4W9IC

Pvhl:elob:eloc in complex with (2s,4r)-1-((2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 35
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9iC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9iC01
4W9FC 3ZRFC 4W9HC 4B95C 4W9CC 4W9JC 3ZTDC 4BKSC 4W9GC 5LLIC 1LM8V 4AWJC 4B9KC 1VCBC 4AJYV 3ZTCC 3ZRCC 4W9KC 4WQOA 3ZUNC 4W9IC 4W9EC 1LQBC 4W9LC 4BKTC 4W9DC
chains in the Genus database with same CATH superfamily
1E27A 1G1YA 3RX5A 1GSMA 1YYCA 2B3IA 1EO7A 3GPEA 4FQLH 1DJGA 5D7LA 3SQRA 3CFCH 4PWEA 4G9DB 3BJLA 4JZOA 5TFSL 3AG1B 4XH2A 3OQ3B 1BQ5A 5IBLD 1G0XA 4Z7UF 3EZ8A 1CICD 4X5RA 2RB8A 5IJCC 2AKRA 1LM8V 3WJJA 1T6VN 2AK4E 1UXMA 3QUYB 1IARB 4MJ5B 3T2NH 3GUTB 4DP0X 2P5ED 3GIZH 1PF3A 5I16B 1QABA 3UGUA 3FUIA 2HZHA 4HPOL 5HHVL 4O2CA 4B9YA 1U8KA 4YAQB 2VR9A 3DRQA 2L7UA 3LZLA 4EZJA 1JYWA 3TBTA 3BVUA 1E90A 5DMGD 5L9DH 2P47B 2JB6B 1OAZL 4OY9A 4JG0L 5HSFA 4QT5B 1MLCB 4L5FH 4XVTH 3KPSE 3UDWC 1CTNA 3UH8A 5I19L 3T0AA 1JHKH 3U0PA 3FMGL 3FQWB 4L4VB 1T0OA 1KZQA 3DIDA 4OZ4B 3FHAA 3QJXA 1JGIA 4X9FA 3ESOA 5EO1A 3VQLA 4OI9A 2VXQL 4LSTL 1JDCA 1YEFH 2X3AA 4L2LA 4HHAB 3BWSA 4K8RC 3MLYL 4NUGL 3MRCB 4BE6A 1O7VA 5CZVH 3PAZA 4KKRA 5C2BH 2Y1YA 3GLEA 1D5IL 3DTXB 1E8WA 3CFBB 3QQ3A 1DQMH 2QKIC 3L5HA 3PGFL 2AJ3B 2XTJE 5HYSB 4B9JA 4ABVA 3P0VH 2AJXL 3GK8H 3BH9B 4JGNA 2DM4A 2COVD 1O75A 2QR0B 5F93C 1PYWA 1RZKH 4BRJA 3IPEA 3FQRA 3EYOB 1J8HD 1XF1A 1ZGLA 1SQMA 2K1MA 1RPUA 1GIGH 4WZ9A 4EI6A 2ZIDA 2Y1AA 1HIMH 3SDCB 1TT6A 3HG1E 2WYZA 4LAJH 1IKNC 1MXGA 4QWWD 1FCGA 3A67H 3FCTB 2IAMD 3NYKA 5CNHA 1AP2B 3KPMA 2IPTH 4JM0A 4KI5F 1GJIA 3BQVA 3S0PA 3TZVC 1FNHA 4MD0A 2QV4A 3TO4A 3RTQB 5L4FA 1H6FA 1J5OL 2VZ3A 1W0VB 3KW7A 3QIUA 4TNEA 4Z7OE 3RB7A 4O4YL 5FYKL 2FZ3A 3VI3F 4BH8B 1BWMA 3O3UN 2B9AA 4R9HA 2A9NL 1KMGA 5IT2L 1NDGB 4JFFE 1YPZE 5JPNB 1M1XA 1TR7A 1CLOH 2B59A 2YSSA 4N9OB 4QF1A 2WXRA 4R3SA 3U30B 3MOBH 4QHPA 5IR1B 2VABA 4FQQB 3WFHA 5F3BB 1PZAA 5DDHA 5JNYB 4K55A 3PP3K 2FEEL 4UMSA 2UWEF 3TYGH 4ONHA 5I76A 2ATAA 4GRLD 1AACA 1DE4A 3O0LA 4ELMB 2R0KL 1VFAB 2KQMA 1FL3B 2VN6A 3DARA 4RBPH 4GUOA 1EZVX 3KH3A 4QLWA 2CDGA 5T3ZE 3U9WA 8FABA 5D7JC 3FSVA 2H2PC 5AOJA 3NIGB 3WNPA 5I1IL 3OAUL 2CUIA 2X9XA 4UF7C 4ZUSA 3NH7H 2VLLB 2BWDA 5JIKA 1CDHA 3VUAA 4AJ0A 4PJIE 5KG9B 5F0PB 4PRPD 4GEJA 2XPYA 3BP5B 2F1BA 3FULA 2XRAL 5CP3A 1UGNA 4LLWB 3KLLA 2J4WH 4R5TA 4KROB 3GSVB 2OA9A 4MA8L 4ES9A 5KVFL 1U92A 3QCTL 1AO7E 1OANA 3G5WA 4DVBB 3CZNA 3QCUH 3ISWA 4NCC2 1BREA 3B34A 4A2LA 1L9OA 3EOBB 4TQEH 4D3CL 4I3SL 3RZWA 3X1GA 4EO5A 4G6ML 1A7RH 1P7KB 1UWGH 2ZWYA 3FUDA 4FNUA 2FAUA 1A3RL 3NPZB 4GRWB 3CHQA 4OUUB 3R8BB 1TZOA 2I32A 2EUVA 3KPRE 4OZFG 2D7NA 3EKCA 1P1ZB 2BFGA 3RJQB 4AGMA 2D03L 4HIJA 1A9EB 3GRGA 2ETWA 2R2HA 4YMPA 5DGRA 1B6UA 3IRCA 5DK2B 1E5BA 1BF8A 4EMZA 2BIOA 4D9RD 4K3HA 4MAYA 5DS2A 4NQEB 3VNYA 4FFZL 2JELH 5CLYA 4M1GH 1MWOA 1I7TA 4KRPC 4PLKC 2IV9A 4YXLH 4A2MA 4D0DB 3A6BH 1VFBB 1GSKA 5GS0L 1G9ML 3LKRA 4RH4A 2X88A 3FB6B 4JAMB 4WUUE 1QFOA 2XU9A 1IGIH 3W39B 4Y9BA 4LSRH 4PG9B 5E5RB 3DIFB 4XODA 1RZ8B 2ZAHA 5BVPL 2Q7NA 4XO8A 4AQ1A 3BT2L 3LQMA 3N43F 1OCCB 1KY6A 5IMOA 3VMNA 5BOJA 2D0FA 4KTDL 4WFGD 1BZ7B 1NDTA 4YK4B 2Y36H 3FQXA 2GBUA 5FK9A 2Q9OA 1B9KA 3WNNA 3GTTA 5E8OA 1U93B 2DLGA 4WKXA 4PM1A 4UBDD 4XN7A 5IFHL 4PJ9C 3B9DA 4CMMB 4PBXA 1TZHB 3EYSH 3SDCD 5JHLA 5MP6L 2QQLL 2CIIB 3H9HA 3NJFA 3VWKB 3L4VA 2OJZH 4XP4L 2P4AB 4PI2A 3O9WC 4PH8A 3BLBA 5EO9B 3IU4H 1EUUA 1Z9LA 3FB5A 1C1EH 3ZHNA 2JH2A 2ZYSA 1UXLA 2B3RA 4PN6A 3T3ME 4FQJL 5DVLA 2SEBA 3WO4C 5DJ6A 3EJQA 2I5YL 5DGQA 1V8HA 5H8DA 3V2AR 4F8NA 5JIIA 5KBKA 2KC0A 3G08B 4A55A 3VD7A 2J21A 5CJ8A 1SF3A 3VXSB 4JFPB 4PCYA 1I8KA 3RQ3A 2D9QB 1HXYA 3WEXB 2DQJH 4EKJA 2FJUB 4OCYL 1DZBA 3UJTL 1N6QH 1IM3D 2P49B 3ZKSD 3ZKMD 2AABH 4X7CC 5B1AB 3U4KA 1A66A 4BFIA 3S36L 4IBVA 2O61A 4KKAD 4I18C 4OCNC 4HDIA 1JD7A 5F1SA 5JXED 5AFAA 3D39E 3QWOA 4K0OA 5LLIC 3LD8B 3O3EB 4IHOA 4JHZA 4NQSA 5D1ZC 5C0DA 1QQDA 1CIDA 1HE8A 1UT2A 3CSYA 3FQNA 4UT7H 5GSVB 1EIBA 3LVEA 3T1FA 3QEGL 1SOKA 3X3FL 2I24N 1V55B 1AXSB 5GGVY 2HTLC 2JB5H 1JXJA 3AWEA 3H9ZA 3TVMA 3FBQA 2YRLA 2XXGA 4I0CC 1C5DA 1WRFA 4AE0A 1HKLL 4HWZA 1JYNA 4YGVA 2PTTB 4WEEA 2IOOA 3LZQA 1PEZA 1T6BX 3U82B 2DQUH 3Q2CA 1NAMH 2HJLA 5EUOE 3NZHH 2VDPL 2Z8WC 3T0EB 4PCKA 3EH2A 2FO1A 2WLHA 2HG5B 2QPFA 2XT1B 1ZK5A 4EQ2A 5BXFA 3KPNB 5DD0H 2IPKB 4AENB 1KGYE 