 3R19A 4MS8C 1QMUA 5CCKH 3T4YB 4IOIB 4JR9L 4RRPM 5JO5A 2ADJA 1NIFA 1QSEB 2GIMA 4RMWA 4YPJA 4EVNA 3CC5B 1NQBA 2QGCA 3S0PA 4JFTA 5I82A 4JG1H 1K8IA 3MO1B 4DVRL 3CLEH 1I4FB 1UJ3B 1L3WA 3QDGB 5EU4A 2CNYA 3MCG1 1L0XA 5EEYA 4KRPB 2FO1A 1L6ZA 1X5ZA 4JFDE 5BJTB 4Q4IA 1J48A 5D2LB 1BJ1J 1PQZB 3WFCH 1RVFH 4ONHA 4TNVK 5AZEL 2NY0D 3VFPB 2KPWA 2EE9A 2QMJA 3CDZB 3D85D 5I1IH 5D1XE 3H4HA 3QYCA 2X4QB 1O9WA 4YC2C 2RHEA 2MFNA 5HI3D 1ZT1B 3QA3A 1JGUH 4O2EB 4GEIA 4HLEA 3KPRD 4APQA 1MY5A 2Y07H 1KLGB 3NFPB 4U6TA 3WNLA 1QHQA 3PP4H 2VDQL 1LP9B 5AOKA 4XPHL 2NNFA 2G3MA 4HU2A 3PPSA 4JFDB 4QHUA 4LGSB 1EHKB 4LKCA 5D8JL 3R8QA 5IF0B 4OLVL 5CIPA 2UXVA 2DLIA 2PNDA 1M4KA 4HJJL 1HINL 3C09C 5HYIA 2J1XA 3LTVA 4Y7OC 2YD4A 4ISVB 3WSQL 3QUYA 1G1YA 3WHXA 3VD1A 4C83A 4FG2A 3DTXB 4Z1PA 3DURA 3BP7A 4CGTA 1BD2E 2QSCL 1FL3B 4KROB 5DT1L 1ZANL 1T66D 3L81A 3OQRA 4NM8H 4OJDH 2NY6B 4MJ2A 4P5KB 3ATEA 1CFVL 2AJ3A 2ZQKA 3GIVA 5TDNA 2HXAA 2BSEA 3QIWC 1Q1JL 1R33A 5B3NA 2DQJH 1N67A 4NGHH 5F7BA 3LH8A 3HC3H 1WC7B 2C3WA 3ZRFC 2FHFA 3T4YA 3HE7A 2PF6A 3U4BL 3RI5F 5T1KB 1QSEA 5DO2D 3E8UH 1A25A 3CC5A 4NQEE 4GBXC 2D3JA 5A6MA 5IQ7L 1GTNA 3MO1A 1IC4H 1I8IB 1UJ3A 4HCRH 4PVMA 3QDGA 4RQQB 2Y22A 3LQZB 1U3JA 1MFNA 3BP6B 1GGBH 1KIUB 2JMRA 1O9ZA 4UUJA 4N2AA 1PQZA 3WOVA 4M62L 3GJFK 3TT3H 3MLUL 1N10A 4UI2A 4O5LH 3BAEH 1BD2B 3MXVH 4XNUL 3VFPA 2IALB 2KH2B 5CGYD 4AMWA 3FUJA 2X4QA 4JUTA 4LL1A 5A2FA 3IS0X 1VHPA 5GJTL 4PRPD 1CGUA 3HBZA 4JQIL 2CHZA 1V8HA 1KLGA 2VDPH 4FJZA 2BY2A 3ARPA 3M46A 3FUFA 4HUUB 2E7CA 4NQEB 2ITDA 3APCA 3VXSD 1PG7H 3MV7D 4HG4J 3LEYL 1MCBA 4N0YH 3QXDB 5IJKC 4ALAH 3SY0B 3WEAA 4JFDA 1FYHB 5IF0A 2V7NB 4EZLA 4ZD3H 1IC7H 4WGVB 5D1XA 3D12B 2VABB 2VL5B 3OQ3B 3DTXA 1ZWIB 1U58B 3EADA 3RA7L 1FL3A 4BM7A 4GKZB 4P5KA 2AJVH 4Y2DD 4PREB 1BXVA 1J12A 3GXPA 3T8MA 3QORD 4JE0A 1ZDQA 4ZPTA 2V2TB 3EJSA 4KMLB 5DRXA 2WC7A 1MZYA 2R27A 3MRDB 5GGVL 3X14A 4CL7A 3WL9A 3NJGA 1I8IA 3O6FD 5AYQA 1HYSC 4NQQA 1T83A 3BP6A 1KIUA 2EXWD 4L8SB 1AO7D 2A4EA 1F3RB 3FXIC 2FEEL 3QT2A 1WZ1L 1BD2A 2CGYA 2IALA 5IUSA 2AJXL 4A1RA 1YEIH 2DDQH 4OR1A 4WFFD 3TOPA 4UILL 5D1ZI 5F7EH 4ZX3A 3GI8H 3W39B 5FDYA 3HNVH 2XWZA 2Y9RT 3KPNB 2VN7A 4UNUA 3TCLB 4HUUA 1YHPA 1RUQH 5AZ2H 4NQEA 1EHXA 3HNTL 3RWIA 5F3HB 4S1DC 5E4AA 5F8RC 2FX7L 3KXFE 1NFIA 3QXDA 1RZFH 1T21B 5LG6A 3WY1A 3BVVA 3SY0A 1H3UA 4U6XB 3RB7A 1IGTB 1XV8A 3GF8A 5CGMA 2V7NA 4JFED 4KTDH 3D52A 2EKSB 5H35B 4JY5L 4M8QB 1MLBB 3HB3C 4MA7L 2N3JA 5K9JL 4J3UA 4PP2B 5T3ZL 3GRWL 1DL7H 1HHHB 2R0ZH 2CBQA 2VABA 1ZWIA 1U58A 1SMAA 1RZIB 1AHKA 4GKZA 4K15A 2DI8A 4AL8H 1NFDF 2MQ0A 4JPIB 2ITCB 2GIYA 3WFBL 4PREA 3ZHDA 4AYID 3NIDF 3UADA 1NCDH 4OJEH 3RGBA 4KDWA 4ODXB 4IRJD 3KXFB 2V2TA 4PS3A 3MRDA 1AAJA 1O6VA 3UXFA 3GKWH 3I9GH 3ZMRA 5DRNA 1F6AB 3ESNA 3UH8A 4FQXC 3SDCD 5D72L 4YFLF 4JFUA 2DBLL 4IU3B 1WEJH 1GSMA 1FN4B 2W9DH 3IJ9A 4G6FB 4L29A 1CD1B 1MDTA 3NCYP 5I1KH 4IBZA 5DHYB 3B37A 3IJ8A 4BUHA 1XSIA 3QEGH 1INEH 2HT3D 3EJYC 1CDIA 3TLRA 5F9OL 1K4DB 2OMVA 3QUXA 4M7JL 5JHAA 1P0SE 1Y6MR 4R0LB 2NLJB 3CFUA 3W39A 5KSAB 3H3PH 3KPNA 4JGNA 5C3IA 1OB0A 3DHMA 3KPSD 1AXTH 1ZS2A 2VAAA 4ZTPH 3RIAF 5I2IB 4L23A 3IDMB 3VE0B 2X9ZA 3EH4B 4Z76B 1WWAX 3BRDA 5B1JA 4YHIB 1CFBA 1T21A 4UQCA 1JWMB 2YC1B 1O5PA 3UYOD 1IGTA 2Z7WA 3SGEI 3VQLA 5AWNH 5MENB 5EDSA 4OU3A 1EGJL 2XTJD 1OTUC 3O6KH 3L3GB 3IBEA 4M8QA 1MLBA 5D71H 1B4RA 2WZPD 4PP2A 4ODHL 2VGLM 1FH5L 3NIFB 1HHHA 4LVEA 3QUMH 4XMPH 4APQC 1E4XL 4IRSD 1A4JA 2VMFA 3WLWC 1JZ2A 1G7PB 3N55A 4PFEA 3CFIC 1EMTL 5L2JA 3FUEA 1ZLWK 2OMXB 1KEGL 4JPIA 4I1RA 4S0TD 5E08H 3NJFA 5IMLB 2BVQB 1FNAA 4ZUWB 3FFOA 2EH7L 3KXFA 4M3HA 4LCIH 2XN1A 1DUYB 4O2FA 1QFWL 1N64L 1JTOA 2VDPB 1YVLA 1F6AA 4PJIF 3HRPA 4YQXL 2CO6B 4CKVX 4ZTEA 4OIIH 1CL7I 3QUYC 3PYCA 4IU3A 2UZIH 2BVPB 1FN4A 4Q9BA 1UWXH 2I5YL 1CD1A 3GMPB 1FAKT 4V1DE 3S37H 5I15L 4X99B 5DHYA 5KYUB 4KU1A 4Y2OB 5MP6H 1I3GH 4FXGA 2F5BL 2X42A 1K4DA 3TYGL 3HE7C 4FZ8L 1E5BA 2W59A 2XIBA 2NLJA 4XXCA 2CHWA 1SXCA 5IHUL 3T8XB 5SWZE 4H8HA 5KSAA 5JHDA 2OKMA 5D7JB 5I2IA 1OARH 5GGSB 2FQEA 4Q74A 1KYAA 5DMYA 5DVMA 1MIEH 2R83A 4LNVA 1H6EA 4YHIA 5E8DL 4EAEA 2PCFA 4F15B 1JWMA 1OL0A 2YC1A 5F71A 1OTSD 5B38A 3ZX1A 2N0MA 2XSKA 5AZUA 5ACZB 1M56B 4HCRA 4Z23A 1JRHI 1CXKA 4OM0L 3ATAA 3CFCH 5FO7B 4OV5B 2GBUA 3APMA 4LSDA 3H0TB 3ZL2A 1G7PA 