3ZTDC

Pvhl54-213-elob-eloc complex _ methyl 4-(((2s,4r)-4-hydroxy-1-(2-(3- methylisoxazol-5-yl)acetyl)pyrrolidine-2-carboxamido)methyl)benzoate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
139
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 34
structure length 139
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3ztdC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3ztdC01
1LQBC 4W9JC 4W9DC 3ZRFC 4BKTC 4AWJC 1LM8V 3ZTDC 4B95C 4W9IC 4W9GC 4AJYV 4BKSC 3ZRCC 1VCBC 4W9LC 3ZTCC 4W9FC 4W9EC 5LLIC 4B9KC 4W9HC 4W9KC 3ZUNC 4W9CC 4WQOA
chains in the Genus database with same CATH superfamily
1M3IA 3GMLA 4FFTA 3L2LA 1QKZH 2J2ZA 1Q0EA 2VW6A 4FQHB 4GRLB 2VDPL 3QQ9C 3N0PB 1OANA 5FUCC 3QQ3B 3OXSA 5KZCB 5MEQA 2VLRE 3QRGH 4LAJH 4S10A 5D2LE 5LBSA 1BFVL 4PREA 2O72A 5F2FA 1VGKB 4ZUUA 4HUUB 3B5HA 1ACZA 2PYEB 1C5CH 3S35X 4RFEB 2BIMA 4XWOC 4HIJA 2GK0B 3VMPA 1WFOA 3S3BB 1L9RA 5GSRB 4YBQD 1KY6A 2CRYA 2EYTA 4M43L 3U0TB 2VC2H 4V33A 1NM9A 2W92A 4MB4A 2HLFC 2OCCB 1HQRB 3K2IA 3MBED 3VGAC 5H4ZA 5D7LD 12E8H 3T65B 4GRWF 3IGKA 4MA1B 5HYJD 2E59A 3B7YA 5F9OL 3O3DA 3SKMA 1ODAA 2JKLA 3HHSA 1FLRL 3CLEH 2XNAA 3SZKC 4U31A 5AW9B 1HL5A 1P5VB 4JQVA 5CR8A 3RG1C 3D34A 3L2NA 4FQCL 3T0BA 4IDLA 1HYRC 3ROOB 2IALB 5C0RL 1CLZH 1SXBA 4XPTH 2I07B 1ID2A 3MLUH 3VTAA 1IO4C 1FIGH 3GRWH 4MDJB 1E5BA 1FNEA 2XX1A 1M42A 2W94A 4Q4IA 3HEIB 4K3EH 4AZUA 2WKGA 1WAAE 1ZPUA 5E5UB 2BVTA 4UNVA 3QR0A 4YHPB 3MRBA 2QV4A 4KMTL 2VCOA 3R7RA 2X6BA 1QFUH 1J0YA 2EO7A 4GRWB 4R9HA 3T4YB 4JGJA 4APXA 1PJWA 2CDEB 4OCRL 1GGTA 4R6UA 3B9KA 5DEGA 3NIGE 2J25A 4L1SA 3MLZH 1NCGA 2BNQE 4DGVL 2Q5BA 3MRCA 4Z7WF 4Z18A 2A6IA 3KL5A 2D7NA 1PZ3A 2CXKA 1XR8B 3GS4A 4NOBA 4Z9KB 1YEDB 1T5KA 2F15A 1TZ8A 3KPQB 4HD5A 1ZLVK 1MREL 4JM4H 2BFVH 1PZ2A 5ELIA 1R5VA 1G6RA 4X4XB 1PFOA 1SDDB 4YHMH 4NHCL 2IGFL 1N0XH 3ARUA 3U9UA 3U2JA 3OKOB 3QH3B 4GW4B 4ZD3H 1NEZA 1EHLL 3RX5A 3QQNA 1O9VA 4QRBA 4OZIF 1M1XB 1RSFA 4P07A 1HHHA 2Z8WC 3IBOA 3O3AB 1NQBA 4L3ED 3L3KB 4CSPA 1RL1A 1D9KC 3DHUA 3MNVA 2OJEA 1D5IL 2YBGA 4LKCA 2QHLA 2EDJA 2Z92B 3BWUC 4J3XA 2NY1D 3PYCA 5FWQA 1EH9A 2VW7A 1JVOA 4JFHD 4NQEB 3ME0B 3QG7H 5DEZA 5LDSA 1ZAGA 4FL4C 4WI0B 4IMLB 4KV5E 3KYAA 1DVQA 1KXQA 1QBML 2WMPB 5FUZH 2N7SA 2QGDA 2WTPA 4KK9D 4KHTH 4OD1H 1FZOA 3IXTB 3CPUA 5J12B 3U0WH 1NTDA 1WGOA 5AWNL 1H8SA 2BY0A 2YAEA 3UJJL 3G6DH 4KI5C 5GPRA 4V1DE 5C08D 2E7MA 3MA7B 3N50A 1GZHC 4EKJA 1K6QH 3LNEA 1BZ7A 2K7PA 4FKKA 2A9DA 1LWJA 2PO6D 3BN9C 1OGAB 4PY7B 2W9LA 3ULUL 3LV3B 1TQSA 1F6AB 3BQUA 1E28B 2JQMA 1IAKA 4PWJA 5E5RB 1FG2B 1MWAA 1E27A 3PGDA 2X4SB 5AKRA 4MCMA 5C0GA 3RWEA 3VFGL 3S35L 12E8L 2E6QA 4M6MH 1ZE3H 4FADA 4Z95L 3VTTA 1T4WA 3FN3A 4HJUA 1N64L 3DO7B 3LXAA 1E9OA 1OP4A 3WY3A 3KWWB 2H1PL 1FLRH 1BQLH 5JIMA 3S8WA 2NY3C 2XKNB 1IGJB 3LZNA 1CURA 2EZ0D 4KXDA 1B4RA 1ID5I 2EDHA 3APCA 2BIPA 3F3HA 4MNQA 4PMEA 4FQCH 3MJ7B 3ZZQA 4HD9A 3CBRA 1EJOH 2BRRL 2X89D 1JI1A 4JDTL 2NQDA 3V9EA 1KCUL 3CHSA 4ZT1A 1GA2A 1KV3A 4S1DD 3IMUA 4IEFA 1S7WA 2CO6B 1F8TH 4NKMA 3A23A 3PWNB 3EO0B 1WBZA 4UOW1 1OGTB 4C58B 4R7DB 3AG4B 1DYZA 2FSEB 3HLAB 2OJZH 4IBLT 1OPGH 4JO1H 1WBZB 2MHAA 4CVXB 4QHUA 4HJGA 1KG0B 5KBPA 3QIUB 3QCTH 5JPNA 2WXMA 5EORL 4GW1B 2YIHA 4LSRH 3WSQH 4FN0A 3L4YA 3TYFA 5DQJA 2ENJA 1U93A 1IKFH 3BUBA 4GW1A 3S88H 5F21B 2H1LM 1KIQA 2C8NA 3BIBX 4JFDE 3QYNA 1OCWL 3THML 2V2XB 3CFBA 4ZMWA 4HUVA 2OR9H 3GKZA 4AC4A 1NLDH 1FV1B 1DQKA 1ORSA 1MAKA 2AXGB 3WN5C 2EUXA 1G0YR 2GJZB 3AMKA 1NZRA 2J4WH 3I9GL 3CCHA 5D93B 1KLUB 5HD8D 5EO9B 5IKCB 3UYOD 4QRRB 5CS7A 4WK4B 5AVSB 5I5MA 1J5OH 4GSQA 2KERA 1FBIH 2WO2B 1WK0A 1DCEA 4NKIL 3ARGA 4PJBE 2D0FA 1A7QH 1RIUL 4HFWB 3UROR 4WW2A 2VR7A 3TA3B 3RZCA 3ULVC 4QXTA 4QTIL 5DURB 3SYOA 3FQUA 2R8SL 2LV4A 3MRMA 1K4DA 4Z7QE 1JFQL 3IKCA 3IBEA 4JKPL 5SWZE 4ZZFA 4KRNA 2X3CA 4GQPH 4N26A 5F7FA 2RQEA 3RVWC 3WU1A 1XSOA 3C60C 3E8VA 1QTPA 1AACA 4R4FH 1ZT7B 5IHLB 5KVFE 4E5XG 2NNAA 5C08B 2Y5TB 3BW9B 4FRWA 3U7AA 3KBFA 4G6ML 2EDNA 4LOUD 3T0ED 4HULB 1ZS8B 2Y5TA 5T1KD 4ZMOA 4UQ3A 5TJWK 1UT2A 4NKOA 4UINL 3B6SA 2NZ1A 3PGDB 3GLZA 2ZSVA 5ENWA 4OZFB 1FJ1A 1TU2A 4RFNB 2GJ6A 4OUUA 1RHHA 3A6BH 3E38A 4AT6B 2WB1A 4GRMB 1MUJB 3ABGA 4TSAL 2ZX9A 1HEJC 4JFDD 3K4ZA 4HMDA 4DKFH 5I0VA 2W91A 2A6DB 1MNNA 4GP8B 3B1UA 5BQDA 2HJKA 1AD9A 4PH8A 2PLTA 3KYKH 1CL7L 5CLXA 2BNUB 4ADJA 43C9A 3DROA 1Q9OA 4TM9A 4Z95H 5L4JA 3FOLB 5IHHA 4U1GC 3ML8A 1BJ1H 4GIAA 4JDVA 4NM8L 2IDQA 5D1QB 1U30A 4KUCF 3BISA 1N7MH 4KKLC 4DP4X 3EOBB 4WRLA 3CHQA 4XO9A 3EJYC 3TN0C 3GXTA 5HVGB 3L6FA 4XVSL 1XAUA 5J06A 2VLKB 3QFGA 5T3XL 1E42A 4UT7L 5T1DH 4ELMA 5EF1A 1I3RB 2IDFA 4P5TA 3SPVB 1XAKA 1MI5B 1YQVH 2XQYG 4BUGA 4CJ1A 5HYJE 3QEGH 3KPRE 3MXWL 2YPLB 3GMOB 5I1DA 5IEHA 4BFGA 2G5RA 1EEYB 4NFCA 3TPUB 1L7IL 4APQB 1AMXA 1KCVH 4G59C 2NZIA 4S1RH 4KJWC 4AQAA 1DDHB 4E5XA 4FFVD 2XACC 4UT9L 4P4KA 1S7QB 4ZFZA 4AGPA 4CSTA 5GHWL 3QH3A 2OZNA 1GJIA 4FCHA 4HSAC 2R2CA 5MP6L 3GIZL 1A8JH 1YEKH 4XOCA 1AXSA 4L8SB 2XIBA 1XQ4A 1MQKL 2BHUA 2YK1H 3DMMC 4JFZH 2LHAA 3L3KA 3OLDA 1AZZC 5HYEA 3GZQA 1HWGB 2DQHH 4NS0A 4AVIA 5BW7A 5JNYB 2VLRD 1D3CA 3CG8A 2W9DH 5CZVH 