3ZTDC

Pvhl54-213-elob-eloc complex _ methyl 4-(((2s,4r)-4-hydroxy-1-(2-(3- methylisoxazol-5-yl)acetyl)pyrrolidine-2-carboxamido)methyl)benzoate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
139
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 139
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3ztdC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3ztdC01
1LQBC 4WQOA 4B95C 4W9IC 3ZTCC 3ZTDC 4W9CC 4W9LC 4W9JC 3ZRCC 4AJYV 4W9GC 1VCBC 4W9FC 4B9KC 4BKTC 4BKSC 4W9KC 4W9EC 4AWJC 1LM8V 4W9DC 4W9HC 3ZUNC 5LLIC 3ZRFC
chains in the Genus database with same CATH superfamily
1TZGH 4X9IA 2G2NA 4XHQA 3ZKMD 3T0EA 2QFPA 5DS2A 2EDDA 1S7TA 1KIQB 1ZWIB 3OXSB 5KSBB 5I1IH 3TONA 1SEBB 3KYNA 5F89A 1PZCA 4PJFF 4CVZA 3IU3B 1SHXA 5CZXD 5TF0A 2VSKB 5T1KB 2IPUG 5HSFA 1T1ZA 3TC9A 1AFVH 2HTLD 4H8VA 3K1DA 1CZ8L 5DLML 4P2YA 4B27A 4G6FB 4N8VB 5IY5B 2A3TA 3K71B 2Y5TB 4MJIE 4U3XA 4PBWD 4PJ6A 3H4HA 2BFVL 1OCRB 2JI3A 3ASWA 5E24E 5EOCL 2HFTA 4IDJH 4H20H 3NAAL 4UZUA 2UUDH 5AOLA 5F1KC 1KTLA 1FO0H 2JQZA 1F4YH 3L3JA 4OZGE 3O9WC 1DBMH 4NDMB 4U1KB 4L0PB 3OB0K 5CHNA 4APQC 4FAAB 1ZT1B 4N3TA 4RMSA 4QF1B 4UNVA 1B9KA 1MNUL 3VD4A 3ZVVA 1U93A 3HJEA 1NCTA 4J6RL 2O5YL 4FFZA 4KUZL 5KAQF 4PJ9A 2HJFB 4I18B 5HY9B 4PIRF 2D4DA 1I8AA 2JCWA 4QHMA 4UIMA 1U6AL 4DEWA 5I30L 4PJIB 3HPJA 5EORL 3JVFC 2FECI 4FJZA 1L5GA 1GGBL 3T3MB 4K23H 2N3JA 5C6TH 4DPAX 3S5ZA 4YMPA 3ETBJ 1T1YB 3TESA 3NBNA 3P3YA 4AIOA 2QMJA 4IS6B 5DFTA 2QVIA 5FYJH 1EZLA 3C09C 3ZHDA 2PABA 3GC3A 4XPFL 4D0BB 1QUNB 2AXGA 1SVZA 4HS3B 2W60A 3KNBB 3VFGL 4Y5XC 1IM3A 2IVFC 5CJQL 1VRSA 3X3FL 1CXIA 2WNKA 4JFDE 3BJLA 4J3WA 2PO6B 4GKZA 2YO3A 1XH0A 2BWIA 3FTUA 5FYKE 3DSFL 4S1DC 3BUPA 4DEPC 2HTLC 3QUXC 3R06A 5BOZG 4DGVH 4HFWB 4LKXB 3TO4D 3PL6C 4MA1B 4CW1A 3S34L 4A7GA 2WAHA 4W81A 1S4IA 1EZSA 3OAUH 3OMNB 4HA1A 4NKOA 1H5BA 1HT6A 1XH3B 2ICWI 2EUVA 3D2UD 2JCCB 3Q9PA 1E2VA 3EFDH 3OGCA 3BRGC 3MGTB 3BUTA 3V95A 2DYPB 1JN6A 3MUGA 4AJVA 2B3IA 4OIIL 2MQGA 4BZ2H 5HHQA 3V6BR 3TWYA 3MUUA 2RA1A 1D5BB 3ROLA 4YHOH 3FT2A 4GSDH 2A9BA 3TJHD 4M5TA 1DDHA 4ZG1A 2PXYD 3II1A 5I5RA 2Q0ZX 3N55A 3BO8B 3KZ8A 1SY6H 5GS3A 1BMZA 4KY1L 5GRWA 3LHPL 4EKJA 5AOKA 4FABH 4P2OC 3TEZA 2VN7A 3OLGA 1CLCA 5IW6A 1JK9B 1NDTA 4PV9B 1RP9A 1NGZB 3LEXA 3V4PH 3BDYH 5AW4B 4QXTA 2FATH 1C5DB 3QFJD 1A4CA 3EFOB 3DX1A 2WP3T 3IDXH 3ULUH 5JR1L 2CXKA 4PGEA 3PWLB 1NMCB 1JXGA 4LCUB 1IVTA 5E4IA 2B59A 2FHCA 2VM9A 1K9TA 2UY7B 4IBLT 4OTXL 1U8JB 2OI9B 3NFNB 4ALAL 2D7MA 3GMQB 1G6RH 3EOYG 4OJAA 5DS1A 1FZMA 1JF5A 2EVJA 1HINL 2Y7QB 5DD0H 3LCYA 2YAPA 1KBGH 2Y24A 3MNWB 3SQRA 4MYWB 3JV6B 1W2KT 2DPKA 5F3HA 4ZFZB 1AGDA 3RFRA 2F54B 1QQDB 4AYBA 4KJWD 3O9WB 1BVKA 2CUIA 1J87A 3F6JA 4XB8A 1P53A 4W6WB 3N40F 2NNAB 5IBLC 3TO4C 1GHFH 4UQ9A 5DQJA 1L6PA 4AUJA 3EOAA 1PJ9A 6PAZA 3JSSA 5KJRL 1TITA 2Z1PA 4U4IA 2CAKA 3OKDB 4LZKA 3VMPA 2VL5A 2V6HA 1PDKA 4F5CA 2ZWZA 3HZMB 4EBQL 1UVQB 2CKBB 2WZAA 3HUJB 3DSNB 2QGDA 1RIVH 4GAJH 2HX8A 4E68A 4I3RH 2VAJA 4AKOA 5I73C 3WHE1 2J6EL 1KACB 3ZR5A 1QSFD 5MENA 1QBAA 1J05A 1FRGL 3A24A 3M88A 3LQAH 3UROR 3MJGX 4JJ5A 4AZ8B 5IK3A 3MRGA 2N4IA 4IM8A 2H1PH 3O3DB 4GG6B 1YC7A 2J1KA 2W9EH 3C09B 1EJFA 3QDJD 4HIXL 3UG3A 3EJZD 3GSNA 4HEME 4UQ2B 3OHXC 3UJJH 3OPUA 4Y5XB 2IQ9L 1OOWA 1UT1A 2C5DC 4ODUA 3BAKA 2VLME 1A1MA 4PRNB 3R19A 2KDYA 2X0UA 3PWPB 3O4LB 3IDYC 2DWEA 4ODWB 4P4KC 3WD5L 5FECA 4GW1A 4Y2DA 2Y5EA 5AVZB 3H9SE 5DWUH 1MCKA 5D2NC 3QUXB 1HOCA 4DEPB 5IJBC 1KBWA 1NCUA 2YD6A 2WBJC 5L4IA 5T3ZL 1LO4L 3HKFA 3PL6B 5CN3A 3BSZH 2DICA 1D2OA 1QI4A 1JD9A 3RPIB 1HDMA 5C0RH 4Z7QF 2ZONA 4GW5A 1UM5H 1KGXA 3MLUL 4KKLD 5B1KA 4RAVB 3CZLA 4L37B 3SDXE 2VDQH 3F2LA 5CU9A 5ID0A 5L88L 2E7DA 4I1PA 4I89A 2AJXH 5ABDE 3GSOA 1BREA 4KJYA 1PSKL 5F7YC 3MRCB 5HI5D 1PZAA 1KJ3H 3PHSA 4IOSA 4KJWC 1C5CL 1QYGL 3L8QA 2ICWJ 1TJIL 4PP1D 2CR3A 2UYLA 2VRQA 3MGOA 4ETYA 5IFJB 4K9EL 3TN0D 1BFTA 4J3OD 2EDYA 2F68X 1B0GA 2MOGA 3G04B 2GIMA 5FA4A 1YY8A 5KG9A 3BGAA 4TPRH 2H2SD 3G5XB 3QEHA 3QWOA 1UWFA 2B3RA 3SGJC 4NQDD 2A77L 4HKXB 4WUUA 1XGQA 1U8MB 2XWBB 2XOTA 2DQCH 5I8OH 4HKJB 3GGWA 5EBMA 5HHPB 2X12A 4PY7B 2QPUA 2ICEB 3ZYZA 2VIRA 2IBZY 2QFRA 3EYFA 2NY6C 5LDSA 2W0LA 4TOYL 5BVJA 4LSQL 4U7MA 3DX6A 2BY1A 5LGKA 3IJ7A 4JJOA 4TUJB 2CRZA 4GI9A 4AYSA 2E6JA 4AGMA 1M1XA 1Z9SA 5IG7B 5INCB 5HVWA 2ATPB 5H2BB 3RP1A 5EIIA 3S4SA 4Z7NB 3TFKC 3UYPA 1OP4A 5CIPA 5FGRA 1B88A 2NNFA 3RWDA 3UTPD 3GSQA 4LSUH 1AZNA 3L7FB 1I1YA 3HNVH 2CK0H 4PMFA 1OGPA 1ZHBB 5F8RC 2NUPA 3D33A 3D12B 3L5WB 1B2WL 2YK1L 3CG8A 1U36A 5I1KL 3KLHD 3CVBA 2XLLA 1E4WH 3TBYB 4V33A 4YHZH 5IW1A 4HZAA 1RQ5A 2Z31C 3UTQB 2CHDA 2CLZB 4MNQE 1C08A 1WFJA 1UA7A 3BFWA 4NWTH 4R7DB 3FU7B 3QDMB 1JGDB 4KKLC 1MKFA 2F2HA 4ODVH 5I19L 5I6PA 5ICZB 3KPSD 2F74B 2YPVL 2BIMA 5SWZE 4CMMB 1SQ2N 5HI5C 2DQUL 2GIXA 2RACA 2IOIA 4XN5A 4ELDA 5I73B 4PP1C 4WEMB 4JQVA 3CFJB 3HZKA 4J3OC 3TN0C 3VTTA 1BA9A 4OGXH 2EJ1A 3DETD 2H2SC 4HWZA 2DKMA 1HH6A 3S35H 5AD0A 2G9HA 4R4FL 2DQEH 2VH5H 2FX9H 3OHXB 3BW9A 4FDWA 4GXUM 3QUMA 1ZVNA 4N2HA 4LVNC 2C9QA 3WIFB 5JDSB 5AW2B 3UBHA 1CE1H 1KC5H 1NCCL 3IDNA 4WI3A 3K80A 4P4KB 4PCKA 