3ZTDC

Pvhl54-213-elob-eloc complex _ methyl 4-(((2s,4r)-4-hydroxy-1-(2-(3- methylisoxazol-5-yl)acetyl)pyrrolidine-2-carboxamido)methyl)benzoate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
139
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 139
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3ztdC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3ztdC01
1LM8V 4W9FC 3ZTDC 4W9HC 4BKTC 1VCBC 3ZTCC 4W9JC 4W9IC 4W9GC 4AJYV 4B9KC 4W9CC 4B95C 4W9EC 4W9KC 3ZUNC 5LLIC 4WQOA 4W9DC 3ZRCC 4AWJC 1LQBC 4W9LC 3ZRFC 4BKSC
chains in the Genus database with same CATH superfamily
2WUBL 1KZQA 1MREL 2GTWA 3H56A 4JZNA 1PD6A 3KLSA 4CVXB 1JNJA 5D7JB 1KJ3H 2Q76A 2WCGA 4XN5A 4Q9RH 4BSWB 4WI7A 5EOCH 1MVUA 1TOXA 1LDSA 4CMMB 5CEXA 4XMTA 2EVGA 1I7TB 3IDYB 4YWGL 3N43B 2VLRB 3DETC 2KERA 3PYCA 2K3TA 1WZKA 2J2ZA 5CEZE 5K1NA 4QRRA 5KZCB 1KPRB 1XTMA 4JPIA 4X0NA 1HI6A 5JUEH 2HB0A 2WXQA 1JGVL 3I50H 2K78A 4F1SA 1V3LA 1RZKL 2Q86B 5T3XH 5C0CB 1TZIA 4QMEA 4WFHD 1NOLA 5DD6A 1ITCA 3A4AA 3QPQD 2YPKA 4JVPA 3N1FC 4OLZL 3W37A 3X14A 4O58L 2OYLA 4GKNA 4NNXA 5EZLB 3LEXB 4JPVH 4Z0BL 4H20L 4DIXA 3P4OA 1MAKA 1SJHB 3P2TA 4IIZA 5I1EL 1PZ5A 1F4WH 1OT4A 5LAXB 3MLSH 4JB9L 3RZWA 4UTBL 3I6KA 3PGCB 3ECVA 4NO0D 3QJFB 4HAKA 5EIVA 1VJSA 3F58H 2HA1A 3HUJF 3ES6B 2W95A 2MPAH 3NIGB 2B4CL 2CIKA 2HKAA 3KVDD 2C7UA 3MUY1 3VU1A 1ZPUA 5JZ7C 1SBSL 1M7IA 1YEEH 4KOBA 4I3RL 4OR1A 1G0YR 1AZZC 3FZUD 2NY3B 2NLJA 3QEQA 3MREA 4R4ND 1S7TA 3LKPA 3BI9X 3TN0C 2VZSA 5D71L 4XRCA 3BP4B 1OAUH 3QFJA 2XG4A 3CLEH 4OB5L 5CGMA 3BCDA 5IT2H 1T4KB 2D2OA 5CJOH 4KRMB 3GK8L 3S34H 2G60H 4L8CB 1S7RA 5IEHB 1S5IL 2FAUA 2N59A 4YZFF 5HY9B 2YEZA 3UZVA 3PNWB 5AVWB 4PFEA 1FE8H 2DQIL 4HF5L 2I9TB 5JPMC 1T0OA 4WWNA 2WXOA 3U1PA 1RVFH 4N0UA 2Z7WA 3FT4B 3HAEH 3CZKA 1PBYA 2BXYA 2X0WA 1UM5L 3F64A 2HTKD 3KYMB 1BJ1H 2ALWA 1WITA 2X9ZA 1JUFB 2YBRA 2YXFA 1J0ZA 3N42B 3QS3A 4H44C 3E80A 4JGUA 4XZUA 5KOVC 3TYGL 5F3BA 3W39B 4NQCE 5IJKC 1KXQE 4JM4H 3QPQC 4HIIA 1T7XA 4YHPB 2AXJA 2IMNA 1N64H 3Q7JA 3P9LA 5LCVL 2KPNA 4QYOB 3PJNA 1T0MB 5JDJA 3AZUA 3CFDB 1ZLWK 5JW4M 3D9AH 1JP5A 1KV3A 1R33A 4P23B 4KK5C 4BFIB 1H6EA 3GRWA 1D5RA 3C5SB 3APNA 4K7PL 4Q9QH 1I1AC 2Y3AA 2BWIA 1EO5A 4Z78A 4M8UA 5F7FA 4FYTA 4AYEC 4YGAB 1ULVA 3NVQA 1PKOA 1DVTA 5FHBH 3VFVA 4JFEA 4AEIH 1JMXA 1MJUH 1I7ZA 3VGHA 1GIGL 3O11A 4DOHB 1XXFC 1ZIBA 1IAOB 1XEDA 4UQEA 5E6IA 3ZTDC 2G3XA 3CFBA 3SGDH 1GYUA 1QA9A 1U8IA 3FZUC 4NFDA 5ESQA 2CA3A 3LZFH 3BP6A 1DVQA 4PSRA 2W8CA 5TDPB 3UAAA 1N7ML 2JJSC 2WQUA 4GAJL 1QBMH 5DR5L 5JPMB 3NBNA 3GZPA 2DKSA 1FGNL 4WSJA 3QO0B 4ANWA 1R24A 1D9KA 3DSNA 4URTB 2M8XA 1AHWA 1C1EL 3CG8A 5IFAH 3ULVF 4DH2A 2VUYA 1JPFA 3OLDA 4EZMA 2GSIB 4NENA 4CC0A 5IQ9B 1XH3A 4QGYA 4ZTPH 4R5VA 3UROR 2HTKC 1JIBA 1OE3A 1ZDSA 1BF5A 2P46B 1GZHA 4X83A 1JI1A 1JZFA 4PJAF 2MQCA 2RIKA 3PQYE 5EEUA 2DQGL 1BW8A 4ZXBD 4NO0B 4E9WA 2VC2H 3ALWA 2ZOOA 5I5RA 4WWPA 1KCVL 1ZLVH 4AC4A 1C8QA 2FJSA 4UT6H 3PREA 4Z3GA 1U8NB 4NUQA 1P7HL 2IAAC 4JPQA 3EYOB 3CLFL 3S2AA 5CILH 3ABZA 3B9KD 3OMAB 3OG6B 3E38A 4HWZA 4WY7H 5GS1A 3QJUB 2UWEE 3QS2A 5JW5B 5HHPB 4FAAB 4D7PA 1UOLA 4OZIA 1IGMH 1Y7VA 4AM0B 1Q0YH 1BJMA 2MSPA 5MEQA 4HZ1A 1NGXA 4BZ1A 3NG5A 3ZDXF 1RIUL 5BUPA 3LTVA 5GSVB 2YRZA 2WZ0A 3UJIH 3AY4A 4UU9B 3FO2B 1UA6L 4Y2DD 5IIEA 5I0YA 2G2RA 3ZJAA 3GIZL 4HKZB 4X8JB 4F2MA 3EH1A 1BIIB 4NNPH 4WKXA 3WN5B 3T1FB 5HGBA 2GBVA 5C6TL 2X4PA 2XDHA 3IU4L 5FA4B 3NAAH 3VGBA 4HXBL 2NNAB 4X6EA 4LGPB 3W0WE 2F74B 1DFBL 2WTRA 1OW0C 3O45B 2Y23A 3QNZB 1GGTA 4JDTH 3FTUA 4G11A 3CHQA 3W9EA 4QEGA 4IHBA 4DKEL 5EORL 3TL5A 3CZSA 4MD0A 1WT5C 3KLQA 3PAYA 3JWDC 1YEJH 1EDHA 4M9PA 4ZXBC 3JT0A 3TYFB 4MSWB 1DUYB 4P06A 4N8PA 3IJYA 1JV2B 2VN4A 4HHGA 4OIIH 4OJAA 4TQ8A 3NCCB 4HUXB 3U1SL 5JA9A 2UY7B 2F53A 5G4NA 1EJOH 1OCWL 3VFGL 2QQLH 5L2JA 3MN8A 2RMNA 4EVNA 4PJFB 3WG7B 1G87A 4DCQB 1TYRA 4JQXC 4KY2A 2LQRA 1J8HD 4TV3A 1CO1A 2A74C 1TLMA 1N8ZA 1AQKH 1ZT7A 3A22A 1NBYB 3PHSA 3UBFA 1DE4B 5FECA 4JFHE 5DRWB 3Q06A 2UZIL 4GMTH 3A5VA 4CVWA 5L0QC 3S88L 5CZXC 3MV9D 3ML9A 4IBVA 5DFAA 1HILA 2VW6A 2VERN 4QRUB 4KO7A 3T3PF 3AJ7A 3AMLA 1KT2A 4KUCF 4ANKA 2BVTA 1HEZA 2PCYA 4LCCC 3QORC 3KZ8A 4S1RL 1UM6L 2Y7OA 3PIQA 4TUOB 5AKTA 5KBDA 2Q3AA 4Y2DC 3EJZC 5JR1H 1LGVA 2IXQB 1KJ2H 1BXVA 1J1XH 1KYDA 2VDOH 1XF5B 2E7DA 5I19L 3ZYIA 1S9VA 2Q8BL 4XMWA 1RFDH 1KYOJ 4MB5A 1FNEB 3JVGA 2AJYH 4UOW0 5F9JB 3TS8A 1V27A 1T1ZB 3TV8A 4ZXBB 4GXUN 5I26A 4PGZA 1J0KA 4EJ1C 1IAMA 1W8NA 2FJHA 5AW0B 3MV8E 3WTYA 2EDBA 1PQZB 4YGVA 5D8JL 4FTVE 3H0TA 1LNUB 4G7YH 4FI8A 1MZZA 4LSPL 4ZMLA 4I0KA 4I5BB 1A3ZA 1COBA 1E4KA 5EG6C 3B9KB 4PTUB 2PW1B 3B5TA 1LWHA 1LP9B 4JCLA 4K3DH 2Y1YA 4PJBF 5LBSH 4X5WA 3WIIH 5C0DA 1E7UA 1U3HC 5D7IF 3U46A 1A7OL 4NQTA 2A74B 4EF3A 2OI9C 1HHJB 1MJJA 5L0QB 1EO8L 3UCRA 4N2KA 5IHZB 3N40F 1QD0A 3OR6A 3ZRSA 2ZSWA 1AIFA 4HGKC 3EGDA 5KYWB 5BZWA 1OT1A 1GC1H 2QGEA 1MY7A 3ARQA 4Y2DB 1F4YL 4ZPTB 3QYMA 1KGCD 1NZRA 1MCBA 1JXJA 2EXWD 4CAGA 1IAIL 3P3UA 5KSAC 2W88A 4QRRD 4YBQC 4LEXL 4FULA 4M8VA 2R8SH 5BQ7B 5CLWA 1FNAA 2XBDA 4W68A 2E7LA 4L0ZA 4NGHL 1KIPB 2EUXA 4GKOA 4HS3A 3TA3C 5GGTA 