2NTFB 1OSPL 1X4XA 3V6FB 5BZWA 3MREB 4BKTC 1YC8A 4PB9L 5BCAA 1U8LB 5JW3L 1A21A 5IMLA 1E9PA 4HS8H 1CYXA 3S2CA 4ZUWA 3RTQA 5IOPB 1JZ5A 2EJ1A 4Z3GA 1D5ZB 3RWHA 1T1YB 4QIRA 4Y5VC 5D4HA 4DUWA 4JHAL 4WK0B 1VESA 1P7QD 1N5AB 2NYYC 5D1XC 5GS0L 3FOMA 4FG4A 4FOMA 3NACL 1WBXB 1QPPA 1RXLA 2Y2WA 2BVPA 1YQVH 1NC4B 1CGTA 4KROC 3GMPA 3OLEA 1DO5A 1XGTB 4X99A 2D3VA 5KYUA 3BUYA 3JZYA 3LOWA 4BSWB 3ILDA 4P2AA 4CVWA 2JK5B 2YD8A 3P9LA 3ARWA 4JL2A 4FHBD 5D7IF 4OCRL 3TVMD 2XXMB 2VW4A 3QXAB 4LEOB 2GJPA 3G5YB 3T8XA 4TLTA 1HTYA 4MNHA 4LQFL 4QXGL 1NGXB 2H3KA 2EE3A 4LU5H 3SO5A 1RURH 2JTYA 1T83C 2XBZA 3QAZB 4TOYL 1ORQB 3MBWA 3U25A 3TJHD 3OZKA 5I1DB 1F00I 4OTXL 3V5DB 1QPKA 1JV5A 4QRAA 4V1DA 4EDXA 1WA0X 4DW2L 5ACZA 4AE0A 1FGNH 3SPHA 4D9RD 1GR7A 4GAJH 2A6DB 3NPZB 1V7NL 3A67L 2R0LH 2G4EA 4H0HB 4F9LA 4XBPA 3HC0B 2A4CA 4WEEA 4OV5A 1AYOA 4FLRA 4AGOA 1ZLUH 4Q97A 4BKLB 4LBEB 3AB0C 2NTFA 3V6FA 3CFKA 3MUGB 3MREA 1VGKB 3MYZA 3Q3GB 4PJ9D 3FT2A 5SWZA 2A3TA 3X17A 4YX2H 1S78D 1UWEL 4WUKL 1G7QB 3GTTA 3VJ6A 5IB2B 4WV1A 3NJXA 3O81A 5GRZA 5BRZB 5IOPA 5E4EB 3UTQB 1D5ZA 1RUPH 4MS6A 1T1YA 3EBAA 5C0FA 3QG6B 1IAKB 4KPHH 1OQOA 4QXWA 5EV7A 2Z8SA 4BWUA 1KUMA 1I9RH 2EIDA 5TF1H 3ZQWA 1L3NA 1QRKA 4GAYA 4Y4FD 4FULA 4NWTL 3GEFA 1SY6L 4YUEH 3QRGH 1WBXA 3QIUD 2D7QA 2QTEA 2VRAA 4H0GA 1NC4A 2N7SA 4RDBA 1ZLDA 2G3NA 3LJ3A 2HZHA 3O0RH 4MJ6A 4GP5B 3FCSB 2HFGL 1XGTA 2YUVA 1XDTT 3T65A 1H3VA 3CX2A 4BSWA 2HJFB 3VD7A 4HXBL 1LDPL 2QLVB 2Z1KA 2JK5A 3EFDL 1KB9K 2IDCA 4LOUD 3NAAL 3GSQB 3QUMB 3QXAA 4LEOA 1WD8A 3P2BA 3NK4A 1YN7A 3G5YA 3VGAC 2WPGA 4OZHE 5JIPA 1NGXA 3EXLA 2BZDA 2WLJA 2BCMA 3IKKA 1ORQA 3F2LA 4N26A 4QWWC 2CD0A 5I1DA 3PNWB 5CZRA 2F6AA 2Y24A 3QQDB 2VQUA 4HGMA 4OQTA 1JGDB 4DH2A 1N8ZA 4L5FH 1MI5B 1R0AH 1L6XA 3AROA 1EZLA 1NCWL 2E4FA 3BO8B 1M57B 3QUXC 2A6DA 2N59A 4HJ0D 2NT0A 4RDQG 5FLUA 3RWCA 4A68A 1TO4A 1T0PB 3GLAA 3RAJH 5J57B 3HC0A 2AZAA 3GSWB 4A2MA 4XHJC 2RAMA 2DKMA 4LBEA 1OB1B 4XZ4A 5GGQH 3P3RA 3MUGA 3Q3GA 4XNQB 4ZMVA 4OZHB 3DIFA 2Z64C 5I1LB 3QK0A 5E56A 1AXIB 5B1JC 4HT1H 1ZV9A 4AEHL 5IB2A 3PUCA 1U8KB 4NRYB 3WD5H 3EUDA 4PLKD 3O6LL 4TSBL 1K5NB 4R90H 2F1AA 1Z3RA 3UG5A 1CJYA 1MCPH 3QG6A 3CDCA 4C56D 1JGVH 5F0LB 5A2IH 1A6UL 1HCVA 1UFUA 4FG0A 1CICD 3MRHB 4MJJA 1QO3B 5JHLH 2HPTA 1DDTA 3FCSA 3W3BA 3B5HA 4Z7OB 3DUHA 1SOKA 4XO3A 5DA0B 2HJFA 1UOVA 3AQDA 4HBCH 4AUUA 3LSOA 2RA1A 1P7BA 4L1DA 4EXKA 4NJ9L 1LGVA 4AGPA 1XF3A 4F9PA 3L3HB 5HYQB 5FA3A 4RGMB 1R1CA 2AQRA 4HW6A 5I1IL 4FA6A 1Q9WA 4NAJA 4UYQA 3VTAA 2Z8RA 3U4EB 1RULH 3DUUB 2EEBA 2QMKA 3ESUF 1J8RA 1JGLL 3ZE2B 2FX9L 2R56H 2J8UF 2TRYA 2XA8H 4M9PA 3U0TA 1A6PA 5I8CB 3ARQA 3PNWA 3TBVB 1H6UA 1UCTA 2CNZA 3QQDA 1JGDA 1GC1L 1PKQE 3P3TA 4F3FB 5L8JB 4FXGC 1CDCA 2VXUH 4NQDD 5DUJA 5FYKU 3BP5A 1XGYL 1KCSH 1BSIA 1Q72L 4XXCC 3GSWA 3RPBA 4H8QA 5IQMA 2RD0A 1GGCH 5AVWB 3BKCL 5K9OB 4OCMC 4MTMA 5E2VL 1OB1A 5GS2H 3WBDA 2WQUA 1HU8A 4XNQA 1PG7W 2DN7A 3IFLL 3ZDXF 4J23A 4OZHA 5J9PA 4HGKC 5FS5A 3ULVH 5E70A 5C2BH 2G60L 1MXGA 4QKTA 3TNNA 4XP9H 4DGYH 1TIUA 2QSTA 4IMKA 4WFEE 3TL5A 4QAMB 2Z4TA 3LEXA 3IMSA 4DPAX 2JCWA 1UD3A 3B34A 1PKQB 3KPLB 4XX1G 2B77A 3V52H 2XWEA 3LDBB 2JLPA 2NY5H 2XWXA 5F6IB 1XH3B 2FQFA 4L8DB 2RCSH 3MRHA 1QO3A 4I1NB 4WDIA 4X6FB 1DQJB 3GGWB 5IVNA 5FYJH 2P8PA 3MCKB 5T1DH 3HI1B 3U7YH 2AV7B 4HIXL 4Y9EA 3S88L 3EH2A 3TWYA 1R5IB 3RTQC 5HYQA 1JFQH 4K8RD 4X4ME 5LQBL 2Y5TB 4F92B 3KJ6L 2YAOA 4K9EC 3FQXB 1ED3B 5BW7A 3DGGB 4Q6IC 2BHZA 3U4EA 4YLCA 1YEEL 2N4IA 3DUUA 5D1QE 3HZMB 2L7QA 5FWRA 4G6JL 2XZQL 1EJOL 4GXUN 5HD8D 1P6AB 5FAAA 2ZAHA 3C60D 4ZS7L 3ARBD 1ZD6A 3TBVA 4LCCB 3EBHA 2ZPKH 4X4YB 1S7UB 1JXGA 1IFHL 5CSGA 1T6BX 1QAWA 2DEWX 1S9XB 3U48A 2AJUL 3V0JA 2K7PA 1WVZA 3GDBA 5DC2A 1HOCB 5HJ3B 4QJ4B 2JTDA 3N6YA 5ITFA 2X2HA 3WFEH 4JPWL 2E4TA 5IY5B 1O7DE 1ZGLA 1I7TB 2JKXA 4B9IA 1G9HA 2BVYA 2BY3A 5F7UA 1ML0A 1OPOA 3ISYA 4LBAA 4YHML 4X6EB 3C12A 1XSKA 3I02B 2E76C 3APFA 2KC0A 2LHAA 3ZZSA 4KZDH 4O00A 1FFOB 1JZDC 2QGDA 4CUCA 3BQUC 3PWNB 4FQIL 4F9LC 3MPCA 2AK1L 1MJJB 1MLCB 1FFNA 4L8DA 2NCEA 2WTPA 4JO2H 2DQTH 4X6FA 2I7OA 1DQJA 5FCUL 2GTWA 3GGWA 5DQ9B 3HG2A 1JZGA 2XQYK 5LDSA 4X4XB 2OP4H 4MQ7B 5E99L 4Y7MA 3HI1A 3PHQB 2VDLL 2AV7A 2GSMB 3P2DA 3S97C 3QIBC 4ERSH 1R5IA 4WV1C 3TZVD 4PLJC 4UU9B 1GHFL 1GOHA 3N1GC 1R3JB 4QI3A 4B9GA 3P11L 1BFVL 