5E03A 1AI1L 4HIHB 4POZD 2F7PA 2ZUQB 4IGBD 1Z9LA 2ALWA 2XBTA 4DF9A 3G5VB 2X7LB 1IO4C 4H7VA 4LLYB 4HQQH 4KQ3L 5JMOC 3ULVE 4Z8FL 5DMGC 2FWOA 1ZPLA 4Z76A 1W0WB 1XGTA 2DRUA 1H0DB 3TYGH 4TNFA 4OAWB 1FNFA 4XCYB 7FABH 2H8PB 4YPGB 4HKBA 4FQ2H 1HE8A 1KEMH 4ZYKB 4FFTA 5H8DA 3LYRA 1N8OE 3P40A 3EJJX 2GAZB 3L54A 1VB9A 3I3EA 1O7DC 1JYVA 4Q6IC 1BVNP 4IIZA 3NEEA 5ADPL 2VDOL 3LXUX 4HOMA 4H2AA 1QBLL 2AJSL 3VSVA 3Q13A 3P54A 3UXFA 3REVB 1WT5C 2FSEB 1HHHB 3LAFA 3QGVA 1CDBA 1DVFD 3R18A 1ACXA 5A40E 4FNQA 1BG1A 1NSNH 2NY6B 2MPAL 3B8YA 3TT3H 1IM9A 4DW2L 1M9SA 1FYHB 1GGUA 1XEUA 1KIUA 2HT3D 4QTFA 2R7EB 3EDKA 3OR7A 3GBML 4XCCH 5K9QI 3SDAD 4L3ED 4OFYD 1I3VA 2J12B 1X5GA 4G9FA 4C57C 1ADQL 2HN7B 3FXIC 1INDH 5AW1B 2NXYB 1UZ6E 4HJSA 4K8RC 4OKVB 1CLYL 3E2HC 4POZC 4HKZA 2RQ8A 3KHOA 4WI6A 1T5XA 5LJYH 1RURH 1P2CB 1IL1A 1IEBA 1FWXA 1JZIA 1ZJBA 5SWSB 5JPMC 4GUPA 2AFNA 3MKKA 1T0MA 3D51A 1GIGL 5C0AA 4QRPB 2Z31B 4M1CD 5CZVH 3RWCA 1YEGL 2XZAH 5G5DB 4YXKL 5FOJA 3E8UH 4XP4H 1NPNA 3RVXD 5M94B 3P0VL 1GYUA 1LEGA 5KVGE 3DK2A 2JLPA 1UXWB 5FUCC 3HG3A 4Q97A 2IEPA 2ADGA 1GY2A 5CN2A 4X9HA 4B9GA 3B5HA 1WZKA 5LGYA 2R2HA 3OAYK 4KH2A 4HSQA 2OYLA 3N06B 2PCXA 1NLDL 3MBXH 4Z7OF 1BAWA 4QPEA 3VH8G 4J1UA 1UUSA 5KOVC 3GMOA 2YAOA 1WBYB 1NDMB 2FECL 5J6HB 3HOGA 1FC1A 1JPSL 5CUSH 2NR6A 2AJVL 4L0YA 4Y1SA 3Q5OA 1SF3A 4L3AA 2GEQA 1QPXA 1BW8A 1TPXB 1IBBA 3MRRB 5E6ID 1T0NA 3VXMA 3OJMB 4DETA 5E2UL 1ADWA 3WN5B 3H9ZA 3N2JA 4H8WL 1NEZB 1BF5A 1BPVA 2F7RA 1JHTB 4PJEB 4EI5A 3Q2NA 3QZWG 3D4CA 3T09A 2V8LA 1Z5LA 1FVCA 3WSQH 3P3SA 3M07A 3C5SB 3GJFB 3L95A 2QPEB 3G6DH 3O8XD 2IANE 4YGVA 3UDWC 1FA4A 3GMMB 2ATKA 4H8HA 4NQEA 1TF4A 4JY5L 3S3PA 2A9MH 4WFED 4YS4A 1SHMA 2BHUA 4YXHH 5GS0L 5IEKA 1I1RA 1YN7B 4QRSA 5D5MB 1ORSB 2M1KA 1D5XB 1YEDB 1LP9F 4PBDA 2F5BL 4G1EB 3NZHL 3O41A 5F3BB 3BPOC 2I60L 1GW6A 2OR7A 4NZRH 5E7FA 1FVEA 1Y18A 5F7DA 5CXPA 4EIZC 1TVDA 3RVXC 1QTYT 3HNTL 2AP2A 3IFPB 4I77L 1IGCH 2P5WD 4WO0A 3ESNA 3VSUA 4FXKA 4X50A 4YHML 3EXLA 4Y19E 1ID5I 2EVHA 2VW6A 1L4IA 4JO8A 4CC0A 3DMMA 3PGFL 4B9FA 3WJJC 3BT2L 1HEHC 1MHCA 2YKLH 2XYCA 2LTQB 4G2AA 5DHVA 1GL4B 5AWNH 3WFCL 1ASQA 4YGAB 4UUJB 5J4MA 1G9EA 2CO3A 2NTFB 5AUMA 1BPLB 3C6LA 4AIEA 2ESVA 4FZEH 3K4AA 2XA3A 1LJMA 4HV8B 2R56H 3MLVL 1TTGA 2FB4H 3E2HB 5IQLA 5E6IC 4JN2A 3VXUE 2DS4A 1MN4A 4TQIA 4GQZA 4YOKA 43C9B 5T8IA 2MPVA 2R0KH 5GGRY 3QIBB 3JBG7 3L3OC 4JZOB 4KWUA 4FEMA 2Y06L 3ARFA 2FSDA 4OGQC 2CMRH 4G8GB 4OVVA 4XMZA 5K9KA 2EDXA 1L6ZA 2DLFL 1OSPL 2VAAB 3NACH 5EU4B 3P4NB 2LV4A 4UM9A 1QLEL 3T04D 3MRIA 2EVFA 4IW4C 4W4OA 5EBLB 3V6FB 1A6UH 3ME0A 1YJDH 4I7ZC 2YC1A 1VENA 4P5TA 3AAZB 4NO2B 4DEUA 3UACA 3HE7A 3L4WA 2YD5A 4NUPA 5I6NA 2K4AA 3ARBD 4D9QE 1MZZA 5ISZD 1BQHG 1JI2A 2ZJSH 1MZYA 3DGCR 4XE0A 5HDBB 3DYMA 1IC7H 4IRJB 1KTJA 5BJTB 3O2WL 1QO3B 1MI5A 4D7PA 1WD8A 4ACPA 3NJMA 1JWSA 4PS4H 2YGQA 1JHLH 4AVIA 4OLEA 4J12A 3HC4H 1JZFA 4PJDE 4QRAA 4JM4H 1YZZA 1KGUA 1BLIA 1U8CB 4NHUB 4A39A 5I1AB 3APCA 4JO4H 4E9SA 3BESR 5B1JC 3M1BA 3SYQA 3UBFA 1DQDL 4PW4A 3F00A 3NCFB 3L6FB 4N2NA 2YQBA 1TQBC 5MEOB 1GSMA 4ZX6A 1NIEA 3I6GB 3ZKND 1AAJA 1OZTG 4PJCF 3PWUB 2Y2WA 4KITB 1GSKA 3JTSA 4ZAKA 5GJSL 5KTEH 5E8PB 3BZ4A 3IMTA 4WLCA 4Y9EA 2J4WH 1G1KA 5HVHC 5E7BA 3CK0H 3PLYA 1N19A 3CFCH 1CGYA 5E94A 4GAFB 1M9WA 4XBGA 2I07A 1KDJA 3D39A 2H47C 2BSRA 2ITDA 3ETTA 4D8PA 2H0FA 2WVSA 1MFBL 4G8FA 3Q1SH 1FFRA 5IBTH 4Z1PA 4ZMTA 4WCYL 2BP8B 3BKYH 2CNZA 5CILL 3BPOB 1QR1A 4ONFL 1JZDC 1QI5A 4JFWA 4BA8A 2IG2H 3EKCA 3NIFB 1H3GA 3QXTA 4HLZG 3WU1A 1MNNA 1DEEB 1QSED 1U92B 3BEWA 3QJFB 3VQ2C 1F90L 1PKQA 3MLTB 3ARBC 3FU5A 4WHYG 1E28A 4P59L 1AGBB 4LE8A 4R5VA 2YWYA 4Z0XB 3B9KB 5TGBB 1M6OB 3U0TB 2JQMA 2R59A 3JZ7A 1IGIH 3IBOA 2BNRB 4Z78A 4AEIL 4NQSB 3IAPA 3MLPA 4OUOA 2WVVB 4MZIA 4UT7H 4QD2E 4XNZC 3AFLA 5ENWA 1E30A 4LP4A 3TL5A 1DJIA 4DKAA 3QISA 4WTXA 5D7LD 4AX3A 2C1OB 1D2PA 4JQIH 5C3TA 2WINA 1NBYB 1YO4A 3SDDD 3BWZA 1S7SB 2NW3A 1MW2A 4I8DA 5HHMD 3ZQXA 4XPTL 2MNUA 5C0GB 2AS5M 2UZIH 5HYJE 3T4AA 4NQVA 3RL2B 3V8CA 3V6OC 2FBJH 4QJ4B 4LOVA 3AMLA 4YC2C 2BZ7A 4JFHD 1WAAE 1X5ZA 2F1AA 1H8LA 2I85A 3P30H 2YOAA 5H94A 3KS0J 3T4YA 1ND0B 4MBOA 4GO8A 1P1ZA 3X1FA 2VO8A 4JGNA 3N5AA 1PKOA 3L3GB 3EYOB 1TYEB 4GRWE 2XUWA 3OGOE 1DO6A 1P4IL 4WGWB 1L3WA 4MAYB 4S1SH 5FLVA 2IAMC 2PYEB 2NDGA 3WFDH 1PIGA 1T7YA 5TDNA 2YQGA 4NBXB 2NUTB 2B39A 4X5WA 4AYFB 5LUMA 4BFEA 3M7FB 1J86A 5A7EA 2FH6A 1E2WA 3D06A 3NJKA 5C97A 3CD4A 2FX7H 4OJEH 2BVUA 2P9RA 5AG9A 3P9LA 4ZUWB 1NBCA 4RIRB 4QRTB 1CDJA 2A6IB 4AENB 1N2RA 3ZBMA 5ETUB 4QXVA 3EZJB 1ZVHA 1TSHA 4LVHB 3RNKB 3T1FA 2VXQA 1L9OA 3MJWA 3MRJB 2YD8A 1JF6A 4HUCA 2VDMH 4MZ2A 1TQCB 4G9DB 1K6QH 2C3HA 3CC5B 3QIWA 1AKJA 1CFVL 3DUHA 3U9UB 4JFOA 3NFPB 5FM8A 4KFMA 2WNWA 3KPNB 1DLHA 4HWNA 1O0VA 3UTTE 1ZGLA 1M71B 1W15A 4WRLA 2K7QA 4B95C 2Q76B 1FFTB 4WKXA 1QLFB 3RDTD 4WI5A 4KZDL 1GOFA 4N25A 1FH5L 4XNQB 1J8SA 4Q6YA 3WY1A 2WNXA 4GQ9H 1CL7H 2VXQL 3ALWA 5E2TL 2ENQA 4Z7VA 4ZUUA 2WYHA 5DD3L 2WLJA 4DQOL 3V0WL 1UC6A 4KVNH 2O5NA 5DQDH 4AEHH 4XPGH 4OKDA 1PFOA 4ZUTB 1KCLA 4MXVF 4LGSB 2HLAA 4MWFB 4PRPB 1JK8B 2W65B 2FL5A 4HJGA 3LB6C 5AZ2L 1M1SA 