3ZTDC

Pvhl54-213-elob-eloc complex _ methyl 4-(((2s,4r)-4-hydroxy-1-(2-(3- methylisoxazol-5-yl)acetyl)pyrrolidine-2-carboxamido)methyl)benzoate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
139
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 139
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3ztdC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3ztdC01
4BKSC 4W9IC 3ZUNC 4W9JC 4W9KC 4AWJC 3ZTDC 4W9LC 3ZTCC 4BKTC 4B95C 1VCBC 4W9EC 4WQOA 4AJYV 5LLIC 4W9DC 4W9HC 3ZRFC 1LQBC 4B9KC 4W9CC 1LM8V 4W9GC 3ZRCC 4W9FC
chains in the Genus database with same CATH superfamily
3I84A 1QQDB 5H37A 5KG9B 2Y5TA 4U6HA 1U8PB 2VXQL 1WGVA 2I5YH 4LKCB 3AQZA 1R19A 1MCBA 5HGHB 3WKQA 5I82A 1S5IL 4L1BA 2ZICA 3BJLA 1CXIA 2VDKH 5EIIA 5IFAH 4QF1B 3MODL 4ABVA 5HYQA 1T1XA 3L1EA 2FR4A 5F1IB 3AW5A 4X4ME 3KXFA 1D3CA 3NJFA 1ZIBA 4DNLA 3QQXA 1NUDA 1P9MC 1T4WA 1TENA 4PJ7B 1BQ5A 5GS2H 1I1AD 5E8DL 2J6WA 3WO3B 4FXTA 5E1QA 3H55A 1MW0A 3Q2CA 1BP3B 1DL7L 5D7IF 2OCCB 4HJJL 1RZ8B 5JHDA 1HKFA 4K5PA 3V2AR 2E9BA 1J05A 1KC5H 3DV6A 1NCJA 3R06B 4OTXH 4PJIE 3FN3A 5EPMA 4A7GF 1C7SA 3S2CA 2YSTA 1F6FB 3TF7C 3FB7B 2XWEA 1BD2B 1SDDA 5EUOA 3VRJA 4DO4A 2K8MA 5GZNA 2NW2B 4HWZB 2X89A 1I1RA 3QNYA 1OOWA 3Q8EA 4IBSA 1T7ZA 1RZFL 1THAA 1ASQA 1IEBB 2FHCA 3CDZB 2E9GA 3VXOA 4AKQA 1UWEL 1WRFA 2QQLL 4P5KA 3ZKSD 1JPFB 1S78D 2CNZA 4N6RA 2X10A 5FGRA 2ICWA 5HI3C 5IHLB 4NHUB 5H4YA 4H1LG 2Y7LA 1XF3B 5DA4A 3HHSB 2EYRA 4M3KB 2HKFL 3RWCB 1DQDL 3KXFD 2FJHA 3QJRB 4KK9C 1TO4A 1NMCB 2NOYA 5A2BA 1KB9K 3EJZD 3AVEA 3EJJX 3MZGB 2GEQA 1X5HA 3BUYB 4PJGF 1YMMA 4XH2A 1VGKA 2J8UE 5JHDD 4MS6A 2AXFA 2DQCH 2DYPA 4Y5YC 5IVZB 3I9GH 3Q8FA 1OB1B 1SJXA 1HESA 2P7TB 3A6CL 4P2OB 4GW4B 4UT9H 4DGYH 1ACYL 1DFBL 1QRND 2WTRB 1OSZA 1H8LA 5DYOA 2QVTA 3KCWA 3RGVA 3KYNA 2WLZA 2KDYA 2ZSWB 4QXTA 2E9JA 2X89D 3VAEA 5T8IA 2AXWA 3W11D 1E27A 4DVBB 4RX4D 3FRUA 5I1KL 3D09A 3SE4C 3WTTA 1T66C 1XSIA 4FRWA 5KVDE 1RH8A 2GSGB 4Q4EA 3FT4A 2NCMA 1UD8A 1YEFH 5D7IB 1OT2A 1C16A 4MJ6B 1ND0A 3FU9A 2QHRL 1AHKA 2IG2H 2ZOTA 1KCWA 1DJXA 1IUZA 2VL4A 1U8NB 5E7FA 2XN1A 1AYOA 2XX0A 5CCJA 5FA3B 3NGBC 5GHWL 5CLTA 4I13B 3T77B 1MSPA 1L7IH 3FU7B 2PTTA 3V5KB 1PLAA 2B8OT 4ZS7L 3AGWA 3LEVL 2NY4C 4ACPA 1QR1A 1A1MB 2XQBL 4GXUN 5CIPA 1KJ2L 2CZNA 2ESVE 2P24B 2VZOA 3MRDB 5E2VH 2DYPD 2CDGA 1GSKA 1BAFL 4QWWD 4F7EB 3GKWH 1GKOA 4E68A 3R8QA 5IJBC 5LHDA 2YD5A 1XR8B 1AGCB 4GP4B 4LLWB 4D9RE 3QEGH 4F2ME 1CG9A 1N2RB 1NCCH 4RWHA 4XOEA 4N2MA 3NCMA 1IL1A 1E0OB 1QX1A 4PWFA 1A9EA 3ISWA 4X8JA 2F1AA 5CP7A 3MCLH 2OQJB 4O2EB 1OTSD 5T3ZE 1L9MA 1TZOA 4J3WA 4YSRA 3SOBL 2YK1H 1BOGA 3HC3L 5FO2A 3KPTA 3RX9A 4XO8A 3IDJB 4PJGB 4F24A 3T8MA 3B9VA 4BGLA 4KK6C 1PJ9A 2NZ1A 4KTDH 1S3RA 3GXMA 3DO7B 1AJ7H 4FXGA 1I82A 1JZ4A 5HI5D 2EKJA 4B60A 2GFBB 2IIJA 4M6MH 5GIRA 2Z8RA 4GRMA 4LHUG 1J5OH 3QUYC 3FQ1A 3D2UD 3ECBB 4U1HA 4R7DA 3IRZA 4J4PC 5DHEA 1REIA 1BQSA 3KWWA 1JS4A 2CR3A 3MUZ1 1SN0A 2XBZA 2ZCLH 2JCCF 3O8XD 4O2CA 2BOBB 3KLAA 1AP2A 5CEYB 4ONGL 3HG4A 1DJIA 3DRQA 1HE8A 1ZHLB 4YR6A 3C9NA 5FX3A 1F4YL 1OCCB 4XBEL 2JV6A 15C8H 1JYNA 1DSWA 3BFQG 4OKDA 3QISA 4JQVA 1ZOXA 1L7TL 3HG1B 5AOIA 1SJHB 1YEDB 3NZ8B 3K72B 4UIMA 5DLLA 2V5YA 3UTZB 3K2MC 4XC3H 2M26A 4M1GH 4NO2B 5IM7A 2H1LM 4B9GA 2NY5L 3LPGA 2FJUB 1Q72H 4NGHH 3RTQA 1QWHA 5E5UB 1T03L 4AQ1B 2XQYG 3V4VB 4FLOA 1L5GA 4U7KA 3U6XS 4H8UA 1EAPA 4BQCA 2N3JA 4LPCA 4KOCA 2DJMA 4G1MB 4RDBA 5LNDA 4HKZA 5IB2B 1NGPH 2K7QA 1UADC 5C3TA 2BFVH 4WK0B 4PJ9C 3S35H 5E4IA 3BEVA 1A4KA 3U0PA 2B2XH 4Z7VF 2EDHA 2PXYB 3LOWA 2HT3D 1OE2A 2WQWA 4MQSB 3S96A 4DVRL 4UOW0 5I16B 1HYSD 4W9EC 3L3IB 4AUJA 3CXHK 5G2NA 4K8RL 4KXZH 4JFOB 1QNZH 3V0WL 4JJ5B 1JZ8A 4KJPC 5AENA 1MN4A 1WVZA 4QRSA 1XXDC 2OSLA 2EKSB 1L9RA 5KBNC 4IQHA 4HH9A 1KEGL 3EOAB 4FQJL 1MW1A 2E9WA 3EXJA 4GXVH 3QHZL 3WNJA 3X3FH 3NBNA 4QPEA 4J2XA 2ZUTA 4ZUUA 4CSTA 2DIBA 3LIZL 3FFOA 3FFCB 4ZD3L 3GSRA 4Z3TA 1MHPL 5ICXB 3UBXI 4B5EA 3RTQD 1XB8A 4XTRD 3NJNA 4JY4B 3MUGA 5FK9B 3CLFH 5EO0B 5EBWA 1FGVH 4JPKL 4OQTL 3N85H 1N19A 2JCCB 2X28A 4HSCX 4L3EA 1JZEA 4KHXL 4N0UA 4BH8B 3PABB 2JJTA 4N90D 2NY2D 3ARXA 4IBUA 2AVFA 3Q5TA 2A74B 4V1DB 5FKAB 4PU2A 2QQNL 5A2AA 2IALB 2Z7YA 4E0RB 4PG9A 3DYOA 3OLGA 3GDBA 1TKWB 4XPAH 4K3EL 1FVEB 4V33A 2IANB 2AQ3A 1E4XH 1KGCE 4JM2C 3UPRB 3B7SA 2DMCA 4P5TC 1T0NA 4UAOB 5AG9A 3TA3A 4M7ZC 5D1QC 1TZGH 2J1WA 1QPPA 5D7SH 4BK5C 4R97C 4AGMA 5C6TH 4BSJA 3HC4H 3QDMB 5EIVA 4MA1B 1DQVA 3DYMA 3G6JA 3HNSH 4PS4H 2YMTA 3QCUH 5I6PA 4YXHL 4MQXC 3VXSE 4F8TA 4N0YH 4Z7VB 5K9KB 2NNRA 2FWOA 1MVUB 2RFXB 3BDXA 1P5UB 5KN5B 1E4KA 1T5WA 3PWPE 4W6WB 1K8DA 4JRXB 3BW9A 4L3ED 9CGTA 4KQ3L 4HS6B 5KJRL 4D0BB 1PIGA 1UB5A 4UNUA 3EJYD 2DDQH 3ZSSA 2B7DT 1ONQB 3T3MF 2V3DA 5T5NF 3PP4H 4K9EL 2Z65C 4YWGH 3GB7B 1SZNA 4EI6A 3ZMEA 5EN3A 5IR1A 4FFTA 1X5JA 2R27A 1PZBA 3AFLA 2X2UA 3IMUA 3WMSA 2HKAA 1IGTA 3HR6A 4ZX6A 3PFUA 1MCEA 1IC4L 4H2CA 3UYRL 2A6JB 4X4MA 4YBQC 1NBVL 4WI0B 1DBKH 3STZA 5D6DC 1FGNL 2B59B 5IHZA 2FZ3B 3TA3D 1MW3A 2IADA 4YPJA 5EU6E 1AANA 5D55A 9PCYA 3JZ7A 4NOFA 1GZHC 4S1SH 1Y0LA 1MUJB 3M1CA 4LCCB 3CVCA 2NTSP 4NT6A 3MUHL 5K1VA 1OSEA 