4BFOA 5FFOA 2QDWA 3L5IA 2DW5A 3JWOH 1U0QA 4YDVB 5D1XA 1ZLVK 3K71A 4JKWA 3DVGA 5KS9A 1WUNT 3ALPA 4KI1A 1KBWA 4G6FD 3CPUA 4F57L 5I0DA 4M56A 2YRLA 5D7IA 1A7RH 1IFHL 2UVFA 4L3EE 4MNQE 1TJHL 4R83A 5PAZA 4K3JH 4WHYG 4QT5A 3RA7H 1F4XH 2N01B 2HKFH 3T4YA 3FO9A 5JIIA 4IRZL 4Y2OB 3MSPA 5EUKB 2ESVA 3T4AA 3WFBH 4A7UA 4UTAA 4G7SB 5F44A 3MGOA 1ASQA 3V5HA 4J3SA 1PZUB 2DWYA 3SQBB 1O7SA 1CDIA 1E43A 3BP7A 5D1ZA 3F7YB 2UX7A 1SZNA 3ZDZE 1CBVL 3GB7B 1CFMA 1IKNA 3QIWA 3DTUB 1UACH 1P4IL 1NAMA 4H1LG 3V0WL 4HGWA 3BAKA 2H3KA 1J8HB 4GOSA 2XWTB 5C07E 3FOMB 4J3OG 4XXCC 4UDTB 4U33A 4CBZA 3O4LE 1GXEA 2F5BH 3MV9B 1KEGH 5DVLA 3MKGA 3QFJD 2I27N 5SX4I 2BRRL 4JDVA 2ICWB 2NNCA 1JZ7A 4PRHA 5FYLD 3U4BL 3F8UB 4LE8A 4ODXB 2BRQA 4ABWA 4B3EA 1M3JA 5F9OH 2EXWC 2GK0B 1ZTXL 3CDCA 4FABH 3BKCH 4FQXA 3B1UA 1CGVA 3FULA 3I3EA 3Q8BA 3HFFA 5DXWA 1GKOA 4P2QD 3GGWA 3FUMA 4I48A 1KF9B 5C0BE 1L9SA 5ADPL 5KSUB 3U83A 3RFZA 2VLLB 4LCWA 4NKDA 4AG4H 4F9PA 1GTNA 3S48A 2VMFA 4ZRGA 3S3BB 4FKEA 3RU8L 3MRIB 3FKUS 4ZTOH 3Q6GH 2OBGA 3B2PA 4ODUB 4EBQH 5FYJD 4OZ4A 2FO4B 4EI0A 1E27B 3FJTA 1TQSA 4R90H 3C8KA 1V05A 4MDJA 3LN9A 4O4YH 1VGEH 4P2RA 5EO9B 4UM9A 4GEIA 3BKYH 4NPJA 2R4SH 2HFGH 3KYAA 1HINL 2BNRD 2P43B 3KPSE 4L29B 3F01A 3QWRA 3G3LA 1GJIA 2D03L 3DTDA 1L6ZA 2FNWA 2WXGA 5D4JA 4B5ZA 4OM0H 2KYIA 3N41B 4FNUA 3OR7A 4KY1H 2YSSB 1J18A 3C5JA 4ODSL 3EXJA 2V8MA 4GS7B 1I8IB 3VD5A 4JFED 2GTWB 3HG2A 4JZNB 3OXRA 4PP1D 4U1HA 4LPUA 2Q76B 1OK8A 3K0YA 2NY5L 2D0GA 5C1MB 1UYWH 4PBWD 4NLAA 5CEXB 4NRXA 5E6ID 2XACC 5D1QA 1AD0A 2FCBA 4JHAL 5JHMA 1M7XA 4MFHA 4UBDD 4IKJA 5GGVL 1NOFA 2XFXA 4AIOA 5LN8A 3SOBL 2OJEA 2J2ZB 2ICES 4DNLA 5I1LA 4QUOA 3TBYA 3AQXA 2PKDA 3MBXL 4QRRB 4AV0A 1JPEA 1CR9H 3K2UL 1JE6A 5AKSA 3D18A 5I5MA 1P4LA 1XF4B 2CNZA 4RVBA 4Q14A 1D9KD 2DIJA 2DIEA 1TZIB 4NHUA 4BWTA 1EFQA 5DD6B 5IR1A 3TFKC 4J8RA 2YPKB 1YNTF 5F3HA 3DHMA 3MBWA 1AS6A 4G6FB 4RGMC 3X14B 2NYZA 3WFZA 1NUDA 1C5CH 3BD5A 3P4OB 2A9NH 2F68X 4DGVH 1EH9A 4L3FA 1QYGL 2AEPL 1R9FA 1PZ5B 4K7FA 2H32A 2JCCF 3OPZH 3V8CA 3KPNA 4JS7A 3KR3H 2WLJA 2D7NA 1JF5A 1FLTX 3DX6A 2QFPA 4JKKA 4YXKH 3I6KB 3IGKA 5TF1L 2RTTA 2ZXCA 5FYJL 5GS3A 1JZ4A 2Z8RA 4MCYA 3NZHH 2C7UB 1TEFA 2GKIA 4XB7A 1M7IB 2YUWA 5CSZA 4PSPA 1L9NA 3TPUB 4ZPVA 1BM3H 4HJUA 5F3FA 1VPOL 3QEQB 1A9EA 2NLJB 5D2NA 5HGGS 4A2MA 1S7TB 3UBXG 3TVMA 1RULH 3BDYL 5ICXA 3RWFA 1XGZA 3BSHA 3H2WA 3AU1B 3QFJB 3RHWF 4PP1C 3MQIA 1KCWA 5I1GH 1PF3A 1QQDA 3D6GA 3NCJH 5T3XD 4LB8A 1KGXA 3RGBA 1XDTT 3D12B 5E6IC 1YEGH 1S7RB 2VIRA 2YA1A 4UBDC 2HWZL 5L9DH 2YEZB 3MRJB 3UZVB 2OZ4L 5TDOA 4OTXL 2XZCL 4LFHD 4FERA 2K45A 3U36A 3K80A 4N0UB 4BUGA 5IZ7A 3HC3H 4X7DC 4CSPA 2B7DT 3NACH 2AC0A 4MAUH 4N5ED 2YAMA 3L9EA 2H9GA 4N8CL 3UO1H 1NSNH 2YBRB 2XXGA 1D9KC 1THCA 3W1ZA 4XZUB 5F3BB 2WO2B 2RBLA 2WLZA 4X9FA 1AHWC 2JLPA 5E9AA 4AYFA 4RMUA 5F0JB 1LDPH 1RUAL 1XL4A 3B2VH 4XBEH 5BPPA 4HJGA 1MFEL 4GUOA 3LXUX 2B1AL 2BNRB 5KBKA 2NUTA 1V7NH 4OCNC 1GZHC 4ELKA 1U8PB 1UM4H 4OW6A 5GRUH 1KNOA 5LQBL 1YQVL 4Z78B 1MPAL 3D4ZA 1DBBH 1QZNA 4QXGL 5L4IA 4WK0B 3MZGB 1BZQK 3KVPA 3K6SB 2PN5A 1YJDH 2CKNA 4GAGH 3VFVB 1E30A 4AWJC 4JFEB 1AR2A 2HZHA 4R26H 2F53D 4HUVB 1PKQA 1I7ZB 3LB6D 2HFEA 2XY2A 2ADJA 4DP2X 1HOCA 1W2KT 1KJ3L 1E3XA 5E6IB 4EAEA 3L2NA 3BQUA 3CFBB 5BXFB 1QA9B 1U8IB 5EOCL 5GS1C 4RH4A 3MXVL 3GMQA 3QDGE 3AROA 3ULVC 2NMSA 3NA9H 1KJVA 2BNQE 3HKFA 1BSIA 4Y19E 3VVVA 5JUEL 4YNYB 5I82A 4KRLB 5DHEA 3HNVH 2HVKA 1R24B 1D9KB 1RJLB 3DSNB 4IJ3C 1BVKA 3GXPA 1AHWB 4FI7A 1JS4A 3NFPB 5T3XL 3AY4C 1ZA3B 1KN4L 4PBDA 3RNKA 4NENB 4KV5F 3BVDB 2OYMA 4EEEA 1HT6A 3MJ8A 1TPXB 1XH3B 3WV0A 3DBSA 5TPWH 1JYXA 4JPVL 4ZX6A 3O6FA 3COOA 2F0CA 3H6JA 4CL7A 1T04A 1NBQA 3MYZA 2WLKA 1ZV9A 4QJ3B 1F4WL 2ZOKA 3MLSL 1AO7E 1I3VA 3ZDYE 5A7BA 4IBUA 5DI8B 3W82A 3OX8A 1AQ8A 1RZJC 3VQ2C 5IQ7L 3QAQA 3F58L 4YSUA 1UVQA 4GO6B 4TLKA 2MPAL 1KTRL 3RWHB 2Z7UA 5I0VA 1RHFA 2WHVA 4LP8A 3T6WA 3HTLX 3J07A 1GGIH 5ADOH 1A6PA 4J3UA 1YEEL 3L48A 4ELMF 4HWZB 3LVTA 4PY8I 2HMID 3RL2A 1F3JA 3MUGA 2MHAA 3LPGA 4PCSA 4R0LC 4OZIB 1SLUA 2VLJE 2YN5A 2OTUA 1OAUL 1XB3A 3LB6C 3CLEL 4PJ7F 5MEQB 4FXLA 5IT2L 1U92A 4N6RA 5JMOC 3L1OH 5CJOL 1WAAE 4ORZC 4L4VA 4C47A 4IJ3B 2GC4C 3S34L 3VDAA 3WNMA 3ZMEA 4GI8A 2VSCA 3HHRB 3UTSA 5IIEB 2G2RB 4FQ2H 4HS8H 1FE8L 1CDYA 1XL6A 1RVFL 4F2MB 3L3DA 5IP4A 5CU5A 1ZKAA 2BWQA 4ZS7L 5HGBB 4Y4HA 5INCA 2VL4A 2X4PB 4FFVD 1JK8A 2YZ8A 4OAWA 4OQTH 3VD7A 2HVJA 1EA9C 4M6AA 3L3OA 4X6EB 1T03H 5D1XD 4XCFL 1AGDA 4YK4C 3R1GH 5FCSH 4ELMA 4DP6X 4ONGH 4N8VB 1DQJB 3O81A 2QHLA 3KLHC 3S8WA 4PGBA 4KAQH 2PYFA 5FB8A 3D9AL 3JVGC 1M9SA 4N2EA 3NJHA 5DZ9A 4K9EC 1K3ZA 1WIPA 3T0XA 2EE6A 3P2BA 1SY6H 1BVNP 1PNDA 5D96B 3KWWA 3IJYB 3WKPA 4JKPH 1OF2A 3FQTB 4J27A 3WUZA 2DEYX 2F53B 3QUXC 4ONFH 1HYRC 5FHBL 3MTRA 1HSBA 5D1ZD 1DQVA 2GPZA 4HISA 3SE3A 4AEIL 1E4KC 5L2JB 5I1IL 3EGSA 1MJUL 2D7QA 5IMMA 1MCIA 5DJ0B 2BY3A 3A6BH 4BWUA 4EVNB 5L4MA 5MI0C 2HMIC 2X41A 4G7VL 1BF8A 5GGQH 3NTCH 1ZT7B 1N8ZB 2A1WL 1W72A 1I8KA 5FECB 4KI5F 4PHZA 4QHMA 1QBML 2V6HA 3I9GH 5KSBE 1HILB 1U33A 2R1XB 3OKKA 3EOAA 2EUWA 3ZY7A 5LJYH 2IFFH 1KT2B 1HEZB 5D7SH 1V3MA 3WEXA 1UHVA 