3JVGA 1G9MH 2CXGA 3CLEH 3SOBL 3ZE2F 1B0WA 3L08A 4GSRA 1YMMB 1D3CA 4OUUB 1FL5B 3U7YL 4ZFFB 4XNZB 3T0ED 5K69A 2R27A 5AW3B 3JV4A 4XR8C 2VOTA 4NT6A 1Q0EA 3OXRA 4BJLA 1CT8B 2WJ5A 3S3CB 1E4XH 1KBKA 4U3SA 4AIXA 1OAQH 3G6JE 3MJ9A 5EA0L 5BW7A 4HLZH 1UKSA 1RHHA 4MD5B 4PJHE 1JTTA 2GJ6A 4WHYH 3T2PA 4HUVB 2WUBH 4MDRA 2XN0A 5BRZA 3HCVB 3O4OC 3HVDA 1QFOA 4JKPL 3JYBA 4JKMA 3QQ4B 5AAMA 3OM3B 4R4BA 5DS8B 4W68A 4BZ1H 1T2JA 2EEXA 2R1YB 2HJKB 2G2RA 1NIDA 2FEDD 2P43B 1S9VB 4QOKA 5J3HD 1XR9B 2MWCA 3UZEC 4EUPG 1DFBH 1GW0A 5F8QC 4KKZA 3H8NA 3B7YA 1EAJA 3MJ9L 3RDTC 3NDZE 2IAMB 4P9MH 1R46A 3MRPA 4PJ9D 1GZPB 1EV2E 1QASA 1JF1B 1DBAH 4FA8A 5DURD 3M86A 1G7PA 1YMHA 4O2FA 5B1AB 4OD1H 4DNLA 3N0AA 5EU5A 3I85A 2AVFA 1IQWH 4NZTL 1TJMA 3TPUB 4AM0Q 4X98A 3BH9B 3FHQA 2DZEA 2DQ6A 3EH1A 1YEJH 2GK0B 4I0CC 2WW8A 1UOVA 2K78A 3HS0C 3LH8A 2BS9A 3QNYA 3BXNA 2AV7A 3WFBL 3C12A 3EG9B 2VDLH 5D7JB 3GTTA 3VM5A 5T33L 3B9VA 1RKRA 1JV2A 1XF5A 3T8VA 5E8OA 2WTRA 5L7XL 1DQML 2VN3A 1NH6A 1LEKA 2AQTA 5FUOL 1MCNA 3DXAA 5C0CE 1IB5A 2LGNA 3G5YB 5I5MA 1KGWA 1TUPA 2ZWSA 4R3SB 3LV3A 5EEYA 1A4KB 4RISH 3SDCA 2NY2D 4FG2A 4PJIF 5A6LA 3HVNA 3QVAA 4U1HA 4C56B 4WI8A 3PRZA 3LOWA 1SFDA 3NA9L 4X7TB 3N9GH 4I0PA 2UZXA 3HRPA 2SEBA 5BZWA 3SQOL 2ENSA 2XETA 5F7LB 2KHAA 3ZTEA 2FEDC 2EVIA 2HA1A 4RZCB 3ZY7A 4TSAL 4TULL 4WFGD 1G9NH 4F20A 4WI2A 2ODHA 1NC4B 3BIKA 3DVIA 3GZPA 3QDGB 5KN5A 4ZO6A 3ABLB 4ONHB 4DIXA 4F57L 1I1FA 3Q0HA 2E27L 5EO9B 1K4CB 2V33A 4ZUVB 3O6KL 4PJ9C 2R0LL 1CF8H 3X14B 3UC0H 2FJHB 4Q2ZA 1U3HA 5JUEH 1KYOJ 5CP7A 4PYHA 1OARH 3ZE0B 3P77A 3B7RL 2QSVA 3IXTB 4U33A 4JFYA 5BUAA 2DQIL 5TDOB 3KXFE 4ICWA 4M7ZC 3G5WA 3UCQA 2JFCA 2YAEA 1XH1A 2DDQH 4UV4H 2ARJB 4NC0B 2D7NA 2EDWA 4BDVB 4NPKA 5ECGA 4F2ME 3BN9D 3LZQA 1WHPA 2JCCF 3QORA 4NUJA 2F1EA 4PRBA 4F15C 1GJWA 3CZFA 4Q0XH 5F9JA 3DO3A 3CSBA 4PGCB 1A6AB 5DRXB 5D71L 3VGAC 1HN1A 3S96B 4Y2OB 1UJ3A 3AUWB 2GT9A 1EIBA 1HAUA 2IAAC 2F58H 4OZGB 5F3FA 4Y5VB 3KLAA 2B08A 5AVVB 4OLXL 1UFGA 2VYRE 1FAKT 4KKCD 5CBAA 3S5LA 2GIYA 3FYIB 4MSWA 3GBLA 4XO5A 3H3PL 3LPOA 2NY2C 4XP1L 2FNBA 4K3GA 1ODUA 5I1CH 1N5AB 1MAJA 2K6WA 5J56B 2R0WL 5DC2A 1H5BC 3V4VA 1O5DT 1IKOP 1JXJA 3GMPB 4KXBA 1WH0A 1BQSA 2RIKA 4OVUA 4JFFD 2J5LB 1F6FB 1KPVB 5JPNB 4CNIA 1QI3A 2FLBT 1MCPH 2HKAA 1I8LA 3BVUA 1BJ8A 3VI4E 5IJCC 4JKKA 1L7IL 3GRWH 3QEUB 4BSWB 1T0PB 5C6WH 2NY3B 5T3ZD 2NSMA 3NH7H 1Q9OA 3OKLB 5MEND 1BOYA 2GFBB 4TNEA 4X7EC 2BNUA 3S37H 1E9OB 1ZVSA 4EUPH 2AMGA 1WFIA 4MJHA 2ZXAA 4Q9QL 1TQSA 1QFWH 4G1MA 5J9PA 2C34A 1HKLL 4ODBD 2QGEA 1J8HE 3PWJA 2Q87A 1N12A 5T3XH 3U4BH 5TD4A 1S7TB 1N6VA 1URLA 2HRGA 5F89B 1X5YA 3N91A 4O58H 3V4VL 4AKQA 1ZLWH 4OLVH 3HB3D 2DLTA 4N8VG 4YE0A 4Z18A 1HWGB 1T1ZB 4DP8X 1A4BA 1KOAA 3HI5L 7PCYA 4LT7A 3R8QA 4PS3A 3HUJF 4P3CH 3TVMC 3N1FC 4FNLH 3Q6GH 5ALBL 4JMNA 3MRKA 5KJ7E 4X6DA 1PAMA 5AALA 1MFEL 3IMWA 4MNGE 3KM2A 1DLFH 4GBXA 2Q7YA 4G6AC 2ZX8A 1N0LB 5K33A 5EU6A 1TQVA 2A9AA 3D4GA 3FCSA 3FTGB 5CMAB 4IOSD 3OVUB 2VDKB 1WDAA 1NICA 4OCWL 2C1PB 2LLLA 2FCBA 2OL3H 5H4YA 3T8XA 3WNPA 3RKDD 2QTEA 1HYSD 1N26A 4X6EB 5I15H 1U93B 5TE4H 1JRHH 1MLBA 2H32A 3H85A 1BIHA 5DZJA 2A9CA 2BSBA 3QYMA 5JQ6L 4QUOA 3CV5A 3PV6A 4FI8A 3VW3H 2R4SH 4ZW7A 2EO7A 4WUUD 5JW3H 2VERA 1YEWA 4OR1A 1EJOL 1ZTXE 4HCRL 4R90L 2ZCHL 2ZXGA 3RU8L 4L4TE 4JCMA 1OHQA 1T2QL 4NC1C 3WNIA 1CGUA 1FG2A 3AWGA 4CADA 1JJUA 3WS6C 2AABL 3PUUA 5FM5O 3GZOA 5CD5D 4A2GA 3FSAA 4F15B 1CJYA 1PL3A 2AXGB 5DEFA 1CBVL 2FEEI 2W60B 1AHWA 1GS8A 2R1WB 2PW2B 1IM3B 2DEXX 3GI9L 3OWEA 2X89A 4GKZB 1X5JA 3VGAB 4LNRB 1JPST 1DE4A 1KJMB 3F12B 4Y2DC 1VZIA 1V7NH 4JJHA 1L0PA 2PYFA 1EBAA 3FHAA 2AGJL 4F58L 3R06B 5CM1A 4J3BA 4ZMWA 2Y7MA 1I8KB 5C0BE 3BKCH 3O45B 4U6HB 1A4JB 2K1MA 4G7VH 5KYXB 3CSYA 1ERNA 5ELIA 5FYJE 3HI1A 3QXUA 1H5BB 5DJZA 4XP9H 5FO7B 1YDPA 4QHKJ 5GRJH 3MLRH 5D1XA 1M3JA 1NKOA 1VHPA 2QKIB 5CFAA 2BY2A 3UTSE 2CDFA 2QGCA 4RDBA 3JWNG 2BC4B 1G7LB 5HGBA 2OYMA 2VABA 1E67A 5AAPA 3RKDC 2VR9A 1YEFL 4JMXA 5BS0A 4DTGL 4Z7NF 3TOPA 5DDHB 4PTUB 1VCAA 4JFEB 3HS8A 3X13A 1DDHB 2J8UA 4TUOA 1XGYH 3LS5L 3L3HA 1WJ3A 3VXPB 4LNVA 4X7SL 1T6WA 1RZGA 1UA6L 3SPVA 1SXCA 3M17A 1S9KC 3QPXH 1UWEL 2O26U 1A7QL 3FFCE 2DJMA 1I7UB 2CO6A 2JV6A 3AQXA 4QEGA 4D9LH 4FQQB 4QXTB 2JMRA 2Y9RT 4QYOB 3AM8A 4J2XA 5FOBB 3QYNA 1IGTB 3BQVA 4GSUA 2R23A 4Y4HA 1AG6A 4HWEH 4PGEB 4K9EH 1TOXA 4PCYA 1DVUA 5ACMA 2BDNH 2IFGA 5JHLL 3F62A 2B59B 4HC1A 4PP2A 4N6RA 5CD5C 2PW1A 4TVPD 4LCVA 1DUZA 5GRZA 1D6EB 3TVMB 2ZWYA 1FZMB 4FYQA 4HEPG 3SDXB 1JDCA 3D1MC 4FYSA 4IRZH 1ZSDB 3GBNH 5FXCH 4L1HA 2CPUA 1F97A 1XGPA 3SKMB 5F3HB 4BV1A 1SVCP 1AC6A 1OAYL 3BYYA 2HUHA 3I6SA 3MV7E 1TTAA 2AJ3B 1BF2A 4MJIA 3DHJA 2N59A 4WU5A 1WG3A 2HRLA 4TRPL 3ULUE 1LL1A 1S6NA 2GG1A 2XVBA 4GLRH 5DQJB 3NIDF 1N4XH 4L23A 4DK5A 2EZ0D 2YPKB 4M9OA 1S7UA 2A83A 2A5UA 2XQBL 5EU3B 4IBWA 1EXUB 4YSRA 2VL5B 4HC1L 3S37X 1LQSR 4PTTA 2H3NB 3GXMA 5T5FH 5E23A 1A7NL 1TFHA 1NOFA 1J9SA 2PWGA 3VD0A 1Q9LA 1UB6B 4L0ZA 1SJHB 1TENA 4LRNH 3OJDB 4G3YH 1GRWA 4JRYA 4JQVC 1B4LA 3D87B 3EJYD 1J05B 2APBA 3IJSB 2AZAA 2E9GA 4L8CA 5IK3B 3MRGB 3IS0X 3T6ZA 3JWOC 1AGFA 3OLDA 5E2VL 4GMTL 3DYOA 