4UDTB 1M7DA 2IAAC 3SDDC 3TZVA 4HPOH 4WSJA 3MPCA 5A40E 4HUVB 4K94H 3S34H 5GGTL 2NXZB 3HLKA 5EZJB 1ZGLB 3A23A 3ZIMA 1CBJA 2V5TA 4MJHA 2YPVH 4MXQC 1PZ3A 2C9SA 2MPVA 3HEIB 3IDNA 3KPLA 1Q90A 5IUSA 3Q06A 1U0QA 3DPBB 1HAUA 1S3KH 3V4PL 3TO4D 5I2IB 5I30L 3EDJA 4LBAA 1RZKL 3DDGA 2BSSA 2VUYA 1NLDL 3K2UH 3B9KB 4NXKA 2PO6B 4JVWA 4PREB 3TBWA 4L5FE 4KX9A 1LILA 3D4GA 1GVIA 4PJAE 4FLRA 4R84A 5DD1H 3L6FA 4K55A 4G6AD 3QSKB 3S3JA 2P8MB 1IV8A 4WNSA 1I8IA 1S9VB 2OMTA 5DJ2A 2QGCA 3Q8AA 4ABWA 5I1DA 1QFUL 2Q8BL 5ADOH 1V7MH 5FV1L 1J1XL 1LWJA 4X9FA 3GSQB 3SDXE 2Q86B 2E6QA 4WQOA 1NSNL 4NKIL 3CC5B 2XWRA 2GJ6B 5I74C 3MNWA 1M6OA 1R47A 2V8LA 3TZVD 4YH6A 5J06A 3QUKA 1JUFB 1RJYA 3T3MB 3MGAA 2RR3A 4FXKA 3U79A 1QI4A 3NA9H 3NZHH 4I18A 5JMOC 2WM0A 4GT7A 2R69H 3KVPA 5J3HC 1NANH 4N2AA 1GS6X 3F7KA 2G2NA 5DWPA 3V6OE 4R4ND 3B7YA 2R2CA 3TBVA 1ZWIB 3EJTA 2ZKHL 3ZW3A 1AQKL 1XD1A 3H4HA 1KBGL 4KKRA 3NFPA 4UDUB 5F7FA 3V55A 1TT6A 2WD0A 4WU5B 1A0QH 4H8WC 1UACH 4B7IA 2IDUA 1IC0A 3V7AG 5M7QA 3QVAA 2OK0L 2P5WB 1XCQB 4R4BA 1KV7A 4KVPA 3V95A 3C08L 3WFDH 1RAMA 5D6CB 5IQ7H 1LO5A 3GNMH 1YNKL 4I2XE 4DP4X 3HBQA 4L1HA 1KB5A 3V79C 3L3OB 4JN1L 5I1JH 1I7TA 4ODSL 4ZJ9A 2P52A 1UD6A 3M45A 1IJNA 4XP1L 3H6JA 5DT1L 1C12B 1X5XA 1KEMH 1T0PB 4PLOB 2Z1PA 1CC3A 1JGDB 5ISZB 2ARJA 5D1XB 2JLPA 4RQQA 2A4ZA 2ESVA 2PCYA 3F7LA 3SYAA 5GSRB 4JPSA 2WTPA 4ZMTA 2E4TA 2R59A 4K07A 1SOSA 2XRAH 2IFFH 4CU6A 2AP2A 3PWVB 4F2MA 1CQKA 1OY3B 3MLUH 4N1EA 3A3YB 2YAEA 3TV3L 1SUHA 4Z0BL 1YY8B 2ETWA 3FUFA 3CXDL 4BA0A 5JO5B 1VJSA 5JOPE 1SY6L 1IAMA 3J07A 3N2JA 2BO0A 5DDHB 3S6CA 4MDRA 4HULB 2DLHA 2H2PC 1IKNC 2B08A 1NCDH 3DV4A 2WWMC 3MN8A 3HNTH 4G11A 5EG6C 2GT9A 1S9KC 3UCQA 4K4KA 4JDEA 3VFGL 2PWEA 5DHYB 4L9LB 5L6YL 3C5SA 3TWCL 4XVSL 3G5XA 2ESVD 1HEHC 3OL2A 5GRUL 3FCTA 3RI5F 1R34A 4HMCA 2AXJA 5LN4A 3PIQB 3Q8BA 4DP9X 4MWFB 5JOFA 5CCHE 3U9UA 4DW2H 5IW3A 3WNNA 2P8PA 2AMUA 5BS0B 1HL4A 4ADIA 3PFQA 3ESUF 3MGOB 4ENZA 2B9AA 2HFGH 4PCTA 2FGWH 1FWXA 2LFEA 1MCWW 3MLXH 4NHCL 3EYVA 3GGWB 4YXKH 5CZVH 3LKRA 2Z8SA 1XSKA 2XN0A 2NY6D 4BZ1A 4O9HH 4L4TE 4ZQKA 2APWA 1RSFA 5LGJA 3QZWG 5CJOL 3HS0A 1GR7A 2ADIA 2WKGA 4UINH 1QD0A 4JFQB 4D0DB 1N26A 3ZQ9A 3FU3A 3FTSA 3Q13A 4LOVA 3MFFB 1NUNB 1EEQA 2NQDA 3LIZA 5EUOF 3T6VA 1O9VA 4WF7A 2ERJB 4AXWA 4KC3B 5EU3A 2NYZA 1KIUB 2D03H 3B56A 4I85A 2CJ3A 5EDXA 5GGSA 5DJZB 5L4JA 3ETBJ 2V9TA 1I1AB 3QRBA 3CK0H 5FOBB 4W9JC 4EZKA 2GI0A 4ZMQA 1F0LA 1SXAA 1GGCL 1U6AL 3OB0K 4IRJA 2QQKH 3B2MA 1KFGA 4JANB 1JK9A 4ZG1A 4HD9A 2K6ZA 1ZLUH 4G9DA 4CUCA 2RAMA 4O02B 2V2WA 5ESQB 1DP0A 4AJYV 5I71C 3B2UD 5E1GA 4GRLA 4NRYB 3T2NL 3RNKB 3FTUA 4DK3A 2CO6B 1ASPA 3QXAA 2Y5TB 2ZG2A 3UTQA 4U6HB 1XVSA 2NY3D 3VFVA 1YEEH 3KZ8A 4HS3A 4KVCH 4MXVE 1CGSH 1PDKA 2O5XH 3BWAA 1INDL 3ARZA 1QLRA 4AK1A 5TPWH 1PQZA 5ICYA 5EIIB 4NCC2 3RYMA 4AEFA 2VDRH 4JDTH 5HYQB 1CGVA 1T1XB 2MHAA 1MFCH 2FR4B 3KXFB 4M43L 4X2UA 4GBXC 3LRMA 4ODBD 2IFGA 4HDIA 1AQ8A 3P0YH 5DD6A 3ISRA 3EYQD 4Q9RH 3T3PE 1GTFA 5E8OA 4DFHA 4UMGA 5I1GH 4IRJD 5CZKA 2F54E 4YL9A 5HDQL 5JHDB 3CPUA 2BIMA 2FBOJ 4NJAH 4KAQH 1FFPA 1J05B 4Y2DA 3DV6B 1N6QH 4ELKA 2OJ1A 5EPMB 4OZFG 3CZEA 1VESA 1CR9H 3TT3L 3NT0A 4Y1AE 3RZCA 4GRLD 5EU7E 5C2UB 1SDDB 5EUOB 4ZW5A 1NLBL 2NQCA 3VRJB 3EADA 3VXSA 4NUJA 3MRNA 5DQDL 3D7PA 5C0IA 4WNQA 1QSVA 3QNYB 1C5CL 3K1DA 5CWSA 3KPSD 4B7LA 1OARL 3ZZLA 3BRDA 1E6JL 3RIFF 3PWPA 3VXOB 3FXIC 5E5MA 1Y6KR 1OVZA 3I6SA 4P5KB 5GGQH 1ZTXE 5EORL 4AM0A 1Q0YL 2ICWB 4IK6A 5DWUL 2Q9OA 3AQXA 2EYRB 2FT8A 3JT2A 1B9ZA 4FG6D 5I73C 2FJHB 1L6PA 3BGAA 4QRTA 5DJAA 4OM1L 3KBPA 4UCFA 5HHOA 4PJFF 1FZOA 2KHAA 1I3UA 4FNTA 5DD5L 3WUWA 5T33L 4PGBA 2XT1B 1HEJC 4LSTL 4RFEA 1YMMB 4XH2B 1VGKB 1KGCD 3SYOA 2AXFB 3FQUA 1WFTA 3VFPA 2A0LC 3RWDA 4YDNA 2DYPB 1H3WM 3BLKA 3FN0L 1WHOA 3GZKA 5ALCL 3IFOA 4ODUA 5EU6A 2Y7SA 2XQYK 2HLAA 3CDYA 4L0ZA 5AW3B 3RZCD 4CGTA 1CDHA 1OSZB 1JD7A 5DYOB 5HDWA 3RGVB 2BXYA 3KYNB 1O5PA 3GSXB 3VXSD 2HTKC 4QXTB 3W2DH 3AU1A 4MMZA 4PN6A 3UGUA 1VENA 5IMOA 4Q7DA 1B2YA 3X14A 1EDHA 2OCJA 2A9MH 4C4UA 1VZHA 2JKRM 1E27B 4L3FA 4M48L 3O2DH 3FRUB 1YSOA 1YNLH 1E2VA 3FT4B 4OLWH 1SLWA 3MRIA 1C16B 2ZONA 5LG1A 1ZVSA 1ND0B 3D08A 1MCRA 3LHPL 5T5FH 2ZPKL 2LU7A 4BSVA 5D7JA 4XNYH 4FULA 4F8NA 1FV1A 4UZGA 5HHOD 1XB6A 3CC1A 2J1YA 3QCVL 3NSXA 2PTTB 3U48A 3ECUA 3JVGC 2NT1A 4EUPA 1KCSL 1KPVA 1UXSA 5DO2D 3Q0HA 2Z91A 1QR1B 3J2PA 3LKPA 1KFAL 4HC1A 5CIPB 5KSAA 4AVKA 4F1SA 1CO1A 5EIQA 2CDGB 3MTRA 4WGVB 5DEZA 5EU6D 4R5XA 3JWNH 1XIWA 2WXIA 2FRGP 4PB0L 4FA6A 5AFAA 1A3RL 3LHAA 4X50A 1CG9B 2GSIA 1IL1B 3KE0A 3EH3B 1JHKH 1A9EB 1JXKA 3TVMD 2WB7A 4X8JB 3FW6A 5CP7B 5JXAH 1F58H 1GS7A 3BZ5A 4J8RA 3V7AE 5I6OA 2W9DH 4NI3A 2R8SH 3M17A 4Z8FL 3VD4A 4FQ2H 1BOGB 3V6OA 3IGKA 3UTSE 3HOGA 1KCRL 2A1WL 3QA3A 3ZGHA 4NCDA 5CEZL 2IPKA 2V7NA 3LKQA 2C9PA 3BAYA 4LPTA 3ESNA 5A3ID 1XCXA 2D7NA 4LAQL 3HE6A 1GPOH 3NCXA 1E5BA 4FXGB 1OGPA 2LV4A 4FQCH 2FL5A 3CN0A 5GIRB 1QZ1A 4GRMB 1KTBA 2MWCA 4U1HB 3U9PH 4L29A 2QT6A 5JIDA 4R7DB 1KCKA 4I2XA 3CIQA 3KWWB 1IM3A 3AREC 3B83A 3SGJC 1SY6A 2JFCA 4W9DC 4O2CB 5BXFA 1IBZA 5DHDA 1HZHL 2AK4E 1G6RA 1UT2A 2AQNA 1AP2B 3H42L 3KLAB 