3ASOB 5IFAL 4OVVA 2ZUQC 3SSGA 3RY6C 4FQXD 2JJVA 3RDTA 2EEFA 3DRQA 4WJ5A 5I8OH 4LCWD 1Y1UA 4JVWA 3LPOA 3QYCA 3NSDA 5A3ID 2E7LC 1O6SA 4PUBH 4WI2A 4IHOA 3P73A 3DO7A 2CR6A 5D1XC 2FJHB 3BP5B 3H2QA 4OFDA 4ZUWB 1WDAA 2RHEA 2VC2L 5K39A 4YGVB 4P2RD 4B9FA 4DP0X 3UTPD 3H0TB 5H37A 3QDHA 4UT6L 4UOQA 1E5AA 5EC1A 5L2KA 4M1GH 2FL5A 5CILL 3UC2A 2O93L 4X5WB 5MI0B 3T4AC 1UD6A 4FLOA 3RI5K 5C0DB 1U6AL 2QQKH 3PL6A 1H0DA 2ADFH 1DVFC 3KEDA 4KKLD 3ZHLA 1N6QH 3EBIA 4N28A 3BXNA 1MJJB 5E6ZA 5D1ZC 4A2FA 1Q0YL 3HRZB 2W1NA 2XTJD 3FQ4A 5K1VA 1J5OH 2ZSWB 1AIFB 2BY0A 2ZCKH 1IKNC 3QIWC 1U3NA 2BPBA 1NC2A 3EGDB 4PJGF 1U3JA 5KVFE 4LLQB 3EFFA 5BZWB 5A2BA 4YPJA 2HPOA 2DQHL 4M4RA 3BIAX 4B6ZA 1PJ9A 2ZUQB 2CHXA 2ZCZA 3UJIL 4IS6A 1NAML 5J1AA 2V3DA 4JG1H 2DWEA 7PAZA 4UIMA 3LJ3A 2CLVA 1RUKH 3ESVF 2P5EE 5FM8A 1FNHA 4NNPL 2Z4QA 2VC2B 3NAAL 5D1XB 1LVEA 3ECWA 3V0DA 5I1DA 3K71B 3DVGB 5KS9B 1HL4A 2OULB 1BQKA 2OMZA 5JHLA 1WE5A 3DGGA 4F9PC 4AOFA 2EDNA 3OKEA 1NGZA 2CQVA 4JFUA 5A3IC 1FFNA 5CEYA 4QT5B 4PWGA 2ZOUA 3VFWA 3T4YB 4APQA 3FO9B 2HKHH 3H7BA 5IJVA 3CX5J 3AMKA 2YPLD 3T4AB 2DQTH 1YEJL 2PCPB 5H8DA 1I53A 3RBGA 2K1MA 4PJGA 1H8OA 3V5HB 4GUQA 1ZEAL 1TZOA 4E0RA 3I02B 3SYAA 3TO4D 2EEDA 4TM9A 4LPWA 3C60A 3BP7B 1MH5B 4OIIL 5D1ZB 1CDHA 5TE4H 3LPPA 2GHWB 3ZK0A 2XWXA 4EDWH 2QQLL 3IPBA 1UA3A 4ANVA 3RAJH 4JFQB 2CA4A 4WI8A 4YN3A 3A47A 1QNZL 1NAMB 4U7SA 4D0BA 4HGWB 4JPSA 2X44D 5AB9A 3T2OA 3MRLA 4KKLC 4RMVA 2VLKE 2PXYD 1I4FA 3P2DA 1PGRB 3TVMD 1A9VA 3RX7A 1F90H 4YC2C 5CUSH 3ZE2B 1CFBA 4RA3A 4ENED 3CSPA 3G5VA 2KH2B 3GZQA 5D1QC 3ZKMD 3FQUA 4JRYE 1U8CB 2GIMA 4FQXB 5JR1L 5I0WA 2W60A 3MACH 1KJ2L 4KXBA 3D4YA 3GGWB 4I48B 4P5KA 1J1XL 4UNUA 2VDOL 3VXPA 4AIZA 3BN9C 3JXAA 4LCWB 2C9QA 2ZKHH 2D7OA 3DX4A 4NKDB 2CCVA 4WI3A 1RFDL 1ZJAA 3IPEA 3PS6A 5ICYA 2F15A 1D7FA 3U4AA 3NRPA 2AJYL 3MODH 1K5NA 4FCAA 1RQ5A 2E56A 4G82A 4OZ4B 2RB8A 3ETBF 2AJVH 5EIIA 3V4PA 3GF8A 2BMKB 1OM3H 1OALA 2IH1A 3C8KB 4P2RB 5DMJB 3LCYA 1P7QA 4MQTB 3HLKA 4OI9A 3H9HA 5DO2D 4BUQA 3WTUA 3L95A 3GIVB 3GTTA 2EIMB 4G7YL 1PZDA 3T2NH 5EU5A 3DPBB 3A4FA 1NWOA 4X8XA 4ECNA 1Z3RA 1H3TA 1OCZB 1RPKA 2NY1D 3L3GB 5KVEL 3MV7E 2Z7ZA 3WIIL 1JRHI 2WUCH 1CFVH 3BOVA 3OR7B 2DBLL 4JY5H 3C5JB 5EULV 2UV3A 4ICWA 1A9BA 2FGZA 4NC1E 3VXMA 1FORL 4YHLL 2XTJB 3L4TA 4QPEA 5T1JA 1IM9A 4JL2A 3OXRB 4U1HB 4ZW3A 2CPUA 4YC2B 3W56A 3C08L 3WIFB 1VCBC 2FQGA 1FPTH 1KWGA 5I1AA 3B7YA 5C2BH 3QZMA 4NRXB 5AOLA 4K73A 1KJ2B 2CPCA 3BQUD 5F1KC 1BV8A 2G2PA 1BFOA 5D2NC 1R75A 4RAVB 1GC1L 4N22A 4GBXC 3SPCA 2OJEB 5EUOA 3TVMC 1PFCA 4WNJA 5I1LB 1XR8A 1MEXH 2I5YL 3QZNA 3TBYB 4X4ZA 3CC5B 4UM8A 3H85A 4ZUUA 1BM7A 3U2JA 4U2YA 1F00I 3K4DA 3A3YB 2YOCA 3D18B 3ME0A 4NJ9H 4Y1AA 5DVMA 4AGNA 1P4LB 4A2LA 2R8SL 1VZIA 4F20A 3HFMH 3QE5A 1TNNA 4KU1A 5GRJH 3ZKMC 1ZGLP 1BOGA 5JPNA 1Q0EA 4EKJA 4J8RB 4DQAA 4DGWC 5F3HB 3QWNA 2MNWA 1B4JH 1C16A 2FX9H 4X6DF 3HJEA 1U8QB 1GY2A 3ELQA 4FNRA 2B9AA 2IIJA 4ZSOE 3LS5H 3AACA 5E5MA 3GYRA 3SKMA 3O6FD 5DSCA 5DD1H 4K3JL 2YPLB 1AGCA 3KPNB 1F4XL 4HKXA 2Q8AL 3RA7L 3V6OA 5LO7A 5F0PB 4CU8A 4ZMYA 5KG9A 1DJSA 1CI3M 3DX6B 3NT0A 3WFBL 4N1HB 2YQBA 3TO4B 3IMUA 4PR5B 1AOZA 3JUZA 5IUCA 2DLHA 3PP3H 4B9JA 1WTGT 5AVXB 3QNYA 4MCYB 3LRSA 4JANA 3STBA 3AW5A 2VDLL 3K2IA 2FDBP 3EO9H 3MRGB 3EJYD 1SNRA 4ZNCD 2MPVA 4ZPVB 4MMZA 4FYSA 1UACL 2X3CA 5D2NB 5DGQA 2PXYB 3HG5A 3TVMB 3SGEI 3MRHA 5HJ3A 5ICXB 3RWFB 4E42A 3ATFA 2BX5A 2NY7H 1IJNA 4PV9A 2D8KA 3G6JF 1TO4A 5HYSA 3IXTB 4LCYA 4DSYA 1JGUL 2YQ2A 5IOKA 4ZOEA 3BH9A 3MLXH 3KPMA 1OTUC 3V7AG 1MFBH 2VIRB 2DAVA 2WCPA 1EEUA 3BQUC 4HP5A 1F1AA 2UZXB 4FQQA 2BZDA 5B7MA 1P4BH 3L6FA 2ZX6A 4V2CB 5TDOB 3BGMA 2PPDA 1VZHA 5F9OL 5C0ND 3U36B 4FABL 3TIDA 5CR1A 3VRLE 2BVEA 2QPUA 4F8QA 1UXLA 1A6AA 4MJIE 1MWAA 2H9GB 4AG4L 2ZXQA 1NA8A 3BZDA 2CO1A 4OLWL 4XBGA 2BIIA 4XNQA 5GSRA 4AI7A 5L4JA 2DJUA 4CN1A 5DZOA 2XV6B 1DJYA 4ZTOL 3U9PH 2FSDA 4N24A 1AACA 3Q6GL 4XWGH 5IESL 1L9PA 4EBQL 2AXFB 1OGPA 2VDLB 1I1CA 1L5GA 4XN1A 3B37A 4R90L 4HJGB 4O4YL 5CEZH 1BMZA 2V0AA 4H88L 4PJEF 3O6FC 3AS0A 3GBMH 2NUTB 3BKYL 2FEDD 4ELKB 2R4SL 2HFGL 3DO4A 5E70A 3IJ8A 3G6JA 2NY1B 3US0A 4M5ZH 3VH8A 1P6AB 2XG5A 4DEWA 4NWUH 3ZO0A 5I6LA 1H3VA 4S1DD 4A63A 3JTSA 1XGPA 1MFDH 4KY1L 2DWXA 1EHAA 3BWAB 3FT3A 2CMRH 2HFEB 4JUTA 2Q87A 3BAIA 2ADJB 3EJYC 4W9HC 4WWOA 3GNMH 3B9DA 3ARDD 3BQUB 1UYWL 4FFWD 4HETA 2WB7A 4J12A 4I18A 1ODUA 5E51A 3QAZC 4D9LH 3V6FA 5KYYA 3BIBX 3QR1A 1KJVB 1FL3A 5AW4B 4M29A 1T0NA 2V5SA 3ROLA 5AKRA 2VZ1A 1G94A 4PGCA 2KZ1B 4TVPE 3QJTB 5FM5O 32C2B 3PV6B 4FGMA 3AVEA 5BRQA 3QSKB 2YRPA 3CJJA 4MAZA 1BVKB 4TSCH 2EYSB 1SEBB 5D7LA 5T1DH 3K0WA 4RGNE 4WU5B 3BVNA 3FRUA 1G9MH 3B43A 3OZKA 1FL5B 4RDBA 4R7NA 3FUHA 3MJ8B 4P59L 4U3CA 1KXTB 5CJXA 3GSNA 3MROA 4D9RD 2C3XA 2X87A 3WNJA 2R83A 3O6FB 1C5CL 4BCYA 3LKRA 4DGVL 4J3XA 4JFOB 2WBJA 3M17A 4Y4HC 5DFVD 5HPOA 4X4ME 1VRSA 2ZOKB 1X9RA 1N6UA 1GOGA 1HCZA 3OPZL 2E46A 3L3OC 4NP4L 1JHKH 2JKNA 3ECQA 4YXKL 3MCG1 3SQOH 1UQSA 4PRDB 4P57A 3VXQB 2V8LA 4DO4A 1BFVH 2FEDC 5FO9A 1DLHA 3ATAA 1IT9H 5E9NA 2BH0A 5DEGA 4E2OA 5L2KD 5DEZA 3BAJA 1L0PA 2JMRA 3WTWA 2V2WA 3QAZB 3RL2B 1BM3L 4S1DC 