2DOCA 3IDIA 4G9FD 7CGTA 3GSNB 3OX8B 4Z3IA 2IDTA 3AQYA 4QLWA 1KSRA 4JRXB 1PYWB 3FUJA 3QPKA 3MQIA 1N6UA 3ZTJG 5CLZA 1OXYA 5KSAA 4WSKA 1JI1A 4WV1B 3VXQA 5FECB 4A2DA 1HEZA 3D85A 4GW1B 4D3CL 2VMCA 3IGFA 4Y2DB 4FNUA 2FEJA 3GSRB 3ZDXF 1RUKH 2GJZB 3IKCA 2WO2B 3U46A 4I0KA 3VACA 5HHOA 5D2LE 4LP5A 1NL0H 5C0AD 3PS6A 1KG0A 3ARGA 3RAJH 2O61A 5I1DB 3RFZA 2DMGA 1YEEH 2GK2A 5JIIA 4FTVD 1J5DA 1HDMB 1X7QB 1DSYA 4YWGL 4KBPA 1OM3L 3VXRD 4K3HA 4HWBA 1SQMA 2GSIB 4KZEL 4OQTA 4L1LA 2IO5A 3ELQA 2DEYX 5FYLH 3MOBL 1PY0A 2DQFB 4XAKD 1K4DB 4HK3J 4V2BA 1DYZA 3MACH 3FB6A 4XX1G 1EFXB 3PXHA 1VGKA 1DN2A 2EYTA 3QIUC 3KYKH 3CFMA 2NOYA 5DJAB 4NQCE 3QWOB 3MA7B 3OD3A 4KMTH 3FS9A 4Y5YA 5FYKL 2YPLA 1I4FB 5EULV 5GS0D 1DJWA 3MYJA 2BRQA 3DK0A 1V5JA 2AEPH 1NCGA 1ILSA 3VXMD 3JWNH 4JDZA 3EJYC 4KDWA 4ZUSA 2EH8H 3VMNA 1IAII 2VGLM 2CUHA 3K6IA 1M1XB 2E7LA 1JNJA 3HG2A 3MA9H 32C2B 4WEUD 4EI5D 5EIIB 4AVHA 1E5ZA 4B6ZA 2NX5E 1AQDA 3RUGE 4PJXE 3WNMA 4MGXA 1U21A 3ZTNH 3MRBB 1VFBB 5D4QA 1ZAGA 3QR2A 4X6BA 3CZKA 4TUKL 4EVNA 3FUKA 3JT2A 1FIGL 2WQXA 2PCYA 3UO8B 1BZ7A 2ZG1A 1R3IH 2VZUA 4OZHE 3I6KA 1BVOA 1C08B 3D07A 5CGTA 4TL4A 5DC0A 3QEQE 4CU8A 4ZXBA 1JXKA 4LL1A 1KB5B 1ZT4A 4LPTA 5AVSB 2ZAIA 1JFQH 1OKEA 2VM4A 3UBXI 1OPGL 3CFQA 4ZMPA 4YDZA 4Q14A 1V3MA 2AEIT 4DFHA 4NNYB 4P23D 5GZOA 2IPKA 4OF6A 2EDLA 2CCWA 3EZ8A 1BBJA 5BZDA 5D1QE 1A1NA 3NJHA 2BOBA 3QDMD 2DKSA 2AANA 4LLUA 1NFDB 3LPPA 4FQIH 3U7WL 2XBDA 2D9CA 5FUZH 1WGOA 5K59F 1HOEA 2CKBH 1E43A 3RX9A 5A1AA 2G9HB 3C6LD 4JZNA 3CDFA 2ZCLL 2NR6C 2G0LA 4QNPF 4JE0A 1E65A 4WJG3 2GW5A 4G8IB 2CO2A 4R26L 5SWQA 5H37A 1RU9H 5CJ5A 1JGUL 1MRFL 3FSOA 1NOLA 4A68A 3WFHA 1LD9B 4N2GA 3VYOA 1ET8A 3LEVH 5TDPA 3ARFD 1Z5YD 4OFDA 5FFOA 3JZYA 5DUMH 1VPOL 3FB8A 4Z76B 1FORH 1BEXA 2C3GA 3SKOB 1QFWM 5IT2L 4BK5A 4DPCX 1D7CA 4XT1C 2CGZA 1T21B 4Y1AE 1T1WA 3JTTA 1M42A 4GW4A 4D8OA 4HKBB 2BCKB 5H4ZA 3WIHA 4S1RH 3ZTJH 4C4UA 3GLAA 3H3BC 1DSWA 3EO9H 3KWWB 3ZRCC 1ES0A 1Q94B 4L8SB 1JYWA 2CQVA 3L7EA 3KBPA 4HIJA 5DEGB 1HSAA 3U83A 1XMEB 3HC3H 3QIUB 1SMAA 4DUVA 2GQHA 4X0KB 4L48A 4RMTA 1UUNA 5I82A 2PWDA 2DIAA 3SO3C 5ES4B 1GMIA 1Z2KA 4NN7B 3AG4B 3V2AR 1OF2B 1SMDA 4FXKC 1QNIA 2P47B 4YFDB 3FW6A 3DMMC 3U0WL 1BXVA 4L3CB 4IMLB 5C7XL 1U2CA 1Z3GL 5IEHB 1IM9B 2FQEA 3HG1E 3WIHL 1XXDC 2EDKA 1X4ZA 2BJMH 2I60H 4UT9A 1KDIA 4ZAKD 5E9NA 1KCBA 1AIFB 5C0JB 2VSMB 5F6IC 3VXSA 3HNTH 3H56A 3WENA 3IDMA 1G7IA 1CD9B 3RWEA 1CWVA 1PNCA 3JWDL 2HLFC 1HWWA 5F72S 5GGUA 3S8GB 2I9LA 3WO4B 5B38G 3VD3A 3D39D 4XAWH 1J8RA 3QRGL 4NB7A 1AH1A 3OKNA 1P6FA 4UV7H 3BMVA 3IYLW 2XXFA 2FDBP 1S3KH 2J21A 1NEUA 1YECH 4J23A 1U91A 2GSGA 2X2UA 2L7QA 1VEOA 4TLSA 4W4OC 3ZW3A 2BSCA 3BE1H 3DPBA 1LEGB 4GRLB 1C9SA 1W8NA 1SN2A 4P5TC 2ZSVB 5ESAA 3CLFH 3HKZA 4J3OG 3HE7C 1QNZL 2ADGB 3CJJA 5HXMA 2KMWA 1DBBL 2YMXH 2ROXA 4P2QB 3ZDZE 4YUEH 5EUOA 4KTEL 3DUSB 2G30A 1J1PL 3BUIA 5ITBH 5FFLA 4IBTA 5I5IA 4YL4A 1OSPH 3BLPX 3CSGA 1YYCA 1FZJA 1RUQL 1H6FA 5IFHH 2XN9E 3GZKA 2ENJA 3PPEA 3IBEA 4HG4J 5A2JH 3K6FA 1U3JA 3VXUB 5CSZA 1NEZG 1A14L 1ECZA 2ICWB 1R47A 3IGAB 4YHPB 4Z3TA 3US0A 3ZT5A 3Q8BA 12E8H 1IGJA 4ZAKC 5F21B 3NIFF 4UTBL 3RTLA 4RSVA 4B97A 1BFOA 1AGCA 1D6VH 1SLVA 3IS1X 3GXDA 2ZIDA 3LSOA 4N90E 3ARDB 2AAAA 5IKCA 1S7XB 1VSCA 1Z5LB 1FVCB 3R8BB 5BQ7A 3ALXA 3ECUA 3EOTL 4Y4KA 3VD1A 1VGEH 3DHPA 3BN3B 3AXHA 4WDIA 3RWGA 3WXWH 4QAMB 2PPFA 1LMKA 1UZ8A 2YLKA 2OULB 1D5IL 1EZVY 3EGDB 3NVQA 4NQEB 5DJ8A 4KKNA 3EJRA 5I9QC 3LZLA 2AITA 5K5YA 5AAWA 3TBSB 3X11A 3RX5A 4QRSB 2NY7H 2F6AA 2MHAA 3NCMA 4B7IA 4OM1L 25C8H 4P49A 1OE3A 4EDWH 4G70B 1YPZE 1AZVA 2C9UA 3FOMA 3VXNA 4GYBA 1UYWL 2HCZX 5F7DB 4PJDB 4PWEA 3FAXA 1A7BA 3DOIA 1ED3A 2P7TA 3FCGA 2KL6A 4HMCA 4JHUA 5FA3A 2H45A 3DRQB 4RAUB 4XRCB 3SO3B 2DWXA 1F4WL 4PMEA 3TBVB 5FWQA 5HGGS 4HBCL 2ZUWA 1N5YL 3ULVL 4AI7A 3BVNA 1JPTH 3A6BH 1MHCB 5HJ3B 3SPGA 1OD7A 1G1YA 5IBUB 1HNFA 2DWYA 2WYTA 4E9RA 3MNMA 2VJXA 4MA3B 2W9DL 1PZBA 1TXKA 1LHZA 1P5UB 2ESVB 2XA8H 3QIWD 1AKJD 2VLKA 4K71B 1PJWA 1NC2B 5LGHH 4Y16B 4L2YA 2IDFA 4KRPD 2KDGA 1AQKH 1ZCRA 2WBWB 2XV2A 3LKNA 1HHGB 3ABZA 4FCHA 2W9LA 5DD5H 5IROA 5LBVA 1ROWA 3LQZA 3T4AC 4R8WL 1HQ4A 5LGJB 1GC1L 1IAOA 2W1NA 2ZOWA 2VUKA 3P2BA 1H8SA 1JPGB 1RZKL 1UM4L 4RFOH 1UXSA 4HXBH 4NHCH 1KB5L 4LCIH 4HG4K 4JN1H 4LF3B 1U8OA 2GHWB 4O4YL 2Q7AA 1T0OA 4UM9B 1RK0B 1DCLA 2LW3A 3W56A 2R1XA 1H3WM 3C60C 3QIBD 4HIIA 4P5TB 3D4ZA 3F5WB 1TQTA 1N64H 4F7EA 1IFRA 2BVTA 2V2WA 2VERN 3CFBA 4NN5B 2Z34A 4YXLH 3SD2A 2DBJA 2Y1YA 3N1PC 5EN2A 3D9AL 3W2DL 3MUHL 4QMEA 1GOGA 4RMQA 4HXAH 4KI5E 3AROA 3TTYA 1IGML 1MI5B 2FNWA 4DK3A 5IVXF 2X1WL 2YEZB 3ARZA 4YLCA 1RXLA 1PG7L 1H9VA 2NYZA 1EAPB 1IBHA 5IVOA 4NQXB 4AL8C 1IBGH 4DO5A 5IHBA 5JYMA 3QG7H 4IRJD 2VJ0A 4A55A 2B2XL 4J3OH 4YHNB 2G0KA 4FX5A 4B3VA 5I1GL 2GJ6D 1DVXA 4DK6A 3KLDA 4YQXL 1WLHA 4LCWE 3UGXA 1BBDH 3C5JA 3PHOB 3LD8C 3S8WA 1ETJA 3NCEB 4DP0X 5KS9F 5KVGL 3V5DB 1EX0A 3QXWA 5IOPA 2VDPL 4UYPA 5I71B 3QIWC 1RULL 1EMTL 3MBEA 3E6HA 2EE6A 3AVEA 1MFCH 5ICYA 1KGJA 1DQLL 2ED9A 2Z1KA 5SX4I 5HYSB 3U30C 3C2AH 4QOKD 4U1NA 4XBGB 5KSVA 1BZ8A 2I07B 1HE7A 4OF5A 2FZ3B 3CVIH 3WIIL 4O9HL 1OTSD 1INEH 