3FQXA 3LXBA 5FYKH 1J1OL 1ED3A 4LSRH 5C0RH 3DGGA 4FAAB 2D31B 4MXWL 2XRAH 4B3EA 3LEVL 3HZMA 3L4TA 4PG9B 1MCWW 1D5BB 1KTBA 5TQ0L 4FYTA 5KSVB 2CXGA 5KBPA 4RETB 3AABA 3GBNL 4BK4A 3D9AL 4B9FA 2YAPA 3ZJAA 2FRGP 3QJXA 3ZSTA 4ENEC 1S7UA 1TJIL 4YGAB 4X4YA 1IX2A 2E46A 2IBZX 5G5DB 3W57A 3DBXB 3AMKA 1DSYA 5ABDE 1I8MA 1FH2A 3GHEL 1Q9OB 1DJSA 1M42A 1T7YA 3OG6B 4KO6A 1QFWM 4C58B 4X4MA 3RWGB 1HOCA 4ZOCA 5JR1L 1C7TA 4H0LC 1XH1A 3MNVB 1H5BA 2CWRA 3PL6B 3MI6A 4NT6A 5I1JL 5D1QA 4AJWA 2Q86B 3G6DH 1PZ2A 1A0QH 4IDLA 3M1BA 1JGEA 2HKFH 1GGTA 2ICWB 3WXVL 5EBWA 3VWJC 1JYNA 4QXVA 5DEJA 3OHXA 3OAUL 4BJLA 1ET5A 2ICCA 2LE9A 3PAZA 1FFOA 1FBIL 1HNGA 5D7LD 5D93C 2EH8H 3FFDB 5TE4H 2GG1A 1YO4A 5GPRA 3PWUB 1DQTA 1MJJA 2PTUA 1MLCA 5CR8A 1I1AD 3RJOA 2BW5A 3RILA 3GBML 4WHDA 3SZKC 5DQ9A 1A7NL 4X4XA 4MQ7A 3PHQA 2X41A 3HAEA 4H4NA 3BN3B 3FW6A 4L1BA 4ES9A 5C07E 4ZSOB 1A3LL 1DO6A 4ZFQA 4ZZKA 1R3JA 3UJJH 5I1CL 1UB5B 4QRTB 5FYJE 1CD8A 2YQ3A 3KGTA 2VLLB 1I3VA 2D31A 2WBWB 6CGTA 1HEZA 3E3QC 3EFFB 2YKLL 1JN6A 1WH0A 4XR8C 3P40A 5KSVA 3LZFL 2FAUA 1JF6A 4F58H 3D87B 1W72H 3W2DL 3WJLA 1OAQL 1S7XB 4I0KA 5EC2B 3RX8A 4JHVA 4F2ME 5FV1L 4CC0A 1BM7A 4YL4A 3BDYL 1DCLA 5G5DA 3DBXA 3ROOB 3TFKD 3HVDA 1O5DT 4YZFF 3GD1C 4PJHF 1N5YL 4Z7UE 5CCKL 4UWQB 5C07B 3WUWB 1HYRC 1AZZC 3L4YA 1NEZB 4O9HH 4R2GB 2X05A 5J11B 5JHLA 3RWGA 5JZ7C 1FZKB 1AKPA 3K0YA 2QJDA 3IU3B 4JDTH 5F93C 3BE1H 4FNLL 4JG1L 3ETSA 3NH7H 4PWFA 3UTZB 4ZMNA 2FIRT 3PL6A 3CVIH 4EKJA 2Q86A 4K7PY 5AOJA 4MQXC 3RGHA 3OMAB 4L3AA 3D08A 3WFCL 4W9DC 4HA1A 1RVFL 2ICWA 4KKCC 1TOXA 1CVRA 4JFYB 1KCKA 2OA9A 3MUZ1 2VXSH 1GW6A 4DIXA 4KX8A 4U3SB 4S1RL 1Z9OA 3FYEB 4TMPA 3G3LA 2EUWA 4AUJA 1SUJA 3PWUA 3RU8L 1OCWH 4GINA 4S1DD 3RZCB 4Z7UB 1TF4A 4PJ5D 1Y0LA 2AV1B 3MKKA 4LESA 4ZDHA 3D48R 4PJDF 4YHPB 2Q8BH 4N0FB 1XMEB 4OJFH 2HFFB 2VMEA 3PP4L 4HU8A 2X6MA 3HB3D 1H3XA 3GXFA 1FDLL 2B15A 35C8L 4M5YH 2VOTA 5CLYA 1UB5A 3DOSB 4Z8FL 2DJUA 4BQ9A 2Q2EB 4W9GC 2K3HA 2RQEA 2WVVB 2V2XB 3D39E 3UBXI 3H7LA 3CHOA 5GRXG 3WNJA 3VWKD 3EO9L 3KVQA 5FO2A 2YUWA 4DQOH 5FYKE 3TPKA 2H9GB 3MRKB 5EC2A 2EDHA 3HJEA 3WNKA 4NM8L 2WD0A 3TONA 4F20A 1BZ9B 3BUBA 1OSZB 2WM0A 1CDHA 1U3ZA 2JJUA 3RDTB 4BIKA 3UL4A 4JGMA 2DQJL 1NUFA 2QFPA 4I5BB 4RGMC 3HC3L 5DGRA 2WTRB 3ROOA 1Z3GH 3WUWA 5C07A 4UBDD 5KZCD 3BW9B 1NEZA 1EFXD 1FZKA 3UG4A 1CDJA 3E8UL 3IDNA 3IU3A 1RP9A 4ATWA 1IC4L 5BV7H 5JORA 3ZYIA 4NCC2 3D39B 3EJYD 4JO1L 4JW3A 1CK0H 2NQ3A 4M7KL 5TGBB 3C2SA 2FNWA 1S3RA 4Y2NA 4JFYA 2NNXA 3PHOA 3BAEL 4CBZA 4UIMB 4F2MA 4U3SA 3GSXA 4D0CA 2H0PA 1KCUL 1SHSA 2X1PA 3RZCA 3REWB 3BX7C 1BVOA 2AAAA 1ZXQA 3GSRB 5I5IA 2AV1A 5HSFA 1A1NB 4PRAB 1JK9B 1FNEB 2B20A 3KLQA 5HI4C 2F18A 4OCXL 4Z7QF 2HFFA 2GK0B 4K7FB 3SKOA 3GHBH 3KYNB 3QO0B 2OMUA 4N0YL 1AKJA 4KQ3L 4ALAL 3SCMB 2L7JA 3QG7L 3LYRA 4KI5F 4JBSA 4W81A 5FYLE 1KIRB 2P5WD 3IETA 5HHXH 3DOSA 3HMWL 2B4CH 3BSZH 4I3RH 1SHMA 4M29A 2COQA 2F54D 3L1OH 5D9SB 5L6YH 1XBDA 4M4RB 1IAMA 1OGTB 4TVPL 3RFZA 1MJUL 4LNRB 3PWVB 1J0KA 4D3CH 2WXIA 4YSAA 4JO8A 3BD3A 2KYIA 3FU7A 3ZVVA 1H8NA 2H9GA 3E7JA 5DD0H 2V5SA 3ARXA 2KT6A 4Z7AA 4XMKL 5K5YA 2AJVL 1BZ9A 2YQ2A 1OSZA 4N0CD 3RDTA 2XV2A 1V10A 4IGBB 3IJYB 3R7QA 3HS9A 4I5BA 1TITA 3B2PA 2WTRA 3LZPA 1QWNA 3WNMA 2C5DC 2OX5A 2ATAA 5KBKA 4E0RB 1Q0XH 2H6PA 2JCCE 2VSCA 3EJTA 2HAZA 1SDYA 5FDWB 3FUIA 5BVPH 1KXQE 1IGMH 1P2CA 3M07A 4M93B 3QBTB 5LG1A 2AKRB 2P47B 5IV2B 3TEWA 4RGOH 4N1CA 3D39A 4AXWA 4TNFA 1S5HB 3OB0K 3LPWA 2I27N 4BK8A 4OUOA 2WW8A 3JT2A 3VSQA 3KNBB 5TGBA 3DKHA 2WUBH 1NLBH 3ZT5A 4UIMA 3BI9X 4HOZA 4GYBA 1NCTA 1U8HB 2GYSA 2VJXA 3B8YA 3UTSE 5IOKA 2BJML 3EGSA 1NOAA 3REWA 4NXKA 4M56A 5F7EL 2HVJB 1W72B 3GSRA 3HNVL 2I26N 5BXFB 2JCCB 1UD5A 1H5BC 4W9ZA 3JWDH 1G5AA 1F1GA 2PWDA 2CBOA 4LAQH 1A1NA 2VDNL 1RUQL 4FMVA 3FTUA 4RBPK 5D1QC 4FFZH 1AANA 4JO5A 4A7GA 1D2OA 2GK0A 3KYNA 3QO0A 1RZFL 3SCMA 2ZXDA 1HE8A 3OHXC 1KGCD 1JWSB 1W91A 1KIRA 3VXUD 3ZQ9A 1BZ7B 4KTDL 1VCBC 5IG7B 1U2HA 3D06A 4M4RA 4Q2ZB 3MLTB 1OGTA 1Z9NA 4ZK8A 1G1KA 3K6NA 2AQ1A 1DL7L 2X2YA 3PWVA 5F0MB 3RIFF 3UTSB 1JNLH 4WUUD 4G5ZL 3B9KB 1EXHA 2G5UA 2GT9B 4YMPA 2DLGA 1P4BH 2HRGA 4A6YH 1U92A 1SHWA 3KWWB 2FQGA 1G84A 1HC1A 1JZFA 1SJHB 4IGBA 5EMYA 4MA3A 1KSRA 3GMNB 2NYYD 2W8CA 3DYMA 2DYPA 4E0RA 4KHXL 2EVJA 3LPFA 5FDWA 1ACZA 2DWTA 1MCQA 3QH3B 4DP7X 1I85A 