5ID1A 3MUGB 2MHAB 5IV2A 4XNDA 4BCZA 5FGSA 1RULL 2XY1A 1LTXA 2WLHA 5H4ZA 2OTUB 3TTYA 3QZWA 1R6VA 2Y1AA 3HZKA 1U92B 4N6RB 2H5UA 2ICEA 4L4VB 2FWUA 5IVXF 5D2LF 3LZRA 1NC2D 1DVUA 3SDXB 1YEGL 4AX3A 3TBSB 4W1TA 1IZKA 1OTTD 2ATKA 2OM5A 3WDHA 5L9DL 4LDCA 3VSVA 1WZAA 1ZHKA 1T6BX 2E7MA 1FFRA 2GYSA 5ABZA 4DPAX 1R3IH 4P05A 4XGZB 3HC3L 3S8FB 5FGBA 3NACL 4MAUL 3L3DB 4XP6H 3V9CA 4F80A 2GAZA 4PTTA 1U2YA 4RRPA 3BD3A 1BZ8A 4E9TA 2FR4A 3GTNA 1RLBA 2VR4A 2KZWA 3EDJA 5TK2A 2MJWA 4HCFA 4OAWB 3MRNA 3PP3K 2HVJB 3L3OB 4POZC 1F2XK 4JRXE 4QRAA 2WXMA 1LDPL 3K6IA 3B2VL 2WIMA 3RDTC 1X7QA 4MVBD 3ESPA 4M5SA 4PGBB 1PYWA 2PYFB 5DHVA 5FB8B 1H6UA 5HYJE 5DFVC 4NZ8A 1V7NL 2VH5H 1UM4L 4APQD 4Z8FH 2CKBA 1YYLL 2W0FA 1KFAH 3VYPA 1DBBL 1L3WA 3KWWB 1O7DC 1YJDL 4GAGL 5CP3A 4BGLA 2OSLB 1THAA 2CCWA 1HSBB 4N8UA 4R26L 3D4CA 3EGSB 5IMMB 3ARDB 5I75C 2ZX8A 4L0PB 2Z34A 3DOIA 2ARJA 1UB6A 1RV6X 4DEPC 3AB0C 3F7VA 2VDMH 3PL6C 3BFOA 1W72B 1I8KB 4NWTH 2DWDB 4QHMB 5TTRA 5MENA 3NP4A 5DD3H 5HHOA 3NA9L 3QHZH 3OKKB 3EOAB 3UTTE 3GXIA 3LKSB 3DX1A 2WQSA 3VXNA 4LFHG 2CUIA 3HNVL 1A4CA 3D69A 3GHBH 1WH0A 3WEXB 3VGAB 3RFZB 2VXQH 1VGKA 4FG2A 2WXFA 1ZWIA 2PTTA 4YE0A 1UWGH 1SJXA 1H3WM 3FQWA 3ZU8A 3GBLA 2LU4A 3DRQB 3K2MC 3O8XC 3KH3A 4Z7WF 2XT1B 3NRFA 5TPWL 1D2OA 4XH2B 5FLUA 1O6SB 3AQZA 4R7VA 5C97A 4KQ3L 5AVYB 3DO7B 1MCDA 1MG2C 3LZLA 3OJDB 4N8VG 4QAMB 4KXZH 4RAHA 4RGOH 4OH2A 3MFGB 1WYJA 5K39B 3ULSB 4YXLH 1WC7A 1C08A 5KWYC 1P7QD 2XVBA 1KPUB 5EC1B 5L2KB 3ZZ1A 3PFUA 3AQDA 4E9RA 4DWHA 5I75B 1XF3A 2FL5B 3OKOB 3LH8A 1N18A 3MUUA 5ADOL 2XU9A 3NJKA 1NMBL 2NDGA 3PDOA 5GRVL 3PL6B 5HBBA 5C70A 4MJJA 2X6BA 4I8DA 4JM0A 4HU2A 3S5LB 1S7WB 3BXNB 4PBXA 3CSGA 3C60C 4IBYA 5JHBA 4PI0A 3KMDA 3VXMD 3I85A 3Q3GA 3DRTA 4C54A 1T1WA 1SJEA 1IIIA 5D5MF 5CGYC 1FYHB 1NC2B 3L1OL 5C0CE 3EFFB 2ZP0T 4PWJA 2CJTA 3BZEA 1NCWL 3FQ2A 4Z7VE 1Q9LA 4M4RB 4HIHB 2Q20A 1CGYA 3DX2A 2Y7SA 4IS6B 1N2RA 1WAEA 5GZND 5J1AB 1OGAA 4FQ2L 4HS8L 5KYXA 3S35L 2CLVB 4U6XA 5EU6A 1OSEA 2D3NA 3H9SA 2QVMA 2F54A 5IMOB 3TCLA 5IMLA 1EERB 1UZ8A 5A2IH 4MA8H 4FQCH 5DVOA 2HLFD 3FN0L 4OQTL 1TQWA 3IWUA 3PWPA 3LHAA 3IDGB 4WTWA 3B5GA 5T1MB 3R1GL 3NIGE 1BZ7A 2WBXA 4MAYD 4ONGL 4OQ1A 2ZPKH 3QISA 3OKEB 3CBRA 1NGZB 3I84A 4FNSA 3FFDA 1FFNB 4LLUA 5CEYB 4RWYL 4LQ1A 2XA3A 3VFWB 1SQMA 4FLQA 4APQB 2EQDA 5E2UH 5IJVB 4LRNH 3D05A 3FQYA 2MKLC 3QCVH 1CL7H 1WZLA 1NLDH 1SY6L 2ZUSA 4GIPD 4ZQTA 4E0RB 3JTTA 3MNWA 1BF2A 2IBBA 2LR4A 4JKPL 5CF3A 2XA8H 3MYJA 1GMIA 1KXHA 4W6XB 2P24A 2LFGA 2XQBH 3RVVD 1N70A 4FNLH 3OAUL 2RD0A 4D0BB 3HI6H 3A6BL 1NQBA 4CILA 4CU7A 1TLKA 4EI5A 3MRLB 4IDJH 1WD8A 2V7HA 3L4VA 4O02H 5GGQL 1M53A 1GTFA 4DT2A 4L48A 5CZKA 3NZUA 3QG7L 4E5XA 4AXWA 1VFUA 3G5VB 2IFFL 5DC9B 2FQFA 2CDEA 4G5ZH 2B1OA 4V11A 1J9QA 1A7NL 1PLCA 4G1EA 3EO1A 4X9HA 4JKLA 2AAAA 3VXTA 4GAAA 3PY9A 2WCSA 4P5KB 3MJGX 3VXPB 2PPEA 3EBHA 5JQHC 1YEIH 1CB4A 3DVNB 3ZTEA 1E4WL 2EDDA 2B39A 5EEWA 1IM3A 1EXUA 2XCMC 4JJOA 4GXVH 5C0RL 3CDZA 1ACXA 1K5NB 4PUBL 3IGAA 2WTPA 2IWFA 3MRDB 2D4FA 4LLDA 5JXEC 4TNFA 5DJZA 5DQJA 5EIIB 3DUSA 2Z9TA 2J1WA 4N2FA 3V4PB 2IH1B 4F33A 5ENWA 1P7QB 3QHFH 2J5WA 1CF8H 3ZQ9A 3L95B 1QVOB 4X0KB 2ZWSA 4XMZA 4DOHE 3Q8AA 1ZVYA 5EU5B 1YEFL 3MRQB 1E4XH 3UDWA 3UYOD 2E9GA 1I85A 4V1DA 4JY4A 1DQMH 4JFDA 3T8MA 3V6OC 4Z7QB 2XJKA 4GRWF 3WNNA 4GT7A 3UPAA 1Z9NA 4L8SA 1OE1A 4XC3L 4X98A 3L16A 3FC8A 3VXMB 1N6QL 1GH7A 5AVQB 3OLGA 2WNWA 3V52H 3INUH 1QZ1A 2WXRA 1J5OL 2WKLA 3VXRD 5I1AB 2E86A 3O3BA 3Q2CA 4MMZC 4W9EC 1F1DA 5BOZG 4GW1B 1BFOB 5EUOB 2HT2D 5C8JA 1XR8B 3VSTA 5GS0D 4A7GA 4KWUA 4UNIA 4XE5B 4ZUUB 2ATPA 3EAKA 3ME0B 1X5XA 1ZHNB 4JG1L 3WS3B 3V6BR 3BD4A 4N2CA 1WRFA 5GHWL 3OTTA 5AW5B 3D3VA 4XNXH 4Y16D 5F2FA 4G80A 1OWRM 2ZWKA 5JPNB 1MRDL 5D7LD 5C09A 1F6LL 4X9BA 3STLB 1BBDH 4IBQA 4PCTA 4MAYB 5GGSA 4YQXL 3SKMB 1FGVL 2YJLA 5I74C 4HUMB 2X4QA 1ZGLA 5DSCB 1DZ0A 1NM9A 5ACZB 3PHAA 1AGCB 2WBJD 4HKXB 5I6KA 2XIDA 3VXOA 4YX2L 2BCKA 2VLMD 2HKHL 5KG9B 2CK0H 2J8UF 5GIRA 1PU0A 3U6RB 1Z9LA 3BUPA 4R6UA 1D5BB 3JQOB 3WLWC 4AEEA 5CAYB 2CJUH 3LRSB 4JANB 5TE4L 2CD0A 4WHDA 4NJAH 4EDWL 2F7QA 4FYQA 5E8OA 5G5DA 1S7XA 1E28B 3RAJL 4AJWA 2CCLA 3FT2A 4MMZB 5F9WC 1Y6KR 4KDWA 3DMMA 4NO2A 3IMRA 1WWCA 3MRHB 5HJ3B 1GAFH 4LLYA 2P3YA 2V9RA 4PV9B 3BT0A 4JG9A 5HYSB 4LCYB 3ZR6A 1VENA 3QR2A 1YN6B 3BH9B 3KPMB 2E9WA 5D93B 4W9FC 5CUSL 3GUTA 3VFRA 1Y18B 3AGWA 4LGRB 2UZYA 3VRJA 4I18C 4PJ5A 5FA3B 2NY2C 2HT2C 3L6FB 1CYXA 5CBEA 5GS0C 3I2CH 4LLMA 1ZRUA 4ZOAA 3ZKXC 2G4GA 3CFCH 2OXGA 3MACL 1A6AB 1YAZA 3O9WC 4Q4EA 2FWOA 2H6OA 1MWAB 5T5FH 5I74B 2ZKHL 1JNNH 4MCNA 4XNQB 7CGTA 3ZHNA 2CO2A 3MODL 3W5MA 4DTGH 4CSZA 3AWGA 3G5YB 3KYKH 4FJ6A 2AJVL 5CJXC 1NFIA 1L5GB 4I88A 1OM3L 1WHOA 2TRYA 5BS0A 4Q89A 1H9DA 2ZAIA 1NGQH 3FPXA 4LF3A 2YD4A 2ZAHA 4AK2A 2WBJC 2AXGA 3T2NL 1U9KA 3AU0A 3CHSA 3NGBB 2VR6A 2XG5B 4QOKD 1OLLA 2B5IC 2WUCL 5EZOH 3SPIA 1XGPB 1JMZA 4JY5L 1JYWA 3BW9A 3X1BA 3FT3B 4JFYA 1FCCA 3VXRB 2GEQA 4PY8J 2VQUA 3K6OA 4Z7UF 1WFNA 3HBPA 3HCVA 4PS8A 2W0LA 4I18B 4X5XA 4XB3A 4AENB 5C2BL 5KYYB 2VDQH 2NNXA 2O5XL 2XIBA 2YD7A 4W9KC 1FL3B 1E90A 2JKXA 5DU7A 1HAWA 1BXXA 1FZKA 1MEXL 