1VCBC

The vhl-elonginc-elonginb structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
142
structure length
142
Chain Sequence
b'LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ELONGIN B)
publication title Structure of the VHL-ElonginC-ElonginB complex: implications for VHL tumor suppressor function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 1999-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 1vcbC01
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 1vcbC02
1LM8V 3ZRFC 4B95C 4BKTC 4AWJC 4W9LC 3ZTCC 4W9JC 4AJYV 1VCBC 4W9FC 4W9GC 4W9DC 4W9KC 1LQBC 4BKSC 4W9EC 3ZTDC 4W9CC 5LLIC 3ZRCC 3ZUNC 4B9KC 4WQOA 4W9IC 4W9HC
chains in the Genus database with same CATH superfamily
2F08A 4O9HH 3P02A 5ETUA 3EH2A 3QIUA 1KJMA 3KPOB 1JTOA 3WKYA 5B3SB 2H6PB 3IE4A 4P2RE 5AW6B 1DBJH 4M5ZH 3TJPA 5CKGA 3OKKB 3U6XS 2OZ4H 4DN3H 1E28A 3NJNA 4NGHH 3V5DB 2OW6A 2FVNA 2YSSB 3BEWA 2W81C 3ZQ9A 2PPDA 3US0A 5FYLE 1KOAA 4CMMB 2X6MA 1KNOA 4FXGA 4FZEL 4N0YH 1XL6A 5E2VL 4CC4C 1AO7D 1A4BA 1L9MA 3V6OE 3S37X 3IVKB 3FDWA 4KI5F 3UG3A 1DBML 3AAZB 2EEAA 2VW6A 2Z93B 1NM9A 4U1HB 3CFEB 2QR0A 3IFLL 4OLYL 3OHXB 2XIIA 4NP9A 3D30A 1EO8L 3LEYL 4HGWB 1ETA1 1XEDA 3GQFA 3ZYZA 3S3SA 1KWGA 1RFDL 1ZANH 3FQWB 1RIUH 1GC1C 2YKKA 1VGKA 4CGTA 5DVKA 4CC0A 6TAAA 4LIQE 2YC1A 2W88A 1ED3B 2DQUL 4M5SA 1P1ZB 3EHBB 3SKNA 2OI9C 1LYQA 1LEKA 3T0EC 1XVSA 1Y18A 4OF6A 3UYPB 5FEBA 2X2HA 5ES4B 3DIVA 1YAZA 3KMDA 2OV0A 3EOTH 3KW7A 4NS0A 2BFVL 4U3HA 2KZKA 4NAJA 4TL4A 1PSKH 1TCRA 4FULA 4XE5B 2VM4A 1T1YA 3DK2A 3EFDL 4HW6A 4A2MA 1LWRA 3NZSA 2XZQH 3L5WA 4HV8A 4OB5H 3UTSB 3TEYA 3PHSA 3BAYA 4MB3A 3APNA 3ZYIA 3QJHB 5FGRA 2VDRH 4ZW5A 4L0PB 3OSVA 4A7SA 2ETWA 5JLZA 1IKFL 1U8CA 4HKXB 1CVSC 4QDGA 5DEJA 1WT5C 1BM3H 4D0BB 1UURA 3VWJB 2FGWL 1A4JA 1ZK9A 4PRHA 2XVLA 1NCUA 4WNSA 3VB9A 3CHXA 2QPUA 3DSFH 3QUKA 1LP9F 2X2UA 1BHGA 3FU7A 5TF0A 1X5MA 1RUML 1T6BX 2BSEA 3S3JA 5F9JB 1P0SE 4LNRA 5LNEA 1F4WL 5DJDA 1FYTB 5LNDA 2Q6WA 3W5MA 2DYRB 4RFNC 3QH3B 2X53A 3GJFK 4QI3A 4MJIA 5IVXE 4ZI8A 3LRSA 1VESA 3JV0A 5AAPA 3X13B 2YLHA 4K5MA 1DFBH 1N8OE 2OULB 4OCWL 1M56B 3IM1A 3S36X 4OCXH 4X4YB 1PPIA 2H2SD 4JQIA 2QFPA 2DKMA 3QDMB 1S7TB 4HBCH 5IWLA 2H47C 3DMMB 4F33B 5IEHA 2CHWA 4XZUB 2GEQA 5T5FA 3FU6A 5E8EB 1XSIA 1QX1A 2W95A 2B3RA 1DUZA 5GISL 2G2NA 4GINA 2VIRB 4N9GA 1IL1A 4QRRD 1NFDE 3HZKB 3QRLA 4GBXB 4NQCB 4GG8B 3OQ3B 2HLFC 4JFVA 4MBOA 5BRZE 3KPOA 4TLTA 5D7LE 3SDXE 1OANA 2WB1A 3BKYL 2H6PA 3DBSA 1JZ6A 4ZS6C 5ABAA 2VT0A 4UT6A 1A7OH 1A6VL 3R06B 5F7MC 2F19H 5ANME 4CSZA 4QO1B 3SYQA 4U6HA 2B1HH 1BPVA 3V5DA 4M48H 2VDML 3DBXB 3VFNA 3ABZA 3QHFH 3NJLA 3HG1D 3QUMB 4PVMA 5CZRA 3WXVL 4XMLL 2H6OA 4MS6A 1MH5A 4ODSH 2WZ6A 5A2AA 1CQKA 1C12A 1P6WA 5BRPA 3K2KA 1FVDB 3GMNB 1JPEA 3BX7C 5DR5H 4N0CC 4P8QA 3IVKA 1ZAGA 4JM2A 5AW3B 5IIEB 2NDFA 4K3JL 3RJDA 5DI8A 4LEXH 4BH7B 3LZNA 1Q9WB 3MRKB 3AAZA 2R0WL 3MLSH 5CZVL 2Z93A 1F4HA 3CFEA 2NY6C 3FUIA 4JO1L 3OHXA 3ZL1A 1M3IA 2HJKB 1N5YL 1F02I 4Y19E 4PVLA 3TO2B 1KXVA 4PW4A 2X4PB 3FQWA 4WVRA 4PTTB 2OKMA 3KWVA 3M46A 3RURA 1KY6A 1U3HC 4A2FA 1R47A 2PTTB 2H9GB 3MXVL 4NI6A 4XMUA 3ZDWA 1H9DA 1K4CB 4S1DC 3JSSA 4F7PB 2X9WA 2FX9H 1P1ZA 2CRYA 3BXNA 3PXLA 4MYPA 1FSKB 4I13B 4OSUH 3IGAB 1T20A 1C7TA 4N2AA 3UYPA 1SDAB 1J8SA 2EICA 3EUDA 3MV7D 1BBDL 1O7DE 1KPVB 1JD7A 1EJ6A 1N0XH 1RZJC 2OJZH 4FFZA 5FGCB 5LBSA 5TE6L 4CVUA 3UYRL 5GS2H 5KJ7E 5L0QC 1QOKA 1HN1A 5FV1L 3ERXA 3WN5B 3ARDC 4JGHA 3SDCA 4F9LA 1ET8A 3FSWA 5AAWA 5L8JB 1NGQH 2Y69B 3DXAB 3VYPA 4MAUH 5I1HL 2BY2A 3UTSA 5CU9A 5JHDD 2OMYB 4ABWA 1HHIB 4HC1H 3UP6A 4AYBA 4XOEA 1IFGA 3DA0A 2NY3D 3QJHA 3WFZA 2YK1L 4KOBA 1N4XH 5FCSH 4P5SA 4JJHA 4R26L 4HJJH 2FHCA 3I75B 4HKXA 3V7MA 1BMWA 3QUYD 2OFQA 1SMAA 3VWJA 4D0BA 4RAVB 4R6UA 2CM6A 1E4WL 4XXWC 1GYVA 5D5ME 1MWOA 5I76A 4LCIH 1G9NC 4YDZA 4PJ7B 4U4IA 4CGUB 3JTSB 1B0RA 2P24B 4WW2C 4YJZL 5IP4A 3B56A 2HXAA 2OQJB 2J73A 4XH2B 1B2WH 1CT8B 2V2XB 4MVBD 2YBGA 3WTTA 5FHBH 5F9JA 1U36A 4FYRA 3PGDB 3SYOA 5JZ7D 1FYTA 2R69A 1JXJA 4NQUA 2ZF9A 1VGEL 3QH3A 2EDHA 5TQ0L 1X5IA 4LRNH 5I5RA 1ZHKB 3M86A 4PJXE 4OCYL 4WRLA 2DBLL 2IAAC 4X4YA 2EUVA 5EG6C 2HUHA 2BIMA 3GBNH 1S7TA 3BUPA 4P9HL 3DMMA 4I77L 3RDJA 4F33A 4KNSA 4XZUA 4FA8A 1QLEL 4NFDA 3H9SE 1GS7A 2A0LC 2Y1YA 2CDEB 4NZDA 3U9UA 1M9WA 1Q9OB 2CKNA 2VIRA 2F0CA 2DMHA 2AJYL 4TQHA 4H1LH 2Y06H 2ZP0T 4YWGL 3HZKA 1UFGA 4Y5YB 3TPKA 4FLOA 4XPFH 3SE9H 4GBXA 2H0FA 3D0VB 4GG8A 1RK7A 4MJ6B 4TOYL 3S35X 4Y2DD 1RL1A 3BRDA 4TSCL 4AZUA 3UJTL 5DA0B 1EUUA 2FJFB 4OKVB 4KJPD 4RMSA 4B9JA 3MKKA 2CGRL 1B4JH 2JQZA 4WEBL 3CHRA 4DP8X 4JBSA 4WKZA 4QO1A 3ZTJG 1CICD 3S37L 4X7DC 2K4AA 1CUOA 3IDXH 1D7BA 4NKIH 3DBXA 4B0MB 1RURH 1PG7H 1T83C 4KQ4H 5T8IA 4R96B 2EVJA 2GYSA 1OHQA 1FIGH 1ZDSA 2JFCA 2JCCB 3LEVH 5I0XA 2YFNA 1MCLA 3H6AA 3N9GH 4MD0B 1FVDA 3GMNA 4J8RB 1KXQA 5AVWB 4KBPA 4HMCA 4LPWA 4I85A 5IHUH 2UZYB 4A7GF 4BH7A 3X17A 1CD0A 1Q9WA 5IBUB 1MY7A 1NMAL 2APVA 4Y4KA 2X09A 1L0PA 2HJKA 2VDPL 3GNML 1QSVA 3NAAL 4ORGB 3TO2A 2XWTB 2QQLL 1TQVA 4FTVB 4NM8H 4XP4H 2X4PA 3MODL 4PTTA 2B0SL 1Z2KA 4FEIA 3A47A 5LG6A 1PY0A 2PTTA 1TQWA 4NKOB 1QLRB 