2WYHA 3I9GL 2VZOA 3NOIA 1I3UA 2AKRA 5IV2A 5CUSH 3DMMD 1GGUA 1CFNA 3GINA 3B3IB 5JQHC 1TZAA 4N22A 5CEZD 3KNBA 2A83B 4GI6A 1A22B 3H3KA 3M6DA 2J4WH 2OR7A 1INEL 2CO2A 4GLRH 4YSRA 2GJ6B 4Y89A 4IKJA 1U8HA 3TH3T 2H5UA 5L2KD 2GKIA 4U1MB 2R7EB 3CFQA 4RMSA 4WKZB 1YEHH 3QPXH 4MA8L 4AYFA 3X1FA 1AGFA 4Q9RL 3UPRB 3X11B 4CU7A 5FGCB 5BW7C 3BH4A 2JCCA 1HHKB 3H3PL 2UY6B 3V8CA 3T6QC 1KXQA 3ES6B 3UTOA 3C8KA 3J7HA 3QNZB 4OZGF 3S37X 5IM7B 3AG4B 3UYRL 4FI7A 5TFSH 2KUTA 2GUYA 1HK6A 2F53D 4FHKA 3O6MH 3D69A 5AWNL 1BZ7A 4M7LH 3HNSL 4IOFD 2AVFA 3HHMA 4ZW7A 5BV7B 4Q2ZA 4IMLB 1JZ3A 1SYVA 4P2OA 1XCWA 3H54A 3UTSA 1DVTA 2Z7YA 3QUML 1B4TA 3B9KA 2PXYD 4QGYA 2GT9A 2K45A 1KOAA 4IBSA 2E5EA 4AOFA 1EZVY 3SBQA 1AZUA 2GHWB 1SJHA 5JOPE 3GMNA 4NUJB 5ERWA 2FGZA 5A40E 1CGWA 4ZO7A 4LLWA 4LCIL 2I24N 2OSYA 3GMLB 2X0UA 3VYOA 3QH3A 5AW4B 3O9WD 3FB5B 3DRQB 1R3IH 1URIA 3DLQR 2VDOH 3OJVC 3CDYA 4JM0A 4OIIL 4UT6L 2H2SC 4HKXB 2BNQE 3ZDYE 3CHPA 2ZF8A 4NKIH 4NEHB 4KH9A 2A74B 1UWGH 1SBBA 5CWSB 4LEEA 3FU8A 2A83A 1PD6A 5MERB 1ZJAA 3QCTH 4LHUD 1NCGA 1YJDH 4PGJA 2EDQA 2QT6A 4UT7H 4X50A 5CINL 1LYQA 3ORJA 4M3JA 4KQ4H 1I9IH 4HGWB 1EJFA 4XMVA 2NY5C 3EHBB 3LB6D 3VD2A 5J11C 2F7RA 4WKZA 2B1AL 3UCQA 3DX2A 3UPRA 3FC8A 1HHKA 5HHNB 2ZF9A 1NMAH 2BCKB 1BMWA 2ODHA 1AZCA 1OARL 3KWXA 4I7ZC 4OFYD 5C0IB 4XC1H 2VZSA 1MIEL 2HVKB 5FHBH 3ZDYB 3MFFB 1KB9J 2W38A 2BNQB 3EOAA 5KSBF 5IM7A 3LX9A 4LSQL 2AZUA 2LFEA 4C8XA 3KYKH 4XHJD 5DQJB 3VFVB 1JPST 4Z77A 4HIEB 3EG9B 5D5MB 3RZCC 4MJIE 3CFCL 1N6QL 2WBJA 1KPUB 1XGPB 2AFNA 3MLZL 4A2EA 3FO9B 2E3VA 5DUPH 2GFBA 4B27A 1J8KA 2QZQA 3FCTB 1M7DB 3PU7A 2VO8A 1T0OA 3VB8A 3G9VA 1IQWH 3GXDA 5H4YA 5TD4A 1CDBA 4HS8L 1I7UB 2ZKWA 3FBKA 1KGYE 2D0HA 4P2RE 3BSHA 4GS7C 1TSHA 2DQCH 3GK8H 3DXAE 3EH3B 1MG3C 3PXHA 3RFZC 1H8LA 3FB5A 1NFAA 3DV6B 1NFDE 4DETA 4KKLC 2OK0H 1NCIA 3NIDE 3KM2A 1P84J 1YQVL 3CZJA 4MJIB 2A74A 2OZNA 4TVSa 2RR3A 5D4IA 3T0WA 4I87A 4WIQA 5MERA 3GXIA 4CAGA 1O7VA 5EUOB 2DYRB 2JI2A 4A66A 2VE6B 2VIRB 1UXMA 3BHBB 2MCAA 3NDZE 1KFAH 3VCLB 1IV8A 1WPCA 3IFOB 4YDLB 3AREB 5HVGB 3EJZD 2Z7ZA 1E67A 3MJ9H 3GRGA 4PTUB 1N6UA 1AI1L 3WG7B 4LU5L 1D7CA 2BCKA 3DXAB 4E41E 4S11A 1GL4B 1RURL 2L8AA 4ABUA 5AB2A 1IO4C 5C0CD 2HFEB 2H1XA 4LVOC 1TQBB 5C0IA 6FABH 2HVKA 3KS0H 2D2OA 3MFFA 2BNQA 3E6FA 3NIDB 4ZUVA 4AQAA 4A04A 3AU1B 3OVUB 2BXZA 5C1MB 5DQJA 4NO3A 3VFVA 2L0DA 1FGNL 2NXZB 4HIEA 4ATTA 4GAJL 3CFEB 3EG9A 2O5XH 5EOCH 4ZNCD 3HG0A 1KPUA 4F80A 3WGUB 2CHDA 1PD1A 4ONGH 1HFUA 5L9DH 3BKJL 4PH8A 3CZEA 4ZMAT 3MX0B 5AUMB 3SJVD 4G7YH 3A4DA 4YX2L 1GVIA 1M7DA 1T2XA 4FL4B 4MAYC 2DIBA 4XPFH 3S6CA 4HH9B 3U1SH 2ZJSH 5JUEL 3VRJB 4E41B 3HI5H 3Q2LA 1I7UA 2ZWNA 4XP6L 5EG6C 4TRPL 3BYYA 4Z0XB 4JUSA 1F42A 3MNMA 1VJSA 5GRYA 3UFIA 1WIOA 2DQEH 3H9SE 5LHDA 2XN9E 5EU6E 5A2JH 1IEBB 4DK3A 5I6PA 3RKDD 4YSQA 3DV6A 1R9FA 1R5WA 4L4VE 2KPNA 2WP3O 3GSNL 3WTUA 1A9VA 3QRGL 3VSTA 3GT6A 4MJIA 1QA9A 5JXEA 1BJMA 2WXPA 4MB3A 1JPTH 2I85A 1TPXB 3D0LA 3NA4A 4QRQB 1OLLA 1PCSA 4QEGA 3FO2A 3N42F 4PJIE 4NZTL 4YR6A 4LP8A 3BHBA 1U6AH 4HWEL 2YPKB 5FV2A 3VCLA 2CU9A 2LVCA 3AAZB 3MV01 4GIPD 4M7ZB 3IFOA 4F1SA 3MLRH 3QI9D 4P2RA 1GMIA 2IC2A 1MRCH 2KZBA 4OJAA 4ZUUB 3TT1H 3X1EA 3H9SB 2XN9B 3DXAA 5DVKA 5EU6B 1C5DB 4IBTA 4IRZH 2HFEA 1NFDA 2VXTH 4L4VB 4TNVF 3CK0H 1G4MA 3WAJA 1WS7A 5E6YA 3ISWA 3CNKA 3AU1A 4AI7A 4IIQB 4L5FL 4LAJH 4RAHA 4HUMB 5LDUA 2FT8A 4JM2C 3QUZD 3WJJA 2ROXA 3D7PA 3MRCB 3WEBA 1BQKA 2P5EB 3CFEA 3WIIH 4EOWH 5I6XB 3RAJL 2K4WA 4LARL 4DP1X 5IJCC 5I75C 1DVSA 1XAKA 4JY6B 4U6HA 5GGQL 5IHWA 2X0VA 3MX0A 4JRYD 5AUMA 1EAJA 4BFKA 2X5PA 3N43F 3MRQB 2F08A 1ITBB 3WENA 3VRJA 4HH9A 5I30L 3BQUD 2P49B 1DJGA 4K71C 4XCFH 5JPMA 1BECA 2XBDA 1WJ3A 5LUMA 3WD5L 4PRID 4AK1A 4YFEA 4UB0L 5AVSB 5I5MA 4R90L 2PMZA 3P4OB 2O6EA 1JGVL 1UKQA 4P2OC 5CLWA 3UAFA 3DV4B 1LK2B 3QIBD 3B9KC 1OKEA 2EYTA 2VLMD 2UY7A 2J55A 8CGTA 5F2FA 3F00A 1LILA 5GGRB 2FIKB 4PJ8A 2Q8AH 4BCXA 5CFHA 4HBCL 4W9HC 1QFPA 5F1NA 2NYKA 1ZCRA 1YEJH 5MI0C 4I0PA 4OF8A 2DEYX 4WEUD 3UEZA 2RQ8A 3UG3A 4Y0GA 2VLRB 1PSKL 4ZUUA 3LNHA 2FR4B 1UG9A 3H9SA 1QYGH 3RY4A 2XN9A 1TVHA 4ENED 5FGRA 3MZGB 5KBMA 5D7IE 2WMPA 4L4VA 2WP3T 2BFGA 2OR8A 3WKNA 5TPWL 4N5EC 4Q6YA 2D9QB 4IIQA 5BUAA 4LPUA 2VXUL 2A6KB 1JK8B 3QUGA 4J8QA 4PJIA 3GXNA 1WFMA 3CVDA 1P4LB 4D9QE 2K6WA 2W0LA 2FJHA 