3ZKXB 4NB7A 3ROLB 5MEND 4G7QB 3PHOA 2O30A 3SE8H 1SFDA 2QHRH 3MUHL 1HNGA 3CU1A 4Y16B 4PJIA 2ITCA 1ZANL 4TTDC 5GZOD 5D7LB 2QQNH 2OL3A 5GRJL 1LLAA 1FFTB 1LL1A 5KEZA 4FQIL 4YSDA 2W9EH 2I07A 4BZYA 3IFPA 4R7NB 1B4JL 2FX9L 5L8JB 3P3YA 1WHPA 5FGBC 2P80D 3LS5L 1A3RH 3DDGA 3QNFA 2DWTA 2WBJB 1II4E 3M17B 1TVDA 5AKVA 4I1RA 5AZ2H 4AYSA 4BE5A 5I1CH 4GW5A 4PVNA 3CAFA 2XWJA 1S46A 2Y06H 4AY0A 3IJHA 2B5IB 1X5ZA 1UQSB 4XNBA 4U1NA 3B56A 3GO1L 8PAZA 3FDWA 3RWGB 2XUWA 3HMXH 3BVXA 2R0LL 5DEGB 1A3LL 4OGYH 2RA1A 3TEXA 3X17A 2XXMB 3EF4A 3UL4A 1NFDA 3EO9L 2EDWA 5J6GA 2V2WB 1M1SA 4IOSA 3ABMB 4XN9A 3M7FB 5ID1B 5IV2B 5AZUA 4JE4B 5E8DH 2CKBL 4KC3B 5B4MD 3QZWB 3HZKB 2ICEB 4UV4H 2BS71 3QCTH 4ZUTA 4WUKL 4JHBA 1SOXA 1KUMA 1P9MA 4YLQT 2VMJA 3CZEA 3SKNB 1P4BL 4Z7OB 4JFSA 4YHKH 2FO8A 4GYBA 1VFBA 3QIBA 8CGTA 1OGAD 2XFGB 1J0JA 4F27A 4P46A 4Q6IA 4W4NA 2R23A 5EBLA 5JLZB 1F2QA 5EU6D 4PTTB 1QPPA 3A67H 3H9SD 5KJ7E 1RURH 2F54D 3QA3B 4FFYA 3QUKA 4OFIA 4FLRA 3L7EA 1E2WA 4ZODA 3B7SA 3U9PL 4DF9A 4OCYH 4XWGL 3CXDL 4Y2NA 4K5LA 3PWPD 5F7DB 2FHBA 1SUJA 2NXZD 3T2PA 4XMKH 1X7QB 2CRMA 4X9IA 5IROA 2YPVH 5DHVB 5IHHA 1F5WA 1RK1A 2BNUA 5FCUH 1XBDA 1GW6A 3KE0A 2CKBB 4NQCD 1J8HE 4LSUH 4M5ZL 4QOKB 1DO6A 2W0FB 4AV4A 2APTA 3F00A 3LXBA 4PBVC 3PWNA 3NUKA 3V9EA 1A7QH 4ORGA 4YBLC 2YRBA 5LBSA 1NCAH 1MFDL 3D87B 3QPXH 1IGFH 1TJGH 2OSYA 3KL3A 4O2CB 5GJSH 3ZE1B 3WNPA 4U1LB 4HMCA 4UAOC 3BGFB 1X5FA 5DRXB 2CMRL 4JHZA 2DI8A 4BK4A 3BESR 2ARJB 3EFOA 3LIZH 3EH3B 1JTOA 2E75C 1HXYB 2VR8A 3NJVA 1JXFA 5DJXA 1BVZA 3C9NA 2QR0A 4S0HA 1PEWA 4QHNB 3ZKNC 3BZ5A 5MENB 4PG2A 3L5XH 4QR7A 5LN4A 5B4MC 2WQ8A 1AIZA 1H8NA 4YR6A 1FZJA 4PRPA 4WAFA 4NN7C 1MJ8H 5I18L 5AW1B 3VXNB 5FO8B 4CADB 1A1NA 2GIYA 3D69B 3UBXI 2MNUA 3AABA 4TSCL 3GMNB 3F5WA 3HZYA 1QUNA 3D8MA 5T1DL 4FG6D 2ZOLA 5B8CA 2AEQH 4TSBH 5KVDE 1C8PA 2CM6A 3FQWB 3TT1H 3RVUD 1LE5A 5IY5B 3BUDA 4PJHA 1H3UA 4YDKL 1XGQA 4BHUI 4P5MB 5L8LB 4JGHA 4BFRA 1IM3D 4MASA 2DTSA 2ZUVA 3DX9A 2VSDA 4PG9B 3K2KA 4NN5B 2A73A 3VXSA 3D08A 1JHKL 3M45A 1WC7B 1C08B 2YSTA 4YBLB 4UQ3B 3DVFA 4GG6F 2WTOA 5J1SC 1SHXA 1BFVL 2OR8A 2M83A 5JXAL 2EVIA 3S37H 4UAOB 4L9LA 1GJWA 6FABL 3IRCA 4QCIB 1IT9L 1DCEA 1XF3B 2ENQA 5F7HA 4G6AD 3VFMA 5CM1A 5L88H 2VQTA 4V1DD 1NH6A 3PDOB 4JFDD 3V7AE 3GJFA 1KGCE 3WMQA 1MCJA 2VDRH 3D33A 4QRRE 4PS4L 2X2HA 3GBEA 3GS7A 4LPYA 2YMXH 4ZI8A 3Q3GB 1UT9A 3DRTB 1S3RA 1T1WB 5TGBB 1SM3H 4TOYH 1J8SA 4OCXH 3FS9A 2AQNA 5CCJA 3BZEB 3FT0A 2OAAA 3OB0H 1Q9LB 4I7ZC 1Z5YD 4EI5C 2F8OA 4OLEA 1YLBB 2QV4A 4JN2B 4ZMVA 2W80C 3MJ7A 1N2RB 1GGYA 4BD4A 3ARFA 1OGAB 2AGJL 1DJHA 5KYXB 3PV7A 3SY6A 1EX0A 3WGVB 4U6XB 4ZO7A 1CGSL 1R3IL 5DTFB 5EU6B 1SDAB 3H9SB 4XP6L 4GG6A 2F54B 1A6VH 2PP8A 2R4RH 5IMLB 3AC0A 4U0RC 5ETUA 3RWEB 5A6MA 5AVRB 4FG6C 3PWPB 3PG2A 1UH3A 2NXZB 2R2EA 5MERA 5DS1A 2DJSA 1BZ7B 4P2OA 1RUPH 4OT1L 5C7XL 1G7PA 3FFDB 1NANH 1F02I 4LLUB 4LOUD 4TNEA 4WO0A 2CR0A 4KZ0A 3KLKA 4NQCB 2VH5L 4A7TA 3QEQE 4H0HB 4PRIA 1B2YA 2DOCA 3ISYA 3GEWB 2VAAB 4GMSH 4L2YA 3PAUA 5C0JA 3NCYS 4OIFA 3JTTB 3MNWB 4AQAA 3QFJE 4S0SD 1TVHA 1T21A 3MYJB 2WXIA 1DSFH 5E56A 4Y5YB 3EGXB 2RALA 5FYLE 3TP4A 3S36X 2R69A 3UDWC 1XGUA 5I1KH 1I85C 4J7RA 5KBLA 3S5LG 4ELDA 4HMEA 1PIGA 4L8SC 3EHBD 2KLRA 4UI2A 2V7HB 2VDML 3RWJB 4FZEH 4N0UE 4U7KA 4XCNA 2DMCA 4AITA 1QSEA 3IM1A 4NWTL 2R29H 2ZOTA 3HG4A 3NPSC 4MHHI 5I24A 5DD3L 3WJJC 2EC9U 3QHZL 2CUHA 4Q9CA 5K9OA 4E5XB 1IJ9A 2FX8L 3UFIA 4AXWB 2G2NA 4LHUA 3ZDWA 3L4ZA 3MTXA 2B3RA 5FYJE 1HWGB 1T7ZA 3GHBL 4PJ5D 1SEQH 1PCSA 3BRGC 1JCVA 1YMHA 1QRKA 1IGIH 4JFHD 2GCYA 2WXKA 2X1PA 4UYQA 1SLWA 2I25N 2BOBB 1IM3B 1DQKA 1EXUB 1UUNA 4V33A 1LEGA 3RUGF 2CBOA 1XCQA 3CDZB 4NKMA 1S9XA 4LLDB 2OFQA 5CCKH 5KVFH 5DJZB 3DUSB 4MNHA 4P4KA 4F15C 1JCKA 1XB8A 4YZFE 4JFEE 3MC0A 3V4UH 5BS0D 2W0PA 1WAPA 4YXLL 1JZGA 2EC8A 4FF9A 3SYQA 3VI4F 1Z7JA 5HHXL 3P30H 5TF0A 1OK0A 4ZMOA 3BH4A 1E6JH 4C4KO 4DKFL 4V1DB 1N8OE 4JY4B 4JFDB 1KCSH 3SCMA 1URIA 5LXVA 3R4RA 1R47A 2BP8A 4L8SB 2H0FA 1C5BH 4X98B 4XMPH 1IRAY 2WXJA 3G6AA 4TF4A 4X4XB 3GMMB 4OSUH 4QRSA 1CGUA 2ALAA 4FTVD 1KENH 3VD9A 4HZAA 1YC8A 1MWOA 4M3HA 5F7AA 3O3BB 1YQ2A 3N50A 4NI6A 3DMMC 3RUGA 1F58L 2OQJA 4QJ4B 1G1OA 4YDNA 2O6DA 5C8JB 1OE2A 5F89B 3I6GA 2EO1A 4OU3A 3M1CA 4HLEA 4PP2A 2B8OT 2ZX7A 2QSCH 2ATPB 1NMCB 5I5JA 1HWWA 4PCKA 2IQ9H 1OWWA 3L2MA 1U93B 4G59C 1T2JA 3FMGL 4G80B 4QYAA 5I6XC 3GRGA 1CIDA 1FBIH 1R3JA 5A2JH 4MA8L 3SPVA 3VXUA 4PJCA 1YECH 2W81C 1IAIM 4FQCL 4S10A 5DZJA 4F15B 3HHMA 3MMEA 4X6CA 3WGUB 3TEYA 5J6SA 4F58H 2VRKA 5GGSB 3DV6B 3RY4A 3RI5F 4ZBJA 2VN5A 5G4OA 2X4QB 1DBMH 2ZPKL 1ZGLB 2FIKA 2KC0A 4HK0B 4GO8A 5EIIG 1NCIA 2QGDA 5IVZA 6CGTA 3VXOB 4R97B 4YSAA 2IPTH 4LRNL 4F7EA 4R96A 3QCVL 1SHWA 1CL7L 3LS4H 5CP7A 4OZIE 1NLDL 1PG7X 4FMFA 3ZQXA 2WQXA 4N1CA 3IRPX 1TFHA 2XV2A 4K8RD 4PMFA 3OB0K 2IOOA 3UYPA 2IH3A 1S7VA 3F6IA 1D6VL 5G5DB 1S7XB 4XMLH 4FNLL 1YDPA 3FT2B 2Y1VA 4U6HB 4OF6A 4JO1H 4UF7C 3EHBB 3HI6L 4IOSD 4NO2B 1X6NA 4AL8C 3IN2A 4IDJL 3DUUB 4LLYB 1IFRA 2KL6A 4ODBD 3P9MA 3RX8A 1CDBA 3ORJA 4O02L 4F2ME 2F7IA 2ZF8A 1HXKA 1WEJH 5JQ6H 4G8AC 3GUTB 3VFRB 1Q9WA 5B7FA 4A2DA 1ZLSH 