1BJMA 1MLCA 4ZFOB 3T6XA 3TYGL 3C8KA 3R1GH 5LWYL 3PUUA 1A14L 1VACB 4PGDA 5DMIH 3QJOA 2YAFA 4U7KA 2CM5A 5CFHA 1G9NL 3N9GL 4XN2A 2V7HB 3DJSA 4MB3A 1HQ4A 5DFVD 2Q8AL 3WTUA 3KXFB 4OGAD 5HI3D 2WTOA 3U7WL 5CLWA 2EE0A 3QCVL 2F6AA 4YGAB 3HHSB 4UIMA 5IP4A 5F1KC 1KEGL 4Y9BA 1R3HA 2F9BT 4JFHE 2EH7H 2IANA 4GMTL 3S37L 5D7LB 3TJEH 4L3EE 1E27B 2GJJA 1JFQH 4Y2LA 2W59A 1PLAA 4J6RL 5HSFA 4JO4L 2XZQL 3RWDA 3ZPDA 3QAZC 3WGVB 5HYQA 5JORA 1TPXB 3L1OL 3CC1A 4ZMTA 1CFTB 2BOLA 2LLGA 4H1LA 4N2OA 3U6RB 1V05A 1A7RL 3CDYA 1HHJA 1MIMH 5EU4B 3DPDA 3UFIA 1RIHL 5D71H 4F33B 3MRBB 1HJBC 5EO1B 2AQ1A 2WVVA 5KS9A 3OR6A 3QUZC 3H8NA 3LIZA 4P23C 4CRPA 1JP5A 4ZYKB 5KOMC 3SDCB 5LGJB 4OD3H 3VVWA 1K8IB 3DPBA 3KHQA 3QCUL 4BFKA 3HPJA 4LCVA 4GKLA 3R0NA 1DBBH 2DQ6A 4N5EC 4B96A 2IFFL 2IXQA 5HHVL 3MRJB 2QQNL 3D2UD 4IYKA 4H4NA 1X4ZA 2VJ8A 2ZNXA 32C2B 3RWFA 4ZG1A 1IQWL 2VO8A 3NP4A 5JO5A 4TPRH 3VD0A 1U58A 2NX5E 1NCOA 1OB0A 4NLHA 2FJGA 3V9FA 1H19A 4EIUA 5D6CB 4LGSB 1XB6A 5ECGA 2J72A 2VR8A 4LF3A 5C86A 1FF5A 1K3ZA 3U0WL 4OQTH 1JOIA 2P48B 2WLLA 3SBPA 1QFWM 4QHMA 3IJ7A 1RFDL 2B1OA 2ZWNA 4R2GB 3OLGA 3WDIA 2D2OA 3QFDB 4JFFD 5IREA 2HCZX 3I84A 3L5XH 3OKDA 4PGEB 5C0EA 4F8LA 2EEFA 3BZEB 4JFDA 2J6EH 4L4VA 4Y2DD 5EWIH 3BVDB 2HFGH 4ZXBC 4Y4HD 1M1XA 1XH2A 2BZ7A 3OHXB 4WW1A 2J2ZB 3VACA 5DS8B 1ZTXH 1U8KA 2EXYD 4H1LG 3OXSB 1WT5C 1HHGA 5FFLA 3G9VA 1NFKA 3UABA 4IMLA 1IIKA 4PB0L 5E9DA 3P2TA 3QZWG 1UZ6E 2DLEA 3MGTB 3WL9A 2GBAA 3GMRB 4JFED 4IRZA 4JB9L 2YK1L 4PJBA 3I02A 3DVNA 1LD9B 4FA6A 3UBXI 1QBAA 4ORZC 2Q6WB 3G6JB 1EJOL 1A6UL 4I5BB 5B38B 5L88H 1NBZB 1YJDL 2WKOA 3ZT6A 4ZFGH 3VFTA 3UAJC 3NGBC 4DN4L 5F3BB 1F5WA 2LU3A 3ZTJH 3D9AL 4L3CA 4GYBA 4WEBL 1DSYA 1URZA 5C3IA 3SCMC 3ZKMC 3OHMB 1KT2A 4BELD 4JO1L 3SDAA 4DGYH 4DO6A 1BVOA 3O6FA 1AFVH 2DKMA 3RFRA 1SOKA 1FN4A 1T2XA 5EBGA 2WYHA 1N8OE 2E27H 5I6MA 3HC3H 4FEMA 2CDGA 5AL8A 4BCXA 1OW0C 3ZL4L 5JDJA 4MJ4A 3ZDYF 3T4AA 5IUSA 4OCWL 4GEJA 1CR9H 4I2XB 4LGRB 4LDLB 1YMMA 4NUGL 3WO3B 5JYMA 1IEBB 3LMJH 5LDUA 3RWHA 3U9WA 4MDJA 3OWEA 1OM9A 1HSBA 4WWKB 3FUDA 5DFWH 4V1DA 5BUGA 3H2QA 4LASL 5GRVK 1IGTA 1BBJA 1XH3B 2EDLA 4WLCA 2BSCA 3RWIA 5EBLA 4H7VA 2EIMB 4HWBA 2J4WL 3I9GH 1DSWA 2QBWA 2LVCA 2IAMC 1TYEB 3V0VB 1I75A 5I1AB 2V0AA 2O6DA 4LEEA 2X9XA 4PJHF 1IBGL 1NCDH 2QVFB 2OTUB 1XF1A 3MO1A 1OVZA 4X4ZA 3V4PA 1OF2A 4PJ5E 1BFSA 2W0KA 3ARFB 4XNZC 4AX3A 3J8F7 4FTVE 3FU3A 2ZOTA 3QUXA 1GY1A 3GYRA 3EYVA 3PP4H 1QHQA 1T1YB 2L3BA 4F20A 1K8DB 1ULVA 3NN8B 4U0RB 5C0BD 3QQ4B 4Z3HA 1TXKA 1T0MA 1BVZA 4PJXF 4XWOD 3ULVL 4X9YA 2BIQA 2IOIA 2BSEA 1HOEA 5GIRA 3VSVA 2Y2WA 4MJID 2K7QA 1KB3A 5FYJU 3TO4B 1CXFA 3QISA 1N67A 3CD4A 2EINB 3BPNB 5DQDL 4D0DB 5INDA 3ZDYE 4D7BA 5GS2D 3N41F 1BF5A 2BIOA 3RVXD 3H2WA 4TVPE 3OD3A 5KSBB 2AGJH 2N1KA 1DLHA 2XWXA 3HN5A 4IJ3C 4E42B 5JXEA 3WXWL 1FFNB 1DLHB 2K0RA 2Y2YA 1S5IH 3F7YA 3OPZL 4KVCH 1GTNA 2Z34A 5T1LA 1QA9B 3HBZA 4TSAH 3FNKA 5F88A 4KX9A 2EDYA 1OD7A 1GL4B 1G7IA 4M48H 1TZIB 1X4XA 3T1FA 4N9GA 2G75A 2YPKB 1G7LB 43CAB 2VLJB 5D1ZA 1SN2A 1Y18B 3KPNA 4UDTA 4MMXB 1R1CA 4JFEB 2DQGL 4L4TE 2F19L 1JNJA 2NXZC 1IKOP 4J28A 5ICXB 2K78A 3ZE2B 1CF8L 4OLYL 4HKBB 1RZKC 1IAII 2XPGB 1ZJBA 4G8EB 5AOZA 4PRNB 1JVKA 1SQ2N 4ZRGA 5EC1B 2XVGA 1W0YT 3HBGA 4FYQA 4RMTA 2PN5A 5I0XA 1SMDA 5C0CA 2PETA 4EI0A 1L6PA 1TG8A 2GSIA 5T3ZH 1S2EA 3T0XA 1F2XK 1X5IA 3OR6B 3F12A 2K4WA 3BUDA 4DTGH 4R2GD 3WFEH 1TJGL 2E7DA 1LK2B 1IBZA 2G3NA 5SV3A 4NQXB 3WKMH 1KCWA 2RH0A 2JELH 4IK6A 1MFAH 4LCWB 1MSPA 4FA7B 2JV6A 3BMVA 1D7DA 3P2BA 4LLWB 3VXOB 4NQCA 1SJHA 1ZEAH 5AD0A 4LLQA 2BSTB 3FH8A 3VD3A 3DWTA 4UBDD 1FYTD 5FB8B 4GKNA 4XNQB 4JG1L 4LIQE 4J6IA 4LVNC 2BMKB 3EOTH 1MCSA 4FKEA 1RU9H 4NIYE 4YX2H 1MCPL 4BZ1L 3I74A 5I1DB 5IEHB 1CGSL 2I60L 1JG9A 1R24A 2Y3NA 3QXTA 3VXTB 1RERA 4XCYA 1BM3H 4QHMB 1XCQB 2IDUA 1NMCB 3QIBD 1KXQE 2RIKA 4U1JA 2FB4L 4GKZB 4U05A 3KLHC 3NRPA 4P46C 1VFOA 1HAUA 1TT6A 1BQHB 1G9NC 2VQ1B 1KEGH 2PP8A 1XXDC 3BP4B 2UWEA 1IUZA 4E9QA 1BAGA 4FNLL 1KJ2H 4KAQH 1T5XB 4DW2H 1LO3H 3EYQC 1WG3A 2PTTA 3ZT5A 5CEZL 1FAIL 1YEGL 3B7TA 3D39B 1UM6H 4UQCA 3C08H 1ZLVH 1A1MA 5C2BH 1CGYA 3MV8D 2CHZA 4MA8L 3FT2A 4KY1L 3CCHB 3E3QE 1NC4B 2VYRE 4PV9A 4LNVA 4JUTA 4J12A 1CYWA 3MOBL 4ERSH 3MOAL 5IJDC 5E6IC 5IQ7L 2V2WA 4K94H 3VXSB 3ELAT 1BLNB 5CWSB 2FAUA 2BXYA 3LH9A 3BFQG 3SYCA 1U8JA 1YQVL 4KKBD 2CK0H 4WQOA 1NL0H 3K91A 2CHDA 5AW5B 1LGVA 3B5GA 5GGSB 1QSEB 3W39A 5B38A 4CVZA 4HCRA 2GIYA 3TV3H 2NY3D 3OKMA 4X6BA 1CFNA 1D9KD 1EZVX 4WHYH 1OTTD 2BZCA 3QCUH 4MJ6A 4BV1A 4LPWA 5D7LA 1A2YA 4ZOBA 3BQVA 3SE9H 2NW2B 4ZS6D 2A73B 1A2YB 1DUZB 2XFXA 5I76B 1U6AL 4KK9C 3MODH 3HS9A 3KL3A 4LFHG 1FHGA 3CLFL 3UTTB 1MRCH 5I16B 5JORB 1JGEA 2DQHL 2G3MA 3AS1A 2H9GB 3MTRA 1OSZA 4O51A 1YVLA 4LL9A 3HS0C 4M5YH 1FNGB 2ETWA 4MXVE 4MBRA 3CZKA 3IU3B 1NC4D 4HZ1A 4R4ND 1ND0A 3DA0A 4XMZA 1EVUA 2FGZA 1FGNH 1IZJA 4Z1PA 3V6OE 1BIIB 3U79A 2Z7WA 4HGKC 5KAQF 4HCRH 4Q9CA 5DRZB 1NFAA 5I1HL 5DUBA 1R3KA 2P5PA 2VJXA 3ZT7A 2EH7L 4GMTH 1WHOA 2R0KL 4KDTC 2EYRB 4D0CB 5KSAC 5I1LB 3HNSL 2ZXWB 3MYZA 3ZL1A 1NUNB 3OJVC 2YKLL 4KI1A 4XP9H 3BGFC 1OAUH 4OZHE 1INEL 1G1KA 2ED7A 4L0PB 3QBTB 1VEMA 