1MXDA 3J2PA 4MBOA 1V3JA 2G30A 2H0PA 5CJQL 1AZZC 3MXVH 3B8SA 2Y24A 3Q1EA 5B4MC 4QEGA 2AEPL 3APMA 1VESA 1JNLH 2RMNA 2EVFA 2R1XA 4AYMC 1RIUH 3D50A 3ELAT 3ESNA 3IJSA 3DOSA 3OTTA 4K5OA 1WSST 3HLKA 4Z3GA 1EEUA 5J1AA 2ENSA 2VDRB 2Z1PA 1UA6L 3THMH 1IBBA 4NI6A 1N5AB 3SCMB 1BOGA 4UQEA 3SDDC 2C9SA 4IMKA 3L3OB 2IG2L 5IBTH 3RTLA 1TKWB 4M61A 2HG0A 1ACXA 3VI4A 2UY6A 4X8JB 5EN3A 1VCAA 4H40A 5CZKA 1KULA 1LD9A 1MCPL 3FCUB 3FRUB 2I60H 5BRZE 5G5DA 3BESR 3CX5J 1CUOA 2EJ1A 4BQBA 5EMYA 1EUTA 1JK8A 3US9A 1CXLA 3RG1C 5L7XH 4HIXH 1LO5A 2FIRT 5SWQB 1X7QB 1NA8A 3TCLA 1AY1L 2VDOH 3KH4A 1YQ2A 4PJBA 5DUPH 3HI1B 4AQ8A 1O7SA 2BP0A 4QAWA 2A77L 1CGTA 1HEZA 2XPGB 1AQDA 3CFJA 1OGAB 2ZP8A 1OD9A 2WNGA 3DMMC 4XCYB 4J3BA 5L8LB 2DIAA 2AS5M 4N2EA 1FO0A 4HZAA 4XVJH 3DX9B 5FS5A 4K7PL 1KPRA 3APCA 1ZAGA 3CDYA 3OB0H 4BK5C 4WO4B 5BW7A 3D3VB 1GS6X 1K9TA 1IQDB 1DEEB 1Q9OA 3JWOL 3KCPA 1BFTA 4JRYA 3L9EA 3UTTD 4DKEH 1Q4NX 1T7WA 1D6EA 1X5ZA 2KERA 1D3CA 1NANI 2YJQA 4XMPL 3HVDA 3O6MH 4LPUA 2X2YA 3NIDB 2B5IB 4LDEB 2AQTA 2F74A 3BN9D 4MDIB 5D5ME 2ENJA 3QCVL 4J3TA 5GS3A 5IK3B 3ATBA 4AUYA 3CVCA 3LQZA 2ALAA 3OL2A 3ULVC 3HNVL 2HJKA 2W1NA 5HXMA 5IKCB 3UX9B 3B2UC 5GZNA 1IGCL 5E1HB 3W11C 4UOJA 4XMUA 2OK0H 4B9CA 5I74B 1RL1A 3ARBB 4MFHA 4PJEA 4WJ5A 5G55A 2ATPA 4BELD 1TIUA 1D7CA 5JR1L 5KVDH 1UOLA 1EDQA 4HS8H 4P2QA 5GISL 4U6HB 4OF7A 3U1SL 4H1LH 4ZSOB 1FRGH 1D9KA 1Y0LA 1JS4A 4NSKB 4EN2A 1A8ZA 2NY6D 1JYXA 1UZ8B 3GBMH 4XOAA 4GG8B 1X9QA 3BUQA 4OLYH 2O26U 3W0WE 2R69H 3EHBC 4Y4HC 4X8XA 3H9SB 4JG1H 1XGTA 4M8UA 4OFQA 3HRPA 5E4EC 5CXPA 5CP7A 2XN9D 3GQFA 1ZOXA 4AJYV 1YG9A 3TN0D 2DWSA 3GI8H 3VU1A 3DRTA 4KZ0A 4Y4FD 4WI0B 4G7YH 3IFNL 3FTZA 4I0PB 3DXAE 3HC0B 3OPZH 4TNGA 12E8H 5DS8A 2IBGA 2WNXA 4L9LA 4AH2A 4FFVC 2VDKH 2P1YA 4XBEH 4F37K 5DJDB 1IAOA 3OZ9L 3A4EA 4MB3A 3N06B 5D72L 4QRTB 4L3FA 5HDOA 3ML8A 4I1NB 3X3GH 2FR4B 2GY7B 2Y3AA 5IQ7H 3BZDA 4FXKB 1MHEB 4DP7X 4X6BA 3IJEB 1MRDH 5CEZL 3AU1B 4JZJB 4P4KD 3BUTA 4LHUB 4U7MA 2O6EA 3RVXD 1KGCD 1DVYA 5JHLL 1WBXA 3GEWB 3QFDA 4FTDA 5D2NA 4X6CE 4Z3IA 2DLIA 2FIKB 5I8CA 2X1OA 3GWJA 3B5GA 3RY6C 1UJ3A 2EKSB 3P0YL 4Y16D 2EYSA 2FRGP 2Z6FA 4W9HC 1I3RA 2D0HA 3GRWA 4OLXH 5F9OH 3EDKA 5MENB 2VL5A 4XZUB 2WTPA 1RUKL 1NC2D 3SYOA 1BVLB 5I1LA 4EE2A 4G80B 4JY6A 3UERA 1QOKA 2DLFH 2XDHA 1MCEA 3B4NA 4IIZA 1E0OB 3MV9E 4AEFA 4N8VB 1Q72L 4DGVL 4DWHA 4PJCE 1ONQB 3HE7D 3FRPB 4LOUD 3WENA 1WTGT 2ZOLB 3Q1SH 2NQ3A 5EZOL 4BZ2H 3SE8L 2AXHA 2MKLC 4OJFH 5CZXD 3SE9H 1B0GB 1P7BA 2G3NA 1IGJA 1UOWA 2CWRA 2PWFA 1MCNA 4LSUH 3KWVA 3OF6A 4F57H 3MRGB 2PO6A 4Y5VA 5DUBA 1U8QB 3TJEH 3IFOB 2R59A 4BFGA 4NUJA 5JIPA 1CBVH 1KV3A 3BVNA 3T4AB 4RGMB 4M4RA 2AXFB 5CD3B 3RBGA 2OW7A 2HKHL 5ITBH 2VLKB 3VFSA 3VWJB 2JKJA 2V3FA 3C5SA 3OKDB 3PL6D 2YRBA 3IYLW 1PZSA 3H6JA 1NLBH 4NJAL 3VA2C 1MFCH 1G0YR 2CRZA 2WIIB 1GL4B 3EJUA 1S5IH 1KTCA 2VAAB 3VXTB 1I9IH 3LSOB 4IOFD 4DSYA 2WO4A 3DGCR 1NFAA 4M6NL 4PRHE 1ETB1 3NAAH 1EHLH 1XGQA 3L3KA 3VXOB 2BWQA 4AUUA 1RZ7H 4L8DA 4U1NA 2BVUA 1NIAA 2WXNA 3GMLA 3V5HB 1AGBA 4JB9H 4WHDA 4AGQA 2V2TB 5F0MB 3L3IA 2JCCA 5I1CH 5A3ID 5J6HB 3F3HA 3S5LB 3CH1A 1HESA 4P2RD 1AC0A 2GK2A 2KPNA 2RBLA 4ZMOA 2ZSWB 4XTRC 4AKOA 4XCNB 3SKMA 4KV5E 1XVSA 3MRJA 5T1JA 4YHYB 1OE2A 3BISA 3UTSA 3QDJB 1P7QA 3TASA 3N1FC 1SY6H 2FX7H 2H8PB 4WTQA 1FUNA 3UJIL 3N1GC 1SLVA 3SGKA 4Z0BL 3DO4A 2BNQE 2ORBH 3GMRA 4XE0A 5CILL 2HN7A 4JLRB 1QTSA 1DCEA 4APXA 3U25A 3QS3A 5FECB 1ACYH 1MVUA 2EC9U 5MEPB 1JI1A 1KLUA 3UOAB 4ADIA 4M93C 2C3VB 4UZUA 2AW2A 5KVGL 4C8XA 1BVKA 3F7PC 3JV4A 2ICES 4GBXD 4Y19E 5D93C 5AZ2H 4XC3H 3WS3B 1E4XI 4FULA 4YHPA 3IXTA 1C5BL 2N0MA 4KXAA 3MV8D 3GHEL 2K7QA 4MD4A 3BP7A 4P49A 3QJHB 4WLCA 5E9DD 2GEQA 2FJFA 2QHLA 1BP3B 3EYQC 3L8QA 4F7KA 1G7QA 3W9DB 4FXTA 3REWA 3AMLA 2NY5H 4XPFH 4CN4A 2IPUG 3QDGD 3GMNB 1TPXC 3SDYH 1KYFA 2NDGA 5GSRB 4PVMA 5B1JC 4DGWC 1BECA 2J8HA 4UQ3B 1T0MA 2X0VA 4DIXA 5FF6B 2X2UA 2B7DT 3VA6A 5DQJB 4TM9A 2V5YA 4HAFA 1ET5A 1WEJL 3RHWF 2WP3O 4EOWH 1ZA3A 1BWWA 3BGFB 4KFZC 4R2GC 3VXRE 3D2UD 1XF5B 1N4XH 3NSFA 3EXJA 1HI6B 4W68A 4PW4A 2X2HA 5L2KB 2CLVB 3T6ZA 3MRLB 3DJZA 1QVOB 2VKXA 4M7KL 2GY5A 4MAZA 2NSXA 5KSAC 2MNUA 4PJ7B 5JOFB 2XI9A 4S1DD 3VI4F 5JHDB 5IEKA 4MXQC 3FFDB 1QO3A 1O6TA 2R4RL 1L0XA 4QRUA 3LKNB 1IJNA 4FC3E 3GXPA 1LVEA 2E74C 4XB3A 4U1IA 4XVUC 3HHRB 4LCCB 4CC1A 1QFUL 3WJMA 2NNCA 1INDL 3DX0A 4PJBF 3BKML 5MEQB 4Z9KB 5A2FA 