2UZYB 3VRJB 1PPIA 4PJ5B 5I6XB 2WLMA 4G5ZL 2NYKA 4XNYH 3CVDA 5CBEB 1A21A 2X1XR 4PJXF 3O4LD 4NQQA 2DLFH 3QIBD 2V5RA 2FWOB 5C2UB 4M02A 4ACPA 4P46D 1Q9KA 1YEIL 4HK3N 4QHLA 4WLCA 3K8KA 1CU4H 3MLRH 1SF5A 4GXVL 3QPKA 1CLVA 4OGXL 1AXTH 2J21A 4D8PA 2BIMA 3DWTA 2F53E 5BS0B 1KB5H 2N56A 5C0BD 3IDNB 3QHFL 1XAKA 1UKQA 1INQA 3CZLA 2IGTA 4UV7H 4XPHL 3TWYA 2B16A 2AXGB 4HFWB 4L18A 3G5ZA 3MUZ1 4A6YH 1E4XL 2ZUTA 4YO0B 4RFNC 1Q9OB 3P0GB 4OF5A 2QEJA 1QRNA 4R4FH 3V0FA 5FIEA 5AZEH 3IRZA 4YSSA 5LGHH 4K8RC 4FTVB 3BW9B 5BW7A 4IU2A 4JFYB 3PAZA 1MDTA 4N68A 4PRAB 2F18A 3INUL 5G55A 1LXMA 1KBKA 4H8PA 4P2CG 4X5XB 5CJQH 1HC1A 3NCMA 3VD1A 5HYSG 1NCBH 2DWSA 4XBMA 5DVNA 1M7UA 2G3ZA 1OAZH 3G6DH 1IGCH 1WUZA 3DYOA 1FZKB 1JOIA 4HG4K 2XLLA 1SMOA 4WW2F 4WV1C 3PHOB 5T3ZD 2B77A 4PRPD 4CC1A 1AC6A 2D7PA 2DDQH 1P7KB 2Q7YA 4FNQA 3FUJA 4LPVA 5LDSA 4PJIB 2ITCB 2JK5A 5HDRA 4FD0A 2OL3B 1G9NH 4XNXL 4HC1A 3W81A 2RGSA 4DJMA 1P9MC 1MN4A 9CGTA 2I07B 2IV9A 3IFPB 4KVCL 4XPAH 1T3FB 5DJCA 4J3VA 3MBEC 3QIBC 1BBDL 1W0VA 4JZOB 1E8WA 4P46C 4Q6IC 3SHSA 1MHCA 4WVRA 1LD9A 3KAAA 2FT8A 3M8OL 4O00A 3T8VA 4AVHA 4NOBA 4RFNB 1MVFA 2K6ZA 2XWJB 2Q1EA 5IHUL 2CK0L 3E6FA 3ILQD 4K94L 1WWBX 3VXSD 4U1NB 1XD0A 1WSST 1FN4A 4F7PA 5MEOA 5IROC 2YEVB 4AQ8A 1ADWA 4MCZA 4DUWA 3KGRA 4NJAL 4X7TA 3C5ZA 1NFDB 1J0YA 3KVQA 3HHSA 2Y2YA 1WFUA 1JWSA 4UT9A 4AQEA 4P48A 2EH8L 3NPZB 3REVA 5FK9B 3ZE0F 2JVUA 4KJQC 5TE6H 4ODTH 3FU5A 2D4DA 3ZDZB 2C9UA 1FO0A 4UNVA 2HJLA 4CA4A 3S3CB 5CLYA 3IWVA 3FU3A 3ARBD 2FECL 5D1XE 4PLKC 2ZF9A 1P6WA 4HIEB 4I2XA 4HJTA 3IF1A 5KS9E 2E6PA 3O4LB 3VW3H 1VFBB 1IAII 3I2CL 3QIBB 2CU9A 4KKCD 3ARFD 5CKGA 5D7IE 3CFCL 3U6XS 2X9WA 2E5EA 4P46B 4Q6IB 4I85A 4DKDC 2R23B 1PCXA 1WICA 3ESUF 4QHPA 5EBLB 3BAXA 5T5FL 2AABH 2AI0H 4GKSA 1JNNL 5T3ZL 2ESVE 2D7TH 3NRQA 3P4NB 2ZCLH 3L7EB 4H13C 4LK4A 2ICWI 3M86A 4DTGL 5B8CC 1SMAA 3CH8A 3KBPA 4M61A 1RLWA 3RYMA 2HFFA 1FG2B 3KYKL 2F58H 5C0BB 3DHUA 3B7UX 2ENSA 5M94B 2EUZA 2WP3O 4P2OD 2DQEH 2QZQA 4E9LA 1NGQL 1RK1B 2BNUB 1DBAH 5BUGA 1OSPH 4TVPH 4UIKH 1LWJA 1U2HA 3LXAA 5DC2A 4B9YA 2X6UA 1WGOA 1RZPA 4DERA 1JAEA 3LRGA 1U8LA 3OXSA 4IGBD 4PRID 1B0IA 1QLEL 3ILQC 3PWNB 4HBCL 4WHYH 3RIAK 3T3MB 1TIUA 5EZOL 2ERJC 5L8KB 1PD0A 3GEFA 4GSXA 4JR9H 4M62H 4JBSA 3ZE2E 4CN6A 4I0PD 5C71A 3BLKA 4X6FB 1F4AA 4L9LC 1J9SA 3QC6X 4PRHE 4G3YH 3HR6A 2BFVH 2X2YA 3EFOB 1G7LA 5B3JF 1NCHA 3NIDB 3GS4A 3ZMRA 4AE0A 2IOIA 1N0LB 3P3TA 2QR0B 1O9ZA 3QZWG 5EZJA 4LSVH 3R8BB 3KHOA 1T22B 4X5PA 4LCWE 3CHPA 3PDDA 4YDJA 4YR6B 4PRPB 1PZCA 2PTVA 5F6HI 2HCZX 4J3OH 3BE1H 1NC4A 3SE8L 4Z7IA 1EUUA 4OZHA 3KS0J 2MCPH 4LHUD 4M9OA 1O75A 3KCPA 3O2WH 2BXZA 2VISA 3HZYB 3VFPB 1QUNB 2QQNL 3QI9A 2VR5A 2WK2A 1ET5A 5B8CB 3U4EA 4P2RE 5ITBL 1UZ6E 4AE1A 3UTPE 4B9IA 3RPBA 4JJ5A 4IOFC 1LE5B 5CJBA 4PJHB 3SDCA 1L7TH 4Y19D 1AG0A 4QI3A 3TCXA 1S7UB 1XGQB 2IANA 3I9PA 3SYCA 4HWBH 4I3SH 1A3RL 1QLEB 4JG0H 4MA1C 2EIKB 2I7SA 4LMQE 1BQSA 1BAFL 4UINH 5AZ2L 5I1CL 3WTSA 2H3NB 1P1ZA 4OZGF 1NGPL 2NY6D 2A73B 3VXSB 1T7VA 3UTQA 5JHAA 4P4KD 2Y06L 5HGHA 2ERJB 1U58A 4C56A 2BC4A 3ARWA 3AS1A 1CTMA 1G7QB 2ITDB 3QQ4B 3QWOA 5JW4Q 5FPIA 4L9LB 2IF7A 5IKCA 4I4WA 2ROXA 4QTIL 1A3QA 1X5AA 5D1QE 5KW9H 3VFMB 4OGYL 3ZL2A 3QC5X 2K7PA 3GJFB 3SCMD 2EICA 4GG8A 1MFCH 1V5JA 2ITFA 3RQ3A 2RFXB 2BW4A 2QVTA 3RWIA 4LO9A 5E8DL 2CBTA 3L45A 2O1AA 3DBXB 2ZXDA 3HZ3A 4FFZA 2ZP9A 3VO0A 3D2UA 2OK0L 1EHXA 4MNGA 3SEPA 2VN7A 5AWNH 3ARBB 1J0HA 2XZQH 4OJYA 2EDQA 5CWSB 1C5DB 1U95A 4Q4IA 2KUTA 1F3RB 4MMYA 5DLML 5HYQA 1PZBA 3MJ7B 4WJKB 3ARFB 5CIPA 5EH1A 4U6TA 3UYRH 4YHKL 1U3ZA 4WK4B 1Z0MA 4IMKA 2JELL 5KVEE 1V7ML 5CINH 1EEQA 4JFWA 1UA7A 1EHNA 4NQXB 1PZ3A 4JO8A 5E08H 2C1OA 1WD9A 5ETUB 1CN4A 4K15A 1HH6A 4BGDA 1JYNA 1RURL 2OTWB 2FJFA 3JV6A 3VXUD 4ZD3L 3RKDD 2R2EB 2ZG1A 4OCYL 4P9HH 1AZNA 1YPZA 1VAHA 2K9FB 3QUZA 4P2OB 3VRIB 4ZFOA 1RK7A 2C4FU 1TETH 3TXAA 4FQLL 5DMGD 3F7PC 5CZRA 2PWEA 3S98A 4J4PA 3GXFA 2DLEA 2H47C 3L4XA 3SPJA 5FCUL 2WWKO 3SGJA 1PLGL 2XBTA 35C8L 2HT4C 3CGTA 2NY6C 2ADGB 4PRIB 5D2NE 5IVOA 1NBZA 4LSUL 4JFZH 4P4KC 2XYBA 3V0HA 1OSZA 4A7VA 5F1NA 4N0CD 3SKUD 6TAAA 4AQAB 1F6FB 2A4EA 4XPGH 3UTOA 1T21B 4I0PB 2W65B 3QIUA 1DLFH 3V0AC 1XEUA 3MRCA 3HI1B 3QPXL 5ITFA 5GJSL 2X4UB 4HALA 5DUBA 5E8EA 4FP8H 3SCMC 4Q9BA 1YNKL 3LKOA 2PUQT 1Z9PA 4K55A 1D5XA 1PY9A 2NY0C 2R7EA 1WWWX 1F56A 1QSEB 3IMWA 1ORSB 3L5XL 2CHNA 4X7EC 4CKVX 5H94A 4GKLA 5K9OB 5T1LD 1O6VA 4LHUB 4PGEA 2HRPH 4IIQA 2EEBA 2JKLA 5HP5A 3L81A 5M95B 5ECGA 1ZHBA 2EDLA 1YMHB 5TDNB 4DVRH 2WKOF 1OB0A 2JKJA 1LQBC 2AEQL 3HA0A 4TSBL 3CSYA 3NJLA 1EDYA 3TO2B 2GCYB 2K8MA 2DPKA 3TT1L 2BSRA 3HOGA 3ZL4L 1HCVA 1HIML 3QUMA 4F3FA 1DQLH 4BKTC 1XCQB 3HIZA 2H0PA 4EUPH 1S9XB 2NY6B 4R7LA 2D0HA 2VXTH 3RKDC 1AP2A 1K8IA 4MNHB 4P4KB 3V79C 4MA3B 1KDJA 3LQAC 4N3UA 4WJG3 1TZGH 3TASA 1PKQE 3E9UA 2VDPB 5DMGC 1JVOA 2XKNA 4H8HA 5B21A 3WIHH 1GZQA 3WXVH 3ZT6A 3P02A 3SCMB 2BSED 1RUQH 4NQDA 2BP8B 5L88L 3F7LA 1LK3H 2AK4A 4N0CC 5HDWA 2GJJA 2VDRL 1JV5A 4O5LL 3VD2A 5ALCH 5E1AA 1QRND 3G6AB 2ZQKA 4QRSB 1X5GA 3L9RA 3FU8A 4PJDF 3WY1A 1JPSH 2YMXL 1SN0A 2WZ5A 1XGYL 4N2LA 4F7MA 1SM3L 1RK0A 2V7NA 