5DLLA 2VE6A 4I48A 1TDQA 2G3XA 2ZCKH 4PVMA 1QRND 1YC7A 2CU9A 4LLDA 1MI5A 4TSBH 1PLGL 5FFGA 3HBPA 2BP8A 5FKPB 1A6UH 2EECA 1WZ1H 2DQMA 1QPKA 1TETL 2E7LC 4ZXBA 2EKSB 4FMKA 4DO5A 4K7FB 3TFKC 4KXZH 1XF5A 2WKLA 3DDGA 2NDGA 2PWEA 1NFDE 1UENA 3TIEB 5CN3A 4P4KB 4ZFZB 4BSJA 4QWWD 4K7FA 1U2HA 1TTGA 3VFOA 1CICC 3FCTA 1CTNA 4TULL 2ESVB 4CDHA 4ADIA 2H26B 1YNLH 2X1WL 4IRZH 3X14B 3RI5K 2FZ3A 3K5RA 1J0IA 3T0EB 3NCFB 4ZDHB 5D4IA 1NBQA 2HG0A 4WW2B 5FFOA 2HMIC 5H94A 5E9DE 5IVNA 4PV9B 4ZNEE 1F4XH 1AMYA 1DVFB 4DW2L 4KWUA 2B5IC 1MFCH 2XV0A 3BPOB 1BJ8A 4HJTA 1AJ7H 4FOMA 4ZS6C 1E7UA 4LL1A 4PJ9A 4IDJL 2JWYA 5DD3L 3BUYB 4A39A 3T3MF 1PZUB 1EJ6A 1UJ3A 3LNFA 3DARA 2ZKWA 4HS3A 4R26H 1D7FA 4R7NA 3NFPB 1UOWA 5DC0A 3QPKA 5FCSH 1HQ4B 4LVOB 1E4JA 4K94L 3NEXA 1XL6A 5DURD 4JRFA 4QXVA 3WCYA 4I0CC 5DVPA 3EGDB 5FM4A 2EC8A 4PCYA 4LSTL 3QK0A 4PJBF 3TNMB 2L7QA 2UX7A 1BW8A 3FTUA 5AG9A 4NBZB 3VFUA 3V52H 4HCIA 3OG6B 2PABA 1A65A 3LCYA 5H37H 5ENWB 2BSSA 2QVKA 4Y9GA 5A2KH 4U1SA 4J3OF 5D7EA 4Z0BL 3APDA 3EGXA 3GHEL 2R2BA 5IJKA 5F44A 3T8XB 2H9GA 1CF1A 3L3JA 3AU1A 4M3JA 1RLBA 1ZANH 1WWCA 4H0IA 4WFFD 3UBHA 1P9MC 3PHOB 2XWCA 3QQDA 1XGPB 2WNKA 4UOJA 4IRSC 5DQDH 2OV0A 4PJ5D 1BV8A 4NWTL 2B39A 4M9PA 2AQPA 2LU5A 5DO2C 2Y7LA 1BOGA 4M6OL 4C83A 5TE4H 2OX5A 1YN6A 4GKNB 5IJCC 1BP3B 1R3KB 4PRPB 1I8MA 4ODSL 2CGZA 4LU5H 2E86A 1RY7B 1TMQA 5C0BB 5F6IC 4EDXA 4Z6AT 1MWOA 4N0FB 4TNWF 5DEGB 3HE7C 1DL7H 3F7VB 4Y4HC 5T5FH 1TTAA 2ED6A 1ZTMA 4PW3A 5DQJB 2ODIA 1RJLB 2OMVB 3OXRB 4W68A 3WUWA 5KN5B 5JW3H 2GBVA 3FSVA 2FQGA 2Y0SA 1ZHNA 4PJFA 4PJCA 3T6WA 3BH8B 2F54A 2VR9A 4QHLA 1MLBB 3CMGA 5AYUH 5DMKB 1AY1L 3GTNA 4E41B 3PV6A 3Q8CA 3C09B 4YHZH 2P28B 2A99A 2EXTA 2NX5D 5CFAA 4R3SA 5CSBA 2QKIB 5CD5D 5K9KA 2Y5EA 1UKTA 3S98A 1HL8A 1IBHA 2HRHA 2XC8A 3KWXA 4P04A 5FM8A 5B1KA 5HVHB 5G5DB 2A83A 1NCBH 1R5WB 3NQIA 3NZHH 4DFHA 3B7UX 5AKTA 3X14A 1B2WH 1ZA6B 3HHMA 3PJLA 2ENQA 2XQYK 5TPWL 1VESA 3QT2A 2X0UA 4I0PA 3O6FD 1IFGA 1C5DB 5EN3A 2Q7YA 2BJMH 1P2CA 1PNCA 5EIIB 3OG4B 2CIIB 3CFJA 5IVZA 2DS4A 2PR4L 3MJWA 1JV5B 4GW5A 4KXZI 4AJYV 3B3IA 3D69B 4HUXB 2Q9OA 1ASQA 5F3HA 5CP3A 4M00A 3BD5A 3EJPA 5I73C 4Z5RB 4QO1A 3U1QA 1ORQA 3BE1H 4XBGB 5IJKC 3D8MA 3WO4B 4OB5H 3WNMA 3AWGA 2A74B 3RIAF 4ZFOL 1V3MA 5IF0B 3ZTEA 3QDMB 2WJ7A 1IC7L 3QUHA 3G6DL 5F89B 4W9DC 2DI7A 4HUWB 1S78C 4NN7B 2DQEL 1MW3A 5JLZA 2WZ0A 3P3TA 3Q6FA 3IFNL 1N5AB 1QFWL 1JMZA 1MJJB 4YLQT 5H2BA 5BQ7B 2AEOA 2NNRA 1SVBA 4N24A 2D8KA 4N2KA 5E1QA 4J27A 3ATEA 3QFJE 4EUPA 2F1EA 2CLZA 2ITCB 3UTZA 4AG4L 2QJDA 5AW6B 3VXOA 3QR1A 1AQDB 1LMIA 3HI1A 3PXLA 5CNHA 3UX9B 2VTFA 5C9JA 1WWWX 2Q8BH 3OJMB 4TMPA 1FPTL 3GLEA 4XR8C 2DBLH 5F7EL 5FOJA 3AACA 4P2QA 3HOGA 3WKPA 1I7RB 2A1WH 2JKSA 4PWIA 5E8OA 1GJUA 2JIXA 2R1WB 3KVQA 3I85A 3HB3D 2XBTA 4TTDD 4GKOA 4XTRC 3N1GC 4MCNA 5LBSL 4ADGA 5ITFB 5L8JB 1PZDA 4HJGB 3SJVA 4NBYB 4HWZA 2QADB 3LRGA 3MLTB 2V8LA 5FM5M 2GIMA 3Q48A 4FFZL 4ELKA 4KQ4L 1KPRA 3BPCB 5IG7B 3GT6A 4J3WA 4XOEA 4DPRA 2OSXA 1BQHG 2PW1A 4HA1A 1F86A 2N7BA 3ZQ9A 4LP5A 5CKGA 5E1IA 3OGCA 3SDCD 3DUHA 3GKWH 1DL7L 4MZ2A 1AZBA 1OM3L 4AENA 3PWPB 2IG2L 2NYYD 3Q9QA 4O58L 4F91B 1NCHA 1ZLDA 5DI8A 3T0VA 2GHZA 1N4XL 3MGAA 4NHUB 1Q72H 5B3JE 3OTTA 4HKZA 2ZKYA 3GSOB 3PP3K 1J8KA 3IDIB 3VXSA 5CU9A 5C0RH 2P5EA 2CPUA 3DVGB 2NXZD 1UZ8A 3RL1A 2H32A 2C7UA 4LMQE 5ANHA 1E8YA 5SX5K 1IL1A 2YGPA 2NW3B 1PZSA 4Q9QH 2XCMC 3B7RL 5CJQL 1A9BA 2BSED 2GC7C 4NCC1 4M5SA 1PZ5A 2UXTA 4MJIA 1FFPB 1VIWA 5J11C 3QDHA 5TQ0H 4PCTA 2JKTM 3SZ6A 2EXYC 3QJSB 2MCG1 3L4TA 3UMNA 4GG6E 2A77H 3ERXA 5LQBL 4KVPA 4UZSA 1EAJA 4BM7A 4DETA 3LVTA 2ZONA 5LXGL 3VXMA 5BOZG 3ESPA 1PCSA 4YFLF 5BRQA 2UZXA 4OF0A 1C16A 5HGBA 4OV6F 2DQUH 4WJ5A 3Q06A 2FHFA 4JKPH 3RL2A 1YDPA 2Q76A 5FXCH 2V37A 3CFKA 3FQ4A 4PGJA 5ICYA 3MNZA 3ARBC 2NOYA 4AW7A 3D3VB 2VWEE 1TEYA 1FNEB 2XJKA 3D48R 4AK2A 4RAVA 2ESVD 5F7MC 1U3ZA 2WP3O 2X4RB 1U4FA 3BE1L 3FO9A 3IJSA 3LKSA 3FU5A 3QO0B 4PJGA 4PEEA 4UB0L 5TK2A 3IJHB 5EU5B 3O8XB 1DE4B 1OTUD 1MREH 2GUYA 2X4UB 3S96B 5J13C 2AJXL 1DBKL 1EBPA 5FYJE 3VI3A 3LPPA 4J7RA 4OUOA 2YEZA 3QXAA 5IESL 4YHLH 4FFZA 4FP8H 4EIBA 5BVJA 3GHPA 4FQPA 4U1HB 4AQZA 4PR5A 4YMPA 3AGWA 3AQDA 4UM9A 2YPLD 4OT1L 5FAAA 2OJ1A 1TVBA 5HD8C 4V11A 1ZVNA 2IAAC 3ROLB 1U92A 4J4PC 3JTTB 4AQEB 2AMGA 2R29A 4MQTB 5JUEL 5D9SB 2GI0A 3FUHA 1F3RB 5HDOA 4E9WA 1N7ML 3TZVA 1J1PH 1OWWA 3QEQA 4BH8A 4KK5D 1GZHA 4FQIL 4CILA 1GC1C 5AFAA 1NIAA 4MRBA 5AAPA 1IQDB 5HHPA 1U2CA 2P42B 2YPVL 1FO0L 1BD2D 1IC0A 3LOWA 4FZEH 3GSUA 5DZJA 3UZVA 4IK7A 2FQEA 1F90H 2EIZB 2WINA 2BW4A 4QI3A 4HJJL 1JIBA 2R7EB 3GSUB 1AZNA 3TFKD 3L16A 5AOKA 4NQSB 3QIWD 5I74B 3SO3C 3ASNB 5TE6L 4QEGA 1ACYL 1XF2A 2F7QA 3BPLC 3MCLL 2H1XA 1LE5A 3A0OA 5DVKA 4PJ7A 3NTCL 1CICD 1A4JA 2A6JB 3JWNH 3V6FB 2A9NL 2VDMH 2WXNA 4O58H 3NJHA 2Z31B 1NM4A 3N1QC 3VRIA 3WEXA 3VGEA 1P0SE 4P05A 3D6GA 1UB6B 5F9AC 4E41D 4PWFA 1RP9A 1F4WH 5D2NA 3WV0A 3S3DB 1HX0A 5AEAA 2FECL 4HWBH 1DVZA 1CLYL 1FCGA 2BRRH 3CVBA 4XMPL 1UVQB 3MRRB 1AS7A 4D0BA 4R7VA 4B3EA 2WWKO 2P80D 4MLSA 5FOBA 1E30A 1FVCA 1SHMA 3MRFB 2CQVA 1KN2L 2AERT 5JIKA 3C8DA 1UUSA 2IWFA 2C3GA 2IANB 4Y19D 