2KKQA 1AD0B 1EIBA 4YEFA 1K4CA 1GC1H 2QSTA 4I0PA 1OHZA 1OAYH 3Q6GH 3VRLE 1E4JA 3PL6C 2AGJL 3DRTB 3IGAA 3Q0HA 4N3TA 4NJ9H 3ZJAA 2GT9B 3O2WL 4W9HC 1QEWA 4HWNA 2XN9B 1KPVA 1PD1A 1CGTA 4ZO6A 1IAKB 4XVTH 1E9PB 3DRQB 3WN5A 4LARH 3WDIA 3FRPG 1OQOA 1PZCA 3BQUB 3O6KL 2DBJA 2CJUL 3BPOB 3DXAA 3HBZA 4L18A 4I1PA 3DX7B 2OMYA 3VI3B 1I8KB 3SBPA 1K3ZA 2ZNXA 1HE8A 3RIFF 3V52H 3I75A 1RLWA 3Q01A 3A4EA 2FGZA 5KUMA 4AQ8C 4BZ1L 4L3EB 4N0UA 5D1QD 4RAVA 5FK9B 3P9WB 1MY5A 3CC1A 1J1XH 5D7KD 5E00A 4PJ7A 3V8CA 3ZPDA 3C5JA 3JTSA 2P24A 1A3RL 1XIWC 4PRHE 2MCPL 4CN1A 4K71C 3S36L 1CT8A 2V2XA 5AENA 2Z8SA 2DWSA 4JPKL 2W9EH 5DK2B 3VXUD 2DKSA 1T6VN 3PGDA 1ZTXH 5BZWB 5JIMA 2N1KA 1KF9B 3WUWG 2YUZA 5E0QA 2ZUYA 4LLVA 1GOHA 2BW5A 4WJG3 4AQEB 4U0QB 4DGUA 4O58H 5FYLL 1QEXA 5IREA 2VDLL 3OAUL 3HE6C 1HH9B 1EZSA 4MJIE 2L7QA 1RUPH 1FH5H 3OXSB 2FNBA 1U8IB 5CLXA 2UZIL 4KMTH 4ZFFB 2XWJB 2N7AA 5A6LA 1KCSH 4E9SA 5KYWA 4XPBH 1TZIB 2CDEA 3V4VA 1I8LA 3T9WA 2WBJB 2F54D 3UEZA 2MCMA 4IKNA 4QXVA 2ZCHH 3FTZA 4PG2C 2W59A 4Y5YA 2TSAA 3BSHA 2X0VA 3D0VA 1MRDL 2LAGB 3M7OA 4E9XA 3JXAA 4MJ6A 4O4YL 4U7SA 4LSDA 4OKVA 2VN3A 2YZ1A 3VGAC 3IBEA 5C2UB 1R17A 9CGTA 1XR8B 3ME0A 1BQKA 1GIGL 2Z35A 5E99H 1E6OH 4F91B 3FZUD 1MJJB 4Y4HC 2X4QB 1DLFH 1RUQH 3FO1B 2EIZB 5C08A 1ZS8A 3D4ZA 1J8HB 1NFIA 3KYMB 4ZX4A 5ICYB 2VDNL 4R96A 1T0NB 4LEOB 4DKTA 3WIFA 3WGVB 4AVJA 4IIZA 2JCCA 1WVZA 2LOEA 4G5ZH 4KZDL 3O4LA 3GMPB 5D7SL 4DQOH 2J1XA 1JFHA 4J8RA 5FX3A 1HSBB 4PCKA 5C0JA 3IGLA 3OMIB 5F7WC 3TWCH 4YLBA 5AZEL 2ZUQC 4Z3TA 2A73B 1TTGA 4ODTH 2FIRT 5DMIH 12E8H 3HB3C 4XP5L 2QVMA 3EFFA 1REIA 5CHNA 5B3NA 2XWTA 4FTVA 2B5IC 3WFDL 1F3JB 5E2WL 3ZKXC 4PP2A 5EN2B 1OOWA 1ZDQA 5K59E 1QLRA 4URTB 4OJFL 3IKCB 1HEJC 2ZUTA 1IQWL 1IBFA 2Y7QA 5F1NB 1IFRA 4Y8DC 3DRTA 2X9XA 1P4BH 3FB5B 2GT9A 1BYNA 4B9ZA 2YIHA 3K1KC 3WSQL 2LHAA 4HUKB 1XH2A 2DQTL 4JFDB 1NINA 1XF5A 2P4AB 2XN9A 4LGSB 4PJEB 3BUTA 4GAGH 1S78D 4HP5A 1IAKA 5IW1B 1E9PA 3DRQA 2WXNA 4K9EC 1HOCB 4OF3A 2XKUA 3US1A 1RZJH 2O6EA 3FUDA 3IAGC 3SODB 1BM7A 3FJTA 2QFRA 1KGYE 5JIPA 1ZD6A 3DX7A 2CM5A 1I8KA 1XGYH 4RMQA 4UT9A 4HXAL 3D69B 4V11A 3UTSE 4QHKJ 5TJWK 3U2SB 4Q9RL 2CH8A 2NYZA 2JH2A 5DWPA 4KDTA 3GO1H 4KKBD 4XO9A 4L3EA 3H0TA 1IIKA 3IJ8A 3UMNA 2CCWA 5D96B 2HKHH 4JLRA 2XOTA 1YHPA 5ECGA 5AKTA 5DUML 3U9WA 2BO0A 1KYOK 4IRJD 4MCNA 4WGWB 4WHYG 1IFHH 3HMWH 1I9JH 3OKEB 4HWUA 1G9NH 3OR7B 5GGVY 2ZIDA 4ZODA 1EH9A 3FCUB 1RH8A 4W6XB 4H26B 5C0AB 1FGNL 2AXJA 4JVWA 1NGZA 1DVSA 1GH7A 3CQPA 3AITA 1E4XL 3GIZL 2PLTA 2B77A 3V7AE 4HF5L 4AQEA 2FAUA 4Z7QB 4L4TB 5TE4L 1FYTE 4KH2A 4IW4C 4QLWA 1TQTA 4GG6B 4OCMC 1DQML 5GJSL 3H9ZA 3OXSA 2O72A 1U8IA 4F58H 1E2WA 1DP0A 2K45A 3MV8D 5F6IC 4ZFFA 2VDKB 5IB3B 4NZRH 3S35L 1FJ1A 5GRYA 1TZIA 2N4IA 1GHFH 3BZ5A 1NGPL 2C4XA 1A6TB 2WBJA 1ADQL 5IHWA 2C9XA 2VL4A 4YGVB 3FU3A 3G9VA 2YN3A 2WSKA 4JFPB 1EDQA 3EGXB 5F0MB 3L08A 1YCSA 4M93C 1G84A 3RZCB 4HJEA 3QZPA 3FNKA 3C8DA 2CO6A 4PWJA 1BVNT 2HKAA 3DX1A 5E70A 3AGVA 4MA8L 3HC0A 4M7ZC 1XR8A 4A6YH 1PTZA 3P4NB 2X4TB 2F1AA 3EJUA 1EJOL 1MJJA 2X4QA 3TIEB 3VGGA 4GUQA 4F8LA 2EIZA 1PKQB 4H0HB 3MNDA 5DQDL 1XSKA 1J8HA 2FWLB 7FABL 3AS2A 3QCTL 2OAAA 1T0NA 3SBRA 5DD3H 2ZP9A 1WITA 4GKSB 3GMPA 5GGSY 3KHQA 1A5FH 3WLBA 5AL8A 1ACYL 4C4KT 5DS1A 3IDNB 4A2DA 4EIUA 1YEKH 3ZU8A 4WHCA 1KXQE 2A73A 3OJVC 2P5ED 3QG7L 3OC5A 5HHOB 1MF2L 4BK5C 3K8MA 3A4FA 3RQ3A 4FNUA 1BECA 3PDOA 1F3JA 4HJUA 3TJHD 2X4UB 4DK5A 2A9NH 4J4PC 2XA8L 1RUAH 3IKCA 5EZLB 5JQHC 1IGCL 1ZV2A 5DC0A 5F1NA 1JRHH 2C3XA 4KO5A 1R5IB 2Z92A 4J8QA 4ECNA 2Y7OA 3CMOH 1OWRM 1EEZA 4S10A 2YSTA 3QORA 3KLHD 1CE1H 3CN1A 4JFDA 2KBGA 1JMZA 5D71H 4PJEA 3BD3A 1F8TH 1JAEA 1B0GA 2C9QA 1UD5A 2O5XH 5I66B 1UUSA 2NNXA 1HOCA 4WWKD 2YMXH 3KJ6L 1A7QL 4G9FB 3DV6A 4WFFE 1HS6A 5ICUA 3KPNA 1JPTL 1MAML 4BWWA 3E8VA 4Y4FC 3BGMB 2DD8L 1WEJL 1E8YA 4R4NC 1W2KT 1R1CA 1TTAA 3TJEL 3F83A 3QZBA 1NCWL 4KK5C 3FT2B 3CFJA 3EGDB 2CHXA 3MV9D 4NO5B 3V0JA 3DXAE 3D69A 3ZE2B 1NC2A 2JQAA 3U2SA 3IU3B 1VEPA 2QQQA 1WRFA 4GRLC 3MXWL 2XA3A 2AF2A 1HOEA 1NAMB 2Z31D 1PYWB 1V5JA 1VADB 3L3JA 5HDLA 1OZUA 4W93A 1PEZA 5TPWH 4N0UE 1DQVA 2AJ3B 2WXKA 4BFEA 3LNDA 3V2AR 1P5UC 3OKEA 4PJ9B 4NC1C 5DMJB 4DEUA 4PJ7E 1WE5A 4I1NB 5DEZA 4YSRA 1GAFH 2CCLA 2C3HA 3BP7B 4HS6A 4PJFF 5HI3C 1HL4A 4Z3JA 4MKMA 4W4OC 3RWCB 2XFXB 2VN6A 2YJQA 3AS3A 4L4TA 1JI1A 3VVVA 2XNAB 1PDKA 4GG6A 4L37A 1C5BH 4AIOA 4FG4A 1PG7X 5H4ZA 2E7DA 2FECI 3F58H 4XMZA 5IB3A 3B2VH 3Q5TA 3TVMC 1NANH 3U1SL 3UFIA 1A6TA 4ZT1A 1AFVH 5H37G 1B6DA 1NKRA 1SMOA 4FDWA 3F6JA 4F5CA 4YGVA 2HG0A 1QFPA 3PP4H 2EKSB 4JFPA 3FS9A 3U6XA 3EGXA 4HJ1A 3RDTB 4FYQA 5EN3A 3RZCA 4KFZC 4WAFA 3UTQB 4OLWL 1D6VL 1MI5B 4BKTC 5AB1A 3UTPE 2EP6A 5H8DA 1UCBL 4KXAA 3ECWA 2X4TA 3P4NA 1X6LA 3MCG1 3C6EA 4G6JH 4Y7OC 4RETB 3D6GA 2NY1D 3B7UX 3LNFA 1CLZL 2WLMA 1NOFA 1XR9B 3RKDD 4RGNB 1LO4H 4GUPB 2D0GA 5DMGD 1JVOA 5C08E 3BVDB 2CCVA 1HXKA 2CO3A 1JNHA 1YMMD 2H32B 5IV2A 5E51A 3IDNA 4CSSA 2ARJQ 3NIFF 5HPMB 2JCCE 4GXFA 3AQDA 1JGVL 1W6LA 3I84A 3ZMEA 2WCPA 4LOEA 2CBMA 3GRGA 3MLZL 3IJEA 5HHOA 1JWUA 4AL8C 1F42A 3O6FB 1NEPA 4HHGA 2HTKD 4N3UA 1P6AB 5MERB 1K5WA 4U33A 2X4UA 3N44F 2AJVH 