1C16A 4UIKH 1GGCL 2N7AA 4K7PL 1TVBB 2SEBB 4QXUL 4EIGB 1IC5H 3NP4A 1FO0L 4E9YA 5C0JB 3VWJD 1INDL 4NM4L 4M43L 5T3XH 1T7XA 3U1PA 3L17A 1GPOL 3MRQA 3ULVL 3C5ZB 4ZUSB 4D2NA 3V4VA 1UM6H 5F6HJ 5LN8A 5D7IB 3WTVA 4UOW0 2V4LA 4A2GA 1KBVA 1IM9D 2R2HA 4JO3L 3P4OA 3RURA 3O11B 3OSVA 4FN0A 3H42L 2CKBB 1SDDB 4K5LA 3SGDI 2WBJC 3V52L 1LK2A 1KJ3H 4KMTH 3IPEA 4YVNA 4MX7B 2OQJB 3U9PH 3IWUA 3PLYA 1QW9A 3TF7C 5GGRA 1HHGB 3FONB 1U2YA 2OCCB 4R7LA 5KBDA 1JFQL 1BJ1H 1PX3A 2CK2A 4KKPA 4WNQB 5J12B 2D2CC 4KK6C 1I9JH 2CBTA 3AY2A 3I2CH 2FR4A 4ODWB 2F15A 1C5BH 5F7DB 4J3SA 2FYVA 1GZPA 3UAJA 2Y1ZA 2B9AA 4X9IA 4NO0B 3BVNB 3SGKC 2LTQB 5LCVL 2B4CC 2ZPKL 5DZPA 4M61B 1IBDA 1TMQA 3EHBC 4W9FC 4ORGB 2A6KA 2R9HC 4ZAKA 2D3LA 1JK8A 2MQGA 3PDOB 4MCNA 1A1OB 4I9WE 1AGEB 5KVDH 2WN2A 4LMQE 1ZA3B 1UEYA 3HLKA 1TVBA 2SEBA 2ZICA 2P8LB 3MROB 4ONFL 5IIEB 5C0JA 3GEWB 5I9QB 5F9JB 1UYWL 1BBDH 2P24B 4PV1C 1MCWM 4HC1H 2EIZA 3RVUC 1HOEA 4ZUSA 2M1KA 3H6JA 3Q43A 2F5AH 1XCQA 4TM9A 5D7IA 3GM8A 3FT0A 2E9GA 4LPCA 4KZDL 3FS9A 3O11A 3HS8A 2CKBA 3UIZA 1PZCA 1Q9LB 4LLDB 1OF0A 4LEBA 1U8JB 1MHEA 1EJ8A 2FX8L 5HDQH 4MX7A 2OQJA 4DSYA 4G42B 5BRQA 3SE8H 5DJ6B 1EXGA 5EEXA 1ESOA 3L48A 4GQPH 3FONA 4WI6A 4Y4HB 5IQ9A 1TTBA 3GKZA 1A3QA 1IARB 2N7BA 5AKTA 3NN8B 2ORBL 4X0KB 2DQGL 1XSOA 1QNZH 5F97E 1KNOB 2HT2C 2G0KA 4QYOB 1QLFB 2P46B 4LSRL 3M17A 3QYNA 2XRAL 3TO4B 4B53A 1D5MB 1SUHA 1RZKL 4ODWA 2EUXA 3BMVA 4WFHE 4PRHE 5KVGE 2BIOA 4MVBC 4NO0A 3BVNA 1RFDH 2QVIA 3GRBA 5DD5H 5JXEC 2WSKA 3L3OB 3NFNB 2ITEA 5F7FA 4M61A 1B3JA 4H88L 4KGLA 2F58H 4ORGA 3UDWA 2VLJE 3PDOA 1EAOA 1NCNA 2J8UE 1A1OA 3ZT7A 1CTMA 1AGEA 1OHZA 1ZA3A 2IAAC 2Z6FA 1BZ8A 3PF2A 3ZTCC 2FEJA 3HS0B 5IIEA 2P8LA 3MROA 4YDVB 5AVYB 5EO0B 3P4MB 3JV4B 3Q06A 2P24A 2ZSVB 4HOXA 1OT4A 2WNGA 2YMXH 4XNZC 1A0QL 4PV9B 3FB8B 4YK4B 3S3DB 4BYHA 1GYWA 4PRHB 4HAFA 3ABLB 1D9KD 3PV7A 4HWZA 3ETBJ 2CBMA 5MEOB 3SPVB 4A2LA 3LRGA 4M6OL 5BO1L 3W11C 1KJVB 3ZDXE 4NZRH 1SEQH 5FECB 2MHAA 4IRZA 4JFFD 3X13B 3BUIA 1BVZA 1Q9LA 1UUNA 2DWDB 2VLJB 3EGXB 1UACH 2J8UB 1E30A 3AW5A 4HQQH 3I84A 3FB6B 3QQNA 1S7WB 3OHMB 4X7FC 3IF1B 1JGIA 2XXCB 1J5OH 4JB9L 3WNOA 4FL4C 3KE0A 2ZE0A 4Y4HA 3ZE0B 5JPMC 3NN8A 4X0KA 2OMZB 2OXGB 2ZP0T 3FO0L 1XH0A 4HXAH 4BZ1L 2Z8VC 1KNOA 5EUKA 2NY4D 3L4CA 1QLFA 4ZFOA 1WIUA 5K59F 2QPSA 1UFGA 3TO4A 4ZOEA 2ENSA 3OTTA 1CFTB 4AGNA 5BO0D 4BFFA 3PS6A 1A6ZB 1RUKH 4RWYH 4F58L 2PP9A 1W72L 5I19L 3K6SB 2X6VA 1TPXC 3L3OA 1YN6B 2Y6SC 4PJ8C 5J3HC 1RPKA 3VVVA 4NN5C 2NXYB 4JREB 4NIYE 3WE6A 1JXFA 4I0PC 1N4XH 3OLGA 4G3YL 4M7ZC 1K8DA 4NO5B 5BMFH 3KGRA 2P9RA 2EE6A 3HS0A 2UX7A 3C6LC 4GOSA 4YDVA 4JDTL 1BAFH 3GIZH 5EO0A 3MGOB 3P4MA 3RY5A 3F01A 4AIEA 4X4ZA 3JV4A 3CWGA 3E2HB 4KKAD 3A4EA 2ZSVA 3RJDA 1OT2A 1Q8MA 4ODVH 3HI6L 1BG9A 4OD2A 4PV9A 3W0WB 3FB8A 3HBPA 5KVDE 1JDCA 4PRHA 1DYZA 3HZVB 4CGUB 2FGWL 2X70A 3VG9B 3U9WA 5HGHB 3TP4A 5MEOA 3SPVA 2VXSL 3RGVD 2EDOA 4NP4L 1G4RA 1KJVA 5FECA 4RSVA 4ZODA 2QV2A 1OCWL 2YQGA 4MAZA 1IKNA 1EQWA 2VLJA 1GZHC 4UV7H 2J8UA 4TYUA 2FJUB 4FGMA 1YJDC 3UP1A 4UQ9A 3K1KC 1DE4B 1KCRH 3IF1A 2Q8BL 4KY2A 5HPMA 4PJXF 1A64A 3MLXH 3U2SA 3GMRB 3SE3A 1TEGA 2OMZA 3ZDZF 5CD3B 5CCGE 2X12A 4HPHA 1D5IH 2X7LA 2J57A 1N8OE 3NK3A 4WJ5B 4PG2C 5JQ6H 4HKZB 1D2PA 2XFXB 4JG5A 4M48H 4XVJL 1A6ZA 1ZXKA 2D9CA 2X38A 4QHNA 1VA9A 3QJVB 4OZIE 3P4NA 2C9RA 5D7SH 2HJLB 3K6SA 4AQ8A 4F8LA 2VRQA 1YN6A 4YSCA 1GIGH 3MACL 3MOAL 3ZXAC 2VT0A 5HVFB 3TO2B 4JFPB 5EN3A 1UZGA 2PR9A 2AQTA 3ALWA 5LN4A 2CIKB 4S2SB 3AQXA 4NO5A 4R97C 3VMPA 4FFYH 3CPLB 3FMGH 5CXPA 4N8PA 3IMTA 4Z7WB 1R3LB 5JHMA 5BV7L 3K2KA 2KERA 2QQLH 1PDKA 2VDML 4F8QA 1MRFH 5DLLA 5FK9B 1QWHA 5TE6H 4QNPF 2OSWA 5DZOA 2G0LA 2AMUA 5DJYA 2BDNH 2R2EB 3L1FA 1CK0L 3KPQB 3V0DA 4HJUA 4I18B 3DSFL 1F8TH 3VXQB 4HFUH 3I6GB 5HGHA 4KUZL 4OZIB 4QRBA 1UT1A 4PW4A 2ZOKA 2ZAIA 3NP3A 4ZAKC 2D7OA 5E5LA 1BGXH 1PNCA 3I85A 1QHOA 4P57A 5G4MA 5EIIA 4M6AA 3IXTB 2V9QA 3U9UA 5DWUL 4DPBX 1SBSL 1JAEA 5HJGA 2ALWA 4YO0A 4YFDB 4OSUL 4U1LB 2AXJA 3ARZA 2ERJB 4HK0B 5DHXB 4AJVA 4P5MB 1EJ6A 3CJJA 4JPKH 5BS0D 4QOKE 1ILUA 2B14A 3VD4A 1ETZB 3GMRA 1HL9A 4HSQA 2YMOA 1KG0B 2X28A 4FP8L 2GUOB 3CFJB 5J1AB 2AHIA 3C5JA 5HHXL 3S34H 2EXTA 3VNZA 5E6UB 3BT2L 2BWIA 1HH6B 1A7RL 2CR6A 3L1OL 4WJ5A 1X4ZA 5HPOA 2P44B 4HKZA 4DPRA 3S3SA 3MXWH 1N68A 2XFXA 2B1HH 4D3CL 