1KXQE 3C75A 3OKYA 1VACA 3PDGA 1NLDL 2AAVA 3QJUB 2WZPD 2X4UA 2XX0A 2ZUQB 4XN5A 3QIWB 3II2A 3DBXB 4PJGE 1CS6A 3H55A 1KN2H 4MZRA 4JO8A 2FBJL 4GG6F 1J86A 4LF3B 5IFAH 2VITA 4CVZB 2HVKB 1MCOL 1XD1A 2AP2A 1KJ2L 4MD5A 3WFBH 5F7WC 5I8EA 4FQXD 2X1QA 3CC5B 1TLMA 3PXJA 4YDIH 2OSLB 1KSRA 4JGHA 4R97C 5DVMA 3PJLA 4JDZB 2JIXB 1U4FA 3MRQA 3U4BL 4R96A 4JN1H 1IE4A 3G9VA 4HJUA 4AV5A 3NBNA 4Z7QE 3CX5K 3MNDA 5FKPB 4NWTH 1EXGA 2PWEA 1G4MA 1P7HL 2VM4A 3IDYC 1SJEB 4BRVA 1I85A 3RB5A 3RNQB 1AXTH 5JDJA 2QQKH 2WBXA 3QNZA 4U6VL 3VFUA 4PJEF 4QYAA 2JV6A 1A4BA 5FM8A 5ES4B 1LDPH 4LRNL 3O11B 3PS6A 5IGXL 3RFZC 1Q9LB 4Q9QL 3F01A 3MODH 4MNQE 1DYZA 4F9LA 5KYWB 4Z3HA 1A4CA 4KTGA 3NTCL 3MUJA 4UIMA 2DH3A 2MCG1 3RL1A 1D5BB 4YBHA 3AT8A 1T0NA 4TNWF 3WUWA 2IH1A 1KCSH 3WTSA 3U46B 3ZTNH 1IL1B 1TFPA 2J88H 3T0DA 1NL0L 4WWKD 3U6XS 3DYMA 1ZS8A 4OQTH 2DI9A 3KLAB 2C9XA 2ZG3A 4M7LT 4RGOH 2F53D 2X70A 1RFDL 3DV6B 3IF1A 4TSCH 4ZQKB 5BOZG 2Z4QB 1K72A 2YMXL 2V5MA 4LASL 5DRXA 3ARGB 1MQKL 3LZRA 1VADA 4PWHA 2J8UB 4U2YA 4KI5C 1A4AA 4M8VA 3KYNA 2FHCA 3AQYA 4ODUA 5F9JB 4KKLC 4ODSH 2WYTA 3HI6H 4J23A 2E7LC 2X44D 4ZYKA 3PQYA 1IBZA 3KBEA 2NYYD 5TJWK 2HFFB 4G43B 1SHXA 3BSZA 3MV7A 4YLCA 4JFSA 2C9RA 4QAMB 3HW7A 3TYFB 4HFWB 4Q9CA 4BSJA 2K4AA 4G59C 3GDBA 5IESH 3NCXA 5DURB 5EC1B 2H3NB 3F7YB 5ETUB 1KIQB 3AM8C 4K3EL 2MEJB 3WNKA 3EBHA 4GSDH 1MI5D 4PGZA 4Z78A 3T5WA 3AREB 2A2QT 2G0KA 1L0PA 3BHBA 3LEXB 3VACA 3VFMA 1XTLA 2F7PA 2VC2L 1R24B 1S7QB 5DZAA 5GXBB 4Y8AA 3HE6D 4JJHA 4G9FB 2Y22A 2VYRE 1WHOA 4HJ0D 3B9VA 4N2DA 4EN3D 5IUCA 4QXTB 2YK1L 3OB0K 4BWTA 4XO3A 3BW9A 4RSVA 5C0GB 1AKJA 1F3RB 4JN2B 4APQA 2A4ZA 2G4EA 3OAZH 4AGLA 2QSVA 3MLRH 1IRAY 4UAHA 1DUZB 4NRZB 2PCFA 2R0ZL 3POCA 1JZ5A 3P30H 3VAEA 1YQVL 2X42A 4A2GA 1YMME 5BV7L 1ET7A 5HHQB 4Y7MA 3AWGA 4R4ND 3MBEC 4X6DE 1A6AA 3C60A 5B8CA 3LEYL 3JSSA 4TLSA 4XP5L 2MOQA 5T1MA 4ERSH 1ZLEA 2X1WL 1AE6H 4FCHA 3EDEA 1PLBA 1M7XA 3CUPA 4EUPA 4JL1A 1XCTB 1Z3RA 3A4DA 3QEUA 2JCCF 1KCVL 4NQDB 4HK3N 4XRCA 3VYPA 3QAZB 3PWVB 1LK2A 4N2CA 1UT1A 4FI8A 2ESVE 1UD8A 2AVGA 3FBKA 4DKAA 2RJMA 3QIBB 3SPGA 4FQ2L 1G9HA 3GSOA 3WBDA 2OTUA 1U91A 4FZ8L 4RAUB 4N0CC 2W07A 5GGUB 1I9RH 2WK2A 2DEXX 4BINA 4ODWB 3G6JA 2D3JA 2F1EA 4HUMB 3ZIMA 4JMXA 2H3KA 3U0TA 5F8RC 2ZNWA 3JVFC 2ICEC 3IJHA 1TJIL 1FZJA 4S1SH 5IVOA 2PMZA 5DC0A 3QXAA 5E8EA 1PY0A 1RHHB 1U2HA 1WPCA 4X6FB 4EI0A 1P4BH 4E0RA 1P9MA 4J7RA 4MAUL 1JPGB 4LVOB 1B4JH 4KOBA 2XLLA 3FTUA 4K23H 1A6TB 1NOAA 2NXZC 4NQCD 1IKFH 3RIAF 4PTTA 1N18A 5EIIB 3DK0A 2RD0A 2GJ6D 3C6SA 4JKLA 1JCVA 4WU5B 1Z9SA 3RZCD 3V5DB 2YAOA 3X13A 3MLSL 4XO4A 5I1GH 1NJ9A 2WSPA 2VDOB 2YXWA 5FYJH 2F6AA 2QMJA 3DVGA 5L0QB 1ZD6A 2F7QA 3OC8A 3SO3C 2JK5B 2DI8A 1KIRA 4F2MA 3EF7A 4R0LB 3V0DA 4MQXC 4HIHB 4YBLC 5E1QA 3LCYA 3CLEL 3QQ4A 3RI5K 5HJBA 4PRNB 4WHCA 1ITBB 4Y2OA 3EG9B 1ZHBA 3TFKD 2OV0A 4X98A 1TSHA 2ZCKH 1AZCA 1RK1B 1WA0X 1SXZA 4JHWL 4GINA 3ET9F 3PXHA 4L8SB 5T3ZH 4Z76B 2PP8A 3LHAA 4GW1B 3TL5A 1EFXD 3FO9B 1JPSL 5F7DA 2EVIA 3TBCA 3MU3A 2ZXDA 5EORL 5BVJA 3SDXA 3RU8L 1WBYA 1JWMB 2V3DA 3SODB 1E28A 4L1BA 2Y5EA 2A6KA 1V7MH 3O6FC 5GS0C 1G9MC 3T9WA 4B53A 1INEH 5HDBE 5H37G 3DUHA 2FECL 2P8LA 3RX8A 3MRBB 4UANA 4EXPX 1DQJA 1T2JA 4NO3B 1FP5A 1YEJL 5FDWB 4DHLA 1Q9KB 3UZQB 3UZEC 1N8ZA 1LO4L 2H47C 5IROC 1I75A 4UT9H 4G83A 4A2FA 4HIIB 4KDWA 2A1WL 2GTQA 3BUYA 2CO6A 4H1LB 4F7PA 1OPGH 2ED7A 4JFDB 3C6LD 4TLTA 3TBWB 4KUZH 1ZEAH 4G2AA 1NGZB 5BOPA 4E9QA 3QPQD 5KS9B 5C0CD 5HI3C 1AZNA 2PPAA 3B2MA 3ESVF 2A74A 2ITFA 4LEOA 1IB5A 1BXVA 1G5AA 3HAEA 4OZIE 4OKDA 4PP2B 4XMKH 2ZZUT 1A47A 4S2SA 1YO4A 3KL5A 2HLAA 5BO1L 3FTYA 5I1DA 1ETZB 5A2AA 4AK2A 4YSEA 2Z65C 2QZQA 1Q1JH 5D1QC 1WZ1H 2EKJA 1ANUA 1HHGB 4U33A 1M7DB 1H3PL 1J5CA 4IMLA 2KMWA 2ADIA 2WZAA 2ZUXA 2W91A 4FQCL 4MA1C 1OM3L 2VDKB 1FDLH 3SIKA 3BRFA 1QUNA 4C56A 2FLBT 4AQEB 1LP9A 4ANUA 3IETB 3ZDZE 5DT1L 35C8H 3BSZL 3E38A 1DBAH 2LFGA 2CM6A 2X5PA 3BI9X 2WCPA 5AZEH 4IRSD 1JZ8A 3ULUD 5FFOA 3Q2LA 1N70A 3RP1A 4XAKD 4WHTB 1PFOA 1WAAF 4NKDB 4O9HH 1CLYL 3LPFA 4C54A 4P5KA 2GB2A 2WXFA 3M1OA 4HWUA 2CJTA 1ML0A 4KAQH 5AZUA 4AMKH 1DJIA 3DBSA 4IU2A 5SWZD 2KLRA 5JHMA 1DFBL 4ZX3A 4BQ9A 2DEWX 1CQKA 4CU8A 1FSKC 4HSQA 5KJRL 4OJYA 5DJ0B 2JLLA 4AYDC 3ILPB 5C07A 3OAWA 4OFPA 4UU9A 3MRIA 1GZQB 3CLWA 2DIEA 4HT1H 3FONB 1WFUA 2OMTB 3O4LD 5FDYA 3QB7C 1H3XA 3PJSA 4OIIH 5BQ7A 5TE7L 2NXYB 1QLFB 3IMUA 4F2EA 5KTEH 