2ZCKH 1NMCB 1FORL 3LB6C 4FTVE 4MWFB 1OM3L 3WEXB 3UTTB 5I1DB 1CFQB 4M7JH 3TV3H 1M1XB 4BUQA 2CBTA 3SYPA 4L4JA 2YPKA 2BNQD 1QQDB 2V9TA 3S4SB 4HFUL 1XZWA 3U1PA 4GP4B 2EH8H 3DYPA 4NQDB 4I48B 4KKNA 5BO0D 3Q8AA 4WCYL 1CGWA 2VXQA 1PNCA 3AWFA 4MMYA 1NCAH 3FUJA 4B9FA 4J3OC 2BXYA 3MLXH 4KPHH 4G9FA 3BDYL 5CR8A 2XN9E 3WKQA 2OBGA 1NGWA 3QSKB 4LSUH 1VENA 1L0YA 3RWEB 3FKUS 4FJ6A 4KK9C 4LAQL 4S1SH 2Q5BA 3BGMA 4K9EH 4Y16D 4AYFB 3MBXH 3DECA 1GJUA 3N1FC 3TBWB 3ULUD 1KC5H 4ZUUB 4H88H 1P7BA 2DN7A 3EGDA 4P5TD 4NO5A 1G5GA 2R4RL 3IDMB 4UDTA 4XNQB 1UH3A 1S7QB 4JQIL 3IU3A 3VI3E 1NIFA 4X83A 3SGDH 3EFOA 3V55A 3RFZB 3S2AA 3TPUB 3LMJH 3L3IB 5GZNC 2I25N 1R3KA 2WXHA 4QWWC 1I8IB 1NAMA 4ONGH 3HR5B 2CR3A 1VADA 3T6XA 4FXKC 3DDGA 4L3EE 4K7FA 2AJ3A 2IWFA 3VG0H 1FFPB 1MJUH 2JJWA 1J0JA 4CJ1A 4PJ9A 2ZWKA 5E08H 5D6DC 4PREA 4HUXB 4TQ8A 5JYMA 2OXGB 3B9VA 3BP7A 4MJJA 4PJ8B 4RMTA 2DMCA 2YAMA 2EDTA 1Y7VA 4OCSH 4OVUA 4UT6L 4KKPA 3RWCA 4J3OF 5K5YA 1GYCA 3OB8A 7PAZA 3EW3B 1YECH 3RTQD 5IW3A 4YSUA 3LZFL 4E41D 2G2PA 2O5YL 4JR9L 3SKJH 1DQLL 2DJSA 3QO1B 1RKRA 1X5LA 4ERSH 1GYUA 1XF1A 1J9RA 3Q9PA 4TNEA 2WXIA 5F3HA 2JJSA 2JKLA 2AEQL 4IOIB 3D0AA 4BWTA 5DZPA 3L3OA 4HXBH 1DLHA 1QA9B 3G5VB 1A7NL 3FTWA 3QEGH 5KVEL 3BZEB 2AJZB 3PFUA 4U0RC 1YEGH 3OJMB 2EXWD 4UQAA 3RDTA 3Q06A 1KBWA 1TTRA 4W9FC 3ETBJ 4XVSL 1X9UA 2HUEA 3UTQA 1UWEL 4NLAA 4XNZC 3FB8B 3V5KB 3C5ZC 1LE9B 3NIDB 1JZIA 3WL9B 4PJ5D 3N42B 2OR8A 5SV4A 2HPTA 4PFEA 3S5LB 1ZLSH 4RRPM 3CDFA 3TEZA 5F3BB 2VDOB 4P5MB 3FFDA 3OF6A 4GAJH 3B8YA 1XR9A 3W1ZA 3FQYA 4GUPA 2R2CA 3Q2VA 1HKFA 1J8HE 2H32A 4FFZL 5I24A 4FQHB 5CEXB 5HPMA 3ZE0E 1FGVH 2DM4A 1UT1A 4Q2ZB 2X3AA 2ITDB 2XRAL 3SSGA 3WNOA 4CVZB 4FADA 4G7VH 5T3ZH 5EV7A 5DJAB 3KG5A 1N6QL 4QGTA 3GYRA 4MHHI 5CN3A 4L8SA 2AQSA 1BJ1J 4D8OA 1YRKA 1S9KC 4RWYL 1JNLH 4NWUH 4PIRF 2XZZA 2A6IB 4YGAB 4LKCA 5CLYA 2H3KA 3T08A 4MWFA 2A6DA 4FG0A 3WEXA 1CFQA 2EAEA 5F1IB 1M1XA 1MIML 1FNHA 4H5SA 1E3ZA 1QQDA 2XFGB 3S4SA 4K15A 3FTUA 5ILTL 2YGNA 5T1JA 1BG1A 4NQDA 2EO9A 4XGZA 4I48A 1JIBA 5FECB 2OMUA 3CV5A 4NZFA 4XNMB 2H5UA 4EI0A 5JPNC 2IALA 3MOAH 4KO6A 4FP8H 5JXEC 3CN0A 3FRUB 4WO4A 1JWSB 1ZEAH 5I15L 4JFDE 5J56B 1INDL 3NSFA 3CFCL 3T4YB 4PJEE 3KDMB 4AW4A 4HWEL 4XN7A 2R69L 5JXAH 2IGFL 3FU8A 3TBWA 2GVYA 1SJHA 1JXFA 2C3VA 5AWNH 6CGTA 2PXYC 3AVEA 1AXTL 4XMTA 2YEZA 5E9DB 1S7QA 3H2WA 1DO5A 3TA3B 4AM0Q 3AREC 3RFZA 4BSWA 2XU9A 3TPUA 1ZGLM 2K3HA 3E1F1 5DZ9A 4W9CC 4APQB 1CG9B 5D7JD 1I8IA 4HIXH 3WY1A 3II1A 3HUJA 1AR1D 4XR8C 2AMGA 4TKWA 4PLJC 2FT6A 1FFPA 1OGAA 2IFFH 1NCDL 3O0RL 1AC6A 2ZKXA 4LBEA 3HHSB 1WGOA 5I1KH 1PLCA 3O45B 4GQZA 3US9A 4LOUC 4XPAH 2OXGA 3HAEH 4ETQA 4O51B 4QXGH 2L3BA 4PRDB 4WI6A 4X9FA 5HGBB 3NYKA 3RB7A 1ITCA 3OZ9L 3UMTA 1XH1A 2JSFA 3TBTA 3EH1A 4LLQB 4NN5C 5C0AE 4P2RD 1UB5B 1ND0B 3FMGH 1YSOA 3FN0L 3H4HA 2F7OA 3NVQA 3SQOL 5CS7A 5AVZB 4HT1H 5T1DL 3UPRB 3RKPA 3CFUA 4K8RD 4Z7QE 4GMTH 4L4TE 4XB3A 2K7QA 5B3JF 3QO1A 1A4CA 1AKJA 5CUSH 2VLRA 4GG6E 1Z9SB 1QAWA 1KIQB 3K2UL 1GJWA 5EUOB 4JQXC 1K8DB 4IOIA 3L3HB 3QI9B 5M94B 2YD2A 3FYIB 3F7LA 4LVHB 4ZMNA 3BZEA 2ADYA 2LABA 4D94A 1BZOA 5J12C 4P2QD 3V7AG 3QUZA 1S7SB 5AW9B 1IC7L 4F5CE 2RAMA 1L6PA 1TYRA 4X8XA 1LE9A 3BWUC 3FB8A 4JG1L 4BM7A 1UASA 2DLFH 4IGBB 2WQAA 1JZGA 3WL9A 4Q0XL 4HQQL 4E5XA 4HALA 3U2JA 4YL9A 2W0PA 2AV1B 3CXHK 4PWKA 3MRRB 3F6IA 4QR7A 1SFDA 1QKZH 3S5LA 4H8PA 4Q74A 5F3BA 1J5CA 4IBVA 1QR4A 1O5DT 3CBKB 3N41F 4P5MA 3QXTA 1OCCB 1OCOB 2PKDA 2ZX6A 4HEMA 4BE5A 4WY7H 4YDKH 3ARWA 2HJLB 2X6VA 1BQLH 2GCYB 3MNVA 3O11A 2V7HB 5CEXA 3ZHDA 1ACCA 4Q2ZA 5CEZE 2ITDA 4ELMB 4CVZA 2MOGA 4QRBA 5BW7A 3QYMA 4BE6A 4A7UA 2YAQA 3WO4B 1XF2B 3JYCA 5CGBA 5DJAA 4DUWA 1MJ7H 1ANUA 3FO2B 1ORSB 4I18A 2SEBB 5LXVA 2VDRB 5IBTL 3IS1X 3JV5A 4JS7A 2E4FA 2HRLA 4LCCB 1BGXL 4IQHA 5HHOE 4RMBA 1OZTG 4N4YB 1X5HA 2A6IA 3L5XH 4AL8H 2R59A 5AAMC 5DJYB 3BWUF 5F1IA 2J1YA 4H8WC 1WFNA 5KVFH 2F58H 3QNYA 4L9LC 3UZVB 1D6EB 4HMEA 3SN6N 1AHMA 5FECA 1ZT4B 4XNMA 5E8NB 1N2RB 5KVGE 4XMPL 4UTBA 4KMLB 4PJGF 2NUTB 1G87A 2XBTA 3WKNA 3FRUA 3OKOB 3G5XB 1JWSA 3SPJA 4XWOC 1QYGL 3ZHLA 1CD1A 3T4YA 4XPHH 1BMGA 3U4BH 3A24A 3THML 4KJQC 1GPOL 3KDMA 4XMVA 1L9OA 1FO0L 4J3OH 5DWUH 2WLKA 2ZWLT 4G9FE 4JRFA 1U58B 3W2DH 3E6FA 1MLCA 1ZRUA 3ARYA 2FATH 4LMQI 4JO2L 3K3QA 3QFGA 4ZRGA 5IQMA 3MJ6A 3TA3A 5C97A 1TETL 1PD0A 1PNDA 4Q7DA 5CJXC 5EOCJ 5AYUH 4UOZA 5EEXA 3ZE2E 3CFDA 4FJZA 3V4VL 1ES0B 2VCOA 4X5WB 5F7LB 1AQKH 3AMLA 4LO9A 4XCCL 1P7HL 1JTTA 4F8TA 3HHSA 2ED6A 5D55A 2WQ8A 4HAKA 1LO2L 2G75B 3BVNA 1GW0A 1I7TB 4BELD 2Y36H 4WENB 1TTFA 1D5XB 1G4RA 3QIWC 4O51A 4PRDA 4KVNL 5HGBA 4ZFQA 4MDJB 5BRZD 4W6YB 2GJ6B 1ASPA 4S0TD 2NYYD 5GGQL 1UB5A 4O5LL 4OJEH 4EN3B 1IC5L 4M02A 1XZ0A 4YX2L 3FQ2A 4WWID 4H7VA 4UTAH 3C6LD 2B1AL 3UPRA 2B8OT 1JZ4A 2WGNB 3KNBA 4OIAA 2BSSB 5DD1H 4F8PA 2FH6A 1QPPA 1KGCE 4ZUSB 3O8XB 4XNAA 2HVKB 4UQEA 1Z9SA 1KIQA 2AQNA 3WFCL 3FOMA 3L3HA 1AY1L 4KMQA 4AC4A 3DX6A 1JZJA 2R56L 3G6JF 1KUMA 3T2NH 4GKZB 1Y07A 2VERN 3ZRSA 2EDFA 2GY7B 1QBBA 1S7SA 2ID5A 4IKJA 4HWBL 3B43A 3NZHL 1G6RL 1TXKA 2E9JA 2WUBL 4IGBA 4Y19D 4G1EB 4Q97A 3BH9A 5D93C 3FT1A 4ZMAT 3AUVA 3N06B 4JFFB 