5D7LD 4EKXA 1QSFD 3DRQB 3BP4A 3OM3B 4YR6B 3C9NB 5E6UB 4XOBA 3HBPA 3BFWA 3ULUE 3DVGA 5F8RC 2QV2A 1XGYH 2XDHA 3QXTA 3OVUB 4AEHL 2K1MA 4MZ2A 2F53E 2ZKMX 4WW2C 1DBAH 3HVDA 4UIMB 3WHXA 1CMOA 2Q7YA 2LW3A 4FADA 5IM7B 4ANXA 4ECNA 4X98A 5IHUL 1PLGL 4Y8DC 2F6AA 2PKDA 3RTQB 1JPEA 4AGQA 3NFSL 3FQXA 2NMSA 1JG9A 3EGXA 5EZLA 1L5GB 1EAPB 3I2CL 1MH5A 3HE6D 1CZ8L 3IKCA 4K73A 3BN3B 1G1CA 5AQ0A 1TTUA 4HKZB 5I1CH 1F97A 3ZYZA 3G6JF 4ZMXA 3VACA 4HG4K 2E76C 3BEVB 5KOVC 1A4KB 5JR1H 2M83A 3U0PB 4KNQA 1D9KB 1AE6H 1IM3D 2FQDA 3S96B 1SN5A 2Y3NA 4YBLB 5C0JA 3NJXA 5A7EA 4HU8A 1UTDA 4EDWL 1R75A 1WITA 1QFHA 1KSRA 3WS6A 2Z35A 4QRSB 2ENQA 2OSLB 4Z95L 4OJEH 2E46A 3AG1B 4HH9B 2K6YA 3ESPA 1TSRA 4Q56A 1BM3L 2WP3T 4IS6A 4NOBA 5DZOA 4JFFE 1E67A 2EC9T 2QZQA 4ZUUB 3VX0A 4D94A 1DQLL 2OMYA 1SBSH 2JF1A 1T20A 3GSRB 2KQMA 3IJ9A 5CO1A 4L8BA 3CLEH 4KI5D 2Q10A 1SF3A 3B34A 5I28A 3CVHA 3MUGB 4KK8C 3AQDA 2I9TA 3PL6A 4OZIE 2IPTL 4L8SC 5EBWB 1HHGA 4WFGD 3DMMC 1EAJA 4DQAA 4EI5A 4L4TA 4L3EB 3LS4H 2G60H 1VPOL 2V4LA 4KQ4H 2BNRD 4N0UB 4DHLA 1KB9J 3ARDC 3F62A 1T1WA 3WAKA 1I9IL 1C1EL 2F58H 3DJTA 3H2QA 3QPXH 3RG1C 2CK2A 4GUOA 4PG9B 2WOBA 4HW6A 2J3SA 5HDBE 4AMXA 4M7LT 3LS5H 1R3HA 5CLXA 5I9QC 4LHQB 4GJTB 3CSYA 4A7UA 4N8CH 1A7OH 1M3JA 4WFFE 4R2GC 4X6BA 1T0NB 3W57A 3TA3B 1F4XH 4YHOL 2AEWA 4F37F 4X6DE 2FATH 5CMAA 3IJSA 4MJID 1YQVL 1OW0C 1FO0H 1X7TA 2O5NA 3TJHC 3ZHNA 4DN4L 1XAUA 3G6JB 1VFMA 4NAMA 3WLWC 1MFUA 3BN9C 1AC6A 1ZLVH 1DQJA 5KOMC 2J1KA 1J8SA 5HGAA 2FWOB 4XWOD 5ANME 4J3BA 1S9WA 1CDUA 3OSKA 1MCWM 1T5WB 3D34A 4Z77A 1K8DB 4HIHA 1U4EA 3POHA 1ZHKA 2GCYA 3BW9B 1IU1A 2J73A 2J8UF 1RP9A 4L1TA 4PPTA 2CGRL 3CU7A 1UB5B 2CBMA 1CN4A 1ZHNA 2WNXA 5LCVL 5GRYA 3UO1H 1RZ7H 1CK0L 4GSQA 2DEYX 2ZWSA 3FO0H 5F7HA 1AI1L 4EI6B 2HLEB 3FCSA 5IR1B 2X3CA 1LO2L 3MXVH 4ZTEA 2XYBA 5E6ZA 3HAEG 1I3RA 1K5WA 1IGTB 4GEIA 1WAPA 4WO4A 1ZVYA 3SBWA 2F5AL 2OR7A 2ZOOA 2H6UA 4UT6L 3STZB 3F83A 5IHZB 4HHAA 4XNUH 1MEXH 3RDJA 4AYDC 3LQAH 2IADB 4I1RA 4PRHD 3FULA 3UTPD 4GAAA 2YUXA 1BJMA 1Y0LB 4M1CC 1EXUA 5GGVY 3ME0A 2F54A 2X2HA 4JM0A 5B8CC 3Q6GH 4JKLA 4NT6B 4LOFA 1KCVH 1V10A 5DA0B 1I8MA 1M7DB 1MPAH 3NCYP 3C60A 4PY7A 3TPUA 4PVMA 3GUTA 4PFEA 4N6QA 1DZBA 1JWUA 1CI3M 2UZXA 4NPJA 3U4AA 4Y1AA 4FQXD 1USQA 3FSVA 3KL3A 2I85A 3GD1C 1H3PH 3UAJA 4N68A 1TNNA 3HI6L 4KO5A 2BS8A 3IMWA 3U7WL 3ZL4L 3IDNB 3KPLB 2AJYH 4TSCH 4HJ0C 4P57A 5EEXA 5PAZA 2ZUXA 4NUPA 5HXMA 3RRQA 5EUKA 1EBAA 1U58A 2BSSB 2X1WL 3TBWB 5BZDA 4KMTL 3WDIA 4WO4D 3QYMA 1XHHA 1KCLA 3BT2H 3SDAC 5B3NA 2MCPL 3T2QA 1A7RL 4E9WA 2LGNA 3ARBC 1I8IB 2OMTB 3NSCA 4TXVB 5DJ2B 5DRNA 3BKJL 3VG0L 5I1DB 1MCLA 3PHAA 3HS9A 5D8JH 2V9RA 4NJ9L 1AC0A 2CHWA 1YDPA 2J8UB 1N5YH 2VGLM 3MNWB 1M6OB 3TJEL 4EIZC 3ZTJH 1J88A 3QUKB 4R0LC 1RJYB 3WNMA 4N2CA 4FXKB 1W0VA 3S5LA 5HHME 4LCIL 4I18B 3JV0A 1GAFL 1C5BL 1P4LA 1HQ4A 1F4HA 3UAJD 4KBPA 4RFOH 3TBVB 3QZBA 4FG2A 4AC2A 2HTLC 2NY0C 4HUCA 3TU6A 2FECI 5BO4A 3NFPB 3P2BA 4M6OH 4LPVA 2DQUL 1RFDL 2D2OA 2WK2A 5IT2H 3EYUH 1H5BC 2CCVA 5I76A 5FW6A 4LEBA 3QUXC 3NIFE 2VLLA 1AS8A 5L7XH 3D33A 1UZ6E 5E1AA 5KTEH 2PUQT 1M42A 2QSCL 3CXHJ 3OLIA 4R4BB 4A67A 5BQ7A 4BFEA 1RI8A 3VGBA 4OCRH 2X70A 2C9QA 1LO5B 1KB5B 4JRFA 1D7FA 2YMXL 5CAYB 1I7TB 4K94C 5L2KE 2VLKE 2FD6H 4XN2A 1JZFA 4N1HB 7PAZA 5J6GA 2DIJA 1TTAA 5CILL 3PAZA 4QY8A 2ARJB 4RQQB 2XG4A 2ESVB 2YAHA 4K0OA 3MRMA 4XPGL 1IM9D 3RBGA 3E9TA 3ZKXB 1XT5A 3WTYA 5B3JE 2GIMA 2CSPA 2VDPB 3B1UA 3ETSA 4F2MB 1WUNT 5J12B 2X87A 2JB5H 3SQOL 4R83A 4FHJA 4XBPA 2FJGA 2I60L 3O0LA 4KTEH 4XMVA 3SHSA 2NNFA 1DBBH 4DTGL 3MQIA 4M7KL 3GBML 1RUPH 2B0SH 3UTSA 3GT6A 1OF2A 2W5PA 1BVKA 1FYTD 4OF5A 5MI0B 3D1MC 4FTDA 1DJSA 5I8OL 5ETUA 1WF5A 1NCBL 3CN2A 3IXAA 3DV4B 3GSWA 2GT9B 4HA1A 1MJUL 3OV6A 3TV8A 1UKSA 2JI3A 4JDEB 4WJKB 5KVFE 1F90H 5KW9L 4PMFA 2HA1A 3C5SB 4ALAH 4AIEA 4XGZA 1RVFH 3G5XB 5DZVA 3O6LL 3FCTB 2DIAA 1RIHH 5DZAA 4FQQA 2AK4A 2V3FA 5JOFB 1DO6A 3U9UB 5F88A 3ARRA 3K4ZA 4JBSA 2P8PB 3WSQH 4A55A 2YD2A 3KR3H 4IBYA 3TBYA 2VN5A 5BV7B 3ATBA 2F53A 2A83A 3BUTA 4JFUA 3EYVB 4DGVL 1MRDH 3FU8A 3LKRB 4PWGA 3PDOA 4LLQA 4QTFA 2DQDL 4UYQA 1DLHA 1ZAGA 1W72L 5I15H 3WKPA 1U92A 4ZQKB 1V7NH 1A4JA 3UTSD 5LGJB 3HS0B 2ADIB 2NY3B 2JK5A 1MCJA 4C55A 2EC9U 3BD5A 3T2PA 3X3GH 4I1PA 1F6AA 1T2JA 1EO8H 2J4WH 3HE7A 3BDYL 4LL4A 4AXWB 3PGCA 1EZUA 2KT6A 4YPGA 5EU3B 2JKWA 1V55B 3P4MA 2WQXA 2EDNA 5GGSB 4GO9A 1XB3A 1NCTA 2YEZA 1BQUA 3LMJL 4MX7A 5LQBH 1JCVA 3QIWA 4J28A 2K70A 3MACL 3ALWA 3FU0A 2AK4D 1Z5LA 4P2RE 1D5IL 1U8LA 4G1EA 3O9WD 4IRJB 4TOYH 1JK9B 3PYCA 3ULUD 2G2PA 4FMFA 2ZTBA 3CBRA 4G9DB 1YC7A 2HAZA 1KDJA 1WZAA 4P9HH 2DKUA 2V2WB 2VKWA 2F53D 2XVLA 4PGEA 4JZOA 4JFFA 4GRLB 4XWGH 2CJUH 3SDYL 1FLRL 3HRZA 3QXAB 3L3DA 3MRCA 5G4OA 3RIAF 5J6HA 3OBAA 1U2HA 5EZOL 3UTQB 4UWQB 2QR0A 2UY7A 3VFVB 4YSQA 4HS3B 4KJQD 4B9YA 5T3XE 4OZIA 1CD9B 3TESA 3LZPA 1DN0A 1PDKB 2MOVA 3BWAB 1E28A 1QLRB 1QUPA 3MKKA 4HHWA 3L5XH 3PU7A 3NSYA 3HE7D 4JG0L 1PQZB 4LDOB 1M9WA 4R4FL 5ICYB 4M3JA 1KXVC 5FGBA 3NJHA 3BUQA 4S11A 2MHAB 3ILQD 1HYRC 2C7FA 4KKZA 3HI5H 2VXVL 4R9HA 4HDIB 1FZMA 4LOUD 5DD6B 5IBTL 4JGUA 5EOQH 3QIWD 4GXUM 4UF7C 