4KGLA 3EH3B 6FABL 4PSPA 5K1NA 2IANA 2DQTL 3LZPA 4RGNE 3NZ8B 1T03H 4R7LA 4KHTH 2IQAA 2P8PA 5FB8B 3GJFH 4HPOH 5F1NB 3ISWA 2FK9A 4UOZA 4PD4J 2VDRL 3HMXH 3W39A 2EICA 3C5ZA 1Q0YH 4N68A 2QDVA 8CGTA 3MX0B 3QRFM 5DA0B 1HEJC 2HG5A 3LXAA 1ZANL 3OAZH 4FFYH 2GTZA 3OLEA 2A6JB 2VJ8A 4IK6A 5JXAL 1S7WB 5A2FA 3JVGC 1I85C 3E80A 1HI6A 2VQ1B 2OZNA 5I8KL 1NEPA 4Y19A 1NANH 2D73A 3KWUA 3LKQA 3DX7B 2DMHA 5C07A 5F88A 7PAZA 5EMYA 1M57B 5EU7C 2ZX7A 2WYZA 3G3LA 4BSVA 4EXPX 5JIHA 1CDYA 1K8IB 2WINB 3OKEA 3DXAD 3UTTB 4FHBD 5BW7C 4UT6H 4OBSA 3B8SA 2NW3B 1Q0XL 3GNMH 5KVDH 1GTFA 4KHXL 3HPLB 1I75A 1TZIA 1JV5A 3UBXA 2I5YL 5GISL 3SDCD 4NQQA 1G43A 2XX1A 3KJ6H 5A2AA 3VJ6B 4NQVB 3GK8H 3TNMB 3O0LA 5AAMC 3HE6B 4P2RE 3M46A 4IU2B 4K8RH 4LSPH 5JHAA 5J89A 4I0PD 4U3HA 3CIAA 4ANWA 1JZ4A 5H94B 2Z93B 3T4YB 3WXVL 2E6QA 2YSSB 1P1ZB 3C60B 2CG9X 2D7OA 4YE4L 2Q8AL 1YN6A 3HN3A 1DJXA 4H13C 1ZLUH 5BPPA 2JJUA 2WQWA 4PRHB 5E5MA 4X8XA 1RFDH 2VR6A 3ULSA 3V7AG 2HKHL 1EO7A 1PFCA 4ZS7L 5LB1A 1WISA 3S3DB 1KENH 2R0ZL 3WLWC 1ZD6A 3P0GB 2NY1D 2ZP0T 5TDNB 2NY4B 4M6OH 1KV3A 2XPGB 4ZMYA 2Q8BL 3DI2B 1ZS8A 4Z7AA 1HK6A 5CGYD 5IOKA 4BKSC 4AQEA 4UF7C 5C0EB 2IH1A 2YAHA 3UPAA 1USQA 1TT6A 1BD2E 1I9IH 4IU3B 4IHBA 1PX3A 3MV8A 1Q9WA 4W9DC 2XZCL 3PGDA 4H40A 3QORD 4PG9A 5JIPA 4CSZA 1Q90A 4KGJA 3HAEG 4PD4K 4YSEA 3BYTA 3LD8B 1NAMA 4ZRGA 1BVLA 4LESA 5LG6A 1GGIH 2D2CC 5HDLA 4HK0A 2K9FB 3DROB 3CZJA 3QQ3B 4JM2A 1FV1A 3T2NH 2X28A 4JFZL 1QZ1A 1X5LA 1OSZB 1FGVH 2KUTA 4JREC 3GT6A 4LCCB 2A6KB 4HJEA 5HI4D 2PN5A 1FZOB 3HNSL 3L9RB 5IB4A 3BOVA 1GPOH 3QG6A 2IFFH 1FYTE 3WTWA 1HTYA 3QCVH 4ZUUB 5GGTH 4GS7C 1MAKA 1KPUA 1NAML 4FRWA 3ZMRA 4GO6B 5DUPH 4EN3D 4JPVH 3RL1A 4O02A 1SJEB 3O3UN 1LTXA 4S2SA 4YK4C 2EUXA 4RGOH 2FL5B 4ETQA 2EDTA 3SD5A 4OZFA 4R5XA 1CGSH 4PYGA 2NY1C 1EHLL 4OZGF 1U3HC 1FHGA 2FYYA 1FFPA 4AUUA 3Q3GB 3MRQB 4I9WE 4HIEB 2X9ZA 1TJHH 4CVUA 2OMWB 2AJZA 2XIBA 4M7KH 4NT6B 4U1LA 5CGYC 2OZ4A 5CZKA 3OXRB 4BUGA 2NXZD 5K39A 2MQCA 2VQUA 1A0QL 1JNHA 4F7CA 3GSUB 2K6YA 3DV4A 4M43H 4ZPVA 3NN8B 2IH3A 1GVIA 5LBSH 3ZDYB 2XNAA 5C9JA 1M53A 2VLJE 2E5EA 4JK0D 3MRDA 3QORC 1A6WH 4XN7A 2X1QA 5D7SH 2YUVA 5BRZB 1RZIA 4C8XA 3WNJA 3PP4H 5F7EL 3MZTA 1AXSB 5HD8C 3QC5X 4NM4L 2CDGA 1U3NA 1ILUA 5HYJA 1UJ3C 3P4MA 1TJXA 3MNZA 1ZLWK 1FL6A 3TF7C 1OAJA 1JFHA 3KR3L 4AMXA 1HCZA 1TNMA 2X6VA 1LMIA 2OMZA 2OZ4L 5JHDD 5L4FA 1NGPH 2O6PA 2RALA 3L1EA 3WTXA 4ZFOA 3QCTH 4J4PA 4NC2B 3Q9QA 4NRZB 2QPFA 4K2UL 4FFVD 1LDPL 1R3HA 2CLVA 4RZKA 5L2JA 2APSA 4XCEB 1A1OB 3S88H 2NLJB 1LNUA 1VACA 3ULAB 3ARRA 3KXFB 3FB5B 2EKSA 1LP9E 3V9FA 1I8LC 4PJ8A 1JZ5A 2QDWA 1QKZH 1MJUH 2CHNA 1B6DA 1AS7A 4R96A 5EU5B 4ELMB 4QRUA 1MELA 4XCNB 5IWLC 2QQNH 2B9BA 5I0YA 3VQ1C 1THCA 2CBMA 3IETA 3HMWL 1X4XA 1YNKH 4HGWA 5DJDA 2VNCA 4PUBH 3BXNB 3WEBA 2YIHA 1WA1X 3CDGB 4ORGB 5TE6H 2R4RL 3QH3A 3RVVC 4NJAH 1N18A 1V05A 3TZVB 4ZW3A 5I66B 4ZFOL 2IDCA 1JV2B 1SJMA 1XF5B 3DDFA 3OWRA 5HJBA 1LK3H 4ELKA 4BD4A 4W9EC 2VZVA 1BLNA 2NXZC 2XYBA 3CFKB 1X5HA 2COVD 4TNWF 5AYQA 5HGHA 2XZQL 1M05B 4G8EA 3T6XA 4LHJB 2ADFH 5AB2A 3I9IA 4QTIH 2YKKA 5HJDA 1IU1A 5LDUA 2YGNA 1FFOA 3EGSA 3LV3B 5I8CB 1I1AD 1A7RH 1AGEA 1UCTA 3TA3A 4JREB 4X2UA 3GKWH 4UOQA 4GQPH 2IH9A 4PJBA 5C3LD 1DFXA 5TH2B 3Q8AA 1JHKH 3HAEH 4GBXC 5BZWB 1HZHL 3VI4B 1XVSA 5T1LD 4H26A 3PDDA 4N0CD 3SB3A 1DJZA 2BSEA 4X80H 4QXGL 4PJ7E 4NAMA 2JB5L 2OA9A 2VLRE 1GJIA 4FL4C 3HI5H 4Q9RH 1M7XA 2GVYA 3CQPA 3ILQC 1Z5HA 4BQCA 5KN5B 4YK4B 1IJ9A 1SOQA 2IADA 3EBAA 3NGBC 5TQ0L 1ULVA 5HHXH 4UQ3B 4ERSL 2EC9U 4XX5A 1QA9A 1D5RA 3EUDA 3QHZL 1OGAE 1D5MB 4XMPH 5EN3A 1H8OA 2XTJE 4V1DA 4KMQA 5BO0D 3PJSA 4JPKH 5JXEA 1Y1DA 1GGYA 1U3HB 2MH4A 1YEHH 3L16A 4PREA 3P77B 3MRMA 5I6MA 4LEXH 1QWHA 5AW5B 2BP0A 3FT0A 2ZKMX 3RGBA 2ZCKL 4DQAA 4M1GH 4H44C 3H0TB 4N0RA 1KELH 2AK4D 4LXFA 4A7VA 4Y4HD 4PWKA 2DMBA 5EC1B 2E86A 3L4TA 4D94A 2VWEC 1ETZA 1NCAL 4U6YA 4HFUL 4NX0A 3GS0A 2YHGA 3G6JA 2WQSA 4NO3B 1DQJA 1P7KA 4MNGB 2BSTA 4X8JB 1AHWC 1AY1H 3CZFB 5TE7L 4PJHA 4LPUA 3ZSSA 1ZV5A 4RX4A 5DMYA 1V3JA 4KXAA 4EQ2A 2BNQE 3BEVB 2NZ1A 2Y07L 4IKLA 4JHAH 1TEYA 2BZDA 3KYOA 4AH2B 4MJID 4PJ5B 4EZLA 3S5LB 2PCPA 1EHNA 3DGGB 4MSWB 15C8L 3TEWA 1EDQA 2YMOA 2A4CA 3NMEA 4ONOA 3RY6C 2H0PA 4DKDC 2GC7C 3A3YB 4ABQA 3HZVA 2RAMA 1HH9A 2Z92A 3F6IA 3TH3T 4XVSL 3RZCA 2XY1A 4MA7L 5D1XC 2VUYA 4PGZA 4M62L 5D70H 1UWGL 4P9HL 1MAML 3D69B 1JNNL 2CO7A 2GI7A 3EF7A 3APDA 4M6AA 4PQXA 4TN9A 1DVZA 1H15A 4JRYD 4WFHD 5KYUA 2VM3A 3N6YA 3V6ZA 3SDXF 5CAYB 1TETL 3LIZL 2BNUB 3QS2A 1H6EA 1Y07A 3WE6A 4E41E 1XV8A 5D96C 5DFVD 1QW8A 5ANME 3MLYH 2R69L 3WNOA 4BRVA 5J9PB 2N0KA 1IC4L 1I3RA 1YEIL 1P7QA 5EZIH 4NCC1 2NY3D 1IT9H 3PWJB 5A2LH 3UP6A 2C9AA 3MBWB 1LO3H 1O6SB 1S5IH 1S9XB 3CXFA 3LH2H 5IMKA 1A3RL 1F4XH 3FQXB 2HT4C 4DGUA 2WIIB 1JL8A 1KLGB 3AM8C 5E5RB 5KSAD 3U7AA 1WTGT 3HFFA 4F7TA 3DX9B 4N0YH 4Y4HC 3D85D 1JVLA 4ISVB 2OR9L 3CWGA 2OFQA 4JFDD 4ZDHA 3U4EA 4Z3JA 43CAB 5JOFA 5FYKD 3VG9B 1I8IB 4UANA 3MRKB 4PRIE 2F7IA 5CF3A 4X6DB 4LSVL 2YN5A 1WUNT 1YY9D 1OTTD 5C08E 1JYXA 1AP2B 1MRDL 2VMEA 5AVRB 4YDJB 4GBXB 1SF5A 2ARJQ 2FBRA 1CIUA 2R15A 4GRMB 3QJXA 5EU6B 5FO9A 