4TQIA 1NZRA 2AV1A 5I1EL 1ZHNA 3T04D 1MI5E 3MRRA 4AEIH 1T0PB 1T4WA 1G7PA 4K3EL 4GXUN 3MI6A 1J1PL 4YXKH 3WOVA 1KSRA 2EDKA 4P5KB 1QVOB 5FGBA 5F7EH 4N1EA 1U4EA 1UJTA 5E8DL 2YMOA 3D85D 1AJ7L 4KZ0A 3LN9A 4R97B 4WSJA 1NC4B 1OEZW 1UD3A 5K1VA 1KXTB 2G2RB 4WO0A 2V7HA 4RGNE 3ABMB 3U0PB 2OXHB 4QNPE 4BKLA 3T0XA 4MD5A 3FTSA 2D03L 3CZLA 1ORSA 2GJPA 5CGYC 2SEBA 2NNRA 4OTXL 3ZVVA 5D2NB 1BVKB 1Z9LA 4NERA 4IOFC 2MQCA 2WKLA 2WWKT 3MRGA 5FYJD 3KPMA 2Z91B 4UT9L 2QMJA 3TF7C 1K85A 1TEFA 2F18A 3U4KA 1R24B 4XI5D 5DJYA 4FJYA 3ULSB 3G6DH 4CADB 4F7KA 3G9AB 1VACB 1IRAY 5CSZA 4AQZA 1DDHB 2VABB 3UZVA 2NY2B 4DW2L 1D6EA 2DZEA 5EBMA 4U1JB 3CSTA 3K0YA 5E8NA 4KHTL 4HJGB 4FTDA 3BZ4A 2NUTA 4NQDE 5GGRA 3RLSA 1NDMB 2VUYA 3G5XA 3OKOA 5IBUG 1OPGH 3VFVB 1QG3A 1AHWC 1JVKA 3A4AA 4HG4K 1U8PB 2A9AA 4XN1A 3BYYA 3MX0B 3NSJA 3ZKND 2MFNA 2BJML 4TUKH 2ESVB 2ZXGA 1U58A 4IRZA 2P8MB 4JO3L 4G71B 2J88L 4TTDD 3NJGA 1P4IL 4JG0L 2ZPKH 3CAFA 4W4NA 3RIFK 4JKLA 1ZT1B 4XC1L 15C8H 4DWHA 4GXVL 4Z7UA 4TQEH 2PO6A 3BD4A 3MYJA 4NHCL 1AZRA 1T66D 1XF4B 1ES0A 1ZA6B 2VSKB 3H9SD 4H1LB 3ESUF 2RA1A 4WK4B 4X5WA 3RVTD 1CLYL 3BZFA 4PMFA 4MJ5B 3ETBF 4Q9BA 4M8QA 3WD5H 5JQ6L 4D3CL 5D4HA 1OAJA 4HZ1A 4FGMA 4MXVF 3U83A 3HUJE 2G75A 1I7TA 3I2CH 5GGUB 5L4FA 5FLUA 5ICXB 1ZXKA 4MMXC 1Q9KB 2H1XA 1UWGH 2O1AA 4OQ1A 1TZOA 4YXLH 1MXDA 4KY2A 4MDJA 4OGYL 4PB0L 2GJ6A 4LSSH 2LFGA 2QHRL 1FZOB 1U33A 4KI1A 4XB8A 2O6FA 3FQUA 4KRPB 2Q76B 3CLEL 4EN3A 4ALAC 4AV4A 1N18A 2X44D 3TN0C 2KH2B 3QIUD 4M61B 1HVXA 2WTPA 3I3DA 1I3GL 4G72B 1YNLH 2BSSA 3OLGA 2DL2A 1I1RA 2IXQA 3VX0A 1RIHL 2FR4B 4ZUSA 4PLKC 2CDGA 3F85A 2HVKA 5DLLA 2RQEA 2CKBL 4OR1A 3CSYB 5FAAA 3M1OA 4PBDA 4FF9A 1NLBL 1MFCL 3UG5A 4GKZA 1HAUA 1UJ3C 4HKJA 4N2FA 4HUUB 3VXOB 3ZKMC 3GSNB 1NPJA 2Q3XA 3CWGA 3DX9B 4POZC 4GRWH 1CLOL 3MLVL 2QKIC 1INQB 3HG4A 1BD2B 2DI9A 4M6NH 1IEBA 2CLVB 1JOIA 3WNJA 2ROXA 4JM4L 3L6FB 4QYOA 5BS0A 3GXMA 3N1PC 4JZJC 3L4ZA 2VW7A 4M7KL 4MZ3A 1RPKA 4P5KA 1QVOA 2OI9B 3GS7A 2V17H 3T0EB 4LOFA 2FL5B 3X12B 3ZTNH 2NY0C 1NC4A 4HFWA 5FCUL 3UAJA 6PCYA 1KXTA 5L4IA 3H2PA 1CDUA 3LIZL 4HEME 4L8DB 1TZAA 4XXCC 4M7LL 3DUUA 4AIEA 4BZ2H 3UJIL 3U0PA 2OXHA 5GRVK 2L7UA 2R8SL 5FYKE 2H2PD 4HC1A 3T3PF 3EF7A 3A5VA 3FSOA 4GO9A 3MUHL 2NXZD 1TQSA 1RULH 3ARVA 5D2NA 5E2JA 2BVYA 4ORZC 3V0FA 2XQBH 1YQ2A 4R3SB 4MX7B 4ZOAA 2Z91A 2ADGB 5E7FA 4P46D 4OCLC 4XZ4A 5H4YA 5ELIA 4C57C 4C47A 1KTLB 1UC6A 1I1AC 1R24A 5CP3A 5K1NA 5L7XH 3KYKL 1SM3L 1G7JB 5C0IB 1VACA 2ZYSA 2OMXB 4PJAF 1DDHA 2VABA 4JPVH 3CGTA 2KHAA 1E67A 3ZL4H 2RMNA 3QIBC 4U1JA 4H8WH 1Q72L 4ZSOB 2CXGA 3SKOB 4HCGA 4D7PA 1SY6A 5CIPH 1NDMA 3FFCB 4PRHD 4NM4H 4TN9A 3VFVA 5FO9B 2WV3A 4U1MB 5C07A 3OQRA 4GAAA 3WJJC 5K69A 1JDCA 1MNNA 1U8PA 3CG8A 1IV8A 4C56A 5DYFA 2BNUB 4AQ1C 4ZX6A 3MX0A 4BXSV 1KTRL 3WG7B 4AGLA 2ESVA 3I3EA 4RFNB 5A1AA 2BSED 3BUYB 4QEGA 5I6KA 1FFRA 5CD5D 1QTSA 3QW9A 3LXUX 1HHHB 4LRIC 4TVPE 5C0CB 1YC7A 3B9KA 1SUJA 1ZT1A 2V5YA 2XV0A 3HNVL 4LU5L 5C7XH 1ILUA 2XTSA 4OIIL 1T21B 1H3XA 5E9DE 4ISVB 1A66A 4U6VL 2CNZA 1PAZA 3WNPA 1D5BA 3M17A 3D34A 1XF4A 4H1LA 6FABL 4W1TA 4O02B 1E5ZA 4KWUA 4YE0A 4WHTA 4MJ5A 4DESA 3PU7A 3T0VA 4YVUA 1HSAA 1Z6JT 5IJKC 4DGIH 1IT9L 5BOZG 1EMTH 5I1LB 5GGUA 4ZQTA 3FQXB 1I85C 1Q9KA 5DT1H 4QKXB 1N6UA 3GLEA 1WLHA 3ARTA 3B7TA 1QBMH 4WI8A 4JM0A 1FZOA 2JLPA 2R27A 1NCIA 2Q76A 3SDDA 3GF8A 1WIUA 2G4EA 1IGIH 5HPOA 3T0AA 4M61A 5IB5B 1IGFL 4MAYA 4WKXA 5FWQA 2V7NA 3CMGA 4B6ZA 1PF3A 3TNNA 3E6HB 2VRKA 3QJVB 1WCBA 1Z5LB 2WXRA 3CVHH 3GGWB 4FMVA 2MNJB 3N2JA 5GS0L 1UTDA 1G7IB 4DP7X 4KX9A 4P4KC 3NABH 2JI1A 3V4PA 1UM6H 4CC4A 4X9HA 5FO2A 5AB9A 3SOBH 1C08B 1OCZB 2CA3A 3GBML 2WINA 2X3CA 3GSNA 5F8QC 3DX9A 3OJDB 5GHWH 3D39B 2NY6B 2ADFH 1LD9B 1M6OB 2RIKA 2ZF8A 4MQXD 4Q6YA 1JK9B 1INQA 1BD2A 2A9MH 4KDWA 1CL7L 4LSRL 3UO1H 5IOKA 4TSAL 2F8XC 4MMZA 5JHMA 1EWHA 3PS6A 1G7LA 1OT2A 1HL5A 3CX5J 4JN1L 3L6FA 5I8CA 1CIUA 1U3HB 3X1NA 5FFOA 5LDUA 3LXCA 4YDIL 5ALCH 1TJGL 1TLMA 2J5LC 5D7EA 3LKNB 1QWUA 1GY1A 5ANHA 4F57H 3Q8BA 4MZ2A 5KVGL 4E9YA 3T0EA 4LGRB 1K6QL 2FL5A 3X12A 3RWGB 1SUHA 2NR6C 5DO8A 5J5EA 2ZE0A 5C0ND 2G5BB 1R0AL 3EHBD 4BFGA 1LEIB 2EE3A 4LASL 2VXQL 3WNMA 3IB4A 3L9YA 5L0QB 5FF6B 1TF4A 1B0WA 3MA9H 5ADOL 3ARDB 4JDTL 3NJHA 3BAEL 4ELME 4X4KA 3LH2H 4JMXA 4EZLA 3LKSB 4JZOB 3WHXA 3HRZC 3K80A 4HCRA 3TWYA 4R3SA 4MX7A 5HJBA 3BAKA 3BH8A 2ADGA 4OZFB 3OR6A 4DN4L 4PY8I 1KTLA 1DVZA 3SDAA 1NJ9B 3UTSD 1P4LB 3QC6X 5F7UA 3GI9L 4U2YA 3OKLB 3Q48A 4FYTA 3GDCA 1HL9A 4MB5A 5E1IA 5IB2A 2DY2A 5E5UB 4FC3E 3KWTA 3L4YA 2XQYK 2DPKA 4ZSOA 5GZOC 3SO5A 3VWJD 4WW2B 1F4AA 4WU7B 3SKOA 1CZ8L 1LDSA 3PABB 3WJMA 4H13C 2ZKHL 5FUZL 3IJYB 3L2LA 3D18B 1JNNL 4DCQB 3FFCA 1CYWA 5FO9A 4X7TB 2FQDA 1EXGA 5CD3B 4YBQD 3I3BA 4U1MA 2BOCB 1QFWL 1SBSL 2F7IA 3H54A 3EYVB 3VWKC 4A7QA 4H0LC 3SZ6A 4G6ML 3BUYA 3BVWA 4HGKC 2MQ3A 4C59B 3AT8A 1HHHA 2CGYA 1FYTD 2VXTH 1IC1A 3LKPB 4KZCA 4OVVA 5C0CA 5DC2A 4QF1B 5EEUA 4M29A 5I5MA 5B4MD 2X70B 3TFKC 1F1GA 4UNIA 1QFHA 2ERJC 2Z8VC 4ISVA 2O6PA 5KZCB 1VHPA 4AH2A 4PH8A 3HZ3A 3QPXH 4O02A 1JWMB 3QAQA 4ZDHA 2WXMA 4AOFA 2DIAA 1BJ1H 4QGYA 3DMMD 4C4BA 4PWHA 4G8GB 4UTCA 1FF5A 2W65B 