5IESH 5E8OB 3NPSC 2VXUL 1LO3L 3N0AA 5LCVA 2XKSA 4PSPA 4G59C 1RK7A 5FXCH 2DQIH 2DQTH 5BZXA 3FQYA 4BFRA 1LE5A 1FFPB 4Y2DB 4ELKB 1K85A 1H8SA 1U8MA 4LPUA 1BLNA 5E2TL 5GRJL 1IIKA 4WTZA 4X6DA 5T1JA 2AC0A 3JXAA 3LB6C 4GMTL 2EXWD 3HMWL 3IDGA 5DS8A 3RZCB 4LDCA 3QJSB 4XXWC 2DI7A 2W81C 3GSVA 3VXSB 4NUJB 3MRNB 4U7MA 5EOCH 5JZ7C 5C0IB 1NGQL 4WNQB 4X5PA 4UZUA 5CWSB 2UX6A 4UB0L 1RUML 4P0DA 1F5WA 5AZEH 3PWPB 3KAAA 5E5MB 4DJMA 3QBTB 3RKDC 1JZHA 4AM0B 5AKTA 3RFZA 2C1PA 4DT2A 5KBLA 5DU7A 4N1CA 3PXLA 2GI7A 5E6RB 2G9KA 4RFNB 1I85A 1R3JA 1HHHA 1HKLL 3P73A 3E8UH 4PGCA 4QRTB 5DJAB 3IFNH 3LSOA 4CADA 2R1XA 4FFYH 2G3MA 4MQ7A 5HHOB 4Z7IA 4KTYA 3VCLA 1BVLA 4L1DA 4PI2A 2G4EA 3BXNA 2HT4C 1FZOB 5AW1B 4AKPA 1IFHL 3WUWB 3UAEA 4PGBB 1M53A 4RFEB 1JZIA 4PYHA 4WFFD 5FM5M 4OF3A 3FQUB 4LESA 4ZFGL 1T22A 1U95A 3VFPB 3RWDB 3NN8A 1G7LA 4F7CA 3IFOB 4ODUB 4P3CL 4W9FC 5EU6B 1HWHB 4I0PD 4JX0A 2HLAB 4ODTH 4QRBA 4P49A 4EN3B 1AHMA 3MOBH 5E6SB 1ZXKA 3S8FB 1TJIH 5CJ5A 2D0GA 3OAZH 5TDPA 3U2SA 3AU1B 2QQQA 4MMZB 5IMOB 2EVHA 1E9PA 5TFSL 5ID1A 3X14B 1TMQA 3W0WE 5BRZE 2DMGA 2B5IB 2WSPA 5MEPA 2QVKA 5DGRA 3QRGL 2H45A 4UUJA 2NYKA 1NFDE 3MRIB 4HWBH 4K7PH 1ZVSB 4FQIH 3ZHLA 5AOZA 4QHMA 2J8OA 4BSVB 4KPHH 5D7JB 1FV1B 4TVUA 5D71H 5I0ZA 3L9BA 4G6ML 4RGNE 1TVDA 1OALA 4EUPB 1UXSB 1KPVB 4KI5F 1KENH 1EEZA 2Z91B 2EDRA 2ZWZA 5FOJA 3UAFA 4DPBX 1TPXB 5E0FA 4ETYA 4MQTB 1NOAA 3LKPB 5KSAB 1GGUA 2XBDA 3GLZA 1OAYH 4JM4H 3G3LA 3HG3A 4ZODA 2FE0A 4Z6AT 2WKOA 3VQLA 1AO7E 1XIWB 4M1DL 2VSKB 3DJRA 4HMEA 1S78C 3E6HA 5JIIA 5ACLA 1SXNA 1TJGH 4K23H 4WEBL 4Q9QH 1ODUA 2FK9A 1B6UA 2GSIB 2IH9A 4DP2X 2J88H 5IVXE 4PJXE 4G7VH 2R0KH 4HGMA 4GKNA 3NCYS 3MLRL 2JJVA 4PJEE 1JDAA 2BOLA 4J8RB 3O6FA 3ZHFA 4DWHA 2HWZH 3ILDA 4KH2A 4XNZB 4CU8A 3EJZC 4YAQA 3Q8CA 3M17B 4RBPK 1UM4L 2B1OA 1MOEA 2ROYA 1UZGA 2J2ZA 2KZ1B 3PG2A 5D96B 5IK3A 3P0GB 2W9EL 4E41E 1F3RB 4XB7A 1SUJA 3QA3B 1FP5A 2Y69B 4TV3A 3BSGA 4U6XA 1GC1L 2IPKB 2BNQA 1UYWL 2V7NB 3LKQB 4IMLA 3HE6B 4A7TA 4Y1TA 1FFNA 3RX8A 2YO3A 3W9DA 3P11H 3T0DA 3AG4B 2FL5B 3BUBA 3N50A 4LKXA 4G7YH 1IGCL 4C8XA 5HTSA 2I27N 4L29B 1N7MH 4LP8A 2QSQA 4IOFC 1GYWA 4NFDA 4I2XB 4XVUD 1IM3B 4PRPD 2F8OA 1MWAA 2ZOUA 4X9BA 5L2KA 3RNQA 2YUZA 2VLKA 2BWIA 1P5VA 5BXFB 2O61B 4DPAX 2LT9A 1G6RB 1X44A 1BZ8A 3QUZD 3BP4B 4FZEH 1BXXA 3DVGB 5E4EC 4RWYH 1YN6A 2VABB 3FS9A 5L88L 1NFKA 5HHMD 3O81A 1OPOA 3QWQB 3WHXB 3O6FD 4PJ8C 2Q7YB 3PNWA 4GP5B 4G8FA 4RMBA 5F7LB 3JTSA 1TZAA 3SCMC 4APXA 4X98B 1RY7B 3ALXA 1WCBA 1NKGA 3FQXB 5J5EA 3EGXB 5EZLB 2BNQD 1U8CA 3K7UA 4NN7B 1MH5B 4OIIH 3IKCB 1JZDC 3LVEA 3LH2L 5JHLL 1T2QH 1R3LA 3JWNC 5AOMA 2E6PA 2NUTA 4QNPF 1OIOA 3Q2VA 4FTVD 2P4AB 3MUUA 1P0SE 3IPEA 3GF8A 1NM9A 5DUPL 3T08A 1W72A 5FHAL 1OTSC 3RJDA 3SD5A 5L2KD 2VLKD 2FVNA 5C0JB 3S36H 2CUHA 2ZCHL 4XN8A 4XO5A 3UBXA 2QKIA 2ALWA 5F7UA 3BSHA 4GIOA 1T80A 4RLDA 2R56H 2Z35B 3L16A 1WIOA 4MXVF 2FLBT 1AZBA 4J3OG 1M05B 4RISH 1HL5A 1JN6A 4DH2A 1D7DA 4Z7NE 2VW6A 5HI5C 4E9VA 4IS6B 1RU9L 3HHMA 3IB4A 2ZXWB 3ZYJA 5TE6H 2DKMA 2OMYB 5F97E 1T20B 3C12A 2WZ0A 4L8BB 3PUUA 2FO8A 3VW3H 4K3HA 2PW2A 3CVHB 3T3PF 2I9TB 3PL6B 5FIEA 1AGFA 1Z6JT 1HHGB 4QHKJ 3O8XC 2X0UA 2XFGB 1IBGH 2C3GA 4EI5B 4L4TB 4IDJH 3C6LA 1OSYA 4RRPG 4WTQA 3UPAA 1T1WB 3U83A 4JG5A 4YC2C 5BRQA 3PJNA 2YMOA 4DAGH 3NCJL 5CGYC 3D30A 2KLSA 4YSAA 4CDGC 1I8AA 3D3VD 4OU3A 3DXAD 3HN8A 3I9IA 4TUKL 1D7CA 5E6ID 3CAFA 1R3HB 4P46A 1GIGL 3CSYB 4UQIM 1F11A 1QWUA 1FLTX 4Z3FA 5D2NC 5FHBL 3VSUA 4KXZI 3MJWA 2FX7L 3KBHE 2D9CA 2FUTA 1GCFA 1A7PH 2IDFA 1MNUH 4I3SH 4WI4A 1W8OA 3MJ8A 1D6VL 2BRRL 2X6BA 3L5IA 4HLZH 4P2RA 2HP4A 4ONOA 5D1ZC 2E47A 5CMAB 3DUHA 4Y16D 2NX5D 5AG8A 5DVOA 2CMRH 3B2VH 3BAEH 4Q6IC 3A6BH 3A21A 1DQJB 2C9XA 3W1ZA 3I3EA 4OCXH 2LU3A 5HGAB 4BQ6A 1S9WB 2V17L 5JPMA 4FNLL 3HIZA 3M6DA 2BINA 4HIHB 3BQVA 2GBVA 5CP3A 3SDCA 4DPCX 4Z77B 1ZHKB 5IZ7A 2GCYB 5BVPH 3D51A 5PCYA 3ZE1E 2JKIS 4QTIL 3FB5B 3S7GA 2R1WA 1ZHNB 4DUXA 4XP6H 2H2SC 2F5BH 3FCSB 3NACL 2YQGA 4KRLB 4U3HA 4GS7C 1G9HA 1I3RB 5IROA 1IQWL 4JL1A 2EE2A 4WO4B 1DBML 5SWZD 4WFEE 3S4SA 1R24A 1HVXA 3GQFA 3UPCA 3WKMH 2W65A 4IKJA 5AEAA 2O30A 4J27A 5KYUA 4HHAB 1LXMA 1E4XI 2ZKYA 4NB7A 3T3PB 3GI9H 4LSUL 2LR4A 3GUFA 4XC1H 1EXUB 2WYZA 3EH1A 2F54B 3DIFA 3ME0B 1WEJL 3GTVA 1XGPA 2XZAL 2R2HA 3FQRA 4IIQC 4WWNA 3RX7A 3VTAA 1I8MB 3C60B 4G7RB 2NY2C 4PY7B 3HKZA 2MTAA 3TPUB 2AJSH 4ZOEA 3GUTB 3ULVD 5CCKH 4OGXL 4R7VA 1YN7A 4XPTL 4P59L 4DP0X 4GMSH 2UZXB 1JWUB 1C7TA 4Y1AB 5C0AE 3FTVA 5FB8A 3F6IA 1N5AA 3WDHA 3VGDA 2V2TA 3DX6A 2BZCA 2A3TA 2BIQA 2VYRE 2DIEA 4L8CA 4P57B 5T3XD 1JL8A 1AYRA 5I0VA 4LVHC 2A9AA 4C4KO 2BIPA 5FEBA 3LZFL 5EUKB 1U58B 5C9KA 3FUMA 2O5ZL 1K4CA 1QPXA 3JWOL 5BZDB 3QT2A 2AZUA 2KERA 1H6UA 3G6DH 4B0MB 3DO3A 4ANKA 2AJVH 2CO3A 2BWDA 1IARB 1V8HA 1CXKA 3HG0A 5HDLA 2IAMC 1Z3RA 5DRNB 2KLTA 4M9OA 1KJ3L 4U0QB 1Z5YD 1MCIA 4QKXB 3TCLA 4N0RA 3RDTA 1YDPB 3FQNA 3MBXH 3N42F 2NY7H 3A47A 4QCIA 5JDSA 3N6YA 4R7NA 1TSHA 3WEXA 1W0VB 4QO1A 3S5LB 1J1PH 5LDUA 2Y6TE 3ZHKA 4EMZA 2EXTA 1P4LB 1YY9C 1HQ4B 2EVJA 2QVFB 3F84A 2XVGA 3OZ9L 3N1MC 4MDIA 3MNZA 3HMXL 4HG4J 5FECB 5BRZA 1U3HC 4CBZA 2NNXA 