2FWLB 2R23B 1A25A 2VT0A 3LRLA 3RWHA 1W9XA 5E51A 1UA3A 5SX5H 4PVNA 1U3JA 1C12A 3O3DB 1MG2C 1XAKA 4XPTH 4Z95L 2X0WA 4WW1A 1ZWIA 3X14B 5HVFB 4L8CB 1S9VA 4GI9A 5KOMC 2NY4D 1GCFA 4JR9L 1OARH 1A7PH 4TPRL 2F58H 3TA4D 1UATA 2XZCH 3NJMA 4PJ5D 3U9UA 4Y9EA 5AYUL 3QRGL 3NFSH 2O5ZH 1E4HA 4MWFB 3TXAA 4CU6A 1NPNA 4JJ5A 3BYYA 4L05A 2HFGL 5E70A 3A6CL 3S48A 1ORQB 1JV5B 1JHLH 1FE8H 1NCDL 3ULVE 2MQ3A 3TNMA 3S88H 4KZDL 2MTAA 5ICZA 4XNQB 1DBBH 1MEXL 3OLIA 4YSRA 1O9WA 2WV3A 5IHZA 5GJSH 1KB5H 2P8PA 1I1RA 3WN5C 3T0WA 3B2XA 5JQ6H 1IEBA 3QEQB 4HBCH 1TENA 1SEQH 1KBWA 2AK4D 3FQUA 5A2BA 2Z1KA 3DUUA 1OAUL 1WGVA 3PG2A 3QI9A 3L3HB 1WJ3A 5DD3L 4JZNB 3ZSTA 3NRQA 5GIRB 3L7EB 4YDLB 3VJ6A 5TF1H 4FEMA 3R0MA 4HW6A 1RVFH 4ZO7A 3IMSA 2UVFA 4NZTL 4F7MA 5IP4A 1BJMA 3V4VH 2NY1B 5FGCB 4PRAB 4BFOA 4L3CA 4QO1A 2H1PL 2IQAB 4N4YB 1MCCA 2EZ0D 3J07A 5SX4I 4E41A 2CCVA 5J13B 2TSAA 1U8OA 3QP3A 3US1A 4P9HH 2FQFA 4PJDF 3JBG7 3UAJD 3VFRB 1N0XH 3KGRA 4HCRA 2WWMD 3QULA 1WAPA 4J6IA 4LIQE 1SBBA 2N1KA 5TQ2H 1N5YH 1A1NB 1A9BA 4HKXB 4FG6C 3WTWA 1U8MA 1UM5L 2IXQA 5C08E 3UL4A 2ADGA 4AV0A 4GYBA 4LPWA 2VMDA 5EZLB 4ZAKB 5FYLD 1WFTA 1FNGA 1PQZB 2XTJD 1YJDL 4F3FA 2HPTA 4L1HA 1CLCA 4BH7A 4LP5A 5IREA 4TUJA 1T1YA 3CFUA 4MDJA 9PCYA 2XQYA 4KNTA 3SD2A 2I85A 1GAFL 3SGJA 3CFQA 4N0YL 3K5RA 1OSPH 3RPBA 3BRGC 3JT0A 3ZJAA 4GO9A 5GZOD 1KF9B 4ODVL 1AGDA 3ARDC 4WI3A 4GXVL 3PY9A 4CSPA 1I1AA 5JW4M 1RU9L 2EIJB 2VLRB 2VOTA 2DQMA 4WUKL 1HCFX 4I2XA 3L7FA 3HG1D 5EEXA 1U42A 3L2LA 2X87A 4URTB 3TT1H 5HGGS 3GMQA 5J57B 2VAJA 4JKKA 1I1FA 2OULB 3I85A 2DMHA 5F7NC 1IC7L 5IMMA 3I9IA 1F41A 4PRDA 2V7NA 4N1CA 2XA8H 2ZX5A 4HF5H 5IW1A 1XV8A 5DJZB 1JMXA 2R2EA 4H8WL 3FUJA 2HCZX 1WCBA 3E80A 4KGJA 1BIIB 3RYMA 1U2CA 2QVTA 3LNFA 4GIAA 4JFFD 1R3JA 4ZW8A 2DQIL 1ZRUA 4XP6H 4PGEB 1J9TA 3PXLA 2Y7LA 4QNPE 3KGUA 5SV3A 4YHIA 3Q6FB 3RGVB 1HNGA 1UFUA 3H54A 3U7WL 2OYKA 4AJVA 2JJTA 1NIDA 3QJZA 1GRWA 4OIFA 2V7HB 4IDJH 2Z31D 3IDMA 1AHKA 1GYAA 4KXZI 4HJTA 2N7BA 5T3ZD 5J9PB 4G7RB 5HTSA 4F5CA 3VGEA 4NQXB 1F4YH 4N0UB 5ID1B 1G7IA 2XX1A 4AYSA 1IAIH 4PUBH 5IVNA 2B14A 5DD5L 1KTDB 4HOMA 2XETA 3DSNA 1NEZA 3HN3A 2YFOA 3SDXF 4Z8FH 4JANB 1ADQL 1NKRA 1ZTMA 2OQJA 2P5PA 3QUXA 1JZ6A 2PTUA 3JT2A 3L6FA 3QZOA 4P46A 4PYHA 4LMQI 1E40A 1PX4A 1K8IB 3PYCA 4KK5D 1NCAL 4YDJB 4R4BB 3IGAA 1CFTB 3B7TA 2ZUSA 3HRZC 2BNUB 3L3GA 5HYIA 3PCYA 4XXCC 3WG7B 4PJAA 5EZJA 2W9DH 1AO7D 1YY8B 1G6VK 1W6WA 2NY2D 1KV7A 1NAKL 3GPSA 3C8KB 2OCJA 1T1WB 3CMOL 5IB4A 7PAZA 3CFEB 4XBGA 2YD1A 3VH8A 1GYWA 3EJJX 3KVPA 3UP6A 5CD5D 4I1PA 3H7BB 1QSFB 1ZKAA 2NUTB 1CFBA 4JFZL 4FABL 2YXMA 3KPRD 1I7RB 3GM8A 5DO2C 3CSBA 1QBAA 1VKXB 2JXMA 4N3UA 3MJWA 1R3IH 2CE6A 4CNIB 3F12B 3T2OA 1VJSA 2UUDH 3OKOA 5FGSA 1U41A 3A0OA 3CG8A 3PNWB 3BD5A 3QG7H 2X53A 3QAQA 3II1A 1J0KA 5GGQH 2DWYA 4KI1A 3ZKNC 4I89A 3BZEB 4LQFL 2K78A 1LEIA 1F45A 2MRYA 5F7BA 1BD2A 2Y5TA 1E5AA 4NZDA 4WUUD 5LXGH 3IJ7A 3H2PA 3HS9A 1AR1C 4OLZL 1RZPA 3MCLL 5IY5B 2Q86B 3HC4L 5DHDA 3OKLB 3VXNB 5AD0A 3RIFK 1KYUA 3B9EA 4JPWH 1KLGA 2WN3A 2EIZA 1LP9F 3N41B 3MBWB 5ALBL 5DEGB 1U8LB 4DFIA 2B1AL 2F19H 2R9HC 3V6OC 4JM4H 2ZOTA 3HJ0A 4N2LA 1ND0A 4KY2A 1E6OH 5A16B 4WAFA 3LB6D 4IGBB 4N0FA 1N59A 2X4PB 4QRQA 4L4JA 1WFJA 4G8GA 3M88A 4KXZH 3G5YA 4J3OH 1IC5H 2DN7A 3K6DA 4YFLF 2IBBA 5C0BA 5E8PA 1QNIA 4PJFE 2A6JA 2XG5B 3QDME 4TLUA 1CFQA 3IDXL 3NP4A 4I48A 3TBSA 5AUMB 1YEGH 4JO1L 4POZC 3TBYB 1GGIL 1CGSL 4Q4IA 4ZXBC 1MFVA 2YGNA 1QSVA 3UFIA 2YD5A 4KJQC 2EH7H 2QV2A 1H5BC 2HA1A 2IMMA 3FFCB 4UOW1 5I66A 3CFKB 5IBLC 1QLEB 2MMXA 2FYYA 3LXCA 3QFGA 5AVVB 4Z7WE 2BVQB 2YAHA 3D7PA 5HJ3B 5IEHA 4ZK8A 4QRAA 4O5LH 2XIIA 4J4PC 2VN4A 4WCYH 1OCZB 1G6RH 1VGEH 1GGUA 1OGTB 1VPOL 1QLRB 1LMKA 2EEDA 3IDNA 1T5XA 3IMTA 4OLVH 4QRRB 4P2OB 4NM4H 4OM1H 5D7IB 3SBRA 4I8DA 1M2OA 3D39D 2VZUA 5IJVB 5KVEL 4HWBA 2KKQA 5E9AA 1E9PB 2CCLA 2EYTB 3C08L 4YSPA 2KT6A 1HSAB 1JZDC 1KPVB 1KTBA 3ABKB 1RZFL 4Z7UE 1AQKH 3V0EA 3PABB 3VCLB 1KIPB 4L4VA 2F9BT 3RA7L 3BQUB 2ZF8A 4DCQB 4OZ4A 4N22A 4I85A 2C5DC 3KPSB 3CD4A 4FX5A 1BPVA 2WGNB 4WEBL 1W0WB 5GGVH 1VFOA 4ZNCD 2JTYA 2YBGA 43C9A 2VXTL 3QHZH 4HUWB 5D7SH 4LFHD 1H15B 5E8DH 3GC3A 1JNNL 3R0NA 3RDTB 3FH7A 4F7EB 5AWNH 4EI5A 1SZNA 3UBXG 4PGDB 3S3DB 4N86A 3U36B 5AB9A 3PHQA 5FW7A 2AK1H 3NZ8A 4S10A 1JGEA 5H2BB 3BH9A 5SWSA 1JGLL 2KPWA 3L13A 5IFJA 5HVHC 2OMWB 4KQ3H 3IXAA 3FQ2A 1A4KB 3JYBA 4F15B 4I5BA 3O2VH 