3IDJA 4TUUA 4X6BB 2BFGA 1GKEA 2BIIA 1DE4B 4UV7H 1R5WB 4A6YB 4LL4A 4M4PA 3EDFA 4MSWB 2AEIT 4X6EA 1BXUA 5F9OH 4OD3L 4PUBL 5DEFB 4GBXD 4IRSC 3D52A 5J3HC 4P2YA 2GJ6E 3EADA 3VMOA 4YQXH 5IB5A 2EH7L 4GNKB 3JTTB 4ALAH 3KWWB 4G6AD 5I2IB 5BO1H 3E6HA 2Y7SA 3CD4A 2OCFD 1Z5LA 3GGWA 3WIHH 1NBCA 1X4XA 2WUCL 3RVVC 4PEEA 1G7IA 3RWHB 3GM0A 4MDIA 4K3HA 3DHPA 3IMTA 5I1CL 1DUYA 4GKNB 1G0YR 4KK6D 5IVNA 3CZFB 4XX1E 1BLNB 3T77B 3OJDA 3D39A 4BUGA 4B53A 1LD9A 1M6OA 3RY6C 3PRZA 4FN0A 5D9SA 1JK9A 2CGZA 5JMRA 1I1FA 3ARBC 1CD9B 4MNGA 4JFQB 3HG3A 3WDJA 3IDIB 3NTCL 3RVXD 4Y4KD 4R4FL 2MPAH 1U3HA 4NZTL 3ZHKA 3MOBH 5DJZB 4OBRA 3KPSB 5AW4B 1DVQA 4XBGB 4XVJL 3WKMH 4WUKL 1NKOA 2E3VA 2EO7A 2P47B 2AJSH 3RWGA 4A2EA 1D5RA 4ZBJA 3FTYA 2UZXB 1YY9D 3ESPA 1JF6A 1IAIH 1UD6A 1LEIA 3O3AB 2WVSA 1KGXA 1FN4B 4NRZB 5FF6A 1W0YT 2ITEA 1I3RA 4WJ5A 1A21A 3ARDA 1JPGB 3PWJA 4WFFD 4UNTA 1MCPH 1NCBL 2IBGA 4NHUA 5LLIC 3CTTA 3CZGA 3RAJH 4Z7IA 3H7LA 3LKSA 4JZOA 4Y9CA 3U7AA 1RHHA 3NPSC 3B7SA 1XH0A 1PZAA 4OZFA 3NQIA 1AHKA 3VYNA 3DXAD 2CUHA 5D2NE 3MTRA 1ICTA 2BM3A 1JN6B 3C87A 3SB3A 3OKLA 5SWSB 4RAUA 4ZFGH 4HAGA 1TJHH 4PQXA 4JFZL 3ZMNA 4XXWA 1RLBA 4ICWA 3DYMA 3VD7A 1IAOB 1UATA 3D25B 1E9QB 2AQ3A 4NN7C 3K6OA 4J6RH 4WW2A 2LR4A 3PABA 4RGOH 2A1WH 1XIWB 3IJYA 3D18A 4K71B 3INUL 4CL7A 2E7CA 2AQ1A 3S2CA 1MHPH 1U42A 5C6PB 2ZJSH 2BOCA 3BT2L 3W9EB 2VQTA 4HIJB 4YOKA 1A3LL 3MUGB 1KBGL 5I8EB 5I18H 2R2BB 4NKDA 2YFOA 2VZOA 5CBEA 3IN0A 4J39A 1X9LA 3ESNA 4C56E 4UANA 2EDXA 1I4FB 1IQDB 1MHCB 3LKPA 2ESVE 3VFUB 4EIBA 4QF1A 3HE6B 1P5VB 1S7VB 3BWZA 5T1LB 1N0LA 3K2MC 3S4SG 2FE0A 3IETB 1NMBL 3QEHA 25C8L 2D7PA 4KI5E 4Z5RB 5IFAL 1JWMA 3ECUA 1J5HA 1NIAA 2CLRB 4X42A 1QMUA 1HT6A 2Z7ZA 1ORQB 1FFOB 4TXVB 3NCYS 2VRQA 4HD9A 4AEFA 3EH5B 4JFYB 2H1PH 4Y2OA 4X6BA 2XWXA 1A9EB 4JO4L 2MEJB 3JWOC 4Z6AT 1J11A 1DE4A 4LDOB 1R5WA 4A6YA 5DRWB 3JQOB 4BFRA 5DTFB 1DJGA 4MSWA 3ZKQD 2ZAIA 4JHUA 4D9RE 3UTPD 3VGAB 3T6QC 2QADC 5DEFA 3AJ7A 4BKSC 1JPFB 1CXHA 2BRRH 3CLFL 3BKML 3EAKA 3SOTA 2XG5B 5FA3A 2Y1ZA 3PDDA 3EJPA 1LDPL 4PJCF 2APBA 3O3BB 5LBGA 4OGXL 2WXPA 3LIUA 3RWHA 3ZHNA 4ZK8A 2FEDC 1W8NA 3REWA 5IY5B 1AACA 1SJEB 4GKNA 3Q2WA 2ZSVA 5GGTH 2CUIA 4W6WB 2DI7A 5DU7A 4YDLC 2ZUQB 3CZFA 1BLNA 3MACH 4QRRA 2MHAB 5EOCH 2CHDA 1WBXA 3HB3B 4NBXB 5F1OB 2I5YL 2YKLH 2UY7B 3QHZH 2QKSA 4YPJA 4JFQA 1FNSL 1NQBA 3KH4A 3RL2B 3IDIA 4EJ1C 2B5IB 3P1VA 1ZIAA 3HI5L 2X7LB 3ZKXB 5B22A 5B1KA 1BD2E 4H2AA 3TYFB 3WFHB 4FTVD 1KCWA 1M6UA 2VLLA 3KPSA 5DJZA 2C34A 3MRQA 1E5YA 3EJJX 4XBGA 4XN9A 4WDIB 5DZLA 4QRAA 3GXNA 1WFOA 2YUVA 3IN2A 4ZJ9A 2FRGP 3D06A 4L4VB 1R6VA 3EO0B 2UZXA 3HC3L 4UI2A 1AMYA 2WIMA 4UTBL 3O3AA 3T0EE 4X4XB 1W72H 4NRZA 2GBUA 1RU9L 5KSVA 4KKQA 1ID2A 4M7LT 1JPGA 1T1WA 3BVXA 2HTLD 4KAQH 3WEBA 3TURA 2XN9D 4X8JB 2MCG1 2DMBA 1T0MA 2DJUA 3GSUA 4TVPL 5BRQA 3PREA 4NFBA 4E5XG 2VLME 5CEYB 1F1AA 3BQUD 3VACA 4QAMB 5PAZA 3S5LG 2HG5B 2QLVB 1JS4A 1KEML 4RNRB 3RZWA 1U3NA 5FO7A 1JN6A 3ZKJA 4DGYH 1EHLH 1OGSA 2WMPB 1DBAL 4L5FE 2ITFA 2C9WA 3ZTDC 2EE2A 3IFNL 1MCJA 1C1EL 4JN2B 5BVPH 1E9QA 2NCMA 4L3ED 2RCSH 1IE4A 1MIEH 3W3BA 1XIWA 1PBYA 4JHAH 5JTWA 2Y6SD 3BSZH 4MS8D 4UV4H 4ZSOE 5HGAB 2EINB 4YHML 3GLDA 3NPZB 4HIJA 3FFCE 3ATDA 2E86A 2FSEB 3MZGB 3RX9A 1NSNL 5I8EA 5F1KC 1B88A 1UGNA 2ED8A 2FZ3B 4PSPA 4B3EA 3MLYH 3QRFM 1I4FA 2R0LH 1MHCA 1Q0XL 4XN2A 3VFUA 4AJWA 3HE6A 1P5VA 1S7VA 1XBRA 5T1LA 1RIVL 5F6IB 1QRNB 5ENWA 3OVUB 3IETA 1E65A 2K0RA 1YQVL 5C0CE 3QUYA 4BQ8A 4NNPH 1T5XB 2HMIC 1AI1H 5DSCB 3ZKSD 2GIYA 1KN4L 3EJYD 3II2A 2CLRA 1DANT 4GEJA 2IH9A 1YC8A 5M7QA 3IPEA 4KHXL 1W80A 1ORQA 1FFOA 3L5JA 3ZHFA 2XICA 1A4KB 4FFYH 2KLTA 2J8UA 4JFYA 4JY5H 1ZCRA 4PG2A 1F6FB 2NOYA 2VR5A 2JKJA 1A9EA 2XZCH 3INOA 3KLKA 2WBJD 3L7FB 4M93B 4AUUA 4K23L 2DLIA 1X9RA 5ABDE 2O5NA 5DRWA 4JPIA 5DTFA 5KSBB 1KIRB 3P4MB 4FQXC 3V6FA 2JELH 3U7WH 3MJ9H 4M7ZB 1JPFA 1XB8A 1Q90A 2WCGA 2XG5A 4PPTA 2KYIA 4WSKA 4MNQB 3BHBB 1OTSC 4JRWA 3DWTA 4YSOA 3EO1A 2DB8A 5JORB 5J6HB 4ETYA 3SDYL 2QSCL 1J8HD 5I5JA 4KQ0A 3ZIYA 1DVFC 1SJEA 3C08L 2XZQL 3IRCA 3PYCA 1WC7A 3RG1C 4R0LC 4YEEA 1S3KH 3FH5A 5FO8A 3KYOB 3N43F 5GSVA 2BOBA 5F89B 2IQ9H 3PHOB 2UY7A 2J6WA 1OK8A 4WJKB 2CRIA 1L7TH 4HH8A 3D39E 3ESVF 1KCVL 5DEGB 5EU5A 3CBJB 2ZXEB 1YYCA 4DKEH 1BEXA 3TBVA 4MNGE 3F7QA 4KZEH 3TYFA 3H42H 4WSGA 5JDSB 4X5LA 3MDJA 4WDIA 4Y1SA 3ZYOA 4GO8A 4PGDB 4NWTH 5A2KH 3AG4B 5EPMB 4L4VA 4RIRB 3OWEA 1DVTA 2BMKA 3ZE1B 5TDNB 1LO0L 4Y5VC 4X4XA 2XETA 4XNXL 5EF0A 3X2QB 1BAFL 1MVUB 3E9TA 5FA4B 1OAKH 1YYMH 1D5ZB 2AXFB 2EECA 4JFDD 1P2CB 4LHQB 1HDMB 1GGUA 2ZX5A 2XV3A 3HMXA 3VFWB 1SF5A 4ONFL 4Y4FB 3BAWA 4MB1A 3W82A 1UACH 3IXTB 4LQFL 4IRZL 5JHLH 2B16A 3ALPA 3HA0A 5CEYA 1A25A 2ZYIA 4YLCA 4ZD3H 2QBWA 4ZUVB 3G5YB 2CD0A 3OMNB 4C54A 3EYFB 4BSJA 4GRLB 4KTDH 4BGDA 2BS71 3ES6B 2WMPA 2P3YA 1NCGA 1NC2D 4Q6IB 4ACPA 3P30H 1WBZB 3C5SB 5C09B 1VFBB 3N40P 4JN2A 1HZLA 4BK8A 2JNZA 3GSOB 4BRJA 4OU3A 4PLNC 3MRBB 1P5UB 3HAEB 4IDJH 1U93B 5EORL 2DLGA 5F9WC 5HHNB 5E1QA 1CWVA 4BRVA 2IMMA 3QCUL 5CFHA 5HGAA 2ZT9C 2PCFB 3OLIA 2W07A 4KKCD 2D3JA 3HHMA 1CU4H 1TNMA 4ZW7A 5HGHB 3LZQA 2OSLB 1GGBL 1H3VA 3PDGA 5D4JA 2OK0L 4LSQH 