5I76B 2XY2A 5E08H 3LQAC 4YZWA 2VLLB 3ULUF 3JWDH 1NFDA 1PPIA 1F3DJ 3MJGX 1TETL 4P9ML 5BQ7B 2JKNA 2Q87A 3HZVA 3O45A 2X70B 2K9UA 1OCWH 2R29L 2NW3A 1MCFA 3KCPA 4YE4L 4YLQT 4W9HC 1EGJH 3E3QC 3GXIA 2DAVA 3BPNB 5J6GB 3V0EA 3Q9PA 3QORC 3RDTD 4LQ1A 1OB0A 3F58H 5D4QA 3B7RL 5DRXA 4QY8B 3OKYA 2XG4B 3MOAH 3MRMB 3ZHDA 1CLVA 2Y23A 4KTGA 2XCMC 3CN4A 1R33A 3RILA 3TO4C 1EHXA 1AO7A 4DGUA 5CINH 1EHLL 2VSDA 1N6VA 3QI9A 1CD0A 5KANG 5EHFA 3V0DA 3BRFA 2A77H 1NIAA 4POZD 4U1MA 1MCPH 2A4EA 5IVXA 1NANI 4XBPB 2FJGB 4PJEA 2N1TE 3C2SA 4FZ8H 4UT7L 1EFQA 4Y19D 5BQDA 1ZEAH 2D3NA 1JPST 4OB5L 3B7TA 4E41A 1AXSA 5JW3L 3T0EC 4PY8I 1GJUA 4R8WL 1OF2B 3UJJH 1AHWC 3QQ3A 3UTSB 1BVKB 4JVPA 5EC1A 3N42B 1EHKB 1K3IA 2R2EA 4H25A 1QYGH 4OZGA 5ETUB 1M4KA 4EIGB 2FGZA 3IXAB 3MLWL 4QRFA 5D7KE 1ZMYA 4UIKL 4GO8A 2R0ZH 4FL4C 4XI5C 3U0WL 3VGAB 3AT8A 3P30L 1NCOA 1TVBA 2W88A 1PMYA 4FFVD 4I7ZC 2EDXA 3THML 4LSSL 4XGZB 2ID5A 3MBEA 4KRPC 2EXYD 4PV9A 4TF4A 1TZ8A 4OZIF 4CN1A 1GRWA 1QLEB 5D1QE 1BYPA 2D7QA 2VWEC 4FQQB 2AK4B 1AO7D 4HOWA 3WTUA 5F88B 4LIQL 2WGNB 3QI9D 3F64A 1IGYA 3P0VL 3PE9A 1R4XA 3TBYB 4JNXA 2UWEE 3EXLA 2DWTA 2P1YA 2F53B 2G3XA 4NWTH 2A83B 1UM5L 1HINH 2XLLA 3VQ2C 3PDOB 4LLQB 1OQXA 1DLHB 1Q0XH 4Y2NA 2DWSA 1PEWA 1U92B 2WC7A 4KXCA 1SM3H 3KGSA 1A4JB 4KKCC 3UEQA 4QXGH 3ZTEA 4E41D 4EDXA 1I1FA 1KDIA 2JK5B 1OO2A 2D3LA 1G9EA 2DWDA 4H88H 1JI2A 1CF1A 4ONHA 5C7XL 4X6DF 2WW8A 2YPKA 1KBVA 1F6AB 2DBLL 2YS4A 3HE7B 2BP8A 4YPGB 1FE8H 3WNPA 1FVCA 4WWPA 4PGJA 3P4MB 4HHGA 3V6FA 3MV8E 1IIIA 2FJSA 1P9MA 2MQ3A 3MBED 2YEZB 1GW0A 4X7EC 4MX7B 5BMFL 1PZ2A 5HPOA 3QIWB 4GAGH 3EJRA 4ZUWA 1JF5A 2DBJA 5F70A 3LNIA 1Z5LB 1KXTA 1U8LB 3CSPA 3P02A 4G1EB 4M7JL 4QXUL 4YQXH 5MHSD 5ILTH 3M7FB 1YECL 3QXWA 3VFSA 1A6WH 1PG7H 1MXGA 1ZJBA 2Y7NA 2CBOA 3BYYA 1RUQL 2CAKA 2R0LL 7FABL 1YCSA 2B1HL 3KW8A 4PGEB 1E8WA 3RPIA 4JZOB 4JFFB 4BXVA 1MAMH 1AXTL 1DQML 1DYZA 2NY1C 2PCFA 5T1KD 3W38A 3HRZB 3FRPG 4MHHG 1X5KA 1CICC 3L3DB 2VDLH 3MRCB 1N6UA 1CFTA 4L1SA 3N06B 5FYJU 1I8LC 5IOPA 2W38A 1X4ZA 1EMTL 1NAKH 1HHIA 2QR0B 2UY7B 2OSXA 4LLYA 3UABA 4ALAC 4OZIB 1DN0B 4S1RL 1UASA 1S7XA 1E28B 5JTWA 4GG8A 3DHUA 3BQUC 2KMWA 4TL4A 1P4BH 2GC7C 3BKMH 2L4OA 3IDMA 4RMSA 1JFQH 3U36A 4Q58C 5BO0D 1JPTH 3FTXA 4FX5A 4TNVF 3HBZA 2JI2A 4U3XA 5CBEA 4F9LC 3NSJA 1UWXK 2UZIH 3JV6A 1FZMB 3PXJA 5D9SA 1RK0A 4YEFA 4PWJA 4PEEA 2NY6C 3GHBL 4H8QA 3OMNB 2J21A 2JE8A 2FH8A 1NMAL 3KPMA 1OANA 3QJQB 1LE5B 4Y5YA 5LXVA 2RBLA 2Y1VA 5G5DA 3ZO0A 1U8MB 2CK0H 1BLNB 3O41A 4X6DB 5TQ0H 3WV0A 3IDGB 5FYLE 5DS8B 2H26A 4J5VA 2VXSL 4UNVA 3N5AA 1G6VK 1DSFL 3GSVB 2Y1AA 2R39A 4PLKC 2EIKB 3HBGA 4NQDE 3F7RA 2EVIA 3TCTA 5AW9B 3WNOA 3WD5H 1IT9L 3PGFH 5I1LA 2WKOF 1KELL 5F71A 3COOA 3SE4A 3WTXA 4JFDD 2B9BA 4WI7A 5HI3D 1SQMA 5D4JA 2C4FU 2ZX5A 3RFZB 5HHPA 2C1PB 3IETA 1SVBA 4UTAL 3DUSA 3SGKC 3INUH 1R3JB 2YPLE 4MD0A 1IGFH 1HHHB 4KK9D 4PJDE 3P73B 4CADB 4PGCB 1PW3A 4NQCE 3LSOB 2CNYA 4JFVA 5MP6L 2R1XB 2NR6C 1NMBL 2L8AA 2OV0A 2UZYA 3B2UC 3NCBB 4MQ7B 4P9HC 1BVLB 4W70A 3VCLB 3KYAA 3BXNB 1X5YA 3KDPB 5FCUL 1N4XL 3D0VA 5F7NC 4JREC 3BX7C 4Q9BA 1YPZE 3NH7L 2VQ1A 3D39D 4TSBL 3HB3B 2H9GA 4YHNA 4B41A 1FCGA 5IJCC 1ZLWH 2CR6A 1QTSA 1T22B 1U95B 2FYVA 2MSPA 5DS2A 5GPRA 3NIGE 3NN8B 1G7LB 4EXKA 4F7CB 5DGQA 4KO7A 1ZLDA 3NIFF 3MRPA 1CTMA 4AZ8A 1YLBB 3I02A 1UZ6F 4ZW6A 2ZWNA 4PVLA 1KF9B 1WK0A 1MHEA 3TEYA 3O3AA 5AL0A 5TDPB 1UA6H 3U2SB 1E6OL 1KG0A 1U8QA 1VFOA 3DURA 4IBTA 1TJMA 1E9PB 4UQAA 3IDXH 3CDGA 3C2AH 4GH7B 5ID1B 3EDEA 5CR8A 3K4AA 5C0AA 2ZD0A 2I25N 2GW5A 1OAKL 1T66D 4ERSL 4NQQA 5MEPB 4U1GB 2H1PH 4F80A 3K3QA 3TASA 1MAKA 4UUJB 2XBTA 2CM5A 4MAUH 1FH5H 4ZW3A 2OTPA 5LBSH 1ADQL 2VKXA 1G7QA 4QHMB 1F86A 3N1GC 5B3JF 2XV0A 3P3UA 5FYKH 1J1OH 5F1SA 5E2WH 3L2MA 4FE9A 1INQA 3IAGC 1ZHBA 3DOHA 3BUIA 3QUYA 1S6NA 4XMTA 2LLNA 4JHAL 2TAAA 3D18A 4OUUA 3TO2A 4KKLC 1EEZB 4J4PA 5JW4N 3T5WA 1JZ3A 2MKLC 3HFML 5TGBA 1CU4L 2W95A 4KKQA 2O6PA 2HT2C 5F3HA 2B1AL 1UOVA 4WV1C 3VJ6A 3FJTA 4JO3H 1EIBA 1SMAA 4FQLH 1GTNA 3E6HB 3B1TA 4OLZL 5AYQA 4JQXC 5I19L 3HKFA 1MREL 2R29A 5EWIL 5CLWA 1CGTA 4GRWH 2P47B 1BAWA 4FMVA 4JR9L 4GKNB 5HHMB 5C0AD 4EF3A 3O6FB 4PGZA 1UM6H 3B4NA 4YAQB 3NTCH 2J2ZB 5IK3B 2OYKA 1Z2KA 1G4RA 4YHZL 3LN4A 4IBLT 1RL1A 2HFEA 4U6XB 3V9FA 2BNQB 2BXZA 4IMLB 5D4IA 1FFNB 1TQCB 3W9DB 5DJ6A 3NIFB 1IGML 4LKXB 4PJ9A 2AXHA 3VRIA 3QDJE 4KKAC 4MRCA 5F9WB 3CBKB 4J4PD 2CRMA 1FF5A 3BI9X 1P4IL 5I5MA 1MWAB 4QJ5B 1S7WA 5L2KB 1F1GA 3RNQB 2VLKB 2NQ3A 4KVNL 3BUPA 2UXTA 4E9TA 3L3GB 3GRBA 4U49A 3EF4A 1RUKH 6TAAA 2WJ5A 3VXPA 3MJ9H 4G80A 3R7QA 2DN7A 1YN6B 1DANU 5GGVL 3QWRD 4AC4A 1GOGA 1WV7T 2ADFH 5EMYA 3ZZQA 4HZLA 3RVTC 3SY6A 3ASOB 2V6HA 3G7TA 2FT7A 3PNWB 2VT0A 5FPIA 2VDNH 2VERA 4G8FB 3JTSB 4APXB 3KEHA 4OT1H 2I9LA 4XVTL 1IE4A 3HPJA 1WCBB 3MNVA 1J5HA 2EIEA 2XC8A 1TR7A 4E9QA 1U8CB 4JKWA 4HS8H 1UA3A 1FC2D 2DMBA 4UNIA 3BKCH 5I75B 1JMXA 1PFCA 2RGSA 3POCA 3E2HB 1IFGA 2BERA 3HHRB 3G5YA 1R3LB 2CXKA 3TCXA 1G9NL 2NUTB 4KKNA 1OLZA 2NSXA 3ULVF 2R23A 3D2TA 5AOKA 3MYJA 2VDML 3WIIH 2JKJA 3U30B 4WGKA 1YEJL 5LWYH 2ZCKH 5C0GA 4FXLA 3TVMC 1IZJA 5EB9A 1W72B 2XZZA 4RAUA 