2FVNA 1WLHA 5DR5H 4H0IA 4N2NA 1X5AA 1XT5A 2XWBA 3BCDA 2HJLA 5AW8B 4K4KA 2A1WH 4E9QA 2E7HA 4BKSC 1EA9C 1NBQA 4I3GA 1CGXA 3TO2A 2A99A 1MNNA 4JFPA 3B6SA 4OD3H 4U1HB 4NWUH 3CIQA 4PTTB 3SDAA 2JNZA 5KBNC 4QOKB 5DJZA 2H2SD 4S2SA 1H3PH 5BVPL 4LE8A 3NEOA 5E1IA 3CPLA 5HHVH 4P4KC 4GG8B 4XAWL 1IGML 3MCYA 4I8DA 3WMSA 3CXDH 3RVXD 3ZQXA 1R3LA 4JRXD 2WLNA 1JI2A 1U93B 2EIBA 2E6PA 4RGOL 1N59A 4PRDB 5FK9A 8FABB 1AYRA 3LKPB 5T3ZD 2B3IA 2LTQC 4YZFE 1FL5B 1PZBA 1J8HA 1P5UC 1S2EA 4I18A 4C47A 1BDYA 2WUBL 5FO8B 2HLEB 3AGWA 4OZIA 2WXOA 4W6XB 1IZJA 1FGVH 3IDIB 3CVBA 5F88B 5DGQA 2YGQA 3QFJE 3UDWC 1YNKL 5E5RB 2AABL 3LN4A 1X5YA 3MUUA 4WU7B 3RWJB 5D70L 1B6DA 2WQXA 3IXTA 2EXYC 5DF0A 3VRLF 3DYOA 3OZLA 5JOFB 5I9QC 1A6VL 2X6AA 2A6IB 2PP7A 4UM8B 2XOTA 4LAQL 2QVMA 4U1LA 1OP5K 4HK0A 4P5MA 4YH6A 1MW3A 1FNHA 1A8ZA 2WSPA 4DHLA 1TUPA 3RB5A 1IAIL 2HRHA 2X4TA 3HEIB 2BVEA 1KG0A 5J1AA 5A16A 2GUOA 2JI1A 3CFJA 3VXNB 2VERA 4XN7A 4B41A 3CZKA 4KJYB 3O4LB 5TH2A 1HH6A 2YRBA 2QVFB 2IAMB 4PJDE 3B56A 3FRPB 4KK5D 3K6OA 2J6EH 4X7SH 4GW5B 2ZXGA 4NSKA 1AS6A 3HW7A 4CNIB 5F3FA 4A6YL 5HYEA 4U6YB 4K3JL 5JQIB 4J3VA 1YMMD 4I2XB 5EBLB 1WA1X 3Q6FB 4QOKA 1M3IA 2YSSB 3O8XA 5HI5C 4TSCH 4AKQA 3FSWA 4GG8A 5I0ZA 4J2QA 1MWAH 4L0ZA 1U93A 5KVFH 3GS7A 1BAGA 4U1SB 5CUSL 1D7FA 4PRDA 2IPUK 3LKPA 4F57L 4N8CH 1FL5A 3B2VL 4XWGL 1WAEA 4HJIA 3V4UH 1HI6B 2JB5L 3S8WA 3FB7A 1ETJA 3L3OC 4CDHA 5FO8A 2WO4A 2J4WL 1SPDA 4NPYB 4XP1H 2OAAA 3QEQE 1KLFB 2GW5A 5D4QA 5F88A 2AQNA 2P8MB 5TDOB 4WU7A 3RWJA 2X4OB 4MB4A 3EAKA 5H37H 1E28B 4N5UA 3HS0C 3TS8A 5JOFA 2A6IA 4UM8A 5K1JA 5ALBH 1GYUA 2CLVB 1WSST 4GXVH 3SE4A 1PCXA 4DKFH 4G8IB 3L1EA 2DM3A 5BOJA 2AC0A 1KN4H 2UWEF 2WYZA 2XXFA 2AQ2A 2OMNA 1ECYA 1L0YA 4UTCA 1R75A 3BPOC 1MCRA 3VU1A 4JDZB 3I6LE 1UQSA 2IAMA 5H94B 3NTCL 3F6IA 3FRPA 3OWEA 3QEQB 3AQYA 1NBCA 2HTLD 4Z7QE 2N01B 1UEMA 3L9EA 3QFJA 4MAYD 3S3JA 2J20A 5I1HH 4KZ0A 2OZ4H 4HS3B 1XCXA 4Z0BL 1LVEA 4GW5A 2EVIA 4KI5E 3RDJA 1HNYA 5D7KE 1X7TA 1X5JA 5F7HA 4CNIA 1UZ6F 1XF4B 1XXFC 3NJJA 4PJAB 3VDCA 2FD6H 2R29H 4AGLA 5TDPA 3SE3C 2AEQH 3OM3B 5FUOH 1RZ7L 5EBLA 4MSWB 3Q6FA 3SOBH 2YSSA 5E9DD 1KN2H 4ODUB 3V5HB 3I9PA 4UZUA 5DMGC 1VB9A 2YEQA 3QHFL 1PZDA 4XX5A 4AKOA 1ZEAH 2L7UA 3PHSA 4ZFFB 2VDOL 1QKZL 1CDYA 4PJDA 5T5NG 3RWDA 4G8GB 3ZHNA 3MLSH 4OKVB 4XNYH 4AV0A 4Z7QB 5I0YA 1HI6A 3NVQA 4HSCX 2DMKA 3QCTL 5HVWA 4ZYKB 4X5XA 1GGIH 2E6QA 3T0XA 4KQ4L 3A6BH 1KLFA 3VXOB 5ETUA 4HEPA 1LE5B 2DIEA 4U05A 3HC2A 4R7NB 4R26L 3JV5A 3OJ2C 2ZCLH 1MY7A 2X4OA 4MZ2A 1J1PL 2YOAA 3J07A 1OGAE 3GYRA 3OKKB 5CJBA 2CJSA 3NUKA 3QR0A 3E2HC 3MRNB 1NMAL 2CLVA 3QULA 1A9EB 1WBZB 3ZYZA 4JM2D 4L1LA 5GS0D 5E6RB 4MD5A 4U1GB 4YHNA 5FHBL 4CMHB 5J7CC 3VG9C 1XL4A 2OJZH 4HUKB 1KF9B 3KYKL 4TUKH 2DWEA 4XH2B 5SX5H 4GPVA 3N3EA 5LXGL 4HHAB 4JDZA 1GGYA 3O3EA 4KKZA 3QEQA 4L8CB 1KY6A 2O6PA 3NCJL 5I8KH 1ACYL 2P42B 3F64A 2XVBA 3SBPA 2AAVA 2ENQA 3S5YA 1EHLH 1HT6A 2JFCA 3G6JF 1L9RA 1DBBH 1OGAB 1T0NA 4XMZA 5E00B 2APBA 2QZ5A 3T0EE 3FF8A 3V7AG 5JTWA 4R7DB 1M1SA 3DJ9A 5C2UB 3QDME 4LLAA 4MAUL 4DAGL 4DUVA 3V5HA 4NOBA 4KX7A 5AOLA 4W4OA 2G75B 3ZR5A 3K71B 3POCA 2ODIA 5F1SA 5F96L 1QOKA 3UO8B 4ZFFA 1IT9L 1EBAA 3IXAA 4FYQA 3ECBB 4JN2B 4ZXBD 3TNMB 4LCVA 1UXSB 2ZKXA 5KJ4A 3LMJL 5TK4A 4OKVA 4YS4A 1MF2H 4PD4K 4J4PA 3T0DA 1CTNA 1TZGH 3NSJA 4GKNB 4F91B 4NUGH 4ZYKA 5KVFE 2PPEA 2CG9X 3O2DL 3VXOA 3SDAC 1MCKA 3CZSA 4OZ4B 5C0BB 1FLTX 3BUTA 3T0EB 1XBRA 1YEWA 4R7NA 3GSOB 3QDMB 2WKLA 3PWPA 5I8EB 2Q6WB 3MJ9L 1OV8A 3BSGA 4HX1A 5B39A 3OKKA 2EVHA 2AK4A 2EEAA 2AI0H 3QUKB 4O02L 5C97A 5IFAL 1A9EA 4G80B 1MREL 3AM8A 2EC9T 1NINA 4P4RB 4XWOD 4I18C 3QPKA 4MB1A 3GSUA 4XVUD 5KS9F 3OXSB 2IFFH 1NBVH 4EDWH 4FTVE 4MMXC 1Q90A 1KELH 4DP2X 2AXGB 3FFCD 4HK3J 2EP6A 2OMWA 4DO5A 5KTEL 2Z4QB 4Y4KD 1G7JA 2DTMH 2O5XL 3MNZA 4FFVD 4L8CA 4I77H 1L5GB 1JPEA 4OZGE 3UMNA 2AQSA 3MBEB 1IKOP 3HG1E 2OMBA 4FXTA 2E27L 3GDCA 4UTAA 3IFPB 1FYTE 5IJBC 4G7YL 1OGAA 3U4AA 3UCRA 1G9MH 2DMGA 5E00A 3U1SL 1D5RA 4OGZA 4XPFL 3IAGC 2ZJSL 1WP6A 2L7EA 3HI5L 2C9SA 4TUUA 3P3YA 2MSPA 1WUNT 1GAFH 2D03H 5IW1A 2G75A 4FTVB 3K71A 2PO6A 1JF1B 3QQ3B 2AJYH 5IQOA 4CRPA 4PUBL 4D0BB 3RX7A 1NMBH 2VMJA 4WCYL 3IN0A 4APXA 3RX5A 1UXSA 2YK1H 1RIUH 3ZGIA 3VFTB 4OLWH 4OZGB 5AQ0A 2Z31A 4GW1B 4GKNA 3HG1B 5AL8A 4MD0B 4JAMB 5E2JA 1CG9A 4KHTH 