3OR6A 4F3FA 5T3XE 3DO4A 1YYLH 5C0DB 4JG1H 3Q2LA 3WAKA 3WS3B 4B9CA 4WJ5A 3CLWA 3JUYA 3T8XB 4DERA 5BVPH 3TT1L 1FBIH 1A6TA 1G5GA 3ESUF 4UTAA 1MCWW 1BXUA 2WXPA 3QO0A 2DQGH 3VO0A 3NGBB 4K7FB 2DTML 3H7LA 4WVRA 1J7VR 2MMXA 4OGZA 5DO8A 3T0WA 1J1XH 4DN4H 4OLYL 3FFCB 3A22A 4KKBD 3ZHNA 4TQPA 3MR9B 4XBEH 1AO7A 1WCQA 5KYYA 3L48A 4A7QA 1C5BL 2A6DA 1A3LH 3MV9E 3KPRA 3KPLB 1WFTA 1JSYA 2FE0A 5GS2D 3BQUA 1KJ2B 3CHPA 5BUPA 1CFTA 5DFVC 5F7KC 2TRYA 5MP6H 2FT7A 2YXFA 3COOA 4Z77A 5IFAH 2X2YA 2E4FA 1OOAA 6PCYA 4NQUA 4XNMA 3SKUD 4ANUA 3GIZL 4BK4A 1AHWB 1TKWA 2FJFB 2J8HA 3BCFA 1A7NH 1REIA 4F2MA 5ESVA 5DI8A 1XZWA 1JWUB 1KB9J 3MV7B 5ITFB 1AD9A 5KSAC 2W38A 1U58A 3BP6A 5IHLB 1DE4B 4Y4FB 1UD6A 2PYFB 2KERA 4P5MA 4J7RA 4JDTH 4GPVA 1KN2L 2VZ1A 3L3DB 3BP5B 3U2SB 3ARGC 2CJTA 3D25A 3BKML 2R29H 4NBZB 3RFZC 4GP5B 4ES8A 1NCOA 3ECQA 1NUGA 1CS6A 1YY9C 2DM2A 4ZXBD 3NUKA 3CBRA 5DJZB 2XQYK 3IFNL 5DLLA 3VRLF 1MHPH 1NCWL 2VXVH 2X4PA 4I3SL 4JFXA 5D1XB 2OV0A 3ULVF 2CDFB 1X9UA 1XB3A 4XWOC 1WO2A 2IPTL 4NYLB 3AG3B 5BS0B 5GGSY 2OJEB 2YUXA 1MWAB 4OZIE 2OMYB 1E6OL 1MJ7H 4NO5A 5CEZE 2PUQT 2PTTA 3ZRSA 2AJUL 2P5EE 4PCTA 2NNXA 3LZFL 4LQFL 4YZFE 4HS6A 1SBSH 4Y5YC 2D03H 3FQWA 2CO6B 5HVGB 1FFNA 1J8HA 1AACA 2ZKYA 5D8JH 4KRMB 3FQUB 3N1QC 5HPMB 3EHBD 2GC4C 4HUWB 3UG4A 2UVFA 3B56A 5D1ZI 2E7LC 5M7QA 2LAAA 1NGXA 1W0VA 3OLIA 4L8BB 4N6RB 1IE5A 2PW1B 5F1IB 2AVGA 3LPFA 1DUZB 2MOQA 2FQGA 3H9SD 1OT4A 3LN4A 4ONGH 3D0LB 2UZYB 4KJQD 4PU2A 2DD8H 1CGWA 2IIJA 1E40A 1XSKA 4KQ0A 3MGAA 1XGPB 1NFDF 1DN0A 3NTCH 1A47A 2VXTL 2MRYA 1JZEA 4HIQA 1BZQK 1KIRB 3BAEH 5LWYH 2UY6A 1FN4A 3CVHL 4UI2A 3CE1A 3MRHB 3ZGHA 2I32A 1UZ6F 3AT8A 2QKSA 1LO0H 1IBDA 4A67A 2KKQA 3ASNB 2V7HA 1THAA 3S0PA 4HJJH 4OIBA 1G7HB 1ZS2A 3Q48A 4ZXBC 2ODIA 1NMAH 3KYMB 3BKJH 3FU0A 3GLEA 3MJ8A 4XHJD 4QTHB 2JKTM 3WHXA 5KSBE 1BOGA 2VDKH 5F0JB 5GZOC 2FJGA 1X7TA 2NY5L 4R7NB 4ZQKB 4AEFA 5CFHA 4PLKC 1RZJL 3PF2A 4B9KC 4IKIA 1XX9C 4IRSA 2FT6A 1XSJA 3GHBH 1ZV2A 5IHHA 2CH8A 4FFZH 4LASH 1KN4L 3OBAA 3W81A 3UMNA 4AXWB 1RJYA 1KXQA 1AGFB 2NX5B 2R8SL 2OXGA 1MVFA 2VQTA 1K72A 3IDIB 1TZGL 4L4TA 3BZFB 5E51A 3ISYA 2QQLH 5D7HA 3FT4B 1FO0A 5I8EA 2CIKB 5I1IL 5DA4A 1EGJA 3PDOA 5DYFA 4KX8A 5KVMC 1OWRM 3INUL 2W91A 2CJSA 2YA0A 3KEHA 5GPRA 1RZ8A 3EHBC 1AFVL 1MIMH 3BDXA 2ZYIA 5HHOB 5CGBA 2W07B 3CFDB 1TJGH 4IIQA 3ARGB 4JEGB 1H6TA 4HD5A 2HVKA 3RWFA 4JDEB 3RFZB 4HWUA 3C9NA 3TCTA 4MJ6B 5E2WH 2ZUVA 1J9TA 3VFWA 1NM9A 3PQYE 3FZUD 4MNQD 4MCNA 4IDJL 4H20L 3W0WA 4E9YA 3I3DA 3T3ME 1FO0L 1F4YL 4LHUA 2HWZH 3ZSTA 5IIEA 3RPBA 2JJTA 1DBML 2WP3O 3DIFB 3QEGH 4JY4A 5FK9A 4AIZB 1QHQA 3NSJA 3ZGIA 1DL7H 1JYNA 4NO0A 1JPFA 5SWZD 4RLDA 3UTSA 4LGRB 1YUHA 3JWDC 3LX9A 3NSCA 4E42B 3CDZB 1J88A 5F7FA 3GKZA 1ZHLB 4N87A 4PLJD 4WWID 1IGYA 1CD1A 1U8IA 5HI3C 3RIKA 4Y5YB 1BYNA 4MQXD 2XKNB 3PWNA 4NRXB 3JUZA 2FWSA 4YBQD 4AJWA 3M45A 3PIQB 2GPZA 3VQLA 1AS6A 4K23L 5PAZA 4ZMAT 4DCQB 5C6TL 1ASPA 4KK9C 5EIIG 5FYLE 3PABB 3QC6X 3S4SG 2R9HC 4ZUSB 2X6CA 1QWUA 1CXHA 4N2AA 5FKAB 1X9RA 4OBRA 5FYJL 2ZOOA 1CIDA 1OB1B 2CLRB 2H0EA 4Q4EA 4L18A 5KYNA 1J0YA 4FF9A 1UACH 3B7SA 3G6AA 4Z23A 3HW7A 1AQDB 4BZ2A 2NZ9C 2DQDH 2BS8A 4OIFA 1FNEA 3UTOA 3X1NA 4DESA 4JFPA 1QRNB 3F6LA 2P44B 2HVBA 2JB6A 4X6BB 1P5VA 3QDHA 1CDUA 4MJJA 4DKEH 3MXWH 1N6QH 5A3IC 2DAVA 1DQQB 4ZZKA 3M1OA 1EJ8A 4BFBD 1SY6A 3V0AC 1R3LB 3WKMH 4DGVL 4LIQH 4WNQA 3JWNE 3I6KB 3X1GA 2RHEA 4DP4X 1WFOA 3OAUL 3V4PA 2XWEA 2WXGA 2Z4QA 3AS2A 1ZT4B 3GSWA 5E70A 1EWHA 3I74A 1EEZA 1NAKH 4MHHI 1WAPA 3EFDL 1LE9B 1U8QB 2JIXA 2Q3XA 1E6JH 4ZOAA 2CU9A 4JPSA 4X4ME 3MJ6A 4XI5C 1M7IB 2IPKB 4BZ2L 4ABVA 1BBJB 4HOXA 4YHOL 3PREA 3UZQA 4GSDL 2Z9TA 3HRZA 3PAZA 4RFNC 1SY6L 5FHBH 2WXNA 3L4VA 4YDIH 3II2A 4LARH 3MO1A 4QO1B 3APFA 5DJ0A 1X44A 4FABL 1E2ZA 3S36H 4IBQA 3VFVB 4YBQC 3V4PL 2OTUA 3BDYL 3VCLA 2FATL 1UT2A 1PAZA 4QHUB 3IDXL 3OKKA 3ULUL 1MLCA 3LKPA 2Z8SA 5DGQA 1Q9KA 2F54E 3HR6A 3FFDA 5C0IA 1RZFH 4PJDF 4N9OB 3VFTA 3GTVA 4I4WB 4HT1H 4Z7WA 3GSNH 2P28B 5E9DB 2PKDA 3KH4A 1G6RL 5FLUA 2DEWX 1BZ9A 1LEIA 1OW0A 2YD7A 2BIHA 4JLRB 3WKQA 1NGYA 5DD0L 5GGVH 4Y4KC 1KBGL 1T83A 4P04A 3JTTB 2AV1B 4DKFH 1YUKB 3UH8A 3N0PB 5AAWC 5GIRA 4E9TA 4LDEB 3B1TA 4WJKB 1BFSA 3TS8A 1GHFL 5CO1A 3LJ3A 1WPCA 4HIJB 2CDEA 5C9KA 4GG6E 4M5SA 1HILA 4JAMB 3TP4A 3VFOA 4UOW1 3MFGB 2V5RA 5FCUH 5A16A 4IQHA 1RIVL 4GAJL 5D7KE 4YAQA 9CGTA 3PWPE 1D5IH 3O4LE 1MFUA 4B60A 4NSKA 5E1GA 4I3RL 1KYFA 4NQCA 4UBDC 3BSZA 4WO4A 2ORBH 3LQAL 3STLB 5BV7B 4X5XB 2H1PL 3UMTA 1YSOA 3FK3A 5DVPA 2EAEA 2W9EL 3LKRA 5GGVY 1WD9A 4XODA 3D2UA 3VXSB 3UABA 1NTDA 3UJJL 3MBED 2NY0D 4E5XB 4PRDA 3MJ7A 5B4MC 2JELH 4JO5A 2ISDA 1AD0B 1ESOA 4P5KB 2GITA 1ZLSH 2L8AA 4HX1A 1R5WA 1CR9H 5IROC 4UILH 4ZFQA 3MTXA 1BZEA 5DWUL 5ESQA 2BS71 4X6CA 3K6SA 1V8HA 2PXYA 3QFDB 3IGLA 5DJ6A 1G9HA 5T5NF 2J73A 2IAND 3L1OH 4H88H 3BSZL 5CIPH 1D5ZA 1RMFH 1PZ3A 2NQ3A 3NCCB 4LLVA 3VB9A 3QUZA 1T7XA 4ZSOA 1KTRL 1UM5L 2GSGB 4XX1E 5C0RL 3QI9C 3AT9A 2VDQL 1L9TA 3C5ZD 3QFJA 4OZHA 5ID1A 2AJXL 2X4OB 2OK0H 3QP3A 5D7IA 3TIEA 4CN6A 1KJ3L 4OCRH 1JMZA 4A6YA 4KRLB 3R1GH 3NIGE 4GKLA 1WAAF 1A3QA 5EUOB 4WEBH 4E9QA 4X0NA 