4ZD3L 4CBZA 2AI0L 1BEXA 2Y06L 1MVYA 1OTUC 5KYYA 1CXIA 3VA2C 1IE4A 4XP6L 4QJ3B 5HGHA 3PV7A 3LD8B 4KMTH 4Z78A 1NWPA 1UM5L 4JBSA 3TF7C 4MNQD 4KO7A 2GBTA 1IX2A 3ESMA 5GZNC 5M95B 4U1IB 2CLZB 4YE0A 1RZGA 4RGMB 3HI1B 4DSYA 1TKWA 1ZHLB 3F2LA 1LWRA 3FRUA 3HE6C 5ISZA 4DGVH 4YXHH 4HDIB 1DQJB 3L7FA 3BIKB 3RA7L 2ZNWA 5EN2A 3HE6B 2H0FA 5BOJA 1T1ZA 5A6MA 4RGMC 4QHPA 3QGVA 4Q2ZA 5CMAB 3O6LL 1NWOA 4ZMVA 1QPPA 2P43B 2XA3A 5FA4A 1IGIH 2YA2A 1A0QH 5FECA 4KQ3L 4NC2B 3RVUD 3BXNB 1AC0A 3HCVB 5JHLH 4C59B 1ZHKA 4U6XB 2VITB 4LLUB 3ZYJA 1DQLL 2B08A 2C9XA 2LQRA 4XMLL 3PREA 3LN4B 3ETBJ 2EUVA 2B4CH 2FBRA 4HIQA 5KVGE 1Q38A 3V4VL 1GS8A 3NSFA 3L95B 4N2MA 1V7ML 2X9YA 5F1NA 2EUWA 2ADIA 3MREA 1ZLWK 1RUAL 2HRGA 1MI5E 3T09A 5D8JL 1LO0H 5A2CA 1HINL 2XXGA 3FSOA 4GKSB 3VM7A 5C0AE 1DCLA 1BQ5A 3L3OA 4ODXA 3JWOC 2R0LH 1TEFA 4NQQA 3QZLA 4ODTH 1EPFA 1ROCA 3VCLB 1DJZA 4DKEL 3VRJA 1KMGA 3MLRL 2Z31C 2VISB 2XZCH 3HC4L 3GMMA 1GGUA 2EEXA 5CP7A 5DJXB 3ZTJG 3QUYC 5J56B 4KZEL 3EFFA 1CCZA 3A6BL 5B3JF 2FEEI 1R4XA 3RWGB 4JY6A 3A6CH 4UM8A 2I9LB 4D2NA 5BS0A 4K5LA 2W81C 4Y19A 3FZUD 4Y88A 1CXKA 2GBUA 4ZUWA 4HJEA 1OGAD 3TEXA 3QEHB 3BUYA 4M7KL 1CL7H 3AVEA 2WXKA 3PAVA 4ZW3A 3STBA 5CJ8A 4U4IA 1T0NA 1TQBC 4PJDF 2VSCA 1EWHA 3BKCL 4Z8FL 3QDAA 3V0EA 1AI1L 1RJCA 3ZDYB 2VL4A 5E6RB 5F93C 5C0CE 5ICYB 5DQ9A 4PLJC 4JFXA 3NCMA 3MV11 2I32A 4PJ5A 3P9LB 4ZUSB 1RZIA 2XG5A 2ZX7A 4WU5B 2HTKD 3IEAA 2OXGA 2APSA 5DO2D 1FVEA 4ZFGL 4LCYA 3X13A 5HYIA 1S9YB 2NLJA 1JHTB 5LAXB 4AYBA 5CINL 4QDGA 5CBEB 2GW5A 5D7LE 4HSCX 5IQOA 4TQ8A 2R83A 1BZ9A 4HXBL 3WYRA 1S9YA 2NLJB 3QJFA 5LAXA 1KN2H 4F7TA 5CCKH 4UT9H 3UG4A 2IPTL 4JNXA 3OKNB 5BZWB 1KJMB 1F42A 5FC9A 1DANT 2IH1B 3DI3B 3FQTA 3L3IA 4F37F 1YN7B 5E1HB 4EIGB 1CI5A 5B3NA 3UOAB 1NBVH 3T5WA 1CFSB 2YD4A 4GINA 4D0CA 1HYSD 5GGRY 4J2QA 3RDTC 1X9QA 3O8XC 2B1AH 2IAND 3UTTD 1NAMB 1XEDA 4NN5C 4NKMB 3PGFH 3FN9A 3QVAA 3UGEA 1J0HA 3ARFD 3EOAA 4HKXA 4F8PA 1C12B 1J5CA 5DDHB 1XF4B 3WDJA 4ZQKB 4JY5H 3CFDB 4ZK8A 5GRJL 2Z35B 1JZHA 3WXVH 3EBGA 3OLIA 2ZTBA 1T6BX 5EF3A 2ZUSA 2OL3A 3D07A 3N6YA 4F7CA 1U93B 1QSED 1XGUB 1EMTL 1JDCA 3RJQB 1SFHA 1N3NB 2PCPB 1D5MA 2V2XA 2XU9A 4HF5L 3D0AA 4FHJA 4E2OA 2K9UA 1HKLL 2XBDA 4OI9A 3D4CA 1NGQH 2DIJA 3K81A 1T20B 4WEEA 5HGGS 4P3CH 1YEWA 5J9PA 4PVNA 3UCRA 5KJRH 2RFXB 2WK2A 3GLDA 1QFOA 3RWJA 3VI4B 3GB7A 1GOHA 3SQOL 4N8VG 2H6UA 1XT5A 4YAQB 2F18A 4L8DB 2E76C 2GHWB 4LEBA 1PPIA 3T3PE 2BWDA 3PUCA 1JTPA 4MA7H 1W2KT 1ZDQA 1RIHH 5D71L 5DRNA 3OKMB 3ZW3A 1OLZA 5DTFA 1YEHL 5HYFA 3IN2A 4V2CB 4BWUA 3S9DB 4FJYA 2AABL 5MENA 5IT2H 1LEGA 4OLWH 4ONFL 4JG5A 3FO2B 5LBVA 3PU7A 1C5BH 2GAZB 2WUBL 1MCBA 3CDGA 4N85A 4NI3A 4P2RA 5EU6E 3MBEB 3DHJA 1FYTA 2NZ9D 2WXHA 4JAMA 1V3LA 5FW8A 2R0WH 1HXYB 4RGNB 2VZ1A 1H3UA 1N4XH 3AZUA 3LEYH 1X7SA 4JPWH 1FYTB 4JAMB 3FOMB 4L3AA 4KZCA 4NSKB 1MXGA 2YGQA 2XPGA 1OD9A 3QXVA 4TPRL 2A74A 2IIJA 3FCBA 4Y8DC 1JF1B 5DQ9B 3VI3E 1IAKB 4B41A 1MY5A 3NACL 5C0GB 1Q4NX 5CN2A 1O5DT 4CU6A 3STZA 2GFBA 3B9DA 1H15B 4FG4A 1KB5L 3BAXA 5DK2A 3MRDB 1JWMB 2IPKB 3BUQA 1HI6B 1R5IB 3KLLA 5HHOB 3KWUA 4WCYL 4JMNA 3T4YA 1P4LB 5EB9A 1EJFA 4LARL 4AL8L 4D8OA 1FQ9C 1ZTXL 2XN1A 1U0QA 2Y3AA 4B50A 4OGXH 2FECI 2JSFA 4NQCB 3C5XA 3QUZD 5ID0B 1XEUA 2QTEA 3AS0A 1PZCA 5IBLD 4NZUH 4F93B 1CBVH 5I1KH 1XF3B 2X4OB 2W60B 3BP6A 1N70A 1JZ7A 4H26B 4JO4H 3P54A 3I75A 3B7SA 4AC2A 2B3IA 4G1EA 1R33A 3TH4T 1NBVL 4PJAA 1JF6A 4XWGL 2DLIA 5E2WH 2A74C 1DQML 1CO1A 2MRYA 2EKSA 2OMYA 3CX2A 5JHDB 4NAQA 3UL4A 4DEPB 5I5RA 3WO4C 2FD6H 4DQOL 4I77H 3G5ZA 1YNTB 4NO2B 4AV4A 4EDWH 2X70B 4AJWA 1H3WM 2W5PA 4ES9A 2P5EE 1T04B 5AB1A 1UFUA 3L1EA 5D7IF 4UI2A 2Z4QA 3BT2L 4X98A 1MWAH 1CFQA 3DX6B 4XI5C 5CP7B 5DJXA 3OKLB 4WIQA 4B7LA 5IKCA 1JDDA 1C08A 3LY6A 3VTMA 1EMTH 2FX8L 2K8QA 1GCFA 4PREB 2W38A 3K71A 3WHE0 3FK3A 5C07D 4HEME 5BS0B 1VGKA 4GFXA 4GSXA 1HHIB 4RA3A 4ZUUB 3RVVC 5IOPA 3D0LA 1G7HA 3SQBB 1K2DA 4HIIA 5HVHC 4J1UB 3O4LA 3MA7A 3PWJB 4HAKA 4LSUL 4G70B 3DOHA 4LAQH 3MRQA 4JKKA 4X6DE 2R4SH 4XVUC 4JRXE 4X6BB 3OVUB 1P84J 1Q9KB 3PIQA 4BZ2H 4N6RB 4PS3A 4FLRA 3T2OA 4ZUSA 4I18A 2X0WA 4TLKA 3L2MA 3RZCD 4TNGA 2OLDA 2CRIA 1XZWA 3N42F 4FERA 2KZBA 5LUMA 3QUKA 1HCFX 3KDMB 2CJTA 1I7TA 4HJJH 4O2EA 1ZIAA 5FF6B 4O4YH 4FXKB 4U3SA 1BFOB 4QKXB 5AW8B 3X12B 1X7QA 4G80A 2VXVL 3MLWL 3DUSB 3ALXA 3D30A 3MBEC 3CLEL 4WTQA 1EHXA 4PU2A 5HHVH 3CXHK 3GXUB 4J4PD 4XHQA 2ZYIA 5J89A 5ANME 2HTLC 2BIIA 1LP9B 1JNNH 1EHNA 3FH7A 3BDYL 3KPOA 1KGYE 3S2AA 3CVHH 2DLFH 1J9CT 4GLRI 1Q0YL 3QWOA 1FHNA 1ZCRA 1AANA 5F1OB 2CRMA 5F72S 2IWKA 1CLCA 5I1IH 2FO4A 5IBTH 1UEMA 2ITEA 3DXAB 3PHAA 4JZNA 4QNPE 2N0KA 3QQ9D 2R1XB 3DJRA 4W4NA 2AEPH 1Y0LA 3NN8A 4JVUA 1D2OA 3QULA 5C0NC 1F2QA 3L95A 1KJ2B 1OAZL 3ATFA 1QFUL 3II2A 4CVUA 2R29H 2CAKA 2W07A 4HMCA 3TT1H 4NDMA 5C0AB 1HEZB 5CJBA 1T22B 3FU7B 1HHKA 2WZ5A 2NY6D 3CBJB 3S36L 3KLAB 4AIOA 3RVTC 2Q1EA 4H88L 5JYLA 2WNWA 2YAQA 5KVFL 1UD3A 1Z9MA 3RURA 5IW1A 2A4CA 1H3TA 2LU7A 2PP7A 5HGAA 3KPRA 3MV9B 5L2JB 4BFBD 3PDDA 2PXYA 3CU7A 2OMTB 3II1A 4RWYL 4J3TA 4NAJA 3ETBF 4UT6L 4ENEC 3AXLA 2YD9A 3AM8C 3CUPB 2WZAA 3HG4A 4P0DA 4HWEL 3VXPA 2G60L 4NN5B 