1FYTB 3ZKMC 1NAKL 2QKIB 4OZ4A 3O8XC 3BAIA 5B1AB 1U6AL 3T0EA 5AAWA 1H15B 3PCYA 2B3RA 2HRPL 4K5OA 4GNKB 3KPRE 3SPJA 3VTMA 3MLRL 5I8EA 3WAKA 4R4FL 5E2WH 3TT1L 4BQ8A 4CSPA 1PIGA 1JBJA 4NRZB 4WVRA 3QUKA 2CCVA 1DR9A 3SDDD 2QADB 1YEKL 4R5VA 4XO8A 4LDEB 3H9YA 2VXTL 1AMXA 4JFQB 4ICXA 4JM4H 4P4RA 3ILPB 4MDIA 4P9HH 1PVHA 2FYYB 3ZRSA 3R7RA 3QS2A 3P77B 3VM5A 4LLVA 3WLBA 4DTGL 1F4HA 5IT2H 5I74B 1MFCL 2Z4QA 3WIIL 3D85B 1ND0B 2EECA 1I8LC 3FQUB 3T0BA 2YBRB 2ZOUA 3MBEA 1KJMB 3OMIB 1KDIA 2WZ5A 5DVPA 5KSBE 3DPDA 4RMTA 3KPRB 1JCKA 4PJEE 3SE4C 3KYOB 2GHZA 3OD3A 3IS1X 4MDRA 5G4OA 4MRCA 4CU8A 5FEBA 5JLZB 3DVNA 5IB1B 1C5CH 4AVKA 4HF5H 3PPEA 4NUPA 3VFSB 4D9LL 2F19L 3CDGB 5H37A 5A1AA 4EUPH 1GY2A 5E03A 1MHCB 4FTVA 3QQ3A 2AITA 2IAMC 4HPYL 1FPTH 1X44A 5BRPA 1OAJA 4PMEA 4D0BA 2X9YA 3W9DA 2IV8A 1WZKA 4XOAA 5GIRA 1DBKL 3VFTA 4OZGA 2G4GA 2B5IC 2VXQH 4GW1A 3CN1A 1B88A 2HT2D 3HG1A 4FQCL 4JQVC 3MRRB 4MD0A 4XXWA 4JAMA 2WCGA 2NSMA 4PJEB 1FYTA 3V55A 2QKIA 4ZW8A 2ZNWA 1HQRB 3HHSB 4YHZH 4PRPE 2YQBA 4ZUTB 2OZ4A 4MCYA 3EH5B 4LSUL 2AERT 2OW6A 3IDYB 3O4OB 4WWNA 4NRZA 4YDJB 5GRJL 4I3SH 3VXSE 3MV8D 2R29A 3FBQA 5E1HB 4XMUA 5LGYA 1FIEA 4QRPD 4LIQL 3BVUA 2HPOA 3JYBA 4WGKA 4DP9X 2DKUA 3P77A 3TCXA 5IESL 1JNNL 1NC2D 5F7NC 3TBYB 1B4JH 1GH7A 3A6CH 3AZUA 4OB5H 3D85A 4L37B 4KRPD 1ND0A 2WAHA 4MXQD 1UD4A 3FQUA 4PW3A 2R0KH 2FT6A 1WTLA 5DYOA 1KJMA 4UIKL 1JD7A 3W9EA 5INDB 4E9TA 4PRPB 3KPRA 4PJCF 1ZLSH 1RZJL 4M8RA 3F7VB 3MLYL 5T3XL 1EBPA 4M5TA 2GC7C 4GQZA 1PBYA 2BSCA 4MD4B 3EYOA 1A6WH 1F4AA 5C7XL 5JLZA 5IB1A 1UM6L 5J6SA 1FQ9C 4RISL 1MNUH 3VFSA 4FG6C 1I1FA 1JPFB 4DKEH 1DQDH 3IB4A 2EO1A 3ECWA 1OM3L 1MHCA 5A2CA 3Q8AA 4KKRA 3R06B 2CO7A 3D8MA 5K69A 1JZ4A 1WAAF 2YWYA 3F7QA 1FHNA 5DJXB 2QTVA 1KJ3L 1ZOXA 1AO7E 1PZ5B 5G4NA 3V79C 2CMRH 1I1YB 1IGYB 2R2BB 2YARA 3VGGA 3BZFB 3GFUA 5EC1B 2XC8A 5KSBA 4FJYA 3MRRA 4HZAA 2B1OA 4PWEA 2VN6A 4NNPL 3GMQB 3MCLL 2YPVA 2HG5B 3QFDB 4OGQC 2V17H 1IAIM 3LZRA 1HQRA 4J3OD 4Y2DB 3RRQA 1GS7A 4TUOB 3TESA 4LPWA 3QORB 4DEPB 5MHSD 4ZUTA 4A2DA 5F9WB 1H6TA 4AYEC 3M8OL 1AR1B 7PAZA 2NY6D 1PJ9A 5B8CB 3OAYH 2VITB 4H8WH 3GXTA 4XNDA 2CJUL 1C5BL 3OMZA 4KMQA 3T8VA 2WANA 1I75A 2P80D 3OLDA 2G9KA 1RJLB 3LNIA 3QDJD 4J4PC 4K3EH 4L2LA 1IEHA 5IKCB 1ADQL 5T1KD 1AO7B 1COBA 2P26A 4KI5C 5GRVL 2QQNL 3Q9PA 1ZVNA 4JFEE 4MKMA 5DJ0B 3BFQG 5J5EA 3C6LD 3N9GL 3ML8A 3NSFA 3E1ZA 4L37A 3GUTB 3A0OA 4AMKL 3QZPA 2D0GA 4R6UA 5K1VA 4PRPA 2EILB 1K4CB 5DHVH 3SQOL 2A0LD 3UBGA 1DQQB 2GSIB 1CL7L 1ANUA 3S3BB 4NC1E 4U1GC 4HC1L 1HNFA 2YXMA 5FA4B 3VXSA 4MD4A 1A47A 4ZNEE 4KJPD 3N42B 3MV7A 2OYPA 2F5AL 4XVSH 1GRWA 4K3DH 4PWKA 1W0WB 2GJRA 2ZUWA 4POZD 4BSJA 4HKBB 1EH9A 1JPFA 1O75A 5D6CB 3T08A 2V8MA 3MKGA 4NCC1 4JFEB 3R06A 3AGVA 4KZCA 1MVUB 3TN0B 3SYCA 1ECZA 1Q0EA 5DJXA 1PZ5A 2K8MA 1I1YA 1IGYA 4OCYL 2R2BA 3ILEA 3BZFA 4AK2A 3GMQA 5K39B 3RPIB 1HHIB 1OANA 1OAXH 2AEIT 3QFDA 1MW1A 3HG3A 3K2IA 4GAFB 4Y2DA 1QNZL 2PWEA 3QORA 4LL4A 3T6XA 3WNNA 4AENB 4IRJB 4UDTB 4PLNC 2PO6C 2V2WB 1KB5H 2IANE 2QEJA 3WKMH 3KPSE 1U91B 1IBBA 1MCCA 4QCIA 1NAMH 3TV8A 7PCYA 3O6FA 3SDCB 1DBJH 1MFAL 3T3MF 4XN1A 3U7WH 2C9VA 1RFDL 5GSVB 5DD5L 2Z31C 1A14H 5IKCA 2Z0BA 4OD1H 1AO7A 3QQ4B 4EUPB 4AVHA 3CSYB 1XO8A 2OULB 4FEIA 2XTJE 4NDMB 5ICZB 2GBAA 2OCJA 5AAWC 3GUTA 1KBGH 3V5KB 1QSZA 4XMXA 3OC5A 3VMOA 3HRZB 3KHOA 5C0DB 2ZSWB 5CS7A 3QPQD 4FXKB 3D2UD 3U0WL 3K6DA 2IANB 3FQWB 4F8NA 5JDJA 4H5SA 1DQQA 2GSIA 2EYSA 3MRPB 4R96B 3ZBMA 2XV0A 4DZ8B 4F8TA 3KPSB 5L7XL 2YMXL 5FLVA 3VFRB 1CC3A 1CE1L 3O41B 5IGXL 3B9AA 4L9LA 1MCDA 4H8UA 3WO4C 1W0WA 2ALAA 5KOVC 4HKBA 5ITBL 4JS7A 3JUYA 3N41F 2RTTA 4HUVB 4JFEA 3HUJF 5DK0A 1MVUA 1NOLA 1OZTG 4HJGB 2JB6B 4LDCA 3ZTDC 3FQTA 4YOKA 4HQQL 1JZHA 1NL0H 3AWEA 4IRSB 1I1CA 2J7LA 1YEGH 4UT9L 4YBQC 5EU3B 4M8VA 1RIHL 2F1EA 5K39A 3RPIA 1HHIA 3GHPA 1BIIB 3UTTD 1BLNB 4HXAL 4NLHA 2HUHA 4YDKL 1IBFA 3QWRA 3ESVF 3G08A 2Z93B 4IRJA 4JFZH 4UDTA 4JHUA 1ITCA 4JANB 2DD8H 4JJOA 3ZTNH 2V3FA 1NGQH 5B1KA 2X2UA 4UZGA 3SDCA 1RUKL 5GSVA 5ADOL 2W9EL 3BAWA 3ATBA 5DDHB 5GHWL 3QQ4A 2XBTA 4EUPA 1QG3A 2K7QA 3CSYA 4HS6B 1TTCA 3CZFB 4GJTB 4M1GL 4NDMA 5ICZA 3WTXA 4KJWD 5CP7A 3LKRB 3OAZH 4MMZB 1YPZE 5KJRL 5I8OH 2OL3H 3QRLA 1XQ4A 3I3DA 3VGDA 2O61B 3K1DA 1IVTA 2WZ0A 2Q7AA 2YD5A 4WGWB 5BMFL 3HRZA 5C0DA 1U8CB 2FO4A 3O2WH 