4EBQH 3BPOC 4B9ZA 1QWNA 5C0RH 1WD8A 2LLNA 3P73A 3QUZC 2OZ4A 2BSED 4RLDA 2IAMC 5JPMC 3V95A 1ORSA 2X2IA 1N7MH 3GXFA 4PIBA 5C7XL 5IB1A 5DTFB 5HBBA 4ALAH 4IRJD 3DUSB 5BRZD 3LJ3A 1HHHB 4JDVB 4CAGA 5FM5O 5JMRA 3K2KA 3GS4A 2V0AA 2JQMA 4OD2A 4NO0A 3WGVB 4GKSA 2P9RA 4EKXA 2GUOB 1HXMB 4ANWA 5DO8A 1F00I 3L3JB 1PZ5B 2OYPA 1CR9L 4KI5E 1QI3A 2HPOA 4GRLC 1FGNL 3QZWA 1ZE3C 2ZOKA 4G5AA 4RRPA 1AKPA 5T5FL 3K5SA 4MJ2A 5DQDL 5DZOA 1PLAA 1FVCB 3VFPA 4Y9CA 2VQTA 4P23B 2IDUA 3L4WA 2VJ0A 4N8UA 1A14L 3B9KA 32C2A 4XXDB 3CMGA 4N2OA 1MCJA 2BNRA 2VNCA 3MSPA 4OM0H 4Y4KD 3HZYA 1LL1A 2ZCHL 5CSGA 1H3GA 1F11B 3Q8BA 3C8DA 4Z18A 3V0VB 3T1WA 3C5ZB 4GXUN 1XF2B 1PY4A 4L8BA 5H94B 1OW0A 2GBAA 5IVXA 3U6RB 1OF0A 3N85H 2JKIS 5EBMA 4IBTA 3ZL4L 1I9JH 2R7EB 3LXUX 1DQLH 3TURA 1NFDA 4LLWA 2J44A 2FWSA 3BEWA 5AW9B 3V8CA 2JKTM 5E24E 1NBVH 3KBFA 1X9LA 5ENWB 2OL3H 3FCBA 3Q3GB 4NM8H 2DQHL 4B0MM 4YSQA 3S3CB 2XJKA 2A73A 5B39G 1F4WH 1FF5A 3N1PC 4KTYA 4U1SA 5DK3A 1FYTE 1IGFL 5D2LA 3RKDC 4KK6C 4J1UA 1OK0A 3DOIA 4JKPH 4UILL 3QVAA 5T1KA 4LCYA 3DC0A 3GKZA 3HNSL 1J1OH 3ARFA 5H4ZA 1MCFA 5DR5L 4B95C 3FTXA 3FO0H 2EIDA 4YHZH 5ID0B 1LE5B 2AI0L 5DUMH 5F21B 3DXAD 4QDGA 3K1KC 5ESQB 1D5MA 1KB9J 4F1SA 5TE4L 4IKKA 2FSDA 1KJVA 2ED6A 4EPSA 4ZTPL 1Z32X 3DJRA 1S7SB 1TZGH 2RFXA 3TV3L 5CLZA 1JHTB 4JMNA 4XVSL 5DMKB 4I1RA 3KYOB 1XX9C 1MIMH 2H6OA 3QFJB 1BVZA 4MCNA 5EU6A 3ZT6A 4GW5B 3FTGB 3S37L 4G1MB 3HG2A 3LKQA 3L17A 3MROA 2CKNA 4OZGB 4DPBX 5GS1A 2G3ZA 3IKCA 3D9AL 5JW3H 5F88A 5DHXB 2VZ1A 3CVIL 1RXLA 5A2LH 3Q2NA 6FABH 1MJJB 3AROA 4PJAF 5LAXB 2CHWA 4JQIH 4G6AD 1BQHG 2NYZA 5BV7C 3D87B 2BY1A 2HT3D 2FATL 1U8JB 2R39A 3JVGA 2HKFH 5INDA 3K4AA 4V1DB 4JVPA 5A2CA 4YPJA 5E6UB 2A6IA 3MV9D 4DOHB 4X4YB 2WUBH 1JZJA 2APSA 1PFCA 3KXFA 1LYQA 1MCQA 3F58L 3VI3B 1XGYL 1U3HB 3P3TA 4D0CB 3WHXA 2BHYA 4NPYB 4FQPA 4LLQA 4Y1AE 5E23A 2E5EA 3LZFL 1XXDC 5LGHH 3JUYA 1B3JA 3BT0A 5F2FA 2NNAA 2C7UA 2LLLA 5JDSA 1K6QH 3K71A 1KNOA 4LPXA 2UWEB 2DJSA 1NWPA 3U0WH 2GAZA 4HWBL 1N64L 3UYOD 5KVFE 1AGFB 1ZLUH 5LGKA 1AGCB 3QZLA 1OOAA 1I7ZB 1FO0H 5C71A 4PJHF 3TA3D 3DYPA 3MLXH 4FQIH 5ILTL 2VUOA 1CICA 4ZZKA 3QQ9C 4QUOA 3EJYD 1XH1A 5F1IB 2BOLA 3IS0X 4FFYA 3S2AA 4JK0D 3HB3D 2P5EA 1DVUA 1ZSHA 4HSAC 4NZRH 4WW2A 4NN7C 3V6ZB 5K5YA 4MASA 5E8NA 4BFJA 3BUIA 1A6WH 4K71B 2KI6A 5T5NF 3EGXA 2ZPKL 4PRHD 1XGRB 5AOLA 3O3BA 3GI9L 2HX8A 3UGEA 1D7FA 4GIPD 3ZHDA 4Z7IA 1ROCA 3ZTJG 3DHPA 1B0RA 5I5IA 5EB9A 4IW4C 3KDMA 4HKZB 3DJSA 2O72A 3RBSA 4PRIB 1X9UA 2NMSA 3K2UL 4JM2B 4Q4EA 1VFMA 1K4DA 4M7JH 4PJ8B 1PZ2A 4KUCF 5ANHA 3TJHC 3ZE1E 4BUGA 1E42A 4LDLB 5ABAA 1CYGA 2NY0D 4LVNB 3Q7JA 5JTWA 5EBWA 3OLDA 4L1SA 1NGPH 4AENA 2H1LM 2OZ4L 2DKUA 4BDVB 5EN2B 4K9EL 1S9WB 4ATWA 1KB5B 2XFGB 5FKAA 2JCWA 4J6RL 4L1LA 2D7QA 2YD4A 5E94B 3CIAA 2PR4L 4JG9A 4FLOA 2DQDL 2BNQD 5HHXL 3TT3L 4KJWD 5I18H 5IHLB 2XQBH 4OJCA 4Y2DB 3FXIC 4OJEH 4F7TB 1J8HA 3MMEB 3LV3B 1I1YA 3ZRFC 1D5RA 1JK9B 3UYRL 2BRRL 3ZYZA 3V4VB 3NOIA 1L7IL 1KIUB 4CC0A 3K0YA 4W6WB 1BAWA 2CRMA 3LZPA 3VG0L 3VX0A 2XZAL 4JPKL 3RVTC 2WGXA 1T03L 2IDFA 4Y19D 1WP6A 1AZUA 3LS5L 5HYJE 2FL5B 5D1QE 4FZEL 2NTFA 5T1DH 5CINL 5LNGA 2BS71 1FFNB 2XWZA 4H25A 1BLNA 3AG3B 4MNGE 1ZLVH 3GSQA 3IM1A 5ALCL 5F96H 2CDFB 4HX1B 4U4BA 3HHMA 2EUWA 2WLYA 2VISB 2GCYB 4HIPA 2XA3A 4M6OH 2E6JA 4PG2A 3EZJB 1RUAH 1RSFA 2XPGA 4YDVB 1EJOL 1KBPA 2H4EA 5CF3A 2PW1B 2MPAH 2FT8A 1OGAA 2QL1A 3MLWH 3GRWH 4JHUA 5I5MA 1B90A 5E6IC 3WNMA 5FGBC 4YIQA 3WSQL 5DLMH 1R33A 4NPKA 4CVXA 2I7SA 4UOW0 5B22A 2HMIC 2HAZA 5K93A 4Y5XA 1AANA 2GT9B 3D4GA 3QXTA 1NMAH 1CGUA 1S46A 5C09B 3VXRD 3FK3A 3BE1L 4NAJA 1F6AB 4WNSA 3EGDB 4O00A 4MDRA 1NCCH 5D70H 3OKEA 4IRZA 4OF5A 4WO0A 2VN5A 3VGAB 2W65B 2DQCL 4U3HA 5BS0E 1F90H 2BK8A 3PHAA 1CD1B 2NCEA 3W9EA 3C9NB 4KWUA 3GLAA 2BZCA 2DPKA 4BUHA 1EAPA 3VXMB 1S78D 4PHXA 1UURA 3ARBA 3VFTB 1U0QA 4HC1A 4EZKA 4PRPA 3B9AA 3UO1L 1RUPH 1NCOA 2AGJL 2Z35A 3CZUB 3LMJH 4JPVL 4KO6A 5I0VA 3UBGA 2N01B 1XMWA 4G71B 1HE7A 5ICXB 3RLSA 4RSYA 3R1GH 4NUPA 2Z3FA 4XPGL 3L2NA 4AT6B 4E2OA 4ONFL 1A2YB 3MTRA 1YEWA 3GHBL 1LO3H 1GC1C 3V0WH 4G8EB 3QXDB 1ZHNA 5ICYA 3W0WB 3FDWA 4Q89A 1VHPA 4GAYB 3B6SB 3FSAA 4LSPL 3FJTA 1Q94B 2BVPB 3TH4T 2EQDA 3EGSA 3WIIL 1BZ8A 3CN2A 4WQOA 3I6GA 4I0PA 4M5SA 2PLTA 4TV3A 4JHAL 1CLVA 2FO8A 3NIGF 4HBQA 1PLCA 5C6TL 1IAMA 4CL7A 3SGEI 3QORC 5DJDA 2PXYD 1E27B 3TFBA 2BHFA 4GFXA 1GS8A 5D7LB 4A7QA 