1YYCA 3JSSA 3PDGA 4AYFA 4X7CC 4EXKA 3WTVA 3NJKA 4YBHA 2FEDD 3S6CA 3PFQA 4D9RE 3T0EC 2BY1A 2NSMA 4ZS7L 1M7IA 3WIHH 1VJSA 2A6JA 2H47C 3SE3A 3ECBB 2GK0A 4PRAA 4WTZA 2Z65C 3BT2H 3IU4L 3ML9A 4M02A 4XCFH 5EC2A 3ULVH 5C0JA 1MDAA 3HZKB 3BSHA 4JO5A 4ZFFA 3QQXA 5DD6A 1BGXL 4GS7C 3DX4A 3X3GH 1E4WL 4L9LA 4XNYH 2WOBA 3PABA 4DP1X 1PG7X 4FG6D 4PRNA 4N90E 2BOCA 3VFTB 1J1OL 1VADB 1AGBA 4HZLB 4N68A 3WKNA 3KPSB 2E7LA 3WBDA 3O4LE 2DQTL 2D03H 5BJTA 2J7LA 3CZFA 4NZFA 5KSAD 3K8LA 2Q3ZA 4L23A 4PJFF 1K6QL 1MJJA 1U21A 5CEYA 3ZKNC 4RISH 4XN5A 3BGFB 4QRRD 2P8LB 3F12B 3H3KA 4BZ2L 3KNBB 3MLYL 1BZDA 2Y1YA 4QMEA 1X5AA 5G4OA 4KTDL 5I17B 4POZD 2DH2A 3RWHB 3BVWA 3J27A 1IAOA 1P5UA 3CZJA 4M7KH 4MJ5B 1SVCP 1SJHB 5E56A 5DXWA 4TLTA 2CHXA 2MCAA 2BIHA 1QLEB 4YDJB 3FTVA 3GSXB 4Z3FA 5E7BA 3ARWA 1FZMA 4PLNC 4OV5B 2ITDA 4X0KA 1OAYL 1IVLA 5LJYH 4Q2ZB 1P9MA 5CMAA 4WKZB 2WLKA 4JFYA 3V4PB 3QDME 3GJFA 4WTZG 1JNNL 2FJSA 2D3JA 2X3BA 2DJMA 3JV4B 4JANB 4JDTH 3T3MB 3EDEA 2EP6A 4XO3A 3VWKB 5I6NA 4K3JL 5EH1A 1UWXH 3BP4A 7PAZA 3WMSA 3EO9L 3G5XA 3KXFD 4ODSH 3GRWA 1HEZA 1HDMB 2NSQA 4NZTL 2IPTH 5I2IB 2X05A 1MFEL 4W9JC 2VDQH 4TN9A 3T77B 2APWA 2I26N 5BPPA 1JN6B 3NJXA 2Y22A 4P3DA 5KJ7E 3P3SA 4KVCL 3QDGD 3UZVB 5K59F 3WTTA 1AGFA 4GUCA 4Y4FD 1CTMA 3FKUS 5E8PA 4A04A 4ES8A 1EX0A 4J3BA 4N1EA 4P9ML 2VZTA 4LKXB 3THMH 1ONQB 1NLDL 1NFDB 3FDWA 4BQCA 1A6VH 3P4OB 2PF6A 2AK4B 1PW3A 1FFPA 4LQFH 3C6LC 1K2DB 1MG2C 5B1JC 2VXSL 3VXPB 4BK4A 3PWJA 1EK3A 2KMWA 2PO6B 4OM1H 5BW7C 1RP8A 3O6MH 2P5WA 1OCCB 2PW2A 4R5TA 2MCMA 1DZBA 2DLGA 1H3VA 1G6VK 3CFJB 1JK8A 1Q9WB 5GRUL 1L0QA 5I5IA 2V6HA 3VQMA 3O11B 2GJ6E 3BI9X 3VGGA 1C16B 1NGZA 2GTQA 4JJ5B 4P2QD 3EYSH 2HWZL 3N44F 4JKLA 4GP4B 1YDPB 3R4DA 3WFCH 3BVUA 4L5FL 4WFFE 1JV2A 1NIFA 3ZNGA 4WK2B 4LGPB 1K4CB 3C08L 1WZKA 2Y9RT 1NMCC 3IDJB 4AE1A 1CBVL 4J5VA 2FTAA 2V3FA 1H0DB 3LD8C 1EANA 4FXGC 1U33A 1LK3H 3S3JA 1DDTA 5TD4A 5D1QD 4XB8A 4GXUN 3GNMH 1ZS8A 5I0ZA 1LO2H 3GK8L 4PWKA 4YZWA 2WO4A 3NRFA 3DUUA 5EG6C 3AWEA 1BEYL 4FGMA 4LDOB 3R7QA 2F5AH 1IZKA 2JVUA 2RTTA 4F2FA 3U36A 1KGWA 4FI7A 1JTTA 2AITA 4M6NL 4OLZH 2HN7A 2FUQA 4MQXD 1AOZA 3T2LA 4OZGB 3RDTB 1A3QA 4NQCE 4H0HB 4DN3H 4X5RA 1MCPH 2J5WA 1T6VN 5IQ9B 3WS6A 5DHMC 5C2UB 3HAEG 4X6EB 3SKOA 3ZUNC 2VMDA 3K6NA 1PEWA 3G04B 5K93A 3H9SE 1I9RL 1YEJL 5DHVA 4I89A 5HDQH 3MXVL 2Y07H 1KIPA 4AYMC 2IWEA 3N44B 3ROLA 1XGTA 3TT3H 3BH9A 4F80A 1Y0LB 3KW8A 4AYDC 4TOYL 1U58B 3BPLB 4JPWL 5CHNA 3QZWB 4I4WB 5DA0B 5DZVA 3ARQA 3H3PL 5FUOH 2E7BA 1PG7W 4ILDA 1MCEA 2Z0UA 5F7EH 5IB3A 2DBLL 4KFMA 1AGDA 5DDHA 5LVEA 4W9KC 4BYHA 4G8FB 5KBMA 1VERA 3ECQA 2DM3A 5DHYB 5IW1B 1IGFL 5GIRB 1TQBB 2EDOA 5IMOB 2QDWA 3MACH 4MWFA 4XP1H 4MMXC 2DB8A 2OMTA 4K94C 1F97A 4NP9A 3LKNB 1D7BA 2RALA 3SE4A 1OSEA 2MNUA 3SOTA 1FORL 3DV4B 2WBXA 4WVRA 4Z7NB 3HKZA 2C9QA 4F7MA 3DOSA 5JR1L 2COVD 1AHWA 2AXFA 2Y1ZA 3HZVA 3M1BB 1J1XL 4MKTA 4F2MA 3VXNA 1E4XL 4DP7X 1E40A 4XP9L 4R7XA 2E9GA 4NUPA 5I1KL 3QUYB 4ZAKA 2FLBT 1U3JA 5DK0B 2QR0A 2ROXA 4HIIB 4JRXB 3DVNB 5L8KB 3B2UC 1VEOA 4HX1A 1XVSA 3D51A 4JCLA 5E2TL 5TDOA 4QXTB 5AW2B 2EDBA 2OMZB 3DIFA 4XODA 3W57A 2F58L 1AZUA 2V7HA 3W39B 1WC7A 2AJZB 3PIQB 5CZVL 3QUML 5IV2B 1DJSA 1QLEH 3UO8B 4KKQA 4OCSH 5C6PB 4PJIA 4MJHA 3IMWA 3MFFB 1VZGA 1KGJA 3TO2B 4YHNA 1N5YH 4UT6A 3C5JA 3CDGB 4KU1A 1M9WA 2CMRL 3AXHA 3VFMB 2PYED 2JNZA 3G5WA 4JE4B 1YNLL 3ARBB 3NFSL 4URKA 2VLME 2GUOA 4FXGB 3H9SD 5FO7B 3MLXH 4QYOB 4BKTC 2FWOB 2I27N 4D9QD 4XNUL 2G30A 4ZODA 5KZCD 1KGCE 2QQKL 3BWSA 3EJRA 4KKAC 2DWTA 3TJEL 1Z5LA 3FTXA 3VAEA 3FPYA 2VO5A 3U2IA 3X1EA 3ZIMA 4H88H 5IUCA 2ZT9C 3KPOB 2RJMA 2WLJA 4CKVX 5HJ3A 3B9EA 2ADFH 4JFQB 3ZTNH 1S9WA 2WBJA 3OAWA 2A6DA 1BVLA 4IEFB 4EOWH 4Z76B 5GISH 1JRHH 2PO6C 3L1OH 4I87A 3OB0K 5GZNA 1AVAA 1E5YA 2WQVA 2MHAB 3C6LB 4FHBD 4UB0H 4HIXH 4K7PX 3CHOA 3REVB 3RUGF 4DK5A 3GXPA 4LQ1A 5DJ0B 3EOBA 2MCPL 1JGDA 4P2QE 4XO4A 3VVVA 4WI8A 2ZUUA 1WE5A 1KCSL 2BJML 3DSNB 1I82A 4Z7OF 1HNYA 2L0DA 4HBCL 1BMWA 3DDFA 2D7MA 4Y2OA 3VFPB 2XIDA 3MLVH 4YIQB 2V33A 3TBSA 3VO0A 3S34L 3BCFA 2IFFH 5IB3B 4LLDB 1IGYA 4TVSa 3HG3A 2QQNH 1D5IH 4XGZA 4APQA 2WLLB 1E4WH 2YC1A 3CVCA 1PEZA 3BO8A 2VL5A 4PRIA 4YNYB 4OGAC 2DQJL 3VWKC 5A2JH 2EE2A 3TPKA 1OT1A 1QNIA 3P3RA 4LLMA 4QXWA 3DBSA 1MCOL 4H20H 4HBQA 4R26L 2VQUA 1MJ8H 1AXSB 3FSZA 3GMPA 3L9EA 3DX0A 3FCTB 1RZJC 2ICWJ 5ICZB 4IQHA 4IOIB 5E51A 2IGTA 5E6IA 2R39A 3T0DA 1IC5H 2V7NA 3VFSA 4G9FD 3JQOB 4XCCL 3WD5L 1ET8A 5L6YH 5BXFA 1I31A 3SO3B 4X4KA 4DERA 4O2FB 1DHKA 1ACCA 1ASPA 2EIBA 4ZUWB 2XXCB 2ZWSA 1D6EA 1OZTG 3B1TA 4WI0A 4ENZA 2WWKT 3ALWA 3B3IB 1ZK9A 1L5GA 3IGLA 1XBDA 2CO7A 1KBVA 4Z7UE 4X99B 1ACYH 4DEWA 3T3PF 1OGAA 4IHOB 4LRNL 3NDZE 1NFIA 4HZAA 1MXDA 2BK8A 4XPAL 3ZSSA 4JDZB 2Q10A 1EXGA 3QFJA 4N6QA 3NA9H 3GS0A 5IB1B 1E9PB 3IJYA 5D2LB 3ZHLA 3F7QA 3CN0A 1SLWA 3M8OL 3FB8B 4X5XA 3FSWA 4Q7DA 4N0CD 4RBPH 5LCVH 2K45A 2ZKHL 1UXWA 3I9PA 3EDDA 2MQ3A 3DJ9A 3ESOA 2V5YA 3V6OC 4TVUA 3IPFA 5I73B 2E9IA 4YPGA 3LNIA 1ZA3B 1MCJA 2ICWB 4WTWA 4WFED 4TNEA 4GS7B 4YXKL 2D0GA 2XKNA 4XXDA 3BWUF 3EBHA 3FOLA 3QPQD 1DP0A 2GK2A 2QLVB 5CR1A 1WFMA 4XNYL 5J13B 5L4IA 1DLFL 