1V05A 3NCYP 2PR4L 1GYAA 3LRHA 3QWRA 1KDIA 4IU2B 5C0AD 2YEVB 4DP6X 4WWKC 4BFBD 1MFEL 1EAPB 1FL5B 4TULH 4XP6H 1R5VB 3FO0H 4XVUC 2BP0B 1MNUH 4O2EA 1TLKA 1N64H 4L4TD 1QRNA 1WA0X 4DZBB 3BCDA 1IBGH 3JUYA 1T5XA 2FTAA 3CVBA 3PXHA 2ZG3A 5DSCA 1UZ8B 5E5MB 3TVMB 1WAPA 1XO8A 3DUHA 3L1OL 1CB4A 3SY6A 2PP7A 1CI3M 1CXKA 2V5MA 2DQIL 1A4KA 3BKJH 3HNSH 2Q0ZX 4JJ5B 1XTLA 3P0YL 3N44B 2EUXA 4TSBH 4OLEA 3ZDZF 2D7OA 3L7FA 4A7VA 4D0CB 4D7BA 2ZCZA 1JDAA 3WY3A 2ZAGA 5DS8A 4DO4A 1KIRA 4G8GE 4YSCA 1PZ2A 3P4MA 5IFHL 5KSBA 5C6TH 1YMHB 3JWOH 3NFNB 4ODHH 3E1ZA 3P0VL 4ZYKA 3RZCD 4LT7A 2WO2B 4J5VA 4WWOA 5TF1H 2FSDA 1TMQA 2FYYB 4EOWH 1JHLL 2WJ5A 1CFTB 3W81A 4XAKD 2EXTA 1KT2A 2R29H 5JORA 1SVCP 1NPUA 1HZHH 5KYNA 2Z7WA 5J6HA 1T7ZA 1NBVH 4RMRA 3GZOA 2HAZA 3F7RA 4PWGA 4N2GA 2Q2EB 2IQAB 2PTUA 3BP6B 5CEZD 2R0ZL 4WV1C 1X4YA 3GKZA 1LVEA 3KYOA 1PLGH 1MWAL 5DRZB 2YAHA 3MJGX 1GL4B 2PYEB 5DJXA 2JCWA 4BK5A 1Y1UA 1CR9L 3NP4A 2NT1A 5IMOA 4MZIA 3BIBX 4K7PX 1I9IH 4QRRE 3TONA 2ZUSA 1JG9A 4TYUA 5DEGA 1CFNB 5F7NC 5HHOD 4N6QA 1OM9A 1NA8A 4J4PA 1A2YA 1FDLL 4QCIB 2WP3O 2F7QA 3F01A 3GK8H 5JDSA 3VSVA 2XXCB 3PNWB 5EPMA 5TK4A 4RIRA 2VMEA 3ZK0A 3KPSE 5KVDL 1T2JA 5D2LB 5TDNA 2HFGH 5C2BH 1KULA 4JGJA 2D31B 5HI5D 2OSXA 2EVGA 1SY6L 2CE6A 3KE0A 4GH7B 5F96L 1MVUA 4WI3A 1BQRA 3SGEH 2C9RA 2NY1C 4FQQB 3T09A 5C1MB 1FWXA 2K1MA 2AXFA 1D5ZA 3EJZC 4AKOA 2Z65C 2UVEA 4TNWF 5HDBF 2BXZA 2NY4C 2KERA 4FQJL 4Y4FA 2J57A 2XN2A 3IXTA 3NP3A 1BJ8A 5E5LA 5K33A 1E0OB 4G9FD 3F7PC 2DQMA 3B6SA 3D1MC 2VR8A 3B9DA 3D48R 2P80A 1CCZA 1JMXA 5B8CC 4ZUVA 3G5YA 5DZNA 1OD7A 4TMPA 4ZOBA 1Z9MA 2IWGA 5AW7B 3ES6A 4JCMA 4Q6IA 4LLWB 1OP3H 3C5SA 5C09A 5CJQH 2XBDA 4FXKB 3J27A 4JNXA 2OTWA 3BGAA 2FJGB 3GSOA 4XPFL 3MRBA 3KZ8A 3HAEA 4M6MH 1PKOA 3C2SA 4XMKH 1S9YA 3FUHA 1N19A 4LESA 3RUGA 4KX8A 4PCSA 1GGTA 3MRDA 2OSLA 4OFIA 4PJ9D 4V2CB 1UA6L 2CPUA 1IGMH 3NUKA 5C92A 3Q1SH 4W4OA 7PCYA 4IU2A 3AY2A 2EDMA 5AG8A 3VB8A 2OYKA 1EAPA 1FL5A 3ALXA 2IH1B 4RMVA 2ZG2A 2AXGB 1OAXH 4XNDA 3TBCA 3AWGA 4B41A 3D3VB 4NZJA 1T22B 4DZBA 2ZWNA 3L3KA 1KGCD 4TUOB 1XD0A 1EX0A 4XOCA 4NP4L 2P5PA 3S96B 3TVMA 5E5MA 5EUKA 1UZ8A 1FPTH 4LQ1A 3V4PL 5J1TC 3O9WC 4PN6A 3PE9A 4QRPB 2EDJA 4HS8H 4Y2LA 2W8CA 4PWEA 2V2WB 4Z78B 3GSNL 3H2QA 1GZQB 4U0RB 5DFTA 2QZ5A 4JMNA 3L3GB 3M45A 3C9NB 3VXSB 3VXNA 1HCVA 4B5ZA 1HYRC 2E6JA 4S1RL 3X1FA 4XNZB 1BA9A 3C5ZB 1V3KA 3RDTD 1O6TA 4HETA 4PV9B 3W5NA 2AQTA 2CMRL 3BP5A 2F7RA 1NTDA 1P6FA 1MI5D 3LQMA 4MB4A 2FYYA 4PP1C 3EG9B 2VR6A 1CFTA 4FG6D 2NNAB 3O2DH 4G11A 1GGIL 3WFBL 4OW6A 4H1LG 1UD8A 3MV8A 4YXHL 5AVSB 1EEQA 3OF6D 5TQ2H 4YLQT 3W11C 1E27B 4PAZA 4RGND 2EEXA 1KJ3L 1N3NB 1MKFA 2A77H 3BP6A 4PRPB 4ZAKC 3OD3A 1HIML 2F5AL 5DRZA 2ZONA 3WHE1 3WAKA 4EPSA 5LQBL 1GZHA 2PYEA 3MMEA 2VM3A 2E4TA 1A6UL 4OY9A 2FEEI 3T2PA 4HCRL 1Z3GH 2C26A 3V95A 3EJRA 4P9HC 5CSGA 2D7TL 2J4WL 2P42B 3PPSA 3H56A 4L5FL 3VRJB 3Q2LA 3APDA 3MNMA 4QCIA 1QHPA 2ZZUT 5JDJA 5HHMB 3HPJB 3AADB 3EJTA 5LWYL 3PNWA 4MAZA 4F15C 4KXDA 2MSPA 1X7QB 2R9HD 3UTTD 2R2HB 1O6SA 5D2LA 4RVBA 1ZMYA 1PZ3A 4HS3A 3STZB 2D31A 3COOA 5JPNB 4L4VE 2Y2YA 4FQQA 4EDWL 2K9UA 4NQDD 3EGSA 3GZQA 1YZZA 1WISA 5BQDA 1HTYA 1J9QA 1XCTB 4WO4D 5CXPA 3QA3B 3QZMA 5IK3A 5JIHA 2PXYB 4KFMA 5GSRB 3O4OC 4KKAC 2R1YB 4F27A 1SDYA 3LRGA 4XWGL 3VDAA 3AREB 3WIIL 3MHZA 2NNCA 3L9RA 1KB9K 2AXWA 4FZEH 4LLWA 4Z7NE 5E24E 5E2VH 4JPWL 1MUJB 1CGXA 4G1MB 4QUOA 2ZCHL 4O02L 4KO7A 4FXKA 4DP9X 3DVNB 1DBMH 2FJGA 5JNYB 3OWRA 3V0EA 4A39A 4OQTL 2Y5EA 4X9IA 5D6DA 2ZOKB 3IFLH 4OLYH 3WMSA 2JTYA 5JHBA 1EO8H 3LEYH 1L7IL 1COBA 4NRYB 2ZCLL 1RFDH 3HLAB 4KK8C 1JGUL 4P57A 2D2CC 5J1SC 4I9XA 2XZAL 1Q1PA 4KXZI 3N41B 1A6AB 2Z1PA 3T1FB 4NN5B 4PLOB 4BH8A 1XGUA 1AXIB 4MASA 1S7XB 3D09A 4PJ8D 5KSUB 2DQUH 5K9JL 2ZKMX 1UOWA 1FH2A 3K91A 2VMJA 1UG9A 2KC0A 3D3VA 1T22A 4M1DL 3U0TB 1QSZA 4PGCA 4TUOA 5EU7E 2APXA 4I87A 3S96A 2BFVH 1PZ5B 2XY1A 3H4FA 2Q87A 4DGWC 4LSVL 2NZ9D 1QRNE 4QRPA 5I8OL 2AK4B 4YHKL 1TU2B 3EFDH 2V2WA 2DYPB 4GRWB 4XRCB 4Z78A 2EXYC 4Z23A 1GZQA 2PP8A 4N8VB 4QTHB 1UXMA 1AZNA 5J12B 4QTFA 3HZVB 1SLVA 1WFTA 3EH4B 3L3GA 4NSKA 3C9NA 5D7KE 2AW2A 3VXSA 3ARQA 2BWIA 2HT3D 2EDBA 3AXIA 3C5ZA 5F9AC 1INEL 2UWEF 5KEZA 1XHHA 4N0FB 1H6FA 1N5AB 4GAYA 4BFOA 1QUNA 1OW0C 4PV9A 1IKFH 5BZDA 1H8LA 3HE7C 5KSBE 4EEEA 1N8ZB 5AYQA 3MREB 2B2XL 3BDXA 3PCYA 3RIKA 1ITBB 4PJGB 3TT1L 2FGWH 3EG9A 4ZFOA 5JQIB 3TM6A 2NNAA 5KOMC 1XCXA 3HC4L 4WFHE 3BW9B 5GRWA 5IW6B 4M03A 4KJWD 5AW2B 3I6SA 4I3RL 3NACL 4K7PL 1DBBL 1RUMH 4X6CF 4R90L 1E27A 5D70L 3TESA 4FQPA 4NQVB 3KLAB 1N3NA 4PRPA 1JZEA 3LZPA 1WK0A 1F4WH 2IH8A 1OB1B 1UYWL 3UBGA 3TA4D 5D1ZA 2WQSA 1P7QA 2BSTB 4XXDA 5FYKD 5K93A 1DN2A 1B0IA 4EI6B 3MLPA 3DO4A 4PJHF 2P52A 4OCWH 5E8PB 4HSCX 5T3XE 5JW4M 4EBQL 3D2TA 3JV6B 4JQVA 1QFWI 5CO1A 2BRQA 5I26A 4FHBD 1T7YA 4WEUD 3TBYB 3ABKB 2XTJB 3QXUA 1HWWA 1BVLB 4Y88A 5IMMB 1XAUA 2NW3B 3P3RA 2ARJB 5D4IA 3CZKA 5DZJA 4YHYC 4TLSA 2BS8A 4L9LB 1GYWA 5GISH 5J1AA 2I60L 5CIPB 2R2HA 3GT6A 2VZSA 3MLUL 4P23C 3STZA 4DO6A 5EEVA 3F64A 3MNZB 2EYTB 4IIQB 5DZVA 3WNLA 2VAAB 1YMMA 5AVRB 1OF0A 2DQEL 3DX0A 1NBYB 3ZE1E 1ZLDA 1WWAX 5J06A 3U30C 3BKYH 2R0KL 