4TOYL 2OMNA 4OCXL 3S3SA 1KPVB 4HK3J 5HDBB 2OQJB 1L6PA 4GRLA 4YPGB 3SKJH 2FUQA 3H55A 4MD4A 3Q2NA 4E5XG 4PP2B 2CDGB 2J71A 2AQ3A 2NZIA 5CN2A 4KTEH 3EADA 2CK2A 5F96H 3PUUA 3HE6A 3AT0A 4U6VH 1WS7A 1ZA6B 1A6VL 4HS6A 4OLZH 2R4RL 1R3JB 3E8UH 1BREA 3LHPL 4O58H 3OGCA 4CGUB 3VXUB 1EMTL 3ABLB 4PJCB 3TC9A 4TS6A 4H20H 1WCQA 3MMEB 1N3NA 4X6CB 5J12C 2QZ5A 2NNFA 4HQQH 1FH5H 3NQIA 5E99L 5I1EH 5I66A 1AHMA 3MO1A 4M5TA 4U1GC 3U7WL 2ZKMX 1RUPL 4Y7OC 3ETTA 1E5BA 4PJDA 2RQ8A 5IVZB 4WO4A 1B0RA 3ASNB 2CUMA 4HHWA 4R96B 5IW3A 2KDGA 4EIBA 3BAEH 5CP7B 2B4CH 2YUXA 1HL5A 4KV5E 1UXSA 1SBSH 3FHQA 4YOKA 1JXDA 1MKFA 2YD1A 1DSFL 4L4VE 3UYPB 4CSTA 2IH3B 4K5NA 1S7VB 4LPXA 4QLWA 1YDPB 2UXVA 4X80L 5DRNA 1NDTA 5A2FA 3V2AR 5I1KL 2EINB 3QDMA 2XXFA 3SPHA 3UTSE 2BSDA 3FNKA 3EJJX 4XXDA 2UYLB 1J5DA 1ADQH 3P9MB 1E3ZA 3ZHDA 4WWKA 3PDGA 2AAVA 3FQRB 5T1LB 4M1CD 3TPKA 3VD4A 5FKAB 3X12A 3K1DA 2X42A 1Q72H 4RDQF 1MUJA 1ZVNA 2H8PA 1UT2A 4ELME 1S7QA 5J11B 3V4VA 1SEQL 1T83A 1I31A 2VLKD 2XN2A 4AVKA 1ACYL 1KSRA 5LKNA 1CE6A 1IGIL 1H3GA 4L8DA 5KSBB 2QLYA 1TJIL 4U1GB 2EE0A 1Q9KB 5CN1A 5EO0A 2A83B 4BK5A 5B39A 5E2JA 4CRPA 2M2DA 1WFTA 4C83B 4M7KL 2J73A 4AT6A 1BWWA 3D0LA 3JVFC 2E0PA 4JRYD 3GBNL 4D8PB 5AYTA 5KVFL 1QTSA 3TNMB 2CH8A 4N9OB 4KO6A 5DWPA 1C7TA 4FQPA 4K7PH 1J1PH 3V4UL 1INQB 3K74B 4FNPA 2WXLA 4J3WA 4MJ6A 3RPIA 1QKZH 1E9QA 1I8AA 3G5ZB 1A5FH 1E6JL 4HWEL 3N3EA 4HUKB 5KAQG 5AAMA 1KCSL 1CFSA 1EAQA 2WNKA 1QRNB 3CHRA 5ID0A 3FUKA 5PCYA 1C5BL 1H15A 1I8LC 1NBVH 4ZX4A 4IU2B 1QFWH 1UB5A 3NH7H 4AQ8C 4PM1A 1Z2KA 3WKMH 4AEHH 1HE8A 2QL1A 4GQRA 3QEUA 2N7BA 3C5ZC 1UCBL 4BIKA 2GUOA 3BIKA 5DR5H 3WXWH 3SGDI 8FABA 4OLVH 3DYMA 5LVEA 3X3GH 4QIRA 2C9RA 4M43L 1FSKC 4M48H 4NO5A 5AAWA 1W0WA 2P49B 2XHNA 4M93C 3K7UA 1ZT1A 3FB8A 4UT9L 2BS9A 2GTZA 4M1CC 4MXVF 5F71A 1C1EH 3VI3A 5ISZA 1MHEB 3U82B 3QH3A 2JK5B 5I17A 5DYOA 4HV8B 4XP5L 4BINA 1FBIL 1EHLL 2F5AH 2XYCA 3B2UD 1O7DE 5DJCB 1YECL 4KVNH 4TN9A 4U6YA 2OMUB 2B9BA 3BKML 3N06B 1W0VB 4LU5L 1BWMA 3MA9L 1IGJA 3U7AA 1P84K 1ZOXA 5L2KE 1CYGA 1SXSA 1HQ4A 1IEBB 3N0PB 1MHCB 3RFRA 2IAND 3UZEA 5FGCE 3CDGA 1LD9B 1DBML 2J1KA 3SDYH 3T0EA 2DRUA 1Y0LA 2W0KA 5D4IA 1KCVH 4G9FA 2IPTL 3WO4C 4BKSC 3E6FB 3LS4L 3EW3B 2XETA 4DGYH 1FN4B 5I23A 2ZXGA 4F7PB 1BOYA 2UWEF 5MEOB 3WU1A 1A22B 3US9A 1W0YT 2APXA 2WZ6A 5E5RB 3SDDA 3G7TA 4HJJH 5HGDA 3WNOA 4C56D 5I15H 5BUAA 4MCZB 4BSJA 1ZVSA 3MJ9A 4XOBA 4EN2A 4X7TB 2H1PH 4NM8H 4JK0D 12E8H 3HHSB 4XMLL 1JWSB 3R8QA 2WZAA 3REVB 1A6TA 4U1JA 1BVLA 1EHKB 2VCOA 3CZUB 4CDHA 1L7IH 2B2XL 4PGJA 2AJ3A 4PWFA 4YIQA 1XF1A 3CXHJ 2X70A 1FO0B 4O2FA 2HJLB 1KY6A 3ISRA 1WEJL 2N0MA 5JQ6L 1OARL 2R59A 4UB0H 3T9WA 4FTDA 1ZLSL 2OLDA 4RFOH 3OLEA 4S1QH 3IF1B 2VLKB 5F0LB 2FATL 1CBJA 3FSZA 3IXAA 4XNYL 3C6SA 1URLA 3U0PA 4S1SH 4HXAL 3LDBC 4NO3B 1PZ2A 1FFPB 1NAKH 1VLXA 1G0XA 2VXQA 4ETQA 3IU4H 1MCNA 4ZS6C 1DZBA 4GKSB 4UQBA 1JZ8A 2KKQA 1NLBH 2EIEA 5JORA 2DJMA 2Z31A 1CU4L 1QR4A 4JRYB 4PJGE 1DFBH 3B2UC 3QI9C 1G7HA 4Z3EA 5K9QI 3WO4B 4WKZA 2VE6A 2OCCB 4M61B 2HFFB 3VJ6B 2AZUA 4AEFA 4DKEH 2OMTA 4IJTA 3SDCC 4Z7AA 1KB5L 2CBMA 2NT0A 5IWLC 5EF1A 1CT8A 4Y9CA 2O61A 1T6WA 3ZZQA 4UV7L 1DYZA 5I1HH 2HTLD 5EC2A 4J4PD 4ZFZA 1TNMA 3OXSB 1U8LB 3JWDH 4H8VA 3HN8A 2GSGA 1X4YA 4HX1A 3IDIA 5KYUA 3VD3A 4B27A 3VFGH 4PMEA 1JNLH 4R4FL 4NUJA 3ZZSA 5LGHL 1VFOA 3DUHA 2QSTA 2WO4A 1L9QA 2DM2A 2LU3A 4Z0XA 1EDQA 3L4WA 3V0VB 1CDJA 3KWVA 1YN7A 5FOBA 5FDWA 3MHZA 3FSVA 5CJQL 4LKCB 5DZVA 3MRFA 5DMKA 3WMSA 2UZIH 4UMSA 5EZJB 4UUJA 2OJZH 2K8QA 1FVDA 2Y7MA 4YDJB 1IGCL 4M8QA 3ARSA 4G1MA 4P04A 3FB6B 5IJKA 1AG6A 1WIOA 2DDQL 2WXPA 1UEMA 2V2XA 4OZHB 1IGTA 4DVBA 3KCPB 2VISB 1TENA 1G7IA 3CXFA 4EQ2A 2HSIA 3U9WA 2Q8BH 3ZT7A 4ILDA 4BWWA 4XPAL 3C8DA 2IANB 2OCJA 1CZ8H 2XNAA 3U0TA 4TMPA 4I77H 1FCGA 1I1AA 2XPYA 4Z7QE 4HGMA 2VXUH 3CFJA 3BC9A 1SRDA 1P1ZB 4RGND 2NCMA 1X5LA 3FQNB 4TUKH 5D8JH 4Z23A 3UTQB 4XO8A 2XQYA 4G8IA 4WCYH 3VXME 1QEWA 3CDYA 4LSPH 3RURA 1I9EA 4OLYL 1BFTA 4M6OL 5HGHB 1U58B 3DOSA 3QUZC 5HD8D 3RVTD 4C56B 2BC4B 3D34A 2VO5A 1VZGA 5HVHB 3OV6A 4MS6A 3QWOB 1CQKA 4J39A 1GR7A 1A6UH 1NKOA 4D2NA 4I4WB 4I9XA 2HTLC 1SFHA 1NDMA 3IAPA 4J4PC 2DZEA 4GXFA 4E41A 3SGJC 3LH9A 3HPLA 4U1SA 1G4RA 5EUOE 3HC0A 4NQDD 1B0WA 4OIAA 4KX7A 1ORQA 2AK4D 3NYKA 5F93C 2FH6A 4QRFA 3LEYH 3OKMA 4Y1AE 2NUPA 5A40E 3QIUC 1QLRA 1ED3A 5TE6L 4FQJH 2Z35A 4ODTL 4GQPH 1RD6A 1F4YH 2WIIB 1U95B 2EAEA 2BVYA 5T5NG 1S7SB 4MMYB 3VQMA 5FO7B 1K8DA 3QDAA 4ODVH 4XMUA 5HYQB 1WVZA 4GUCA 5CIPB 4MZIA 5BV7L 4AMKH 3VW3L 3O0RH 1IILE 4Z3HA 3T77A 1XZWA 4NGHH 3KBEA 3ZTCC 3T08A 5E5LA 4W93A 5EDSA 2C1OB 3HE6D 1CD1A 2X40A 3V6OE 5HI5C 4IIQC 2AI0L 1EEZA 1HH6B 2D7TL 3JV6B 2X5PA 3CVHA 4U7MA 1IFHH 4QXTB 1B4RA 3BMVA 3KPPB 4N9GB 3B6SA 3LEVH 1YEKH 4JPWH 1YPZB 4K2UL 2ZONA 1MW2A 2F58L 4ZFOB 1X9UA 2ZD0A 3SDAA 3DLQR 1FF5A 4Y1TA 3WY2A 3I6SA 2KI6A 2DQEL 3ASWA 1DBAL 3MXWH 1UOKA 1OSPL 4JREC 4YDLC 5FUZH 4TVPL 1G7JA 3IAQA 5F7YC 4WO4D 4XN7A 1G9EA 4WK2B 1E9OB 1NBZB 3BVTA 4JNXA 3I75A 4P5SA 2J72A 1OSZB 3FO0L 5F1NB 4QWWD 1XTLA 5TQ0L 4Z5RA 2X28A 5KVDH 5EDXA 5EU7C 1ACZA 1DJIA 2Z8VC 3MRCB 4JR9L 4M62L 5ITFB 1P4IH 