4CJ1A 1QZNA 4HXBL 3EAKA 4JZOB 4MLSA 4XH2B 2A6DA 1F58H 5KANG 3UBFA 2OI9B 3AU1A 3NCFB 3WFEL 7FABH 2AKRB 1ED3A 4LHUA 1SOQA 1JPST 2CBMA 1FIGH 4YQXL 4TS6A 2JJUA 4EJ1C 1CGVA 1K8DA 5CLWA 1VAHA 3D08A 4EVNB 5ABZA 1CDYA 1FG2A 1G1KA 2EKSA 4O2CB 3VQ2C 1U8KB 1MNUH 4MNQD 2BXYA 3VFWA 3DRQB 2VWEC 1ZDSA 4KDTA 4CVUA 3IN2A 1IX2A 1Q9WA 3FN0H 2OMUA 5LQBH 4XX1G 4XVOA 3NJLA 4YVUA 3WXVH 4AIEA 4JREB 1BVLA 4OV6F 3BPLB 1E3ZA 4G80A 5F89A 3U0PB 5HPMA 3BMVA 2ZUVA 4ZW6A 3QHTC 3VMPA 5D2LF 4GRWF 5I1AA 1BAGA 5LNDA 1WUZA 3MGTA 4MHHG 1H3TA 4OD1H 5EO1B 5CZXC 4K5MA 3WUWG 1ONQA 4GQZA 2QGCA 2C7FA 3Q8AA 3PPSA 1TETL 3KEDA 4HS3A 3FT2A 3KLQA 1HHIA 1ZGLP 4PJCB 2WBJC 2EYRA 4HEPA 1HL9A 4K8RD 1S3KH 2C3GA 3QQ3B 4DN4L 4UV4H 3BEVA 4FP8L 2A7BA 4FFYL 3UJJL 7TAAA 5C0AE 5FUOL 1QFPA 3LEVL 3REVA 1MRFL 2IAAC 1TU2A 2AJUL 1PYWB 1Z9MA 4WI8A 3FQRB 3MN8A 3VWJA 2H6UA 2VDPB 2PCPA 5F1KC 1ZGLB 5F7LB 1U3YA 4P5TD 4RFOL 2NQDA 4R90H 4Z77A 1OSYA 5I9QC 2VB5A 4EI6B 1HZHL 1BJ8A 5BCAA 2VZTA 4NHUB 1U95A 2PTVA 4YE0A 5I8KL 1JWSA 2F8OA 4AVHA 4PSPA 1F1GA 4D8OA 3ESPA 5AAPA 5JXEA 4GP4B 4ONGL 1BQKA 3R19A 3NG5A 1UM4H 4GSUA 3IMVA 1DVFC 4DERA 2V8MA 2YUZA 3VXOA 3KPMB 1EGJH 1XF4A 4MD0B 2LU5A 3TO4B 1JYVA 3SE4C 2ROYA 3TZVD 1KB9K 1R3HA 2ZX9A 3QIUB 1MAML 2K9UA 4DVRH 5FHAH 3ULVH 1PEWA 3MACL 4XCNA 2CMRH 3OG6B 1EAQA 1MF2H 3HLAB 2YA1A 2D31A 1M1XB 2YSSB 2B59B 3CSGA 4QF1B 3ECUA 4JFEE 2VDRL 4R3SB 5DMYA 5E2WH 1UUNA 1WFNA 1DSYA 3INUL 5DDHB 1BQLH 3S36X 2B20A 4ZMYA 4J3VA 4ONHB 3ZN6A 5I76B 2W88A 3RUGA 3WOVA 2YGQA 3TU6A 3P3YA 4MJIE 1T2XA 1ZV5A 2VXSH 2ZG2A 1G6RB 4QTIL 4JO3L 5CGTA 1KPUA 3ZU8A 4CW1B 4OCWH 3DX3A 3FSZA 3W2DL 3RVUC 8FABB 4ODHH 1YMMD 4WV1A 3CXHJ 4WW2F 3GJFH 2C3VA 1Z5LB 4ZUSB 4X7EC 4YHKH 1HZKA 3AFLA 2H2PD 4DZBA 1DJHA 5F7HA 1KB3A 1CE1H 4X9IA 4FNLL 1KG0A 2ZXQA 3BKYH 2FD6H 4G7VL 4RWHA 4HJGA 4W93A 1RJYA 3D4YA 2GQHA 2GVYA 2JLPA 5CJOL 1KFAH 5TE6L 4KZEH 1M56B 2O6DA 4AYEC 2I9LA 3COOA 3A4FA 1C16A 1HQRA 2YAEA 4FA7B 2FB4L 1S7XA 4K5LA 3NACH 1U92B 1LILA 2H41A 2QHRL 4TQ8A 5DI8B 1U6AH 2NTSP 3B2VL 5IJDC 2PWDA 3R7QA 4JW3A 4P48A 2F54E 2EH8L 4IRZL 5FF6A 1JWUA 3EDFA 2HKAA 1JZFA 5JXAH 3EH1A 2ZCZA 4HIJB 4AC2A 4YXKH 4ZZFA 2R2HB 3GM0A 2NYKA 5FUZH 5HGDA 4X7TA 4O58L 1EX0A 2X6AA 4DGIL 2F5BL 3GZKA 5LHDA 4HC1L 2RAMA 4UT6L 5L2KA 4TQIA 3UTTA 1E3XA 1Q0YL 1I7TB 1ZA6A 3VD9A 4OLWL 5JOFA 4PLJC 3H0TA 4WFHD 3RHWK 3IDUA 1USQA 2NCMA 3WE6B 3LKRB 4ZX5A 3FFDA 4KRPD 3FUKA 2E27L 4M7ZC 4PLKD 3ZKXB 2J71A 4WSGA 3LKNA 1HAUA 2YSTA 4ZFOA 2CGYA 4OCLC 2QQNL 4RDBA 1IGTA 1T89A 4L4TE 4WGKA 4AQ1B 4QJ3B 5EIQA 3AC0A 1W8OA 1F86A 1GKOA 5IMOB 2WXOA 1E4KA 1Q1PA 1UZ6F 2D4FA 4K7PX 5JW4Q 5MEQA 4DN3L 5LGJA 5FK9B 3L1OL 2CKBH 2Q3AA 3V6OE 2XZQL 5E8OB 1MRCH 2AEQL 1R3LA 2UV3A 5DFVD 3H9HB 5KSBE 2VLJE 4PJ9D 3CC5A 3PWLA 2P48B 3KW8A 5I6KA 1RUML 5KVGE 4AW4A 2XN9A 2K8MA 2OSLA 3DVFA 3FB5B 3WEBA 3O9WD 4FEIA 3TN0A 4Y4FA 4Q9RL 1WZKA 2SEBB 3LS4L 1ZLUK 5DJ6B 3GLDA 4UDUA 3AB0C 4FMKA 5ELIA 4GG6E 3QNYA 1EEQA 3NIDF 5CGYC 4KTEL 3MUGA 3WJLA 5F44A 1OCRB 3S34H 1I8KB 4GI6A 4FLRA 1HXYB 3B7RL 3VQMA 1A7QL 5B1BB 1ZY9A 4YWGL 2OMZA 1MREL 1MHHA 5E2VH 2VH5H 3GINA 4BFIB 4K94L 2NZ9C 5KBLA 4BQCA 2O61B 1AD9A 4HDIB 4KRMB 3QWOB 4IHOB 2QADC 2X10A 4JY5L 4NQSB 4PW3A 4Y16A 1UM6H 4H88L 1QQDB 5C0DB 3FQNB 4RGNC 2OS7A 3CSYB 5J7CC 3CK0L 1GY2A 1AHWC 3GZPA 2EDNA 1UH4A 4FHBD 3TVMB 1NC2A 4C58B 2ZD0A 2JKWA 1C5DB 4DKTA 1ASOA 4HWZB 4JCMA 2HTLD 3Q5YA 4YGVB 2BCKA 4W4OA 2GSGA 5K9QG 1F8TL 3QI9C 4UZGA 4LSVL 2F1AA 3HE7A 2HJLB 1U8CA 2N4IA 2PUQT 2X2JA 2DTML 5I26A 2NW3A 2R29H 5AG8A 5ADPH 1KELH 4YR6A 5BXFB 3IAPA 1YECH 3MA9L 4OT1H 4YX2H 1KFGA 3RRQA 1CPUA 1KEML 4FERA 2F5AL 5HHQA 2QSCH 4EDWH 1BPLB 1YEEL 5HVWA 4Q0XH 3IK2A 1JTOA 5DMIL 4IKJA 2VXVH 3DOSB 2VSMB 2OR9L 2VJ8A 1KTJA 3O8XD 3Q8FA 5B4MD 2YD2A 3VTTA 3LN4B 5J1AB 2F8VA 3PL6A 4UDTA 5E5MA 5EZIH 3Q0HA 1XCQA 1FLTX 5IQLA 1O6SA 1BOGB 2ZOOA 3EYFA 5EU4A 4JUTA 5IHUL 4NGHH 3N1QC 3VI4B 5ETUA 3SDDD 2FLMA 4NWUL 2UY6B 2EXSA 1GMEA 4NHCH 3RGHA 1MZZA 4XE5B 1LD9B 3CFCL 1QTPA 2B08A 5G5DB 5JUEH 4JKMA 3SGJC 2LE9A 4EN3C 2FEDC 4XMTA 4KKCC 2G2NA 1KWKA 3ECWA 1LO5B 3N6YA 3TCLB 4JRWA 4KKQA 2B9BA 4G9FA 3T2NL 4PJBB 3HIZA 4P2RA 4R7NB 1CDCA 4IK7A 3DKHA 2BP0B 1YVLA 3GSXB 1HEZB 1AQDB 3CFJB 1F42A 4HSCX 4G1EA 3VU2A 5DVKA 3C8HA 1JRHH 5L9DL 4ZMVA 1EBAA 3OB8A 2KLTA 1VERA 4Q56A 1FO0B 3DMMD 1JHKL 2OP4H 2NR6C 3N91A 2MWCA 1KPRB 4OFVA 1GY1A 3BC9A 