4NNYB 4WI2A 4HHAA 4DTGL 1XCTA 2F53B 1A6VH 3HKZA 2ZOWA 4R2GC 1JHTB 2DTML 3QA3A 1WWBX 3T1WA 2PXYA 3CVDA 4KQ3L 4N90E 2VDMH 3MN8A 2R1YA 4TVPD 3GJFH 3TX4A 3WXVH 4XMLH 3RHWF 3G6JB 3AREA 3BFWA 1OGPA 2M2DA 2AXHA 3IMBA 3GHBL 5E9DD 4G1MA 4DZ8B 5MHSE 1K4DA 3DI2B 3V0HA 3TA3D 2UYLB 1IE5A 2GG1A 4K3JH 3JWDL 1DJXA 3DVNA 1CN4A 5JNYA 1AYOA 1GTNA 2R0WH 5SX4I 1YEEL 5CZVH 4IKIA 1GZPB 4R7NB 1GOFA 5C09E 2ZOKA 4JO1H 4QHNB 2Y22A 4YK4C 2DWXA 3WBDA 1E8WA 1N5YH 3QIWB 5LG1A 4NRYA 4NC1E 5DMKA 4FAAB 1HAWA 3HLAA 1HQ4A 4GFXA 2F74B 1AGEB 3F7YB 1A6AA 3T6VA 4Y16A 3MXVH 2JMRA 4OZFG 2P1YA 5I6XC 3QB7C 3QJFB 3E3QC 3CVHB 1BQSA 4P5TA 1X7SA 2JTDA 3JTBA 1QLFB 5KS9F 4FKEA 3FN9A 3OC8A 1NLDL 3U0TA 4BFNA 4P06A 1BBDH 1MFBL 4R8WL 5I0DA 4JQXA 3UYRH 2IEPA 2ZYRA 2Z3FA 2AK4A 1TU2A 3FOLA 2DYPA 2Z8RA 3QQ3A 4XRCA 3V4LA 5A2IH 1URIA 4QTHA 4NRXB 5FYJU 3HZVA 1P4UA 2KPNA 2F1BA 2VL5A 5I1HH 3QI9D 3S3DB 1W0VB 3S5ZA 5BZXA 1GMIA 4Q8BA 4WK2B 4BQCA 2YK1H 3CFBB 5D93B 4N0FA 3ZTJH 3FUKA 4DGVL 4R26H 3T4AC 4FFTA 4F9PA 1N8ZA 1Q1JL 3MREA 3OL2A 3RPKA 4IGBD 1E4WH 5B1BB 5ECJE 1CE1L 4KXBA 2NYYC 1EEUA 4UBDD 4N8UA 4M3HA 3BW9A 4CBZA 1L4IA 3F2LA 1LMIA 3NEXA 5C7ZA 4BZ2A 4FHKA 3EDKA 4L3CB 5DUPL 4OZIB 3EBIA 5I0ZA 3NRFA 3JYBA 4FQ1L 4B9CA 5FW7A 4NQVA 2QV2A 3KLAA 1LO5A 1Y6KR 3DYOA 4UUJA 1EVUA 2Q7AA 3GDBA 5IVXF 1S7WB 2EDDA 5TQ0H 4EI6A 2A4CA 4JB9L 3W39B 1JV2B 2VZ3A 4B0MM 4OCYH 3T0DA 2DDQH 4UINL 1K5NB 3P2TA 2PYEE 2XDHA 3A3YB 4U6TA 3T6WA 4CN6A 3VDBA 5INDB 1TZ8A 3NEEA 5AAMA 1ZE3H 4P9HH 1ZV9A 4I77H 4IKKA 3KCWA 1M53A 3UTZB 3AQZA 4N86A 3UCRA 4X9YA 4EF3A 5A2BA 1QLEH 4FFWD 2NW3A 4OJYA 3IDYB 4U6XB 5C3IA 3CFNA 4P59L 3PPEA 5KVFE 2OL3B 3SPHA 1NFDF 5CIPA 2AJYH 2AVGA 2EEDA 2Q8BL 4K94L 4YWGH 2HT4C 3HIZA 3MNZA 2EYTA 4FNRA 4IIQA 2IG2L 5DJCB 2VAAA 4I89A 4Y9BA 4NDMB 2C3WA 4HK3N 4OFDA 5DD6A 5D2LE 3SDXF 4TOYH 1KG0A 4TSCH 3UJTH 1LNUB 2VM9A 4NNYA 3R7RA 3B4NA 2CGRH 4WEBH 3ARPA 2F53A 4X2UA 3DETC 2G60L 4HPOL 2EDLA 5E9AA 3S37H 3WNNA 3P9LB 3A6BL 2ICCA 1A8ZA 4X5XA 2ISDA 3B2VL 1MHHB 3I6GA 1PIGA 3L9EA 1CYGA 3IU4L 3VE0B 4DZ8A 5E6IC 2AHIA 2I7SA 3DNKA 2UYLA 2VKXA 4DP2X 2V0AA 1NMAH 4P04A 3OKMB 4R7NA 3MZTA 4QHNA 1OO2A 2LVCA 2VDPH 3GNMH 3NAAH 2L7JA 4U6YB 3QIWA 1KACB 4MMXB 4ELKA 2P9RA 2QQLH 3NJMA 4CRPA 2F74A 1AGEA 3MODH 3F7YA 3RPBA 4AM0B 1IGTB 4NFCA 4GQ9L 5DD0L 5DVOA 2VO8A 1JUFA 3BJ91 3QJFA 3IYLW 5DHDA 1IBYA 4OM1L 5AKRA 3TN0B 4PB9L 2GJ6D 2AGJH 4X6DF 1U92B 3MCLL 1MZYA 4EN3D 3O2WH 4PM1A 3O41B 4TTDC 3T3PB 2FQGA 1ML0A 3D3VE 2Y1VA 4FLQA 2VMDA 5LAPA 2WN3A 1FVEA 3NIGF 3N1QC 3O8XD 1UJ3B 3O6KH 4N1HB 1MPAL 1CIDA 2CJUH 4NRXA 3ZZQA 1KCRL 1ZSHA 2WKGA 1S9VA 5EH1A 5I71C 5F6HI 4QRPE 2UX7A 4FQCL 5JPMA 4HOMA 2QKIB 3RVTC 2A6JB 1KN2L 2MKWA 1TYEB 3TFBA 3UEQA 3CVIL 5E6SB 4WFGE 3VXSE 4PJAB 2FNWA 2ZOLB 5EZJA 2J25A 4BZ1H 1BF8A 3ILPB 1KTCA 4CUCA 3PWVB 1SYSB 1QSFB 4DKFL 1K9TA 2D8KA 3L81A 4JFFD 4NO2B 3RY5A 1K2DB 4S11A 3MRHA 5J0BA 4DEPC 1FHGA 2E9IA 4ZO9A 2NY0B 1A3RH 2MCPH 4KPHL 1UUNA 1ZT7B 4OZIA 5CN1A 1F3DJ 2VR7A 4MNHA 5F72S 3S36H 4F20A 2KLRA 1TVBB 5T1MB 5GS2D 2GJZA 3PJLA 3VYOA 3QQNA 1E8XA 4OLVL 2GSIB 1NC4D 3V6OA 3UAJD 4PV8B 3HMXL 3R0MA 3LCYA 1S7WA 2NW2B 1OAQL 2TAAA 3FQTB 4PRPE 3I02B 5JA9A 3BAIA 4P2QA 3QQ9D 2ORBL 5INCB 4AK1A 2OSYA 5FYLH 2EZ0C 3V0VA 1K5NA 1F6AB 1M7DB 1ACXA 2VDLH 3AY4C 1YEJL 3OAUH 4G5AA 4P2OC 4R7XA 5AOLA 3D5OF 3DVGB 1I1AB 1B9ZA 2UZIH 3UTZA 2BSDA 4JCWA 4P3DB 4U6XA 3KM2A 1KFGA 4UQBA 5L4MA 2OL3A 3KL0A 3QIBB 5HHME 1FG2B 2OJEB 4UOW1 3OX8A 5AZUA 3NDZE 1WZ1L 2GBVA 5DJCA 3SCMC 3GSXA 4NPJA 2HVJB 2NY2D 3PWUA 2UX6A 1MRDH 1AQDA 2AZAA 3ASWA 4NDMA 4O4YH 3Q1EA 1LNUA 4UQIM 1JK8A 1YMME 3FQRB 4AQ1B 4HBQA 1HNGA 3AS1A 5HBBA 4YHOL 1GIGH 1SEBA 1OP5H 4HSAC 2EIMB 3GRWL 4Z8FL 1AKPA 5IMKB 3P9LA 3EBAA 3KR3L 1FFNA 4C56D 4YSSA 4Q89A 1FVCB 2ESVD 2XWBA 2VDNH 3WO3B 1EXHA 1MHHA 5DRNA 4G8FB 4KZDH 3VE0A 4WHYH 4G6KL 1W9XA 2LLLA 4KI5D 1CE6A 3O6LL 3K71A 4UCFA 4DIXA 2FO1A 2NDGA 3CIQA 3P4OB 3KD4A 4YAQB 1FL3B 5AZEH 3DO3A 4XO5A 1YDPB 5LCVL 3X3FL 1L9NA 3PIQB 4LVEA 3RWJA 3FC8A 4L29B 3DGDA 3QQDA 4E42B 4XP5H 4U6YA 1E30A 1VEOA 4NBZB 1D5IL 3LN4A 1NH6A 2W94A 4GKLA 3WFDH 5E2WH 2IPTL 3GSVB 2O6CA 1GCFA 4D9RD 2FLRT 4PBWD 1MLBB 1MRFL 1NGXB 3S8WA 1Z0MA 3CN3A 4OJFH 2ZX9A 4JDVB 3TN0A 1TQCC 1IQWH 1G7MA 3RIAF 5IT2L 1PZBA 3CFTA 1OF2B 1OLLA 2YMTA 4KRPD 2P8PB 3WSQH 5C0BB 2D7QA 2DQTH 4LP5A 4NI3A 3VD2A 4GOSA 3GS0A 2H41A 3O41A 4P4KB 2VDQL 2YD3A 3RA7L 4G59C 3BH4A 1ZWIB 5E4OA 1OP3K 4BFIA 1USZA 5EBLB 1CVRA 2FEJA 3CU7A 1MQKL 1OTUD 2FLBT 2JE8A 3WE1A 5T3XL 2AK4E 4LCVA 4ODXB 4GRWE 2QKIA 4HJ0C 3ZUCA 2A6JA 1JPSL 3S8GB 3K6DA 1YNTF 4HXAH 3DKHA 1P69B 4IDLA 4Q9RH 3A0OA 3AU0A 3MRJB 1BD2D 2JB5L 2ROYA 3ILPA 4DAGL 2X2YA 3PWVA 1QSFA 2J12B 2J5LB 1NAKL 4BXVA 3WV0A 1K2DA 5DUMH 3NCFB 4ZUTB 5AQ0A 1D5MB 4XPGL 1SLUA 1W72B 3IJHB 2LU4A 4XBMA 1EGJL 4MA3B 4Y5XC 3BAXA 2KS0A 1AAJA 1VDGA 2H0PA 1TVBA 1U8OB 3MLTB 2JKRM 3T0ED 5T1MA 1FGNH 1Q0YL 4XXCA 1RVFL 1O6VA 2GSIA 3HG1B 2WB7A 4XNYL 2BIHA 4PV8A 1E4XH 1T2QL 2XACC 3GIZH 4YC2C 3FQTA 4YSAA 3I02A 4H0GA 4MA7L 2FHBA 5DFWH 4HF5H 4EDXB 5INCA 4IBSA 5TE4H 3TO4C 3MQIA 3HRZB 3AW5A 1DJIA 1F4XL 1NUNB 3PUUA 1F6AA 3I74A 