4UTBH 4AYID 3UBXB 2QKIB 3BISA 4JM2A 1RMFL 5I6XB 4UI2A 1LL1A 4P5TA 4NWUH 4YLCA 3WEOA 2OMZA 5D1QA 1JN6B 5C3IA 1CBVH 4AMWA 3UXFA 3LEXA 4BK5A 4GQQA 3N04A 2EH7L 4ATTA 4PRIE 1FN4A 4YZFE 2E6JA 5BJTA 3CFTA 4NQTA 2XPGA 1LGVA 2UWEA 3M7OA 2CHXA 4Y4FC 1FSKB 1O9WA 1XGQA 2WXGA 1TEGA 2O5YH 1NCIA 2PW2B 5AALA 3BKYH 3ML8A 5IGXL 3QQDA 3FOLA 3SPIA 1AGFB 3O6KL 3NQIA 3U6RA 1FAIH 3ARVA 5D1ZI 2YWZA 5HHQA 1PKQE 3C6LB 3ZVVA 5DK0A 3LQZA 5C6WH 5CJQH 4K15A 3S88L 4UZSA 3MLPA 5EU5A 1IGIH 3VXUE 2IF7A 2WKLA 3K6NA 4CILA 5D7KD 1GGIH 2LAGB 1T3FA 4XBGA 1A9BA 3A6OA 3U7YH 4MA8H 4RAHA 4P46B 5EBGA 5KVGE 2OZ4L 2WLMA 1JGUH 1F11B 2GTZA 4Q0XH 5D6DA 1U41A 4P5TD 3BPLC 3MV8A 1QTPA 1ZDSA 5DD0L 4BV1A 1P6AB 3B2PA 4I9WD 5AZ2L 5TQ2L 3MJ8B 3GMOA 1GZHA 4NZRL 4P2RB 1PFOA 4KO6A 1QTYT 3OKNA 1NH6A 2BS9A 1VCBC 4NXSA 4XVJH 4RGMC 4H0LC 3SDDA 4W4OC 4MQXD 2FIRT 4HGKC 4HJUA 1CT8A 1T0OA 3RJOA 4XNDA 4N8VG 3KBEA 4QXVA 4HJEA 5EO1A 5JPMB 2DQHL 3QG7L 4CRPA 3SDCB 1JHLH 5E2JA 4OCSH 3L9YA 4I5BA 1PD0A 6FABL 5I1EH 5L8KB 1S7VA 2R1WB 4G6KL 1FUNA 1A4AA 1JXGA 4B3VA 4Z7AA 4I3GA 2BVEA 3AWFA 3L7FA 4KDTC 4LT7A 3UROR 2P5EA 1NEZA 1BZ9A 4Z7WE 4H0GA 4LEXH 1A8ZA 5GJSH 3S4SB 1X5ZA 1R24B 3LDBC 5LGHH 5SX5K 4JFSA 3NABL 1LQBC 3QCTL 4LQFL 5J1TC 1U3NA 2W65B 2VDKL 5KYUB 3ESMA 2IH8A 5C2BH 1FA4A 2VXQH 1HXKA 1I31A 4UTAA 1NFDF 3DIFB 4IRSD 5CM1A 5AAMC 1FIGH 2VAAA 1XGPB 3FQRB 2R2HB 4H8VA 3ZTCC 3X1FA 2XA8H 3O4LD 4PD4K 1EHNA 3SD2A 1DQIA 1YN7B 3DDFA 3MODH 4KY1L 5EU4A 4XO4A 1GJIA 1KC5L 5FB8B 2N7SA 2YEQA 3JYBA 4UNTA 1N5AB 3H7LA 2V2TB 3DX6B 4DKDC 1BMZA 4N2EA 2NDFA 3VXQA 4I0KA 4MXQD 4OLEA 5E8DH 3LNHA 4NQDA 3W37A 1KGIA 1DL7H 4L8CB 4U4BA 2IWGA 1J5DA 4MCMA 4XHJC 2MRYA 5DVKA 4CW1A 2BOCA 2P5ED 3WENA 1JVLA 4N9GA 2VN4A 1PLBA 4PVNA 3J8F7 1K4CB 2DEXX 1FORH 4DKTA 4PRNA 2YPLA 5IVXF 4PJXF 4KKPA 4PJDA 1CTOA 1F4WL 4PJEF 3FF7A 2ISDA 3SKUD 1UD3A 4XWOC 2YARA 4Q97A 3BDBA 3K46A 4NN5B 4DK6A 1DDTA 1RZFH 1YPZA 3TCLB 3GLAA 3RDTB 1JV5A 5F3FA 3QAZC 4Q2ZA 3FQNB 1UWEH 2QQLH 3FQTA 1UOWA 1FC1A 4OZGF 4PWIA 4QCIB 5JDSB 5IG7A 3SKJH 2J5LB 3OAYK 4R7NB 1NBQA 3HN3A 3CZGA 4G5AA 1TTGA 1B6DA 2JVUA 4QO1B 4YO0A 1ULVA 3U4KA 2HKFH 2FO1A 3KYKH 1BSIA 5J3HD 1PZDA 3MCYA 1PBYA 4JW3A 2ZYIA 4MDIB 2BJML 3FUIA 4IHOA 3MNZB 1GMEA 4HCRA 4JKPH 1OM3H 1EQWA 2WXRA 5BRZB 3QDGA 3FFDA 4ZUVA 2FWSA 1MJ8H 1FYHB 4BRJA 3WYRA 1IRAY 4U1JA 1EUTA 4MB4A 3S37X 4C58B 3RTLA 4BZ2A 5KSUA 1NFDB 1DJGA 2L7QA 3DX8A 3QDAA 5T1DH 2GC4C 4FG0A 4E9LA 4X4YA 4W6YB 1DFBH 1IKNA 1X9QA 2VLRA 3HZVB 3O45B 4JFZH 5DZJA 1YEFL 1B9KA 3H53A 4DFIA 2NW3B 4X5RA 3KCPB 3WXVL 5E8NA 1WD9A 1MIML 5EF0A 4RGNB 2CPUA 5T5NG 4FQXC 4KQ0A 1TEFA 1AH1A 4QEGA 4B27A 5I1KH 2NXYC 1JZ7A 2VMJA 1Z7JA 1NGWA 2NT0A 2WV3A 3KLDA 3ZL2A 3QPKA 2FEEL 3CMOH 4LSRH 3SZ6A 2MNUA 4BUGA 2QHRH 1AO7B 3RU8H 1Y1DA 4YN3A 2QMJA 3OAUH 3QI9B 2EDOA 2NPLX 1H9VA 1KGXA 4J1UA 4BFJA 1M7UA 3GKWL 1ACXA 5DXWA 4U1MB 1TG8A 4I4WA 4PJXB 1YHPA 2C5DC 2V0AA 2W92A 3LEVH 3QQNA 3K5RA 4ZS7H 4A1RA 4XXDA 3BSZL 3BWUC 3QEGL 3CU1A 3QDGD 4PJEB 5B1JC 1IBHA 1QKZL 3DX7A 3IRCA 3MRLA 4PHZA 3JBG7 4A6YA 5JDJA 4XODA 1AXSB 2ZF8A 2X1QA 1E30A 2CO7A 3GTTA 1BAFH 3KW7A 2J6EH 3MCLL 3QQ3B 4WY7H 5EC1B 5A2JH 3AGVA 4O4YH 2RH0A 1O9ZA 2R2EB 2H2PD 2YK1L 2VLRD 2WBJD 3C09B 2YSSA 4H25B 1A7BA 2QADD 4ODHL 4OZGB 2WWMD 4Z7NF 1AKJA 1I9JH 1R46A 1DVTA 4KTDL 3QDJA 5M94B 5GGSY 4KZDH 4I87A 1TVBB 4ZAKC 4ZO6A 4PJGE 3X11A 2QHLA 4HUXA 4M6ML 1MLBA 4OF7A 3CWGA 3MBEB 4G70B 4YGAB 3HC3H 4PV9B 4Z0XA 3SOBH 2BSCA 4U0RC 4DP6X 1UQSA 1CL7H 1WWBX 2Y5QA 4XCEA 3IEAA 5IMMA 1EX0A 5C08D 5AW7B 5LBGA 1JNHA 1IGYB 1KIPA 3JWDC 2C9VA 3D69A 5J11B 3KM1A 3WY4A 3BH9A 4CN4A 1SRDA 5G4NA 3H0TA 15C8L 2CKBH 4IEFA 3TNMA 3KHQA 1FCCA 2DQMA 5B1BB 3V4LA 3OAZK 4EDXB 3L5HA 2PYED 1I1FB 4M1GL 4BE5A 4ONGH 4RDQF 3N3EA 4Z7UE 5AVTB 2DWDB 3EYOA 1F4YH 4ONHB 4XBEH 2YPKB 3FTYA 4X9HA 4Y4KD 1O7VA 2J1ZA 2GJPA 2HRGA 2KDGA 1L7TH 2BP8B 2UX7A 2ITCA 4ZMYA 1NCWL 3SY0A 1FVCB 1A14L 1T7VA 5HJBA 3DROA 4LCWA 3US1A 4GBXA 1JHTA 4Z18A 1VGEH 3MV7E 2NY5H 3V6FB 3ZUCA 1HX0A 2BRQA 4MVBC 4MB5A 4XVOA 1XWVA 1ODAA 4JRYD 2B2XL 3RWHA 4Z23A 1II4E 4ZUWB 3L08A 3ZE1F 1KXTB 2FBJL 4NBZB 1KTRL 4J3SA 3VFSB 2K9FB 4PB9L 4U3CA 3WHE1 3RPIB 3D6GA 4PRIA 2MIZA 5HVGB 2PCFB 5TE4H 3CQQA 1CFTB 5IOPB 3QK0A 1HHIB 2IDSA 4LLYB 3V0WH 5FO7A 1QBLH 2AQ2A 3DOSA 3K8MA 3GEFA 4OCWL 1S7XB 4GG8B 5FV2A 4KNTA 2YRZA 4CSPA 1KEGH 3CN3A 3IDMB 4NEHB 3U36B 1PKQA 4MJ5A 4F57H 4LCWD 2AEPL 4GBXD 5CBEB 4HJTA 1J0ZA 1MRCH 3VXUA 1JOIA 1MHPH 3JV6B 3CZKA 4JHWH 5D9SB 1RK0B 1GHFL 1R5IA 2OTWA 4BD4A 3V8OA 4KX7A 3FH5A 1T5KA 2HVBA 2DV6A 4WEUD 4YSPA 2HUEA 4OQTH 3BP6A 5H37G 3KPMB 3WTSA 4XPAL 2N0KA 4Y5YB 5F96H 4KHXH 2AZAA 1XF5A 2CHNA 4JHZA 1IZKA 5G5DB 1JGLH 4WWID 1GXEA 3O41B 3FDWA 4PRID 2H26B 3FRPA 5EFIA 2QQNH 3CVBA 2CQVA 1NKRA 1TZGL 3B9DA 1NDMA 3OSVA 5EIIG 3VWJC 2C26A 3Q3GB 5C6TL 3HC4L 1CFNA 4K3EH 4N3TA 1OP5H 4PS4L 4Q8BA 5I1LB 4XNXH 3GMQA 2J20A 3O9WC 3ZE1B 1HZKA 4XE5B 1L9SA 5HHPB 3IETB 3OJ2C 1KGYE 3DUSB 2FX9L 2VITA 3L4ZA 2ZX9A 4MD0B 5LJYH 4UQBA 4NQEE 4UOQA 2W91A 3VFNA 3OWRA 3NGBB 4XMWA 4YXHH 2UZYB 3ARGC 1XZ0A 1AGDA 4Z7WA 3D0VB 1RV6X 2WMPA 3JVGA 1BEYL 3PP4L 