3F05A 1VEPA 4JRYB 1Q9OB 3KCPB 4M8RA 1YEFL 1D6EB 4Y1SA 1LLAA 2Z92A 4Z7NB 5CZVL 5C2BL 4C4KT 1DANU 3KS0H 5I17B 1DQML 1PZ3A 3M7OA 1MVFA 3LQZB 5D7JB 4BYHA 3VMOA 2HJKB 2TAAA 1Z9NA 3P0VL 4Q58C 1QI4A 2VE6A 3GK8L 3M7FB 4GBXA 4KH9A 4FL4C 1IEAA 3ULVD 5F3HB 1KC5H 2CK0H 4PJEB 4WJ5B 2COQA 2ATPB 4NQDA 3B2UD 1NAMA 4WWNA 3RGVD 1RZKL 1CD8A 4LCIH 3W11D 4P2QB 3MV8A 4UQ2A 1BXAA 1TXKA 3ILEA 1GIGL 1D9KB 1Y0LB 3WS6C 1FQ9C 5E9DA 2ZF9A 2H7WA 3MBXH 2ESVB 1HIML 2YEZA 3FW6A 4N25A 4OGQC 4KJYA 5D1XC 2GSMB 5EFIA 1XBRA 3QDGA 2YD0A 3A67L 4WSJA 3AVEA 1XGTB 2IPTL 1CGWA 3MNVA 4F37F 3EHBD 4OI8A 3CBKB 4OZHA 2R1WA 4Y4HD 5CP7B 1XIWC 4L1TA 4C83A 2W92A 3JWNH 3QXWA 5HY9A 3SE3A 4HETA 4L0PB 3W82A 1RHHA 3DRTB 4P04A 2WINA 4KDVA 3RURA 2E4TA 5DMJB 5DS8B 4L9LB 2XWJA 4AH2B 3D2UA 5EOCH 5ISZE 2ZX6A 2BSRA 2DLTA 1IAOB 1CLOL 5I6XC 2DI7A 3RZCC 4FFVD 4XMXA 5DEJA 3MOBL 3WMPA 1S7UA 5C08D 4LGPB 5KYNA 5E00A 3TYGL 2H5UA 1TF4A 1FHGA 4X6BB 3UZVB 2FT6A 4HV8A 4PWJA 3ZTCC 4FTVE 1WBXB 1DJYA 3QFDB 2B2XH 5D2NB 2DQTH 2CR0A 5I8CB 3VVVA 4W1TA 3VRIA 1WBZA 1UJ3B 4H7VA 2FEEI 2EYSB 5E5LA 2Y2WA 1I3RB 4GS7C 1GA2A 4BCZA 5HHVH 2XQYG 1T22A 2VL5B 4HWNA 3NH7L 5I1LB 4YS4A 4NBYB 4JY6B 4ZRGA 2QZ5A 3HPLB 2OR8A 4U3CA 1G1CA 1GKEA 4JG0H 1XSOA 3WD5H 4M48H 4B97A 4H8HA 1AQMA 1CK0H 4FQXA 3KEHA 5B1KA 1JWMA 4OCMC 1A3ZA 3PWUB 2VDQH 2J4WL 4HAGA 1IGJB 2WXIA 3FU5A 3TEWA 1YEDB 1OAXH 1UWYA 3DOHA 4NC2B 3F6IA 2PO6B 4Y5VB 3EDJA 5DUBB 1N67A 3H2QA 4PJ7F 4NO3A 4N2FA 1K5NA 4TQEL 4NUJB 1S8DA 1A7RL 1P5UA 1UWGL 2QLVB 3UZQA 2FX8H 5LG6A 1PKQA 3W56A 1MZYA 2R56L 3I75A 1MHPH 3UTQA 3VFSB 3C5SB 3P0GB 5HJDA 1QD0A 4XXWA 1KTRL 4X4XA 2P5WE 3QJQB 3C87A 2CPUA 5EBGA 3UBHA 5I1KH 3CFIC 3E1F1 2MCMA 2D73A 3IS1X 5BQDA 1I31A 4N0RA 1G7HA 2JELL 4M1GL 5GRJH 2FE0A 5IB2A 4YXLL 4G3YH 3A6BL 1QX1A 1XGQB 3AMKA 3L3KB 2LW3A 4RQQA 4WI5A 4CMHC 4L8DB 4U1NB 4WTZA 4MA7H 1X44A 4KHXH 2LHAA 3GMLB 1AGBB 3GXTA 5D1ZB 4MQ7A 3L3IB 2JCCB 4KKBC 1IGIL 1E3FA 2GK0A 4XNBA 4LSRL 3QUYC 2Z7YA 4HMDA 3E8VA 4JFQA 4R7LA 4WWKA 4RFNB 5CLXA 2BIQA 3VX1A 3D6GA 2WXPA 3EO0A 3SKMB 2F53A 1NEZG 2HUEA 2JJSA 3FUMA 2XNAA 3MRJB 2CHDA 5LBGA 3QPXH 2Y36L 1NKOA 3UTSB 1UVQB 1P7QB 4ZUUA 3ULUC 2B4CL 1L9MA 1RZJL 1NGWA 3VTMA 4HCIA 4UM9D 1XB8A 2VC2B 2VW7A 1FGVH 1UEMA 3GJFK 3KPOB 4BV1A 5IB5A 3EYSL 4G6FB 3ORJA 2HN7B 4NKDA 1V27A 4JDEA 3UMTA 4BSWA 2OJZL 2R2BA 4APXB 1BBDH 3IU4L 1VEOA 1VSCA 1MW3A 2WQVA 1MVUB 4H8QA 2XJLA 4EDXA 1C1EL 5BRPA 3VSTA 2YRZA 1TQTA 4PCTA 1KLUB 3ZDYE 1J8KA 1RHFA 2KBGA 4QOKE 4U1MB 4F8LA 4HCRH 1RLWA 3WDJA 1BVKB 1SLWA 3JV4B 4DK3A 4W9ZA 4Z7VA 4ZO6A 1WAAE 4U1HA 3N3EA 1JPFA 4EAEA 2KZWA 2X6VA 2PYEE 1G43A 1XH2A 1GZQA 2DQJL 2ZXEB 3IXTB 4JQXA 4YHPB 3SY6A 2DLHA 4XX1E 4BZ2A 1N6QL 4MD4B 2K0RA 1FFPB 3BP7B 2AABL 2ZXCA 3O3AB 1SUHA 2FJFB 2N3JA 2YLKA 3OHMB 1ESOA 1G7QB 3HE6A 4K9EC 1YDPA 3REWB 3SDCC 2GBTA 1E8ZA 1KDJA 2UZYA 3W57A 5KJ7E 1A1OA 5HGBA 4PR5A 1DJZA 1T0MB 1NIBA 3DX6A 4UT7L 4GQQA 3CC1A 3DGDA 2J2ZA 3GJEA 2JB5L 3RTQC 3MRKA 1EHXA 1PL3A 5D7KE 3OHXA 4FS0A 1A3RH 4OU3A 5IG7A 2ZWZA 4N2NA 1ZA3B 4NIYE 3BP6A 5AW3B 5B38A 2X6CA 2D03H 1A4JA 2YWYA 2DQUL 1NAML 4KJPC 3QDMD 5JPNC 4KX9A 4R2GD 4WI7A 3U30C 1TQCB 3NZHL 3VD1A 1P6AB 5EEWA 5FCSH 1I4FB 3RWEA 3MYZA 3TM6A 5DD0L 4GKLA 3ZT7A 1JVOA 1L6PA 4LEEA 1QO3B 5KSAD 3QWQB 4YE4H 1UT9A 3G5VB 3BX7C 3G6DH 4QRUB 3RNKA 1E43A 2IANE 3MXVL 4MXQD 3F7KA 1KCBA 1MJ8H 5G4NA 3WLWC 2WXMA 1ZV2A 1JNLL 2CDEA 4UTAA 2UZXB 1RIUL 5ESAA 1CURA 3WJMB 3IT8D 3B3IA 4XVUD 1WV7T 2Z7UA 5BVPH 2X9WA 3THML 1BZDA 1MFBH 3PUUA 1VACB 2EEFA 2VQUA 4QD2E 2DQEH 1VIWA 5LWYH 2EEXA 2FHBA 2X4UB 4CSTA 5IBTL 3AG2B 2WKOA 3LRKA 1DDHA 3I50H 3L7EA 2VITB 2JNZA 1GHFH 4IBLT 4MD5B 1ZSDA 2FVNA 5I8EB 4XBPA 3NEOA 1YYMH 2I60L 3MLVH 4X4MA 4PB9H 1T7XA 1KYOJ 3MO1A 3WKMH 5MP6H 1EA9C 4DEUA 3WIHA 5L7XL 3TEZA 3LRMA 4HIXL 3ZHKA 5HPOA 3GJFB 5KZCD 2DJ4A 2VDOL 1JE6A 3MRQB 3QZBA 5C0NC 1PSKH 4R96B 4LKCB 2WAHA 3DVNA 1YAZA 3UYPA 3G7TA 3F6LA 1HT6A 1OHZA 3SN6N 2X4SB 3APFA 4NQCA 3NPSB 5BZWA 5E4IA 5EZLA 4ZAKA 2GJ6A 3VFUB 4XVJL 1UWEH 2G5BA 3JV5A 3MOAH 4M9PA 4PJDE 3OR7A 2GSIA 3UJTH 1OCWH 4MRCA 2DQGH 2PP9A 4DKEL 5HYSG 2VN7A 3HTLX 4FGMA 4GB9A 5EZPA 3HC3L 4UIMB 3RL1B 1SBSH 3O6ML 3WV0A 3FB7A 5I71B 2VWEE 2Q0ZX 1T0NB 5CIPH 3WU1A 5K1NA 1YUHA 2IH1B 1FVDA 3HKZA 3T3PB 2A9CA 3UPCA 3HCVA 4CUCA 4QRPE 2KLSA 1ZS8B 1EFXA 3B56A 1L5GA 4D9LH 5KVDL 5CCKH 1Y1UA 3CE1A 4HS8L 3CLFH 3KJ4B 2X70B 