4YHZH 3FQNB 4HPYL 5KBPA 1PY9A 1DQMH 1JGLL 1VEMA 5GJSH 3DVGA 4RDQG 1I1AA 4LZKA 1TTUA 3VFGL 4NJAL 4JM2C 3S35H 4P3DA 1DR9A 1DSYA 1MEXL 1SGKA 3BPLC 3NFSL 1NGPH 2XTJE 4KX7A 2FECL 3DLQR 3O6ML 3QIBA 1ADQH 2EIKB 3QUHA 1A6ZB 1VFMA 1CFVL 2EUZA 2C9UA 4M8UA 4N28A 2HVJA 5EWIL 1KXVC 2E76C 4NEHB 4LCYB 1AGBB 4LLUB 3F6LA 5DHXB 3WJJA 4ZPTA 3ZNGA 2OS7A 2ENQA 3FQRA 4AQ1A 4MA8H 3VWKB 1BBJB 3FFCD 1BXAA 5DGQA 2RTTA 2K8MA 4AUJA 4PS4L 3RRQA 1BWMA 1EJOH 1J9SA 2BVTA 2CIIB 5IKCB 1KCLA 2F53E 5JHAA 5DQDH 2PWEA 3FF8A 1FVCA 7FABH 2Q86B 3QCTH 3BT0A 4FKHA 3SGJA 1EZUA 5BO4A 4KUCD 2WVTA 1OAZL 3MSPA 1ACYH 3ZSTA 5C0CD 3SDCC 3VSUA 3KM1A 3LS4L 1NCJA 4NIYE 5AAWC 4NOBA 2DQCL 3OZKA 2GITB 3P4OA 2IWEA 3QCVL 3P40A 1FL3A 4YAQA 1BOYA 4UQ3B 2AAAA 4JM2F 1SN5A 4LE8A 4HPHA 5I1IL 3S5YA 2LU3A 4O2FB 3LQAL 4E42A 1MF2H 3MROB 5D72L 3SYCA 4BHUA 2BPBA 4N2DA 4WIQA 4HIHB 3BCFA 1KEGL 1SOKA 5LVEA 4CDHA 2X0UA 1GVIA 3K6IA 3GSVA 4JKPL 5BV7L 1DTUA 3NSDA 1C5CL 4FYSA 4ZTPL 1MLBA 1BG9A 2WNXA 1NGXA 4IRSB 2XA8H 2VWEC 3CSPA 1IGCH 2YAPA 4YBQC 4ZS6D 4AYID 2WYIA 3N85L 4E2OA 1T5WB 4Q58C 1D9KC 5C0BA 3GMMB 1IJNA 2VXUL 5LGYA 1BZDA 4P4KA 3NSYA 1QFWM 1NDGB 3B2PA 2DLTA 5DQ9B 3HAEG 3WUZA 4K73A 1ZWIA 3KJ6H 1A7QH 3DVIA 1JPTH 5I0VA 2Y72A 1MAMH 3SE6A 3UZQB 5IESL 4JREC 2DD8H 1WEJH 3LNGA 1TQBC 3TJEH 4N0CD 4ODXA 3WTYA 1MCSA 1NCWH 1JGDB 5HVGB 4BEIA 3ARBB 1D2PA 2B9BA 1WWWX 1TPXC 2NZ1A 2WLIB 3D39D 2NY6D 3NH7L 1I3VA 3BESR 3MRJA 1G9ML 4D9QE 3RVUC 2B4CL 1JE6A 2AC0A 3AT9A 4P99A 1EEYB 3GTTA 1KV3A 4YO0B 2YARA 4XOAA 1U3HD 1ASOA 5JW5B 2J5WA 1D5MA 2EVIA 1P9MC 4W9JC 1FV1A 1W72A 3IJHA 1QR1B 3Q43A 2NR6A 4UZUA 1I53A 3F65A 4S1DD 4HUVB 4B7LA 3QHTC 3PAUA 4MA3A 2BHYA 3C09C 1A22B 1U8OA 1ZOXA 3T6ZA 2UUDH 3BKCL 3Q5OA 2WVVB 2QPFA 4J27A 2CJ3A 4OZIE 3B3IB 3IT8D 1W15A 3CN4A 4POYA 1BEYL 3CHOA 2CALA 3ECVA 3PLYA 2VH5L 1F97A 3MBEA 2WCSA 3HRZA 3ARDD 3NPSB 3FQNA 3BN9C 4JANB 4NUPA 4P2QE 5F70A 3OKNB 2EVHA 3NRPA 3NESA 1UWXH 4X8GA 2XC8A 2DIEA 1BZ9B 2YUXA 3P77A 3LYRA 1VFAB 2WSPA 3D7PA 3VXTB 4PJDF 5I8KL 3U1SH 4Z1PA 4RFOL 2COQA 2OP4L 3I50L 3RVXC 2OLDA 4Y4KC 4POUB 4MXVE 5GZOA 4Z3IA 4NN7B 4GIPD 3IJ7A 1D2OA 2BERA 3QPQD 4X4MA 4IK6A 5JIIA 3DROB 3PGFL 4LCYA 1AGBA 5AB2A 4LLUA 5DURB 1WS7A 2P26A 4OLWH 4QD2E 1D6VH 4TNWK 1OOAA 2O93L 4ODVL 1PVHA 3QXDB 5LAXB 4I0PC 5TE7L 3VWKA 1BBJA 1UCBH 4PJCB 5DLML 2YGQA 1SBBA 3X3GL 2CIIA 5D6CB 4A2GA 5IKCA 1A47A 4B3VA 1BQUA 3MLRL 1CLZH 3KVDD 1R4XA 2AP2A 4P46A 5HHXH 3WGUB 4PJ6A 1A9VA 2HA1A 3SE3A 4YHLL 3EJSA 2L8AA 2C9AA 5DHMC 3I9IA 5IB4B 4JDEB 2NQCA 2VR9A 4FFYA 1HESA 1OGTA 3U7YL 2GITA 4FFVC 1JGVH 4UQ3A 5IROC 1U6AL 4J3OG 5G4MA 4G3YL 2A74C 2A0LD 3MLZH 4L05A 3FHQA 3MROA 1MSPA 3JT2A 4HIHA 5HI4C 2E7LA 2EO1A 1PMYA 3KGRA 3RPIB 3WI9A 3LPPA 4IS6B 4G8GD 3S88L 1FORH 2QADB 2FJHA 2D3NA 3V0GA 2RBLA 4IRSA 3ZDXF 2DIJA 1OM3H 3N3EA 5F7EL 1SLXA 4IHBA 3VXUB 4YE4L 2CUMA 4ZFOL 2V9RA 4HFUH 5FUOL 1ZHBB 1T4KB 4U3SB 4A2LA 4J2XA 1MFDH 3GMMA 3FW6A 4NYLB 2GI0A 1TZHA 4F2FA 1B4RA 4WCYH 1AR2A 3RGVC 3QEQB 3CFIC 1NDGA 1O9VA 4UM8A 3K72B 2NY5L 1L0XA 4HUWA 5FHAL 3C75A 2FX7L 3BDYH 4ODWB 3A67L 2PPFA 2YPVL 3MRMB 4RDBA 3T3PE 4GQRA 1N9PA 3UZQA 4YDVB 4LAQH 3RL1A 2EIEA 2VB5A 4PJIF 5AVYB 3NZ8A 5EOQL 1M7UA 1MN4A 1TTBA 3NA9L 4GS7C 2V2TB 4LPTA 5F0PB 4JHWL 3ARBA 4BIKA 5E1AB 2R4RH 1JYVA 4JQIH 1M05B 1F58L 1DQJB 3CK0L 3HC2A 4GUCA 2EE0A 1GS6X 4OKDA 1FE8L 1EEYA 4YO0A 3V0DA 2WYHA 4KITB 1BCIA 3NQKA 5JW5A 5EO9B 4UMSA 3RNKB 1QR1A 1H6TA 4JO5A 3SIKA 1YEWA 1QSFE 4HUVA 1JVLA 3CLWA 3G5WA 3KPSD 3OKKA 3TZVC 4ANUA 1M57B 3ARZA 5DD5L 2YSSA 4GB9A 4OF5A 2WVVA 3ARFB 1X5XA 3QR0A 4CMMA 4ZW6A 3TXAA 3EYOB 4UT6H 1LO3L 3CC5B 2NXYC 4R5TA 5IEKB 3SQBB 2CRMA 2V8MA 5TDPB 1OVZA 5I73C 4OT1L 2APFA 4FNLL 1RJYB 4MHHG 3LHPL 3LZFH 3H55A 1WFMA 2O5YH 3SE8L 4JR9H 5I9QC 1DQLH 3OKNA 2BCKB 5EZPA 4U1HA 5C3TA 5CILL 4FXTA 2XN1A 3QEUB 1JZ2A 3UABA 1BZ9A 1SN0A 1VFAA 4WTQA 1MW2A 4HGWA 1HJCA 2R1WB 3VXTA 4DKDC 1BVOA 5C0RL 2AEQH 3TBSB 2DTSA 3FCSB 2OZNA 4ZMYA 4M1CC 2ZG1A 1A7NH 5KVEH 3V4UL 3HNTL 2QJDA 1U41A 2OW7A 1EFQA 1ED3A 1C9SA 3DROA 1GW6A 5ITFB 4EI5C 4XVSH 2ITCB 1UWEH 1CJYA 1L6XA 1NM4A 2X41A 1G1OA 4R7DB 1BREA 1V10A 2DICA 1E2VA 1KBBA 4X7FC 1H15B 3TT3L 1DQIA 1XIWD 5DZAA 2HRPL 3UADA 1PIFA 3NCWA 2DQ6A 2WO3B 1E7UA 3L54A 2OYLA 1CF8L 2MKLC 4U3XA 5D6CA 5H2BB 3ULUL 5F93C 2BHUA 5J11B 2IV8A 5BXFB 2XPZA 3VQMA 2HKFL 3U48A 3TNMB 2Z9TA 3CH1B 4WTXA 4BSVB 1K8IB 3WXWL 5K9OB 4LFHG 5FYJE 3GB7B 1I9RL 3N1MC 4FFZH 8CGTA 3HE6D 3WS3B 5E4EC 2WNWA 4L3FA 4JDEA 2YA0A 2XRAH 3KPRB 4XTRC 5T1LD 3VXRB 1MRCL 1PCSA 5ABZA 1EJ8A 1G7HB 2CBQA 4P9ML 1U8MB 4NKQB 1S7UB 3WS6C 5CCKL 4JFWA 4FKKA 1XGPB 4M43L 4AE1A 4KKLC 5ESAB 1JL8A 1WHOA 1IARB 4RWYH 3FYEB 4FQXB 4OFYA 3Q05A 1OTTC 3DJ9A 4IBLT 4JAMB 1MIMH 4GKOA 2H0JA 2GEEA 3C6SB 2V4LA 4J7RA 1R19A 1KELH 1LILA 1ZHBA 4U3SA 5ILTH 4X6FB 1EHKB 2EC9U 2OCCB 3ABGA 4NYLA 5IJVB 1FC2D 4WLCA 3X13A 4XBEH 1T7XA 4OFKA 2A99A 2FX8L 3K72A 2HWZL 5C0BE 1H0DB 1GJIA 1DVFB 5I15H 5FW6A 3B5TA 1INDH 3GPSA 3CFCH 5LN4A 3QDMA 2DS4A 3ZIMA 1C8PA 4G70B 4RLDA 1HCYA 1BDYA 4YDVA 4CVWA 4HWEH 2R69H 4OD2B 2IGFH 1B3IA 2BP3A 4V1DB 5E8EA 2O61B 2EABA 2IPUG 5E1AA 1J12A 3AM8C