4B9ZA 3VI3A 2X0VA 3G5ZA 5AVYB 4RFNB 4Y19D 3GJFK 2X6UA 1Y6NR 3CMOH 4GRWF 4TPRL 4Z7NE 2XPZA 8FABB 4MXQD 4LSRH 4XMLH 1IVLA 2DQCL 4IJ3C 3OAZK 5I8OL 4J3VA 4H25A 3UPCA 5B7FA 2Z0UA 3CZEA 5CSZB 1QBMH 2V9UA 4WW1A 2Q2EB 5B8CB 4GFTB 2Y4SA 3P11H 2CGYA 3JT0A 4YSOA 3TCLA 3JWOH 5L4JA 5I18H 1IGJB 3UJTH 4MXWH 1RK1A 1IGMH 5IB3B 5ICXA 1AGCB 2OMXA 2NNRA 1NGQH 1YG9A 3QUMH 2K3TA 4OB5H 2WQUA 2NY0C 3MBEC 2HPTA 2HRPH 4PJFA 2ZF8A 5KEZA 4JFQA 4LSUL 4Y4KB 4J3SA 1JGEA 2CK0L 3HNVL 5FKPA 3W11C 1MFNA 1X9QA 2QV4A 4WDIB 1QSFA 1I8UA 1N8ZA 2DL2A 3FTVA 3UP1A 5CCKH 3KVQA 1ROCA 1E4WL 4TVPH 3X11B 4Y1AA 2XWCA 4YHZL 2F53B 3O3EA 4OD2B 4J2QA 2B7DT 3SSGA 4E9WA 5JQIB 3QDJA 4M5YH 3KBHE 4LLQA 4NWTL 1S8DA 4BCYA 4D9QD 1R1CA 4ODXB 3CBJB 4ODVL 1ED3B 2P7TB 5D1ZA 5FGBA 1E4KA 3U36B 1DQLH 4WKZA 3T0AA 2FO4B 3WEXA 4C47A 3IDJA 1ZLUK 1S7RA 3O6LH 4CN1A 4W6XB 2YD0A 1B0RA 5D2NE 3N42B 2I9TA 4OGXL 4IMKA 1HXKA 1KMGA 5E1IA 3S35L 3VRIA 1E4JA 2LOEA 2DQEL 2VH5L 4G82A 2FX9L 3APMA 1KUMA 3O11A 2FT8A 5CSGA 2HKFH 3WL9A 3N44B 3F3HA 3SE8H 2VLLA 1CE1L 1KC5L 2OJZH 5JXAH 4P5SA 4AVJA 4JCLA 1S5HB 5DUBA 4BZYA 3NJLA 4XP5H 2OSYA 4M8QB 1VLXA 5G4NA 3FQ4A 4RGNB 5C86A 2H6UA 4HQQL 3G6JF 2WJ7A 4NQDA 2PPAA 2ED6A 3TYGL 3VGEA 1K5WA 1NBQA 2JH2A 4LLWA 2IALA 4MMXA 4N2BA 4XOCA 7FABL 3QI9B 2JI1A 4TNVF 4FQ2L 3IJEA 4IOFD 4B9IA 1KEML 1BSIA 4M7LH 3FC8A 5AW7B 4N8CH 1CK0H 2OW6A 3L1GA 2QQKH 3F7KA 3QCUH 4LRIA 4F7EB 2NYKA 2AQQA 4EDXB 4BKLB 4ZX4A 4K3DH 4ZW8A 5F9DC 1GZHA 2HFFB 4G5AA 2J88H 2Y7SA 3WEOA 1KNOB 4EI6A 3QZWB 2QGBA 1CYGA 2WZPD 4J8RA 1NFIA 3BRFA 2CBPA 3P69A 3K8KA 3K4DA 4G59C 5L2KB 3LRKA 1A9BA 3QNFA 1RJLB 1NSNL 4POUB 4M56A 4QIRA 5C0FA 5I17A 3TT3L 5CJBA 3MREA 2XN9A 3HA0A 5SWSE 4JFVA 4BCXA 1F42A 4JFSA 4QRPE 2Z4TA 2WBKA 4XCCL 2VITB 4P2RB 4ZO9A 3D6GA 5EOTA 4N1EA 2ZYHA 3K72A 4YHIA 2A74B 2XWZA 1BVZA 2Q9OA 5HYJD 3IU4H 1INDL 4HOWA 5ICYB 4H0GA 1P9MA 2D3JA 2DJUA 4JM2C 2H9GB 1SDAB 1E3FA 3E3QC 3MOAH 3C6SA 3U4AA 1I7ZB 1K5NA 3B7UX 1RURL 1AR1D 1RCYA 4OV5A 4L4VE 1T3FB 5CZVL 4J4PD 3FNKA 4HDIA 3BAIA 1VFAB 2XZAL 3FO2A 3CXHJ 4GQRA 5CEYA 1YHPA 1JDDA 3TXAA 3B6SB 2IQAB 3E8UL 4XP4L 2XRAH 4HCFA 1D9KB 5CLXA 2UWEB 2VN4A 4IOFC 4AG4H 2HG5B 4XH2A 4IGBA 2UX7A 2X4NA 1DJSA 4OSUH 2KZWA 2V5MA 2DJSA 1KCRH 1R3KB 4MQTB 4PY8J 5DMJB 2BH0A 1HI6B 2WKGA 1YNTA 2X10A 2WQRA 1XIWC 3MBXL 1KJVA 2FWUA 2YD9A 1TFPA 4PJEE 1DZBA 4KVCL 4UQEA 4YX2H 4ZNEA 3GI8H 4AE0A 2DLHA 1Z0MA 3TBWA 4G80B 2DJ4A 5C07B 5F88B 3GEWB 3VTAA 2EIZA 5LKNA 3BDBA 3O6MH 4NCC2 5CUSL 4EMZA 5IP4A 1WCBA 4JVUA 5GS1B 2VR4A 3OKEB 4N0FB 3PNWA 5FS5A 1PG7X 4C59B 3GDBA 1F6AA 4DZ8A 5EBGA 4JGMA 4MD4A 5GGRA 4YSQA 1TZIB 5DHVH 1O5PA 1OCWH 5EFIA 5D5ME 5FM4A 3TA3D 2R39A 2YRLA 1O7DE 3BP4B 3PV7A 1UEYA 2V3FA 3UTTD 1FYTB 3P9MA 3KM1A 4KKAC 1RIUH 3WSQL 3VFSA 2L4OA 4QCIA 2DBLH 2DIJA 4LBEA 2XU9A 1HC1A 1MSPA 5IMOA 3G6DL 1UQSA 2BSED 4FXLA 1TQUA 1ML0A 3VFNA 3FCUB 1TSRA 1AR1C 2A9ML 4OFPA 3BLBA 2YRPA 3HE6D 4RNRA 2BPBA 4YXHL 1ZEAH 3NQKA 3VGDA 5E5MB 1XBDA 2EABA 5IJDC 3FO0H 5KVDE 1I9RH 4PWJA 4PLNC 3DOSB 4J4PC 3SDAA 4BFIA 2NCEA 2MEJB 2P8LB 4NZRL 1GAFH 5F9OH 4H4NA 2Y3NA 3T77A 3EYQC 4XVTH 4PJ8C 4QRRB 3KR3H 4LLDB 1ZS8B 2EINB 1I7TA 4M4RB 1IGCL 2QADC 1HHJB 5DZOA 3RPKA 1MOEA 4N5ED 2KI6A 3FTSA 3RWJA 5DK3A 2YBRB 3QBTB 3WYRA 1K3ZA 3CXHK 3LKOA 2AKRA 2YKLL 3D4YA 3MV8B 3D48R 2SODB 3TM6A 3VI4F 5F7NC 1QFUH 3LNHA 5AWNL 4G8GE 2YAQA 5FDWB 3V0DA 1B3IA 4TQEH 4OD3H 2BXYA 4FZEL 3KVPA 1KYUA 1FH2A 4JZJA 4XMUA 4U1IA 3L3IA 4I2XE 3F85A 2R56L 3LIUA 1M7DA 4HK0B 3P02A 1LK2A 3WOVA 2FB4L 4JM2B 4K9JA 5J12C 1RVFH 4YHLH 5DTFB 3TA3C 5CWSA 3VX1A 2EDJA 2R0KL 3O3BB 5HDBE 3RA7H 5TQ2H 3M8OH 1DZ0A 2VRAA 2CMRL 4MKMA 1JZ3A 2CBOA 5DRNB 5K9QG 2L04A 4QRQB 3THMH 5I16A 3PHAA 3NACL 4GEIA 4AK2A 4RBPH 1HQRB 3RZCD 2O1AA 4N26A 1FCGA 5I6XC 1A6UL 2BP3A 2O5XH 2Z35B 1DANU 1YJDL 4HLJA 3SJVB 3T9WA 1B4RA 1CFBA 3V0VA 2RBLA 2AI0H 5IUSA 5DYOB 4S2SB 2L3BA 1KT2B 4KKQA 5AZUA 2QBWA 5EZLA 4MTMA 2ZJSL 3VH8A 1IC7L 4NAJA 1JGLH 3ABKB 4I5BB 5DHXB 1XIWB 5JXEC 2WLMA 4L3EE 5B1CA 2IGFH 2WXLA 1UCBH 3PG2A 4PS4L 1CFQA 4XZUA 1JHLL 1LLAA 1GYVA 1NBZB 4G43A 3HC4L 1KY7A 2AJZB 2OTWB 1K2DA 2EDOA 4JM4L 3ZE1E 5C92A 1Q72H 4JO4L 4ODSH 2F61A 5L9DH 2V2XB 2HT2D 4N5EC 3H7BB 2CIIA 1PQZA 3UAJA 1R33A 5C9JB 5I1LA 2EYRB 2W88A 1FVDA 3ABGA 5EF2A 3WFEH 3GIVA 4MB4A 2GCYA 3GFUA 3QUKB 4AQ8A 4P9HC 5C0CD 4U0RC 5KTEL 5DK2B 4JVPA 4X5QA 1ITCA 2ZF9A 3B2DC 5E2JA 5AG8A 3ARTA 4D9RD 2J4WL 2WB1A 5IF0B 3T2OA 3NJJA 3ARED 2XTLA 3CK0L 3NIFE 3P4MB 2P5WA 3CFCL 4PJ7B 1AYOA 3SGDI 2VLRB 1YQVH 1JZGA 1SDDB 5E00A 1KTCA 3QXVA 1BCIA 1FNHA 5EV7A 3CBKB 5EPMB 4FMFA 2KBGA 1JERA 2BNRE 3Q1SL 5JDJA 5IBTL 3DX8B 4TTDC 4XVUD 1OALA 1W6WA 3BKYL 4JQIA 2YAMA 3TJEH 1ZGLP 4FG6C 1R3HB 3VWKD 4MMZA 1IBYA 5L2JB 3RZCC 5J6GA 1J5HA 1Y6KR 4WSGA 1CMOA 5G4MA 1H3PH 1NCDH 1VACB 2IG2L 3QXAA 4PJ8B 5HYQA 1XF4A 1E3XA 4R96B 1NOAA 1MH5B 2QADB 5IESH 3VFUB 4TV3A 1QLRB 1LE5A 3BQUD 4F9LA 4HGWB 2H5UA 4PRAA 5BXFA 4GKSA 2Y2YA 1IGIL 2MCPH 5AVXB 3L1FA 1CO1A 4UT7L 1ORQB 4JW3A 1U8PB 4RRPG 4J28A 5FR3A 1XCTA 3H9HA 4FQ1H 4XE5B 4AL8H 5JO5B 3HN5A 4JQIL 5DMIH 3D34A 2X4RA 1BLNB 3REWA 1F3JA 3KL3A 3TWCH 