5DJAB 2YSSA 4RNRA 1NGXA 1AC6A 4NO5B 2UZYA 1OCWH 4HHWA 2OZ4H 3D05A 4JPSA 3GBMH 1XH1A 3CIQA 1OF2B 3DECA 1TPXC 2JTDA 4QD2E 5KYXA 2YWZA 2VXSH 3K4DA 4JGUA 4OAWB 4CVXA 4MZIA 1SOQA 5IGXL 4NM4H 2VW4A 3K0WA 1FP5A 1DJIA 3FFOA 3NCEB 2UVFA 1S7QA 2QKIC 3RBGA 2A77L 3QI9A 2DMHA 3GIVB 3TBSB 2YD0A 4GG6A 2OSLA 2C4FT 4JVWA 4X4MA 5CIPH 3PXJA 1G1OA 1RIUH 2D31A 3HPLA 3ATBA 4PSRA 5DRXB 5JOPE 1AH1A 2HT4D 2AVFA 3SGDH 3O2WL 4MJIE 2B15A 2KC0A 3JYCA 4P5KB 1YMMD 3SN6N 4RSVA 3IDGA 1ADQA 2X1XR 4LB8A 2E7HA 4M8QB 1RURL 2V2WB 3FCSB 4W93A 1LK3L 2WKOF 3KMDA 1WFNA 4Y4HB 5TDPB 5IIEA 4AQ8C 5B7MA 1LMKA 5IB4B 4YUEL 4UQ2B 2O61B 3WS3A 4I9WD 1UADC 1UWEH 3H56A 5F7YC 1LL1A 1WC7B 2BRQA 2XN0A 3DMMB 3FMGH 5D1XA 1B9KA 3V7AG 4JFSA 1XCXA 4FFVC 2EEAA 1S78D 2EJ1A 3FBQA 4HS3B 2G75B 2YPKA 3INUL 1RIVH 5ERWB 3VXMB 3PWUA 3EH3B 4MMXA 3WXWH 1R46A 2VKWA 4J23A 3ZR6A 3FQNA 3FQ1A 5FUCE 1HZHH 1JZEA 4YL9A 3I6GA 1NPUA 4OT1H 3W0WE 4RH4A 5ACMA 1VADA 3MQIA 3PHQB 4L0ZA 2VDOL 4FXKC 5I18H 3Q13A 3UPRB 2MKWA 3COOA 3DRQB 4M03A 4F3FA 1FNFA 2PPCA 4G8GB 2F19H 3PY9A 3IE9A 1TJMA 1WWAX 3HMXH 3VGBA 4E9SA 1N6VA 4UIKL 2PYFB 4YEFA 4NQEE 2DEWX 2GKIA 3HNTH 2O5XL 4LSVH 4MAYD 5KS9F 3J2PA 2A1WL 1FRGH 4JCWA 1DO6A 2JKJA 1BYPA 1YMMB 3Q1EA 5D1QC 3KLDA 4ANUA 3BVVA 5MHSE 4LVOC 4KROD 3TS8A 4BFJA 4S1SL 1FL6B 2NX5A 1QSFD 2CUIA 4V1DB 4MD0B 5IMLA 1GC1L 3QS3A 4RGND 2Q87A 2VR4A 4QTFA 3WMQA 1I1FA 4OZIE 1KJVB 4RMRA 3BPOC 3ULUF 1PIGA 1DVFC 32C2A 3RWFB 2NTFA 5AD0B 5I19L 1KJVA 1YAZA 2VXQL 3AROA 3N40F 4P2RE 4YHOH 4PYHA 1U8QB 3NSYA 5AENA 3RHWF 3VX0A 1YEFH 1W0VB 3ILEA 3MZGB 4RFOH 5E94A 2DYPA 3SPGA 1AG0A 1YECH 3RGVD 1PLBA 3FAWA 3OQ3B 1KPUA 2WBKA 4JRXD 3VQ2C 3F58H 2JJUA 3KLKA 3D87B 4NRZB 5F7LB 3IFOB 4ACPA 1ADQL 5J6GA 4AMWA 3FF8A 1DBMH 4Z7NE 4ZJ9A 4BBWA 1CGWA 1FFOB 1KIQB 4FFYL 4BKLB 4YX2L 5TTRA 2VDLB 4JFFE 5KJ4A 3BAEH 4UQ9A 4DEPC 2UWEB 2R1YB 4CNIB 1SLXA 1T89A 4WI4A 2KBGA 4P3DB 2Y06H 3SKJH 5SWZA 3N9GH 5CIPB 1GGBL 2GPZA 1FFTB 4NNYB 1DZ0A 3NRQA 2DMCA 1JTOA 2ZE0A 1IM3A 5LQBH 3B37A 2VR5A 1RZQA 4N2IA 3TA3C 2Z31A 1M7IB 2F54D 4WI6A 1IGMH 1SM3H 4WWPA 5SWSB 1BM7A 4CW1A 1A6AB 2WZ6A 1QKZL 1O7DC 1NMAH 2E9WA 1RK0A 4OLVL 2C3VB 2VDLL 4XPFH 4OTXH 2P80A 3MZTA 3BLKA 4JQXA 1INDL 4MA8H 4CGTA 1JYVA 4OCLC 2VERA 1DO5A 4G1MA 1S7SB 3ZMNA 4DP9X 4B9CA 3OMIB 1IRAY 1W80A 2BOCB 4EPSA 1PD0A 1ZT4A 2I69A 4JZOB 1URLA 3FU8A 4AY0A 1FO0H 2YPVH 4FZEL 4IRSD 1UWEL 2Y6SC 4PRHE 1CD0A 1UCBH 3MNMA 4R8WH 4OKDA 3VFNB 4A63A 1UB5A 4QXUL 1A64A 5CEYB 3VSQA 2FO1A 5IT2L 4YSOA 1T1XB 2V3DA 5GZOD 4KRMB 4ONFH 3MCLH 3D0VA 4H8UA 4RGNC 5HI5C 4HK0B 3DRQA 1M4KA 2OW6A 4ZX4A 5F6IB 3MLVL 2YAHA 2BNRE 2NUPA 2WP3T 5C0CB 4C56A 2H4EA 4YDVA 1JHLL 2VXQA 1IGTB 1CK0H 5FYLH 1NICA 5BZDA 4KJQC 1R19A 3SDCA 4ZO9A 2N59A 4EUPB 4XN4A 2K1MA 1CLZL 4X6DB 5ALCH 1GW0A 4MAZA 2WQUA 4PV8B 3SD2A 2VNCA 3N06B 3O9WD 1FRGL 3GJFB 1A47A 2GB2A 1WRFA 2JKXA 2WQWA 1P7QB 4PV8A 1DTUA 2BSTA 4FTDA 4ZX5A 2CMRH 3WE1A 1OT2A 3L5XL 4OF7A 3M45A 4QHKJ 4QJ4B 3RNQA 1BVKA 5D7HA 3A6CL 4LARH 4D9LL 1GC1H 3KCPA 2HRPL 4G42B 4ZUTB 3LKQA 3Q8FA 2X1PA 3K6DA 5GZND 3HG1B 2TRYA 2CLRB 2O26U 4IOSD 4K8RL 2LT9A 1I9IL 4LF3B 3IFOA 2LFGA 3MX0A 1NBYB 4HCFA 1A6WL 1KBBA 1WPCA 1IM9A 5C6TL 4OCXH 4OF6A 4X42A 4OZ4A 2ZP9A 1BYNA 4FNTA 5HGAB 3N0AA 4YVUA 4C4BA 4LEXL 2FWLB 3SHSA 1IM9B 1TVHA 1UWXK 4P4RB 5GISL 2J8HA 5J12C 1TO4A 5EZIH 2QVMA 3HA0A 1NKOA 3AXLB 1QLRB 4FQHA 4GRLA 3KPRD 1EGJL 3QO1A 4L8SA 1VA9A 2ENSA 5KBDA 5FA3B 5I8CB 1KYOJ 3ARXA 3OSKA 4ZOEA 1NPJA 1K5NA 5I6KA 1HL4A 4WW2C 4OJYA 1UYWL 1ZWIA 2PYEA 3P0VL 4YO0B 3SDXE 1G7LA 3ZZLA 4R83A 5BRZE 4IRSA 1PFCA 3D0LB 3NVQA 1B0RA 1EAQA 5ERWA 1K5WA 3FONB 2G5BA 4BKSC 1RSYA 4GAGL 5SWQB 2ATKA 1EO8L 4W9LC 1SEQL 3H3BC 2WSPA 1AGBB 3ZBMA 5CD3A 3NK4A 1ZHBA 3FSAA 4K3DL 4M7JH 4D0BB 2DQFA 5B1CA 3V5HB 5KSVB 1NMAL 1V5JA 2DQJH 4LK4A 3CXDL 2YR3A 4TNWK 3VX1A 5SX4H 3PWLB 2PCFB 5IVXA 4I85A 2MQ0A 2GCYB 3AITA 3FQWB 1N8ZA 1P5VA 4HPYL 3DO4A 3GD1C 2CG9X 4WTXA 1NCIA 1CVSC 4GRMA 1WFTA 4ALAC 1YCSA 4N25A 2AZAA 3QJTB 3WD5H 4L4JA 1IU1A 1R6VA 4TF4A 3D0VB 2ZIDA 5KSAB 1WZMA 1QG3A 2EVHA 3WFDH 1WICA 1IAMA 2XDHA 3F6JA 3J7HA 4TKWA 1G5GA 2Z8SA 4X50A 3OJDA 5JIIA 2F53A 4HVBA 3NP3A 2X4UA 3S96A 1B0WA 3SE3C 1WFJA 1KUMA 1XIWA 5AW4B 1GGIH 2BP0B 2Z8VC 3FUEA 3R0MA 2Z91A 3WGUB 3GI8H 1KFGA 5HGDB 5LGJA 4LFHD 4QGYA 3SPHA 1ES0A 4P2RD 4S11A 5KYUB 1KG0A 5DUPL 2EH8H 2OTUA 3CZGA 3SBQA 4RMSA 3JXAA 2L04A 1NC2D 1YSOA 4FABH 3PL6A 5D8JH 5ETUB 2J8UA 2DWEB 3HI5L 3FAXA 2QKSA 5DVNA 1AGEA 1PBYA 4G9DB 2XWBA 4KZ0A 1F02I 4F1SA 3WNIA 1GOFA 4OZHA 5LCVL 1I7ZB 2VRQA 5MHSD 2QSQA 3RBSA 2ID5A 4FE9A 3LQZA 3STLA 2OSLB 3TBVB 5F7HA 2XZCL 2FE0A 3HC4H 2YA0A 1M3JA 1Z9OA 4ATTA 3C5SA 4TNVF 4WNQB 1BG1A 3KM1A 3AQZA 5DFVC 2MNJB 5IROA 2WW8A 4XPBL 1ZE3C 3VNZA 5TDPA 1L9SA 3DVGA 3WELA 1LEIB 4PWHA 3V0GA 1SHSA 1YMHB 2C7UB 1I9IH 1MCDA 4Q8BA 4MXQD 2OR9L 5C09B 2GY5A 4Y5VA 5I66B 1OGSA 1ZLEA 2AQ3A 2TSAA 3WJLC 3ARFC 2X4PB 4XNZB 1UQSA 5I0YA 3QEQD 3GSNA 3BKCH 3L13A 5F7UA 5E6IB 3KCWA 2ZUXA 5BRZD 1GYVA 2XWTB 2CO3A 1WAEA 4JRYB 2A4ZA 3RIFF 1NGPL 1KGUA 3FFDB 5IB5A 1P1VA 1PZBA 3H55A 4LNRB 1BJ1J 2IAMB 4F7EB 4AEIH 2IQ9H 4PJGF 