5HYJD 2LLNA 3V0WH 3R0MA 4AUYA 1QUPA 4PD4J 4G3YL 1RJCA 5DUBB 5BV7B 2BFVL 4IRJC 1Z66A 1XQ4A 1KJMA 3QDMD 3F65A 1IC4L 3SJVA 5SWQA 1GYWA 1D5XB 2R7EB 4LSVL 1JPST 3II3A 3E7JA 3N04A 5H94B 1S9WA 2LU7A 5I2IA 5J0BA 3BPNB 4PGEB 3WSQH 3U6XA 3W11D 2MCPL 2IDUA 1AI1L 3R18A 3O2WL 1E2VA 1ZHBB 4GRLC 3O3DA 1OW0A 3CTTA 1ETJA 3CSYB 3I9AA 1JBJA 4UT7L 1B6DA 3MV11 1HHGA 5FEBA 3J7HA 4POUB 1CLYH 2BSRB 4LBAA 4WHTA 3RU8H 1J8RA 1L7TL 3QUMB 4U0QB 3HE6C 3G6JE 4F3FB 4YDLB 3OKNA 1DQQA 1MY5A 2CXGA 1S9YA 1CS6A 4JG0L 4JREB 1VEPA 4RGNB 4AK1A 4UINL 2DY2A 1BZ9A 1AP2B 3ZUCA 4BFEA 3EH4B 4OGAC 4GSUA 3RVXC 4IBLT 1HINH 2BHZA 1OZTG 4DK6A 2BLFA 1T6VN 1NEZA 2XKNB 3DC0A 1I8MA 4P2YA 4QRPA 5T5NF 3S3JA 2Z4TA 5IEKB 4WO4C 5J56B 4NQDB 1DJZA 4ODSH 2PO6D 2AK4B 3KPRA 4IQHA 3M7OA 4QWWC 1UFGA 3H4FA 5E1AB 3MX0A 4AMWA 3HLAA 1J1OH 3LN4A 4FOMA 3QORA 1TFPA 5GGVH 1RK0B 5D7LE 1UWYA 2LGNA 3KDMA 5G2NA 5DO8A 2XZQL 3D06A 5D4HA 3RJOA 5E9DA 1SOKA 4D0DA 5IJDC 3MCKA 2KQNA 4YLCA 5BVPH 3K2UH 1OAXH 4MD4B 3QJSB 5ICUA 3BPOC 4LHUG 4KX8A 4WWKC 3UYRL 3T6QC 2EDRA 5F8QC 1ZT4B 1DP0A 1MFUA 2M26A 3GWJA 5CINL 3HE6B 3ETBJ 4KTDH 5ISZD 5FYLH 3W11C 3N40P 2OX5A 2YLHA 3O2DA 4HS6B 3DXAA 3IFOA 5HPMA 3OGCB 4DK3A 3GPSA 2UZPA 3QQDA 3GI9L 1HOEA 1N3NB 1T83C 4HH9A 5MP6L 4I1PA 3DX7A 3FTXA 4QD2E 4P9HL 3MO1B 4XODA 1F8TH 2E4FA 3OGOE 1G9MC 2GSMB 4BK5C 1R5IA 3TJHC 4P8QA 3GM0A 4WO4B 1B0RB 1EXGA 3T0ED 2XV3A 3L7FB 1BQRA 1A02N 3HC4H 5HYIA 2XX0A 3PWVB 1KYFA 4H8WC 2DD8H 4WENB 2QTEA 5FYJH 4PVBA 4G9FD 3SPGA 3ILEA 3CFEA 1UXSB 4XPGL 3VGDA 2EZ0C 5HYJB 4LCUA 3BPLC 4UZGA 1DLFL 3X13B 3HKZA 5DJ2A 4UCFA 3GRWH 5DRNB 5FYKD 4JZJB 1NGWB 3QDMB 5AAMC 1OP3H 4XXDB 2QJDA 4P49A 4PB9H 3VUAA 4DZ8A 3CFKA 1MCHA 1UD8A 5HHQA 1D5MA 3FUFA 4XVSH 1CXHA 4BRJA 1YG9A 2HWZH 1AZRA 1DQDL 3X12B 5IK3A 2OZ4H 2XZCH 3S6CA 3VX1A 4S2SA 2H8PB 2HRPL 4XVTH 5AUMA 3G08A 4N3TA 5I9QB 5AB1A 5SWSA 4JUSA 5DQ9A 3V4VB 4AYMC 1OGTA 3ULUF 2CO3A 5AAWC 2X1WL 1TT6A 3LAFA 4DVRL 4L8DB 4JJHA 3OG4B 4H7VA 2X38A 3K3QA 2HPTA 5EO0B 4Q2ZA 1PS3A 3ZYOA 5B39B 2O72A 2FRGP 3FTZA 4QKXB 1DQLL 2B08A 3ZLQC 4Q97A 3GHPA 4YDZA 4AT6B 3D0LB 4GP5B 2Y24A 4FXGA 2BSTA 3RG1C 1BGXL 1KDIA 3ZX1A 5E23A 2BERA 3AG4B 1TZGL 3VGGA 5DJ8B 3UZEC 4MJ6B 5IG7B 3RPIB 3IMSA 1BDYA 4QXGH 3T0EC 4BH8A 3P9WB 2F9BT 4C4BA 4R5TA 2AKRA 2PO6B 4RMSA 4GRMA 4FA7B 2VWEC 1CFSB 1RUQL 4OBRA 5LBGA 4ODHH 3WHXA 6PCYA 3FXIC 3TN0D 5ID0B 5MENE 1OAQH 2J56A 2HXAA 3P0YH 5HHOE 1H15B 2IOMA 5KTEL 5F7EH 4M6NH 5ALCL 2PYEA 1SXCA 1CXKA 1A8ZA 3SDDC 1JPSL 4NN6C 1SVCP 4YFLF 1TMCB 3L5WA 3VD0A 1HYSC 3MXVH 3QEUB 3BIKB 4D3CH 1UADC 5E7BA 2FQEA 2IPKA 4OJFH 1R5WA 3QUYC 8FABB 1MW3A 5FYKL 3PWJA 4NO5B 3NFNB 3SKJL 1W0WB 3FB8B 2GTZB 3KWXA 3BZ4A 4BSVA 4KTEL 3FUNA 3TONA 2YHGA 4EUPB 1FYTA 1YMMA 1CTOA 1FV1B 5F96L 3VI3B 5ISZB 3QH3B 5I17B 4BZ1H 1KN4H 3MOQA 4U6VL 4Z7VB 3ARYA 3E8UL 3MLWL 4G8FB 5D9SA 4U6YB 3CVBA 4CNIA 2AQPA 1DFXA 3HPJA 4J6IA 1GJUA 1IGJB 2YZ1A 2WZPA 3ZDYF 5E1GA 4HQQL 1FH5L 4KQ4H 5BZDA 2JFCA 3NIFB 4KK5D 4N2IA 4NFBA 4BZ2A 4PLNC 4H0LC 1I8UA 3T0EB 1UOVA 1I1AD 1U36A 1Y0LB 1UD2A 2Z31C 3OM3B 4LDOB 1NKRA 1QPXA 3MOBH 4G9FB 5IQ7H 1JXKA 1MCLA 3U0WH 2J88H 3BAEL 4BCXA 5ESVA 3PP4L 3K91A 3VNYA 5HHNB 1H3PH 2P4AB 5HGDB 1F45A 4NN6B 4KRPC 2HX9A 1BQHA 2E7HA 3O3EA 3K4AA 1URZA 3PPSA 4E41D 2EH7L 1BYOA 1XCTA 1HKFA 4Z3TA 1WAAF 4G8GA 1XGRA 1EGJL 3FQ1A 1OGAE 1BVLB 4U1JB 2B1HH 2FYYA 1M1XA 4GB9A 4A7SA 4O51A 5I30H 3LIZA 3Q6FA 4YIQB 1ADQL 2YD8A 3TT3H 5EU6E 1N4XH 1I1FA 2X70B 1A14H 3H9SE 3ATEA 2F54E 4MWFA 5DC0A 4Z7NB 4OCLC 4X7FC 3BH8A 4CGTA 4JKNA 3EIFA 1DJGA 2WSKA 2O5NA 1Q72L 2ODIA 3UMTA 5E6SB 5M7QA 3PWPE 3Q01A 3SD5A 5FV1L 4WU7A 2YMOA 3IXAB 1XZ0B 3C6SB 1HXMA 3P3SA 4L37B 5F6HJ 1EJFA 3MGAA 1F42A 3AAZA 4LCVA 2GITA 2OMVB 3HUJA 1PVHA 4ZS7H 2EDFA 4KXCA 4CUCA 4HYTB 4ETQB 5IQMA 2YD9A 3DHJA 2X4NA 2BSCA 1JTPA 1WBYA 2AJZB 3HBZA 4XCFH 5J3HC 4NZUH 3V0GA 1AC0A 3H54A 3IJ9A 1VFAA 2H0EA 4WKZB 3OZ9L 1G1KA 2Q3ZA 2VE6B 4PLOB 1MCQA 4YFDB 1X3DA 2OMYB 1LM8V 4DP7X 2OMTB 1UASA 4K5MA 1V10A 3RTQA 1J1PL 2YARA 2GI7A 5BRPA 1BXAA 4JFPA 1QKZL 1P1VA 2G5BA 5EC2B 4ZFZB 1OP3K 5LNGA 4K9EH 4YSCA 2C3WA 1A5FL 1INEH 4PWEA 4JDZA 5E2TH 2GSGB 4HX1B 3TN0B 5KYUB 2EO9A 4ZMTA 2X89A 3WLBA 1RZFH 5I28A 2A0LC 4KJYA 1UWXH 5I1IH 1T20A 4NUJB 5A2KH 2LLLA 1NBVL 1QFWL 4R2GD 4D9QE 3NH7L 3HVNA 2UY6B 4Z95H 3NSJA 4HEPA 4AEHL 4G7VH 1SVZA 5FDWB 3WKML 2W07A 1YN7B 5FOBB 2A1WH 2MFNA 3IJEB 3MRFB 4DESA 3WXWL 2VSKB 4OLVL 2CZNA 1DVSA 2OW6A 4UUJB 2VRQA 3X3GL 1PTZA 4LDLB 2IDSA 4M48L 4CN4A 4M8QB 3RGVA 1J8KA 3LQZA 4XT1C 2V2XB 4WEBL 1IGTB 3V6ZA 4WFED 4NERA 1PZSA 1G7IB 4NZJA 1T5WB 4FMKA 4X50A 1ACCA 5BZZA 2F5AL 3QGVA 2BP5M 3D4GA 2KQMA 4J28A 2EDMA 4KVNL 1MCSA 5A2AA 3BEVA 4E36A 2XNAB 3U0TB 4BQ8A 1I1AB 5F1IA 4OGQC 4V1DE 5F88A 4JFDE 3PRZA 5F9DC 4DEUA 4NP9A 1KTDA 2XWEA 3QZBA 3SDYL 2ZG2A 3CPLA 4AYID 3UTZB 1O5DT 3UEQA 2YKLL 1QEWB 3N1PC 3F85A 3IAGC 1KLGA 1ILSA 1JERA 3DOSB 4GQQA 2P7TA 3CUPB 4N2MA 3SDAC 4DGYL 3FU7A 4K5PA 3GPEA 1HQRA 2KZKA 1J5HA 2AERT 4HHAB 5D72L 2JKTM 4HJJL 1NDMB 3APFA 5I15L 4RX4A 3EDKA 1U6AH 4GINA 4E41B 4QRPD 3N44B 2L8AA 1IIKA 3HPLB 4HCRA 2H1PL 4NM8L 12E8L 1M71A