2QZQA 5F6HJ 5HGHB 1PG7W 2JK5A 4FQHB 2AC0A 1FHNA 3SKNA 3PYCA 4WFEE 2A0LD 5C09B 5INDA 1VKXA 2UZIL 1I8MB 1AGEB 4PI2A 1RUPH 2WV3A 1BGXH 5DFWH 2PYEE 4XB3A 4PJBB 3BX7C 1P6AB 1WBZB 2FBJL 4IEFB 4S10A 4YHKH 4DFIA 3T6VA 3V7AE 3A6OA 1A9EA 4MFHA 4XWGH 3P30L 2H4EA 3QZBA 3GMLB 3NCJH 4H26B 3TV3H 1R24A 1B4JH 1Z6JT 2LVCA 5LAXB 3AU0A 3BUQA 5HHVH 1BQHA 2G60H 1KXTA 4HISA 1FF5A 1G1OA 4OI9A 3L9BA 4PJGB 4S1SL 5C8JB 2YUZA 3I75B 3WFDL 1H3UA 4K5LA 3SQBB 4LSVH 4V1DB 3T65A 5DRZA 1MXDA 3FU6A 3IMVA 3PJSB 4KZCA 2JE8A 4C58B 2EXWC 4PREB 3RGVB 2AJYL 3ULUF 3MLSH 5CEXA 1HYRC 3MNDA 1MCSA 1XR8B 1MFVA 2ZOLA 4JKLA 4PLOB 2FX7L 3LS4H 3HTLX 2BMKA 1J8HD 5AZEH 4K3JH 3MLZH 3D3VE 3GXFA 2GBUA 1ETZB 3HC2A 3WGUB 5JMRA 4EUPB 1BAFH 2C4FT 1RY7B 4Z7UE 4HU2A 2BVPA 4KK6C 4RGMC 4U0RB 2VDML 1GH7A 2AXFA 3N43B 4M8VA 1K6QL 3S5LG 4BINA 3VFMA 3VGGA 1QVOA 2A73A 6CGTA 3KYOB 4N20A 2H6PA 3QA3B 4WY7H 3ILPB 4XXCC 2X4UA 4PRPE 1H3XA 4HJ0D 4IOIB 4LLMA 4KROB 4YDLC 5GHWH 5ADOH 5F1OB 4H8PA 1FFQA 5DHDA 5HYIA 1YMME 1HNYA 5E8EA 1RJZA 3HZVB 4XMWA 4ZW6A 3HHMA 5D7LA 2Z92B 1EJ6A 4GQ9L 1CL7L 3OSKA 1OV8A 1BMGA 5D2LF 5FAAA 3SDDA 4KVNL 5D6DA 4EKXA 1QBBA 4IHOA 2B4CC 5DQDL 5HGAA 3GXNA 4IRSD 4OIAA 4XPGL 4AEHL 1TU2B 2DQMA 4F24A 5KYUB 3V6ZB 3T0XA 1LP9A 3BKMH 1G9ML 4RH4A 3CLEL 3I6LE 3WE6B 1K8DA 1QABA 1FNGB 2V9TA 4BZ1A 3EGXA 4L4TD 1P7QB 4YIQA 4ABWA 1ZIAA 3BWUC 3U6XS 2QL1A 1M2OA 3FOLA 2X4TA 1CLVA 2Z64C 3KPQB 5IR1A 4UZGA 5D9SA 1X5KA 3KDMA 1E4XL 1FZKA 1OAQL 2Y6TE 5GXBB 1OANA 2Z91A 2N56A 1VA9A 3E8VA 3GQFA 5IB1A 1VESA 4ZDHB 1FQ9C 2WUBL 3ZUCA 5F2FA 4XGZA 2HJLA 1N3NA 4WU7A 2NY5C 1F8TH 2XIDA 2BHFA 3MUJA 4UWQB 4NZ8A 2WZ6A 4OW6A 4UQBA 4XBPA 5C0BD 4BZ1L 4G6JH 3VWJB 1OAZH 4K5OA 3ARYA 3OR6B 2H2PD 4NNXB 3V4UL 4LHUD 3V10A 2X40A 4R97C 3RUGF 1WFUA 4BFGA 1DFBL 4PJXF 3RNQB 5DJ2A 2EEFA 3WE1A 1WHOA 3EO1B 2ZXBA 4NO0D 1VJSA 2ERJC 1EH9A 2M2DA 2RQEA 2ZE0A 1INQB 3FB7A 3ARQA 5CJXC 3UTSD 5L6YH 3FU9A 4P9ML 4QLRA 1OD9A 4E0RB 4H0LC 5JIDA 3ORJA 4NERA 1DBAL 4CUCA 4KY2A 2Y36H 3A4FA 4D0CA 1FIEA 4UAOC 5EO0B 4XPAH 4OD1L 1OGAA 1AO7B 3FQRA 3AADB 3IXAB 1IQWL 4IRSC 1W91A 2A6DB 2X4SB 3KCPA 5CZRA 5HHME 3KPRB 1HHIB 1NM4A 1YEJL 3JYCA 1U2HA 4U49A 1VADB 1PVHA 1WZ1H 3DECA 2VDLL 4N0UB 1U8HA 4U6VH 4R2GB 3B43A 3RHWF 4YDVB 3RTQA 4AM0A 2ADIA 1RZJH 3SE3A 4CGTA 2Z7ZA 3IJYB 1AXIB 2EILB 5F7HA 4HW6A 2WWNA 3ZDWA 3O6FB 3QDGE 3QQDA 4UNTA 5B22A 1CLZH 4PJCA 2BNQA 3WKYA 2XN1A 4RISL 3LNEA 4YO0A 5DQ9A 3MV7D 1T6BX 4PFEA 1PLAA 2BHZA 3MRNB 1FLRH 2B14A 3CXDH 3EIFA 3FBQA 3NPSC 3GPEA 4EAEA 3ZE0E 4H5SA 3N9GL 4JO1H 1AQMA 1R3JA 2JIXD 3INUH 5E08H 2YFOA 3ARSA 1MCOH 5CNHA 4GUQA 3SPIA 4EIUA 1T04A 4R83A 1G9NL 2JJTC 2MJWA 2PWHA 4B7LA 3ETSA 2AF2A 2BSDA 4FQXC 4G6MH 3GO1H 3J07A 1RUMH 2OX5A 4E9LA 2C7UB 2PTTB 4OFIA 1ZTXH 35C8H 4A2LA 1CF8L 3Q2WA 3UC0L 4MDJB 2GSMB 5JUEL 5CBEA 1OARL 4NCDA 4DOHE 1U3ZA 3V52H 1RERA 3L2NA 3IKKA 2AQNA 3LN9A 3VD5A 1MG2C 2Q5BA 3FQWB 3HFMH 5ANMA 3ZQWA 4E41A 2XG4B 5AVWB 5F0LB 2XKSA 3MNVA 2XWTA 3QNZB 1EEYA 2DDQL 1NDGB 2E8ZA 3NYKA 4GXVH 4UV4L 1MWOA 3NJGA 3TA4D 4UINH 3ZPDA 4HCIA 4A37A 3HBGA 1BF8A 5E1AB 1NGXB 1VAHA 1TVBB 4L9DA 1UZGA 5F70A 3F7RA 4EEEA 4Q0XL 3PQYB 4LL4A 5GSRA 1KBBA 4MVBD 3E6FA 3RRQA 3DURA 2NW2A 2F58L 3ECBA 4P46A 3F04A 4PRIA 1OT2A 3CU7A 3IEAA 5C08A 4M6NH 5A2CA 1CI3M 1KFGA 2CA3A 5I1CL 2ERJB 5IB5B 5JNYB 1IFHH 3I50H 1QTSA 3ZKMC 1XZ0B 1NKRA 1T5WA 4FG0A 1FSKB 4JY6A 4H1LA 2J57A 2P3YA 5EG6C 1NFKA 3MJ8B 5DD6B 3WNNA 1I7RA 1MCPL 5CZXC 3EO0A 2TSBA 2ZYSA 4RCAA 3FCTB 5EZPA 4CSTA 3GRWL 3FMGH 4TTGA 4NQCD 4LKCA 4OCNC 4ZOEA 3N1MC 4QY8B 3NH7L 2OMUA 4QI3A 3SYPA 3OL2A 2H32H 3POCA 4WO4D 3HRZC 3S37L 5B3JE 1B9ZA 1EHKB 3B9EA 1QFWL 4U3CA 4ZFGH 1NGWA 2JKRM 3MV9A 1CICB 3UAAA 3ZDZF 1PIFA 5D93C 5T3XL 4UU9A 3U4BL 1NUNB 5AL8A 2OL3A 4NKQB 3PDOB 4O58L 1LWJA 1A6VH 4ADGA 4OLVL 3K2KA 5DMKA 4R6UA 1KJ2H 2NX5D 3K5SA 5EH1A 4M5ZH 4UZSA 4HK3N 4OZ4A 3F7YA 4J3XA 4P8QA 1MCIA 1QEWA 2V2TB 3PWVB 2BZCA 1V3LA 4IBSA 1FP5A 4NKMB 4P3CL 1JUFA 2C9PA 4HD9A 4IBYA 4R7XA 4R4ND 4FNLL 3Q6GL 4OF8A 1OW0C 2HVKB 4QHLB 3H1ZA 3NPSB 3QUZD 4N2IA 1DLFL 1MCWM 1T83C 3QZOA 3VDCA 3BH4A 4BFJA 1URZA 1K85A 1SYVA 3LQAC 2BY3A 2E3VA 1ONQA 3QEQD 2OL3L 3OB8A 4FXTA 1EPFA 4ZO7A 3FT1A 1I3UA 5FK9B 3QJZA 4FQXB 5IM7B 2PMZA 4Z3HA 1DVQA 3Q2CA 2EIEA 4LMQE 2XG5A 1ZLVH 5I15L 3BSGA 3IDGA 4PGDB 1JRHL 5TE4L 4XXWA 3O3AB 5ECJE 5ACZB 5C1MB 4CBZA 5D1QD 3VW3L 2H26A 2R4SL 1IGYB 2J6EA 1U8IB 5JW3L 4NUMA 5DT1H 2D8KA 2N0MA 1CC3A 4JGHA 3FRUA 4CKQA 3T6WA 1CXFA 5LXGH 1YPZF 4LK4A 1E27B 1MWAH 4XOBA 3VXOA 4APQB 4WO4C 3IJHB 1YEKH 1YNTF 5EDSA 4U1SB 4JPIA 4XMVA 4OGYH 2IBBA 2ILLA 1C16A 2WOBA 2YXVA 4JFFA 3U48A 2HFGH 2E59A 4YVNA 1AJ7H 4JFPB 4BCZA 4O51A 4BWWA 2JB6B 2WB7A 3U0PA 1TCMA 3JTBA 1CFSA 3TJHC 1V7NL 1QWNA 4A7SA 2UV3A 4WTZG 2VCOA 2PXYC 2WCGA 1E8XA 1L0QA 3EYVB 5I76B 4F7PB 4Y1AD 5F71A 5I0VA 4JFEE 3CVDA 1F11A 4WNQB 3RG1C 3FN9A 3BKCL 3IMUA 3KPPA 5FGCE 3IGUA 4G8AC 4G7VL 2X70A 1XGUA 1BECA 4FXGA 3P0YH 4NP4H 5B3SB 3B9DA 4S11A 4XP9L 5C7ZA 4BH7A 2Z4QB 1IC5H 2ZSWA 3GMRA 5D1ZD 3UX9B 1EEZB 1PBYA 3MLRL 2BWDA 4KO5A 5GRJL 3ZTDC 1V7MH 3QXDA 1YQ2A 3B3IB 3BVXA 1T20B 2BSSA 2WWMD