5AKSA 3LEYL 2ZJSL 2VQ1B 1S7TA 4U3SB 2NY4B 2A9BA 2H9GB 4HK3N 4YHNB 5IWLC 1J8HD 5CLYA 1MAJA 2A0LD 5DVLA 1LDSA 2XG5A 3I50L 4KQ3H 5KJRH 4UU9A 4HD5A 4NZJA 1U8HA 3MRPB 1BQLL 4HFUH 4AZ8B 1V3JA 3I02B 2A6IA 4ZTOL 2OTUA 1PY9A 3BVXA 1MHEB 2HTKD 3O3AB 4DGWC 2AANA 2XV6B 2XFXA 2XZCH 2YGVA 1KG0B 1U8QB 3DURB 1RHFA 1S46A 3PDDA 1IC4H 2DY2A 3CDGB 3AACA 4KUZH 1IVLA 3L81A 5C0AB 1TYJA 1NBVH 2YZ8A 4HPOL 3KJ6L 4K94L 1NC4A 4B96A 2B4CL 4YVNA 2MCG1 1TQVA 3TLRA 1NJ9A 2EJ1A 4PV8A 3VE0A 1JNJA 4NKOA 4YSEA 2CLZA 1G7QB 2XWTA 1IGJA 4ORGA 3IAQA 3IXTA 3QP3A 2EE9A 2YPVL 5I26A 1N0XH 2IBBA 3W5NA 1INQB 1ZHBB 2EXWC 3GSNH 3QUYB 1EDQA 5GGTH 4UT9A 4N9OB 3ULAB 3D18B 4OUUB 1SOXA 2EO9A 3TO2B 1KYDA 3KPOA 4NLHA 2W59A 1X5IA 2F61A 3AREA 1W6WA 1BHGA 4LASH 5TGBB 4MCYA 1F2XK 3NMEA 3SGJA 3II2A 5F3HB 3VJ6B 2ZYHA 3GSOA 3V4PH 5HJDA 1PCSA 3OC5A 5I30H 3AS1A 1UHVA 2H0EA 1ZA3A 1RZKH 1V7ML 1JIBA 1VIWA 3GINA 1WBXA 2HJKA 2YIHA 3GTNA 2X42A 1I4FA 4WW2A 2VN6A 3BH4A 5F7BA 2WVTA 1N12A 1KACB 2XTJC 5FFGA 2DW5A 3VXNA 2BIHA 2DQFA 4JM2F 1GOHA 1NC4D 1HE7A 2OYPA 3NA9L 5HYSA 3LN4B 1CLYL 2Q8BH 4RH4A 1J1XH 1RPUA 2HFEB 2VC2H 2YJLA 1IQDA 1NSNH 4H1LH 4NKIH 5HI4C 1KBKA 4E41B 3MCG1 3QS2A 4I0PC 5DJ6B 4PJ9B 1PLCA 3U9WA 3VRIB 3OKDA 3T2OA 1LQSR 1IC7L 5A6IA 5LG6A 2UWEF 5DJCA 2YXWA 3V10A 1NEUA 1Z9PA 4Z5RA 4OD3L 2VDQB 4CL7A 1TQTA 2OSYA 3IFPA 2AEQL 1S7WB 2ZKHH 3WFDL 1ZSDA 2XXGA 5A2KH 4XMUA 3IT8D 5I1JL 2P5WE 1CFQA 3GYRA 3MLYL 1JZJA 5F89A 2OK0H 2ZAGA 2MH4A 3VXPB 4G80B 2ARJQ 5FUZH 5IOKA 4HSAC 4P05A 4HZLB 2EH8H 2UV3A 1OM9A 1ZJAA 1MCDA 2JQAA 5FYJL 3OB0H 4JN1H 2I9LB 35C8H 1CFMA 4LAJH 3HPJB 4XP1H 1Q9WA 4WAFA 1AVAA 3J7HA 3MNVB 4XN7A 5SWQA 4P23D 3L48A 4L8SA 2JIXA 3DMMA 1N70A 5E9NA 3MLUL 1N8ZA 4TVPD 4NZ8A 1DLFH 3AABA 4BFOA 3G5YB 4BHUI 3TEUA 3ARDA 2FO4A 3RUGA 2NZ9D 1VKXA 5LGKA 5I0YA 2R23B 3DJ9A 3LZOA 1L0PA 2BSEA 4MA7L 4EEEA 5C07D 4HXBL 5C0GB 3O6ML 2EDJA 1BFTA 4HEPA 4RAUB 4OZHE 4RCAA 1GMIA 3V7MA 4DF9A 1ZGLP 1F3JA 4NIKB 5AKRA 4JM2B 5FS5A 4KWUA 4XP9L 3WY3A 1LTXA 4P5TB 4XNQA 3EFDL 4M7ZB 2OMZB 5D1QB 4AQ8C 1M9SA 1O6TA 3DECA 3LEXB 4HIJA 4PIRF 5EZIL 4ZXBC 5C6PB 4R97B 4NKMA 2F7PA 2QPDB 1FN4B 1UGKA 3V6BR 1X5GA 5BJTB 1CD1A 1QBMH 1WISA 1A9VA 2RB8A 1Y6NR 2QGEA 1IMHC 3KLQA 2B3RA 5ERWA 2UWEB 1NEPA 1T6BX 1XGQB 5CZXD 3VFGH 3FUKA 4XVUC 3WJLC 1MELA 2DQJL 4XVSH 3S3PA 3TWCH 4BJLA 1NINA 4Z3HA 3QQDB 3FOLB 1HIML 2HFGL 4WIQA 2FGWL 3SBPA 7PCYA 3U6RB 2AQSA 4WJG3 5GRUH 4YXKL 3SO3C 2X4QA 3QUZC 5HHQB 3ARDD 4PWHA 4H4NA 2RACA 3LQZB 4Z7UA 5DK0B 4O9HL 2WLNA 1WFMA 2BSED 2Z64C 1A6AA 4BFBD 4D7BA 5EU5B 3C8HA 4HVBA 3R1GL 4N25A 4RIRA 1PY0A 2X44D 4UINL 4J6RL 2MNWA 1T3FB 4XBGB 1A9BB 5GZOD 4NHCH 4NP9A 1X5MA 4DESA 4KROC 2QGDA 5BPPA 3IAPA 2GTZB 4R2GD 3NUKA 3MV7A 3MV8B 4ZMPA 2HJLA 4NAQA 5B7FA 3N43F 2D03L 2EDFA 3KVDD 4NENA 3GMOB 5AW5B 3HZKA 5B8CA 3OKNB 1Y6MR 3TJHD 4XB3A 1YA5A 4OFVA 4G42A 3SDDB 4D9LL 3WLWD 5MERA 1M1XA 4PJDF 3D4YA 3PAUA 2PWGA 1CT8B 3SZKC 1SYVA 5JYMA 1GS8A 4L8DA 1A7QL 3G5ZA 2QLYA 3WFEL 5EO1B 1YPZF 4LGRB 4KX8A 3T2LA 3RURA 2FSDA 2L3BA 2Y7OA 4HWEL 2WOYA 4I5BB 2WWNA 1S7VB 1DTUA 2ZIDA 4PTTA 3NIGF 1GGCH 1U6AH 1ORSA 1UWYA 2CUMA 5E56A 3L7FB 2YXFA 3P54A 4PP1C 4YMPA 2HRHA 1RZJL 1YEEL 1DUYA 1NEZB 1BZ9B 1QPKA 4AW4A 2UVFA 3FCUB 5BO1H 5A2LH 1FFQA 3SDAA 4JDVA 4AL8L 3ZR5A 4OCLC 3ARBA 1E2ZA 3U2IA 2VDRL 4OLXL 4G3YL 4QGYA 4ZFFA 4XMKH 3EGDA 5AYUL 1DBJH 3V0JA 2H0JA 3P0YL 4O51A 2FUQA 1T2XA 4OI9A 4AUUA 4BWUA 3I75A 1INDH 2VAAB 4WEMB 5I74B 1FZKA 1ML0A 4G71B 4R0LA 4N8VA 4X4ZA 3WN5C 5EU4B 2ZYRA 1ZV5A 3FT1A 4X6CE 2KYIA 4A04A 3V0AC 5E6IC 1AD0A 4JG1L 3VXQB 5E1IA 1SOKA 1R6VA 4EZLA 1D9KC 3DIVA 4NQDB 4AYMC 4N2KA 2PW1A 3WFZA 1IJ9A 5HDQH 2FWUA 3UYPA 1H5BA 1ZK5A 3N43B 5DMJB 3QUXA 4CW1B 2BOCB 3DYPA 5M95B 4HETA 2BP3A 4N9GB 1QRNE 4BCYA 4AWJC 4Y16C 3H54A 3TT3H 3MNMA 2D7TL 4U7SA 3JUZA 4PRNB 3SDAD 1JPSL 5DZNA 2YPLB 4Y4HC 2DM3A 4NQEA 4PJDB 1NLBH 1YEHL 1ZVHA 3ARBD 3C6EA 1B0RA 2YXMA 5AW2B 1C5CH 3IU4L 3FTZA 5I18H 3MJ6A 5I0DA 1YPZB 3L54A 1OARH 1J87A 1E6JH 1JV5B 4Q2ZB 3VFTA 2ZXEB 2A73A 2YPVA 3FQTB 3DJSA 4ZNCD 5EORH 3WMPA 1P2CA 2WLLA 3EH4B 1Q0YH 3NIGB 5IG7B 5DWUH 5EA0L 4WI8A 5KUKA 3ZUNC 3FO9A 3PWNA 4YO0B 1AZNA 2FQFA 3SBQA 5FGSA 2EYSA 4CMMA 2X0WA 1EFXA 3FSWA 3HTLX 4HJGA 2E27L 4IHOB 5T33H 1JK8A 4DP7X 4PQXA 2XKNA 1UUSA 3NP3A 4LSTH 4BSWA 3QDGB 2ZX6A 2E7MA 3FFDB 4ZUVB 5AW0B 2QPEB 4F8LA 5LUMA 2W0PA 3QUXD 4U1JB 2AJXH 4HBQA 4IK7A 4NKQB 2PCPA 2CUAA 2A9ML 3JWNE 5ALCH 3IPFA 4F33A 4CJ0A 1NBZA 5KSUB 3DX8B 3ETTA 4X4YB 4BFFA 1YNLL 3VQ1C 1WG3A 2VLRB 2XETA 1IC1A 5L8LB 1M57B 3NJLA 2F8VA 5E8NB 2X4UA 2YKLL 1M7XA 2APXA 2VJ0A 4YE0A 2FT6A 2YD6A 3S8GB 2R69A 3SPJA 4Y5XC 4M48H 1N59A 1R5WA 2XWJA 3I9AA 4JMNA 5DUMH 1NGWB 1VFBA 4YSSA 1ZD6A 3BIKA 5EULV 5ENWA 1OGAE 4OH2A 2ZPKH 5IB5A 3VD5A 1F3DH 5AW6B 4WTXA 1EFXD 4J1UB 5GJTL 3FKUS 3UAAA 1RPQA 4W1TA 4X7SL 1FG9C 2YRLA 4I4WB 2VQTA 1YEKH 1KCSH 4XXDB 3P3RA 1FNGA 2O26U 3DVIA 4NFCA 4RA3A 1KFAH 3DX7B 3MRLB 3VRLE 1NGYA 3EO9L 3H2WA 4A6YB 2JMRA 3L9EA 4HLJA 3T09A 1F58L 1UFGA 2CO7B 3IE9A 4DSYA 1E5AA 2APFA 2W9DL 2R8SL 1XBRA 5C0CD 5D5ME 4PB0H 1CVRA 2Q3ZA 5F93C 2YSSB 3V4UL 1A3RH 1SHMA 