3MGTA 4GRLC 1NDGB 2V17L 3L17A 4FQLL 3WL9B 4N0CC 3FO2A 4EUPH 2GITA 3NZHL 4WWKC 1ZTXE 4RRPG 3MBEA 1JZ5A 1PLCA 1UZ6F 2X9ZA 4HF5H 1DUZA 4HUXA 4PN6A 2DMKA 1S9XA 3EF4A 1BA9A 1U8OB 1E4XI 1R3LB 4K8RD 4L4TA 1INQA 5IM7A 1M6OB 1M1SA 1QYGL 3IU4H 2HX8A 1A7NH 3OAZK 1TEGA 4W70A 4Z7VA 5EORH 2VIRA 4XC1L 4NQDA 2C9AA 4GAGH 5DC9B 3PGCB 3H0TB 3STZB 4E0RA 1Q1JL 4WWOA 4LVNB 4U1SB 5CUSH 5DD1L 3V4PL 4PJAF 3L9RA 3HUJA 5JHMA 3VM5A 4LHUD 3PDOA 3Q6FB 2IC2A 5AZUA 1RZ8B 2HJFA 2HJKB 4JFQA 1TYRA 2X88A 3ULAB 3NGBB 1NIDA 5FO9B 3TESA 5IZ7A 5C3LD 3GI9L 5J0BA 4MFHA 1CE1H 4KTEH 2F5BH 4Y8AA 4N3TA 3QFJD 3RVTD 2WQ8A 1XGTB 2QHRL 3LRHA 1XSJA 4U33A 3VWKD 4RRPM 2Z7UA 3I75B 3LKOB 1DEDA 4IBUA 5ID1A 3HLAA 5I74C 4QHKI 3L81A 5E8NA 4A7GA 1X9LA 1EEYA 2R8SH 1YRKA 2BP8B 2VDLH 1UM6L 2XQYA 3EOAB 1JWSA 5BS0D 1BXAA 4ZXBB 4HG4K 3L08A 2DF3A 4Z3IA 3G6JE 3ESVF 3OZ9L 3FF7A 3QA3A 4XN7A 5E23A 1WZLA 5DUPH 3HAEB 2OA9A 1JUFB 4PUBH 5AB2A 4MVBD 3CBKB 3ZVVA 1CDJA 2NXZB 4AE0A 4Q9RL 5T1DL 3PJSA 4DKAA 3Q2NA 3CSYB 1HHHB 1UD6A 3HAEH 1UGKA 1U3HA 3H9ZA 2V7NB 3VFSB 1KLUA 4S1RL 2XWEA 3MYJA 4RZKA 5FCUH 1KTRL 1X3DA 3Q9PA 2DJSA 2QR0B 5G55A 2AV7B 4F92B 2WQAA 3CVIH 4ZPTA 5IVOA 4Z23A 1JGUH 1B4TA 1G7HB 1IC1A 5C7XH 2DTMH 3VU1A 4PP2B 1PSKL 3T71A 5EBMB 1E9QA 1JWUB 1YECL 1JHLH 1EJ8A 2MTPA 3QI9D 3TA3A 4NJ9L 4DKFL 1ZK5A 3F58L 4QKTA 3VYNA 3MODL 4NXKA 4PHXA 2BY3A 3LEVH 1FG9C 3QUZB 1MAJA 3BPNC 2C3XA 3EGDA 3HB3B 1ZHBB 2FHBA 3MHZA 5MENB 5KYNA 4TVPH 1KZQA 4OBRA 1L6ZA 5J4MA 4Y0GA 5F3HB 5KYYB 2FO8A 1OK0A 4MMYA 1C7TA 5IBTL 1NBCA 3WENA 3UTTA 2ZSWA 3PNWA 5CZKA 2NXYD 4QIRA 2XFXB 1OSPH 4ODBD 4IJTA 1HXYA 1RUML 5K39A 4B5EA 1IILE 4AMKH 1E6OH 1PVHA 2N0MA 4FAAB 1RCYA 4BCZA 3CHPA 4CADA 2I7OA 3QHZL 1OSZB 2Z0BA 3X13B 2P44B 3WFCL 3ULUC 5DT1H 2X6AA 2YMXL 4TTGA 3HG5A 2CCLA 3U4EB 2H0EA 1OAUL 3QNZB 4PWEA 1INEH 3ZDZB 5E24E 4WDIA 3EFDH 4GT0A 1QATA 4DF9A 4NQVB 4LAQL 4PY8I 4ZMLA 3VGHA 1GOGA 5J11B 5T5FA 1ES0B 2E3VA 3C2SA 3QHFH 1U8LA 2FSEA 2QSCL 5CXPA 5K9JH 2ZAHA 1MW2A 2PTVA 2DJUA 1NCCL 4O2CB 2FD6L 4DQOH 2HKAA 2WBWB 4TQHA 3DHMA 3NH7H 1USQA 1A6ZA 2VE6B 3OXRA 3U4AA 4YHML 1A14H 4AH2A 3I6KB 5E6YA 3O2VH 2AAVA 4Y2OB 3VFPA 4YL4A 5FGCB 4ZMZA 3NIGF 4L8SC 3CFBB 3VXRD 3OKKA 1EFXB 2D3NA 4ZQKA 1T7YA 3SE4C 5ANMA 3PCYA 1AGDB 3BO8B 4PRIB 1QSFA 5FEBA 1UHVA 3GSVB 5F9JA 3TIEA 4DFIA 1CK0L 1B2YA 1S6NA 1CXEA 3KYOA 3MUHL 3TU6A 2PWFA 4NNXA 3W0WD 3M46A 4XCEA 1NJ9B 4OY9A 1LEIA 3KL0A 1T5WA 2DLFL 2H6PB 1FC1A 4WSKA 4OD2B 2QADC 5EEXA 4M4PA 2DLTA 3N43F 1A66A 2PTTB 4YSSA 1AD0B 4N0RA 1T7VA 3ZKSD 2E9BA 2XZQH 4O00A 3I6LE 2ESVA 1M71A 2R4SL 3DOSB 4FA8A 2FZ3B 4EZKA 5TF1L 1L0PA 5AZ2L 3F64A 2I25N 3GXDA 1ASOA 4PJ8A 4S2SA 4NRYB 1ZLUH 2J6EL 5EWIL 3VFVB 1OL0A 2AK1L 3ARGC 43CAA 4BJLA 3B2XA 2QZQA 4YFDB 3ENEA 1ETB1 1T0NB 1XZ0B 3VFGH 4LLAA 4W81A 3MUJA 2NSXA 2DKUA 4HH8A 2OR7A 4PW9A 3FT3A 4G8EA 4QRUA 4R2GC 4ZX3A 5T1MB 5GS0C 2XV6B 4QWWC 5T1LD 5MI0B 4WU5A 3RFZB 3FYIB 4M3HA 4NN7C 4MNHB 4G9FB 2OYLA 1MN4A 1UD8A 5E70A 2ZPKL 3GSRA 4ZZKA 1RLWA 2B3RA 2XVLA 1ZY9A 2APVA 4Z77B 1Q0YH 1U3HD 2GUOB 4FXGA 5EO0A 1V3KA 4EVNB 5HDBB 2LABA 2GVYA 3PRZA 4A2DA 2IV9A 1BZ8A 3VFRB 4O02A 1PMYA 1TQCB 3NZUA 5FYLD 1WO2A 5ALBH 3C60B 5EBLB 1D5ZB 3DYMA 4M62L 4AK1A 2X6UA 2YKKA 3HJ0A 3LRKA 4WU7A 4Y4KC 3H7LA 1GW6A 5EZJA 3AG1B 3D39E 5EZLB 1V3JA 1WIPA 4DAGH 1NKRA 1NINA 1NSNL 3WY1A 3IAGC 4OLEA 4DCQA 3KBEA 1PJ9A 3CSTA 4JPQA 4OZGE 3AUWB 3O3EA 1MCWW 3LPFA 3OGOE 4NUJB 3DGDA 4APXB 2OYMA 2XWDA 2RD0A 4A6YH 1QABA 3KVPA 3FT4A 1CDGA 2DYSB 4WFEE 3QAZB 3T6ZA 2E5EA 4EBQH 3BXNA 3L9BA 4XCNA 5LLIC 1L6XA 1JPFA 1QVOB 4X9GA 5FO8A 2FR4B 1EVTC 3I3BA 4HFUH 4HG4J 4RISL 5B4MC 2FJGB 4K73A 4NQCD 2NT0A 4K9EH 3AAZB 1TZAA 3KCPB 2R56L 5B39B 3FB7A 3K5SA 3O0RL 4NKIH 2BZDA 2DQCL 2QSTA 1T21A 2YMOA 2EDRA 3C09C 1YUKB 5EU6A 5I15L 3MA9L 5INDB 3NZ8B 4XRCA 2K6YA 3CFTA 1A8ZA 2OBGA 5C3TA 3GSOA 1OQXA 3VB8A 4KZDH 1ICTA 4ONOA 1TVHB 2JB6A 3CH8A 3ZTCC 5DEFA 3WNLA 4ATWA 2AHIA 3WFHA 1JCKA 5H4YA 4MNGA 1PY9A 5C0IA 2AP2A 3HE7B 1F45A 4OCWH 1AGCB 3H85A 3GMMB 1FNHA 1GPOH 5GGRA 5E6SB 1U2YA 5DWUL 4M6NH 4OLZL 5MEPB 3FFCD 3BQUD 3D12B 4YSDA 5FLUA 3QP3A 4LASH 2CDFB 3KYNA 3E8UH 1CE1L 4IRSB 3QJXA 5I75C 4OZHF 1N59A 4D9QE 3GO1H 1IEAB 4BA0A 4GO6B 5H8DA 4AGQA 3MLPA 2D3VA 3EJZC 1JV2B 2OXHB 2ATKB 4Z7WA 4UOZA 1A9EB 4AZ8B 1UB5B 1AIFB 4APQC 4H1LH 5FYJH 1ORQB 4XBGA 4XE5B 2B1HL 2CBPA 4HIEB 5CCHE 3KBPA 2HPTA 3DUUB 4NYLB 3SGEI 2V5RA 3U6XA 3K72A 4L2YA 6FABH 3C5ZD 4LBEA 4X7EC 1M2OA 5E5MA 3TN0B 2F53E 3FB6A 4KXAA 4PTUA 2IJ0C 1CF8H 4OLYH 5FKAA 3EZ8A 3KLSA 5CBAB 3FB6B 4PTUB 1DVSA 3NA9L 4G11A 3KNBA 3N85L 1CMOA 2QVIA 5T3XH 3LKPB 4EI5A 3LQAL 1NFDF 2MEJB 2A0LD 3L1GA 4NQDD 5DJYA 2YQBA 1Q0XH 4BSVA 2D4FA 2L7UA 3KEHA 1KNOA 3F6IA 1P5UB 3TM6A 1L0YA 4IW4C 4XMKH 5B38G 2Y5QA 5E2VL 2WBJC 2UYLA 5EZLA 4HEPA 2B5IB 4IKJA 5I1AA 2X5PA 3GBNL 3DURA 4YDJA 1ZGLB 1UD2A 3QJVB 4XZUA 1HSAA 2VDQL 2E56A 1D9KB 3TEUA 3ARFA 1ZSHA 4XCYB 4ICWA 4XC1H 2YXVA 2Z64C 3EYVB 3HMWH 3E6HA 3QR2A 4G8GE 3UIYA 1DFXA 1CICB 1J9TA 1NSNH 1KGCD 3Q2VA 3TZVB 4L1TA 5J1TC 3EJSA 5DHXB 1FFOA 1KIRA 1DBJH 3HG2A 4MJJA 1CD1A 4OCMC 4P4KC 2B1AL 5AW3B 3WUWB 4BIKA 4AUUA 