1FZMA 3V6ZA 1BAFL 1GA2A 4XP5H 5AG9A 2W0FB 3DX3A 5J8OA 3MRPA 2JKNA 2VDRH 4R96A 2IXQA 3KPSA 3EDJA 1YYLL 3VFRA 3NCYS 3O41A 3OGCA 1XF2A 1MXDA 1LO4H 1A2YB 4HALA 4OLYH 4JCWA 3Q2CA 5CJQH 2FTAA 5I74C 1RZKC 2NY0C 3GNMH 4P2YA 4HUVA 4IU2B 4JN1H 1H8OA 4FMKA 3WS6A 4K94H 2WZPA 1B0GB 2JB6A 3FSZA 1YPZB 4WI0A 4YWGL 2EDBA 2HX8A 4E9RA 3WIHH 4UV7L 5EIVA 5MEND 1R3KB 3EZ8A 1KCRL 4IRSA 4OZFH 5DRZB 3PJNA 3L3IB 4A55A 4F1ZA 2ICWI 3JBG7 5JW5B 3VI3B 1KJ2H 1JCVA 5DQDL 1BIIA 1WD9A 5DEGB 4PJFF 3DO4A 5JOEA 3AMLA 2APFA 5EZOL 2Z93A 3N04A 3D4YA 1N7MH 4G6KH 4G71B 1VRSA 4HWBL 2JJTA 4Y9CA 5DHVB 3S36L 2Q1EA 2W65B 4AJYV 2FBJH 4JANA 1QVOB 3UC2A 5K9QG 1W6LA 5FM4A 5JQ6L 4FLOA 4GB9A 1MFMA 3QZWA 2CUAA 4UNIA 4LCWB 4CBPA 4DVBA 2VCOA 2BM3A 1WK0A 2R51A 4OLZH 4LP5A 1GIGL 1T66C 4OFIA 4PI2A 4HS6A 4L3CB 4PRNB 3L1GA 4MWFA 4D9RE 1TFHA 3N44B 4OCLC 4OBSA 4XOEA 3VD3A 3HG4A 4MMZA 1AQMA 5TQ2H 4AQEB 3LZQA 4BCYA 1AY1H 2WK2A 1VEOA 3PAVA 5B3JF 2WXNA 5KSUB 1W9XA 1FZJA 3NCXA 3FMGL 4FFYL 3IDYC 3O4OC 3QNFA 3BGMB 5DO2C 5T5FA 5J4MA 2VR9A 1ZGLP 3O45B 4O58H 2ZWLT 5FB8A 2W0FA 2QQLL 3DJZA 3ARFD 1MRFL 2F68X 1F97A 3FN0L 4H1LG 4GQ9H 4QT5A 4UDUB 3L6FB 5AB0A 1FE8H 4OI7A 3MBXL 1A2YA 1L0QA 3AXIA 1F8TL 1PYWB 1BMGA 1Y18B 1KB5B 3D09A 2EC8A 3LHPH 4FQ1H 5D7JD 3CD4A 1ZA6A 2BOLA 4IU2A 4BZYA 2YN5A 5CGYC 2IMNA 2IG2H 2R4SH 3QC6X 3CFNA 1IFRA 1NAMB 1PEZA 3CVCA 4K8RH 1B0GA 1QR4A 2K1MA 3TH2T 3LN5B 1YAZA 1U8IA 4GSUA 1R3KA 5DRZA 2R4RL 2VQ4A 4Y16B 3T71A 4CILA 3F84A 3QW9A 4BGDA 5DEGA 3ZDWA 2YA1A 3BAKA 4NUQA 3D51A 2GABA 3NA9H 4KRNA 5IBLD 5EBGA 3S34L 4XPAH 5IB3A 5CEZL 5DHVA 1A7BA 4LPTA 4B6ZA 3OLIA 3X3FH 2F8OA 2W65A 4G8EB 4AC4A 1XGRB 1ZE3C 2MCPH 1A7QH 1IGCL 2YRLA 3AADB 3MXWL 1OE3A 1P7QA 2OI9C 3BDXA 4HSAC 2MH4A 2YXVA 1EAQA 1EV2E 3QIUB 1Z0MA 2XQBH 3HFFA 2GJZB 2A1WL 3BPNB 2ED8A 4KGJA 3NRPA 1EHAA 5K59E 9CGTA 4L3CA 4PRNA 4ZX6A 1WDAA 2Y7SA 5JIQA 3CHQA 3KJ4B 4GKOA 4NWUL 4OD3L 4WEMB 2Q5BA 2XNAA 2OXHB 4AQEA 5IW6A 4DO6A 1KCVL 3TVMA 2VZ1A 1CPUA 4BV1A 1G7HB 5HHVL 5FO9B 1QQDB 2ADGB 3BGMA 3O3AA 3O45A 2YPLB 3DTDA 4OLUL 4I85A 1AS8A 3O6FC 2WLLB 3BUPA 4K2UH 4R83A 3FAXA 3LS5H 3L6FA 2YD0A 4JDEB 4XT1C 3EIFA 3KH3A 4OZFG 4KTGA 1PYWA 1ZTXL 1QTSA 4C56E 3VNYA 1V05A 4HJEA 5I5JA 1N19A 3I6KB 2BPBA 5IQNA 2H1PL 1WRFA 1WS8A 4QGTA 3LN5A 2BRQA 1OQXA 3LRLA 1FSKB 1JERA 4PJ9A 4YL9A 1R4XA 2C3HA 1HXYB 4L9LC 2CIIB 2OL3B 3BEVB 1UA6L 3UIYA 1SN2A 5E7FA 2WXQA 2QLYA 2WLIA 4WW2F 1IGFH 1NMCB 2O5NA 1ZLUK 3WFDL 3BCFA 5C08B 2NQCA 4CDGC 4TQEL 4G8EA 1XGRA 2BNRD 2ICES 2YBGA 4M5ZL 2VDRB 5E94B 4PJXE 1ZLVH 4P9HC 4Y4FA 5BRZD 1UH2A 2J6EL 3ZDZE 4WU5B 4X7SL 4LPYA 1LEIB 3QIUA 3BKYL 3GJEB 2JXMA 3GPEA 3MVSA 2GJZA 4RMRA 4ZX5A 2FHCA 4NQDE 2DJSA 1U3YA 3QZLA 3BFWA 4QLWA 4AEIH 1J8SA 3N91A 3QEHB 4KNSA 3SE9L 2OXHA 3PQYD 1S9YA 3DI3B 2G2RA 5A2AA 1FIGH 3NGBB 2A9CA 5GGVY 1BREA 5DTFB 3X2QB 5D96B 1S9VB 1G7HA 1CFQB 3L3DA 1QQDA 5FO9A 4OZFB 2GCYB 1MWAL 1A7OL 4BH7B 2G3XA 3BWAB 1K5WA 3SDCC 4EI5D 3BWZA 2WLLA 1KJ2B 5EBMB 1FVDB 1EO8H 3JTTB 4FQQB 4NPKA 4PJXB 2Q2LA 3ZDZB 3DVGB 4JDEA 3QWOB 3GZKA 2CCLA 2DPKA 3BWUF 4XP1L 3R1GH 4IS6B 1KPRB 2HT3C 4O4YL 3VG0H 4UQEA 5C0GA 2BVOB 4NQDB 1OP9A 2KZ1B 1ASQA 3I6KA 1DQML 4QNPE 3HRZC 2IH8A 4RFNC 3CVHL 2NY3C 2BNUB 1DVZA 1MI5D 4JVPA 3F7PC 3ZW3A 1O0VA 1JD9A 4E9XA 5ALBL 3O2DA 4E2OA 4GXVL 2WIMA 4DGIH 2AF2A 1I8AA 4UQ3B 1E90A 4DKFL 1KZYA 3F65A 3BEVA 4HOMA 12E8L 1QABA 1X5LA 4EN3C 2BZCA 3SYOA 4HEME 4GUQA 4FQ2L 3KWTA 4U2YA 4LSSL 4S0HA 3JXAA 4XPBL 1LNUB 2XTJC 3WS6C 3HG5A 4C56A 2CLRA 5I66B 2W07B 3L4VA 4P06A 3RQ3A 1UB6A 2Y3NA 2DTSA 5D2NC 1G0XA 2X4UB 1KTDB 3QCVL 1LEIA 3VW3H 1T04B 4KAQH 1XGZA 1CICA 3L2LA 3B1TA 5AW7B 2QELA 1TU2A 2YR3A 1TQWA 1XR8A 3G04A 3SDYL 1RU9L 3GB7B 3NCEB 3UTPD 2AEQL 5FUOL 3FHQA 3ULAB 5IEHA 3LD8B 5J6HA 1KN2L 1WGOA 3OAWA 3WIHA 3B7TA 4M1DL 5C6WH 1S9VA 1WISA 2OJEB 1CFQA 2JJTC 5D4JA 4PSRA 3KLSA 2GCYA 3OKMB 4BH7A 1ZEAL 1MZZA 2HH0H 5DUMH 3NSCA 1UXLA 1FJ1B 1KJ2A 2DI9A 4NN7C 2CPUA 3ZKMD 1FVDA 4FQQA 5AAMA 1I8UA 4AVJA 3MLSL 4PJXA 1CE6B 1EEYB 3ARBB 4O2CA 5E5UB 3QWOA 7FABL 1UURA 3ROLB 2MPAL 4U6VL 4JHBA 1KPRA 3A6BL 4MMZC 2H3NB 1NDMB 1BFSA 2H3XC 4TPRL 4NQDA 2IPTH 4PCKA 1QBMH 1HJCA 2E0PA 2QPUA 4GKSB 3RX9A 1T3FB 2BNUA 2MWCA 4TL5A 4YBLC 4GQQA 2X87A 1FNSH 2J56A 4UZSA 5J0BA 1SJEB 4UQ3A 3L4ZA 2DQUL 4MJHA 1P69B 4HLJA 4N2GA