1AKJB 2KLRA 2VQ4A 3AXLA 2OR9L 2GUYA 3ZNGA 3NDYE 4Y0GA 2AV1A 4YZFF 1MF2L 1B0GA 1D2OA 1F41A 1KB3A 4DN3H 1S7RA 3QDJB 4FNQA 2ZXQA 1H3GA 4L48A 1RZIA 4Y2OA 4MRBA 1AAJA 2CBQA 3NEOA 3X11B 4HUXB 5D2NE 3RI5K 1MLBB 4UQCA 3H85A 4LCUA 2WYIA 3PP3K 4FS0A 4Z0XB 5IMKA 1W0WA 2VE6A 3RL2A 1KCRH 1UQSB 2A1WH 2YAQA 5IUCA 3ZDYE 1P6WA 2C1OA 4XCEB 5CEZH 1N64L 2OULB 5IMMB 1NWOA 3ILEA 2NZIA 2QLVB 4LAQH 1JNHB 2EEFA 2DWEA 2VDMB 5CLZA 1KIPB 5AVQB 5I71B 3D69B 5DRZA 4Z7OE 4YIQA 3UO8B 3BH9B 3MX0A 1G7MA 1SQ2N 3H0TB 3GIVA 4IEFB 3TNMB 1WZ1L 2E7HA 3F6JA 4C4KT 5J13C 3W5MA 2C7UA 4WUUE 2LE9A 1T21A 3ZJAA 3EDDA 3H42H 4DGIH 1VRSA 5KEZA 4JO1H 1TJHL 4JFED 4GKZA 3EYOB 3ZTNL 2AF2A 2H41A 5KBPA 4MMXC 2ZOKA 2I69A 5FLUA 1A8JH 1KXVA 3AT9A 1BXAA 2ITCB 3JYCA 3SY0B 1GH7A 5C3LD 3OJDA 3DROB 3EDKA 4LCWB 4GBXB 1JHTB 4P2QD 4ZX5A 3ZLQC 2VOTA 1JDDA 5IHUH 1PLGH 2DWYA 4TRPH 3V0VA 3RWHB 2C9AA 3NFSH 3CZNA 5IB3A 2DJUA 4OZHA 4PD4J 3X13A 5GRVL 4X5WA 3I2CH 4EAEA 2ROXA 3QR1A 3RAJH 1CZ8H 4PCYA 2ZSVA 3BVDB 4N90E 2XQ0A 1YYML 2H3KA 3ELAT 1N8OE 4PUBH 3NG5A 2GK0A 5DFAA 4Z7WF 4YX2L 4NP4H 4PRIB 4R5VA 4XXWA 4HK3J 3WTVA 1NCNA 4X4KA 1JD9A 2K8QA 1DVZA 3ASWA 1HU8A 1AFVL 5EDSA 4FFVC 1V3MA 4EDWH 3ARFC 5GISH 4IBQA 3H3BC 2EXYC 3UIZA 5FO7B 3K74B 5HGGS 3DOSB 3BD4A 1EBPA 3CLEL 2X9XA 3NOIA 1NL0H 4JQIH 4Z95H 2QMKA 3SPHA 2CKNA 3UYOD 5LB1A 3NA4A 1PKQB 1HCFX 1Q1JL 3GPSA 4UBDD 1BM3H 4MJ5B 4NN6C 5F7EL 1SDAB 5I73B 5E6YA 3VXUB 3L2LA 2MJWA 5L4IA 3E0GA 5JW4M 3CMGA 1R5IB 3QWNA 2Z4QA 1R1CA 3QPXL 3UJTL 2OTWB 2H47C 1DQTA 5ITBH 5DFTA 2ENJA 2MEJB 1RIUL 3TA4D 1UJ3C 4CVZA 3OKMA 4BM7A 3LS5L 4FERA 1VPOH 5HHVL 2X1PA 1XF5B 4LSVL 5AB2A 4MA3A 1CDIA 5IBUB 1UUNA 4G8GD 4H26A 4N0CC 4AE1A 2F2HA 4TQ8A 1I9IH 1C1EH 5DZPA 3FRPB 5CN3A 5EFIB 3WLBA 2WXPA 1YEGH 4NPKA 1NDMB 2VDKB 5JZ7D 3V9EA 3HC2A 1CIDA 3WFBL 4N2GA 1CYGA 3RIFK 1CFNB 1FO0L 2AXGA 2A9NL 4UQ3A 8FABA 2CA4A 3EG9A 2NY5C 1E4HA 2BHZA 3OPZL 4JPIA 3GMQB 3RKDD 3ZPDA 4Y7MA 1EXHA 4F20A 4YHOH 5DRWA 2X53A 4AI7A 2P45B 2VITB 4WW2F 1YQVH 4ELDA 3VFNB 4TTDD 4DN4H 1I8KA 3GRGA 3UO1L 3DSNA 1XZ0B 1AZCA 2HT4D 3I3BA 3US0A 1AGDB 3MZTA 3E3QE 4Z7WB 2WMPB 3MC0A 3MVSA 5AW4B 3LKSA 1S7TB 4WVRA 3MXVL 1CGYA 3LNEA 1WFUA 3H6AA 2XG5B 2CGRH 4HIXH 3IJ7A 4UU9B 4QDGA 4AOFA 4ZX3A 1EDYA 1U8HB 3UIYA 3VFUA 4WK4B 1CK0H 2R7EA 1HFUA 1Q9OA 1LO0H 2A6IB 4XNUL 1AI1H 1MEXL 1XSOA 4K9JA 5IBLC 3ZE0E 3LQAL 2OTUB 4M6AA 2IV9A 4F93B 4ZI8A 1LO2H 3F2LA 5F1KC 1X9UA 3ROLA 3FAXA 2XFXB 4LEOB 3CFJA 3T9WA 2Q8AH 1TQUA 5EOCJ 4JY5H 1OTTD 2WBKA 4Y89A 1MPAL 2F5AH 1E3XA 4X6CA 4CGUB 5A2CA 3QJOA 4UT6H 3SE3C 3WBDA 4RZCA 2F68X 7CGTA 4TPRL 5BZWA 1NC4B 5F7WC 3DBXA 3WUWG 2FJFA 2E8ZA 1NJ9B 4PV8B 3VE0B 4NKOB 4FNPA 2CLZB 2EEBA 3ABLB 3E7JA 1IGJB 4LLMA 4ORGB 1N68A 2EACA 3IXTB 3Q1EA 4PS3A 5TDOA 4LARL 5A7BA 2EIBA 5J1SC 1MY5A 2VDOH 1TMCB 4S1DD 3OLEA 2QPSA 3WDJA 1F02I 1QRNA 5E4AA 3QJHA 3BAIA 3TONA 3QZMA 1BCIA 5F7DA 3KPOB 3AREB 4MCYB 4U1IA 3HI6H 3Q1SL 3L17A 4RX4A 1UFUA 2VWEE 5EEUA 3U7WH 1WQVT 3U25A 4L0YA 3ZL4H 2OBGA 2J55A 2Y1YA 3O2DA 5D70L 4ESKA 2HMID 3VH8A 3GSOB 2OXGA 4OZFH 3RUGF 3PPEA 1OPGH 2R4SH 1ZA3B 2J72A 5L9DL 1WBXB 2HJKB 4QHNA 1I4FB 4WW2B 5T5FA 5HP5A 1LK2A 1I1YA 2JJUA 5AB1A 1XTLA 2BVQA 4YGVA 1JJUA 1GCYA 4PJ8A 2MCPH 3SCMA 4HEME 3VXNB 1D5BA 5HHXH 1HHKA 2UZPA 3ZRCC 4ETQA 2ADGA 3BKJH 5HYSB 5C7ZA 2BZ7A 4U1SA 3H56A 3ZIYA 4BCZA 4HUWA 3LH9A 4EUPG 3MCKA 3DSFL 3MFGB 1IQDB 1JMZA 3E9UA 4U1KA 3GJFH 1MZYA 2JWYA 1AG6A 1WD8A 2NYYC 3OR7A 2WUBL 3OAWA 4GAYA 4M6OL 1LP9E 3EO0A 4IW4C 3AITA 3OKDB 2Y2YA 5A6LA 5I5RA 2F8IA 4LCIH 3EYUL 3QHTC 4PJCE 5DJCB 5IT2L 4J12A 4G83A 4EOWH 4IOFD 5I1HL 3WIHH 1AQMA 5L7XL 5AVZB 2L7UA 4LK4A 4Z5RB 2BIIA 5KTEL 1MJ7L 3IFPB 1R0AH 1ZANH 4OCRL 2O6DA 3BOVA 1ZSDB 4XAKD 1RURL 4GQ9L 3FHAA 5DD3L 3HZYA 3MMEA 1RFDH 4GNKB 1CFQB 4Z7UF 3KH4A 5B7MA 3CFUA 5F89B 2AABH 3RVUC 3SYCA 5HYFA 1TFPA 5DF0A 1RLWA 5IMLA 4OI8A 1CLOH 2QSCH 1OGAA 2PTVA 4PJ8D 2Y1ZA 5AW8B 1S4IA 3SCMD 2DLFL 3D2UA 2UXFA 4N2NA 4OFPA 2HN7A 1QABA 3KNBA 1Q9WB 1C08A 2WQAA 4MS8C 4OFIA 2H32H 3FL7A 4W9GC 5SWQB 4TVPH 3O2WH 4Q52A 5CILH 2JIXB 3DMMB 2R0WL 3O8XA 4B50A 1BIHA 1N8ZB 1BBDH 4BFKA 4XPGH 1GSMA 1CGXA 3QR0A 3S3BB 5KVDL 3NFNA 4EI0A 3ARDB 1YJDL 2FO4B 2N4IA 2WPGA 3RUGB 4ATWA 1VKXB 4KXAA 5D5MA 3S5YA 3ARTA 2BVPA 3QNFA 4E5XA 4HOMA 1BYNA 2X5PA 2B0SL 4L23A 1RZKC 2R4RL 3BMVA 3IYLW 1EZSA 1NA8A 3WHE0 2Z7UA 2GIYA 3EUDA 3SQOH 1KB5L 3UH8A 4EN3C 5I9QB 3DNKA 2I60H 1F3JB 4UANA 1ZPUA 4X7CC 2ZOWA 4X7DC 2AJUL 3H3PH 3Q6FA 1AR1D 2WO3B 4M7KH 4R2GB 5D2NA 4ZZKA 4XNQB 4ZMNA 1F90L 2YA2A 5HJGA 4B97A 3DGGA 3FAWA 4HT1H 3AM8C 4HIJB 4HJIA 4ALAL 5DR5L 1OGAD 5D1ZA 5I8OH 3V0IA 1RVFL 4NKMB 1NCBH 1CD1B 1RIHL 3OHXC 5J6SA 3CHQA 3QFDA 2VDPL 1MJUH 2ENYA 2BMKA 4FHBD 2P49B 4Q6IA 4XZUA 4OGYH 5ERWB 3QE5A 2EDDA 4TLKA 5AVWB 3WSQL 4DOHE 3KR3L 1HDMA 4G72B 1R3IL 5DLML 5EN2A 3BRGC 1RLBA 5T3ZL 2QEJA 2WWKO 1MRDL 2X4QB 4WUUA 1A21A 4Z7UB 4DO6A 5I15L 2Q7AA 4JKKA 4UM8A 5CGYD 1A6AB 1Q9LB 4RIRB 4YXLH 2IMMA 2CALA 2VH5L 2VMFA 3C75A 1T04A 3X3GL 4AH2A 4DGVH 1LEKA 3CDCA 4FMKA 1IAIM 3MV7B 3M88A 2Z0BA 5JORA 2HJLB 3OG6B 2AK1L 4P07A 5BOZG 4APQC 4YHML 4NENB 2DH2A 4QUOA