3T6QC 2OZ4L 5FHAH 3GZOA 1VEPA 1SLUA 3PWPA 4XN9A 3H6JA 1NGWA 1UT1A 3R1GL 4BZ1H 2Z4QB 3ZQWA 2J1KA 1E6JH 4KTEL 2X2IA 1II4E 1BM3L 2WLIA 2R0ZL 1KYUA 4RDQG 3LN9A 4S1QL 5H35B 4EI6B 3B5TA 4PBDA 3ZE1F 3GTVA 1A4JB 3V6FA 4EN3D 4R96B 4AV0A 2NY5L 1IBYA 5IIEB 3OAUH 5CCJA 5E0QA 2HWZH 2Y2TA 1VAHA 4LPXA 3VXUD 3PP3H 2YMXH 1ZMYA 5DFTA 2OAAA 3NFNA 5DJ6A 4DTGL 5C2BL 4G1MB 1OAQH 1XGZA 2CGYA 4OFYA 1OB1B 3V4UH 3IJEB 3SJVD 3EH2A 1U42A 3GNML 1SXSA 1T7XA 2FJHA 3UCQA 3EYUH 3I9AA 3U48A 2ADGB 4KFZC 3RKPA 5I0DA 1L9OA 3BKYH 3EGSB 2DH3A 1J9QA 2ZXAA 4JPVL 1WFIA 1PKOA 1RZKL 3S3CB 2XBZA 1A7RH 2Z7ZA 1S46A 3AW5A 4NQDE 3VRLF 5K1NA 4ZUVA 4YSEA 3VSTA 5ADPL 4CN6A 3HS0B 3V4VB 1QEWA 3SY0A 3I6GB 4N8VB 4S0HA 4DQAA 5L8LB 2WTRA 1CU4L 2YMTA 3E1ZA 3S2CA 4H0GA 3WKQA 3ZKXC 5KVDH 1SJXA 2QGBA 4TQIA 3Q2CA 5A7BA 2Y07L 3FHAA 4XPHH 3MRHB 1HZHL 1D7CA 1EO7A 4AYID 2O5ZH 2MPVA 3K4AA 3SGKC 2IVFC 3IFLL 4MA1C 3RWIB 2D4DA 4JFVA 4NUQA 2V4LA 2YEZB 2HFFB 3BP5A 3QXAB 2BNRA 4FULA 1JWMA 3QWOB 3L3HA 2VUOA 5KVGH 5FK9B 1BCIA 2F2HA 2HLEB 2OI9B 5I28A 5JIDA 2XTJD 4G6AC 5F1IA 3HMXL 3QUMH 3QRGL 1EUUA 3L3GA 4LLVB 3K3QA 5J3HC 5DUJA 1J1PL 5KVEE 1D5BA 2YJLA 5EPMB 5KANG 1QOKA 3CN3A 4BFIA 4X8XA 5BO1H 5JO5B 1ZGLM 2DEYX 3AUVA 3D4ZA 4LVEA 4UV7L 1GIGL 4FNPA 3V9CA 4D94A 3O6FC 1WIOA 2ZYHA 1UOLA 4MS8D 1QACA 2VZVA 3QUXD 2Y69B 1E6OL 4PQXA 5I1HH 2IFGA 3O3BB 2MKLC 5FKPA 5B39A 3WOVA 3PQYA 3VSUA 1B4LA 1OZUA 3B2VL 3K2UL 2O5YL 1OP5H 4KQ0A 3O6KL 4PJ9D 5I19H 3RYMA 2VL5B 2VXQH 2DTSA 2V9RA 2QKIA 3DC0A 3QA3B 2X4QB 2M83A 1FZKA 4PJDB 2DDQH 5BZXA 4P46B 4DJMA 3P3UA 1KDIA 5IFAH 3ZU8A 1G7JA 3BJLA 2W1NA 1D5MB 2NR6C 2QPEB 3IF1A 1EAOA 3PJSB 4OGYH 3U0PA 1I85A 4NC1C 4KO6A 4DZ8A 2SEBB 1F11A 4UDUB 1P4UA 5AVUB 3TBTA 1WZ1L 4FL4B 1IBDA 1CLYH 1NDTA 1R3JB 4KH9A 4QRSA 4G6FD 5GGRB 1CFVL 25C8H 4CMMA 1FIGL 3FL7A 3BGMA 4HHAA 5DRWA 4W4OC 2QADD 2WNXA 4JHBA 1LO5B 3KPSD 3BAEL 2NW3A 5C0JB 2R0ZH 3TNNA 1NEZG 1KYAA 2WJ5A 1FL3B 2WWMC 1D5XB 1SRDA 3KWTA 4F57H 5AAWA 5IK3A 2IBGA 3ARYA 3ZL4H 2P8PB 2DL9A 3QUZA 4IKNA 2F1BA 3HRZA 4KROC 3VB9A 1EDHA 2R0KH 4B97A 1MFCL 3LMJL 4EMZA 3FO0L 4I0PD 1Q9KA 4OTXL 1H3XA 2BVYA 1WQVT 3JT0A 1BFVH 4P2OD 4C4KO 1X5ZA 3ZOAA 3NCBB 1JD9A 1HAWA 1KIUA 1YHPA 4KBPA 3MV8A 3P77B 2KUTA 1KIUB 3V6ZB 1KV7A 2ICEA 1CFTA 3WTXA 1ETZA 4JRLA 1B6UA 3SDXB 3IYLW 3FQTB 5L9DL 1DUYB 2FATL 3BD4A 2CA4A 1Z5LB 5C9JB 2JKWA 2IPKA 1DUYA 1JI2A 1BPVA 2OQJA 4JKNA 2P9RA 4IRJC 4PTTA 3T8VA 4KKZA 3U2SA 3T2NL 1H8LA 2UZYB 2LW3A 1KXTA 2WIIA 4FCAA 4HPOL 7FABL 1X6NA 2YO3A 4Y4KA 4MCZB 4JR9H 5F1IB 1UA6L 2NCEA 5FDWA 5HBBA 2X28A 3QZMA 3DX3A 5ID1B 5IHUL 4IJ3B 2NYYC 5B1JA 2WO3B 2ZF8A 3WTYA 5INCA 3WMPA 3QHTC 4P23D 4OSUL 4FXTA 3RU8H 1NC2A 4IBVA 1B0GA 3HNVL 4IDJH 3ISWA 1S7XB 1T4KA 3BH8A 4GSDH 1OXYA 1TVDA 3U1SL 1M7DB 3PV6B 3DNKA 2PR9A 4I3SL 3UGUA 2JJSC 1N3NA 2PCPA 4GG6B 3CN4A 3ZMEA 3I6LD 2WC7A 4YIQA 4OIIH 4B9FA 3TO4C 3CH1A 5JDSB 4XGZB 2AEPL 4N2HA 2QV2A 4NO2A 1FZKB 1KTCA 1SHWA 2JLPA 1L9NA 2XVBA 3EHBB 5DC4B 3O8XD 4U0RC 5EUOB 1G7JB 1ZLWH 3WNPA 4JCMA 4PGCB 2W8CA 3RWJB 1MHPH 4I3GA 3S36X 3U0PB 4UCFA 1RPQA 3NIDF 4HU8A 5EU6D 5F71A 4A6YL 4U3HA 2BHFA 1QA9A 3SE8H 2HKHH 5CSZA 2OMBA 2H2SD 4JFOA 4LEOA 5DJ6B 4JLRB 1GYUA 5FGBA 4TUKL 5BVPL 1TSHA 1MCCA 2HUEA 1MJUL 1HCZA 3TC9A 3QXDA 4LEOB 4D9RD 4JRXA 3UO1H 2KPWA 1LM8V 2WMPA 3LQAH 2C9SA 4MJ6B 1D6EB 1MHCA 2G9KA 2OSYA 4JHVA 3N43B 4K2UL 1CFVH 1ZVHA 2NW2A 2Q3AA 3GGWA 2WZPD 1S8DA 3DRTA 3KR3H 3OKYA 2I5YL 1OY3B 1TSRA 3DVIA 4YH6A 3K6FA 2D7TL 3BRFA 4PJ5B 4LU5L 1JZ6A 5J1AB 4PJIB 4RA0C 5D5MA 1R3IH 7CGTA 5AVQB 1A4KB 1ZRUA 3WFEL 4QOKD 3SDYH 5CEZE 3KGTA 4WUUD 4HT1H 4PJCF 3BZ4A 4JDEA 3IU3A 2CM6A 4U6YA 1XV8A 4L1BA 3ZHKA 5HGHB 1OPOA 1QASA 5FO7A 1FYHB 2CKBA 2NQ3A 2XOTA 1X9RA 2L7EA 3OZLA 4PRHB 4Q0XL 3SCMB 1GYAA 3DO7A 3MKGA 2PXYD 1BAFL 1RZFH 4QCIA 5HJGA 3UJTL 2NXYC 3V6ZA 5EIQA 3QNXA 3TEWA 3IMVA 4OM0H 5C07E 3UJJH 4YDLC 3IT8D 5AVXB 4L8CB 3HVNA 4JY5L 1BVLB 2ZYRA 4XVTL 2FBJL 3H6AA 3AT0A 3U2SB 4NP4H 3UP1A 5DHEA 3BEWB 5D4QA 1WITA 4Z3JA 4XI5D 1J9RA 1GYCA 2IANE 3ULUH 2CDEA 3US0A 1S7UB 2V3EA 2LFEA 3C6LA 4I48B 1J11A 1ZSDA 3RGVA 4XX5A 1FLTX 1KJ2L 2EADA 5FECB 5KBLA 2HLAB 4NO0D 1VB9A 4OLVH 1TOXA 3MJ9A 4ENED 2ADJB 2XWJA 3OHXC 2VDPH 4HU2A 2EIEA 4HIHA 4UM9D 1A5FH 1N64H 5HI4D 2VZ3A 1TMCB 3QQ4A 2X4QA 1JZJA 5D55A 5KJRL 3W56A 4ERSL 2QQLL 3GSNH 4IGBC 1NCAH 3HN8A 1BZQK 1R5VB 4OB5L 5SWZD 2KLSA 4YDKH 1H5BB 4WNQA 5IHZA 5AYTA 3U9UB 4FFZH 4MQSB 4DVRH 1WSST 2X10A 4BHUI 4AEHL 4R0LA 3BKJH 5F9WB 4QRRA 1DVFA 3VG9B 4G7YH 2DQEH 2XV2A 3W82A 3ETSA 1B88A 5JPNC 3IFNH 1WLHA 4C4KT 3MMEA 4XAKD 2AXHA 3U0TA 4APQD 2QZ5A 3JUYA 4G5AA 4J3OD 2B2XL 1HQRA 2UXVA 4XPBH 2EYSA 2HP4A 2R69A 3SDCC 2I9LA 1UVQA 3S88L 5DRNB 4HKJB 4P23B 2NY1C 4X6CF 1CD8A 4XH2A 5KVGL 2IAMD 5FOBB 3GQFA 1J10A 1EHKB 1ZKAA 3OAZH 3HZKA 4ZFFB 4FFYH 1O6TA 4JRYD 2NPLX 3LJ3A 4HUCA 4TV3A 1OARH 2P1YA 4PLKD 4PJEF 3QPQC 1BLIA 2LOEA 4ONHB 5BV7L 1AP2B 1L7TH 3CZNA 5I30L 4FS0A 2IDSA 4WAFA 1HE7A 5I16A 4RMWA 1Z5HA 1OE2A 2JCCB 1A6TA 4M1CD 3P4MA 1C9SA 5E8DL 3KHOA 5ES4B 3L8QA 3OX8A 4CSSA 3RB7A 4F37K 4D9LH 1J86A 4NBXB 3LKRB 2NUPB 5L2KA 5IBUB 1C1EH 4PJGB 3E80A