3IF1B 4HQQH 4YK4C 1WDAA 1FRGL 2UXFA 3LRHA 2JKXA 3ATFA 4Q52A 4ZOAA 5DRXB 1VCBC 1S9XA 3FF8A 3GBML 1VADB 1ZLSH 4NKIH 1NC4B 2H32H 4OLYL 3KLDA 3KYNB 4GO6B 2R69L 3F00A 3S8GB 1OAKH 3K80A 2ROXA 4ODUB 3VWKC 4KI5D 4JG1L 4MNHA 1CU4H 4ZYKB 3WTUA 3PQYB 3ZYOA 5ECGA 3MLZH 2DH2A 5EF0A 5CR1A 4KKLD 4N28A 3OAYK 2OXGA 1TZAA 3PAYA 3GI8L 4HJJH 4QRBA 3MV7B 5LDSA 4G7YL 4BQ6A 2CKBB 3HUJA 2PABA 3OPZL 3BN3B 4K07A 3ZYJA 12E8L 2DIJA 4GLRI 4XMWA 1S3RA 2VDKL 2E46A 5DXWA 1RIHH 4GAAA 4ZUWA 4X7FC 4YNYA 5EEYA 5J9PA 1DBMH 3WY3A 3HZVA 2CR6A 1YAIA 3X3GL 4Z78B 2XXCB 5IQ7L 4ZUVA 3BHBB 4IIQA 3VFMB 4OKVA 3KM1A 4W9CC 1MRDL 3D4CA 5J1SC 4NUMA 4UTBH 2OPCA 4ZBJA 1LK3H 1KBKA 4N87A 1FZOA 4LL1A 1J87A 3KPLA 4CGUB 1ET8A 3FU9A 4K5NA 2FWUA 3LD8C 1JMZA 2WVTA 4ZMWA 4L3ED 3SJVE 3BW9B 4OLXL 5F9OL 1MFDH 2W9EH 1ITCA 1JDDA 4F8PA 2Y1ZA 2YD9A 5GGSA 1BFVH 2YGOA 3MREA 4APQB 3NEXA 1T83C 5IW3A 3H2WA 2DLFL 3IU3A 4LKXA 2FSEA 2PCFB 5M95B 4IRSA 5K9KB 5EEZA 2E6QA 5JW5A 4E42A 3T2QA 1FYTD 2GHWB 1J5DA 3WDIA 2NUTA 2I9TA 5FO7A 3FU7A 3Q1SL 4BZ2L 1DQDH 2FUTA 1UB5A 1XB6A 3T0EC 4OJFL 3SE9L 5KS9F 2X4NA 2QGDA 1RK7A 1Z0MA 3NGBB 1BYPA 4PWKA 5FO9A 1A6AB 4LSUL 5SWZA 5B8CB 4XPBH 4F57L 4XNYL 1K3IA 2ZYHA 2E8YA 3OD3A 3TJEL 3MBED 5T1MB 3QJTB 4FXLA 2C3WA 1CBVL 3O4OB 1EVUA 1QSEE 3CUPB 4EUPB 4DP4X 3R06B 3HNVH 1ZHKA 5ITBL 4XRCB 3LPPA 1M05A 1G87A 2C1PA 3AS3A 3E8UH 5I1HL 1LK2B 4NKOA 1NLBL 4BGLA 5E2UH 3SCMC 1MFCL 2JVUA 1S5IL 3GSOB 3P4OA 3L3OC 1BMZA 1U91B 2OTUB 4FG0A 3MV11 2W07B 3TWYA 1UC6A 3P40A 3IWUA 3FKUS 3WEMA 3MCKA 3G6JB 4LL9A 1EHLL 3BDYH 1XTMA 3NAAL 4G42A 4N0CD 4Q8BA 3FCGA 3U0TB 3MFFA 1BQRA 2W0KA 1RZ7L 2DTSA 1FZJB 5HHME 2LAGB 4JB9L 4BUQA 2CJUH 3QXAB 4OGZA 5E8EB 4B5EA 5I1CL 4E0RB 1MIEH 1FH5H 1NCTA 4A7GA 1XGPA 4PG2C 2XG5A 2ZOUA 3DDGA 3M07A 2NSMA 3VXUE 1LE9A 3L4CA 1C08A 5I6NA 2IDQA 1OF2A 2KL6A 5F97E 4Y1AD 1SY6L 2FX7L 3C6SB 4ENZA 3L54A 2NXZD 1Z9SB 3X13B 5AW0B 3OG4B 3V0AC 1NJ9B 2CBTA 1OE1A 5JIQA 3F65A 4WO4C 2ORBL 3RI5F 4CKQA 3DVGB 1F3DH 4DPRA 4U6TA 4FQHA 1ECYA 1I8LA 1KIRB 3WO3B 4F2MB 4F91B 1ACYL 1CZ8H 2DV6A 5CS7A 2B5IC 4Y5YB 4AI7A 3QHFH 4UQIM 2J6WA 2AK4A 3CVHH 4Y2OB 4GQ9H 5C07E 3VGDA 4X98B 2DICA 4X7SH 4Y1TA 1R6VA 2D7TH 5AZ2L 2FWOA 3SBWC 2I25N 3FUNA 5I74C 1X4XA 4XC3L 1AQ8A 1PD0A 4OGXH 4GSRA 1HSAA 5F7DB 2DQFA 2QT6A 3AW5A 4R83A 5I0YA 4MSWA 2P28B 4U0RB 5GHWH 1WBYB 3AS0A 2WQAA 3LNIA 5C97A 1Q72H 1ACZA 1E28B 4YHMH 4IKLA 2GI0A 3KPSA 4B41A 2A6KB 3OSKA 2Q2EB 2ZUYA 5IJKA 1W0WA 2JQZA 3M17A 5HD8C 2DYPD 4XZ4A 5GGSY 3UAJA 1W72H 2NY5L 2CR3A 4OSUH 1XSJA 1DQJB 4XPFL 5GS0D 1RKRA 2CH8A 3SDYL 3I74A 1G9NC 1N8ZB 3PGDA 5L4IA 2XCMC 2VRKA 2PR9A 4F7PB 3BUYB 2CO6B 1VFUA 5IROD 5AVTB 2A3TA 3GRBA 4EOWL 2EVGA 1YNLH 1HJCA 1N4XL 1OPOA 3DI2B 4NN5B 1EO8H 5HHOD 2FCBA 1OP3K 1KDIA 2A74B 4LEOB 3N04A 2MQCA 1YUKB 4AITA 1P4IL 3NSXA 5AL0A 5HI3D 3HAEB 2WKOF 1J1XH 4TTDC 5GZOA 1EPFA 4ICWA 4RGNE 2YPLE 3BVVA 4S2SB 5I1DB 4FXKC 2HLAB 3F5WA 2EADA 5DZNA 4JZJC 4LDCA 3HG1A 4JFWA 5BZDA 1PG7W 3ESMA 5DTFA 4IMLB 1PU0A 3NJKA 5HYJD 2ADIB 1AH1A 5D1QD 3KNBA 4D7PA 3LQAH 1QUNB 5CJXA 3D18A 4GKNA 4C56B 3KYKH 3GMPB 4MZ3A 3BAIA 2G2PA 2BFVH 1LP9B 4AE1A 2JI1A 4IS6B 3H3PH 2AXWA 2GUOA 3U1PA 3ZMNA 1RZGA 5AW6B 3UGXA 1KN2L 2WZ0A 3L3JA 5IOKA 2WNWA 3S6CA 4K94C 5E99H 1YPZA 3WFBL 5HGHA 1PX3A 1JTTA 5DUJA 3IPBA 3IMWA 4P5KB 3KLHC 4YDIL 4P23A 4Z0XB 4CDHA 5KVEE 4IU2B 2IWFA 4JO4H 3KPPB 4MMZA 3OZLA 3GB7A 4JN1L 4JCLA 5T1LD 2Z31A 4ODTH 5GGTA 1ZVSA 1H9VA 1KUMA 1MFNA 1KYOK 2H2SC 5HHPA 4PFEA 3RILA 1F11A 3T4AC 1MI5E 4RGMC 3QISA 4WNQA 3MCYA 3C5ZA 5TGBA 4WJG3 3MRIB 3ZE2E 3V4PA 1AXTL 4EEEA 2N7SA 4TVPE 2YS4A 1MCDA 1BFSA 1M9SA 2QQKL 3VE0A 3VWJC 5BS0D 5E95B 4PV1C 3S3JA 3LN5A 2CGZA 2ZWKA 3ARUA 5IQOA 3FPXA 1LDPL 1UXWA 2NX5E 3T71A 2ODHA 4GP5B 1SN2A 4PJIA 3V7MA 5BQ7B 4P2CG 1IBGL 2DYRB 1CFVH 2OYLA 3MODL 2BJMH 3WELA 2Y06H 4FD0A 4IBWA 4LCWE 1MUJA 1FAIH 3RWHB 1LTXA 1OP5K 4UT9A 4WWOA 4JRXE 4PP1C 3LRSA 4GT7A 1KCSL 4F58H 3ZTNL 2J88L 1C12B 4FLQA 2AVFA 1AO7A 2J7LA 5LG1A 1KJ3H 4XOBA 1BJ1J 2YQ3A 4WW1B 1ZWIB 2EE3A 3A3YB 3AGWA 3PGCA 4OQTL 3TJPA 4AIZA 3T2LA 1JXFA 4BIKA 1S9VB 1WEJH 4PS4H 1OOWA 4RGOL 2GG1A 4TSCL 3QR1A 1CIUA 1R3KA 4YHYC 3ULSA 4BKTC 3KPRA 3AAZA 3U9UB 5ID0A 2ICWA 2EDYA 4ZMXA 1T4KA 2VKWA 1XZ0A 1XSIA 1I9EA 2A99A 3O81A 4JJ5B 3PWPE 5F7AA 1OVZA 3BAEH 2FEJA 1J0JA 4GRMB 3KWTA 4FAAB 1LWHA 3TNMB 5BJTA 3Q01A 4UAOB 5ICZB 2VR8A 4OIBA 1OAQH 4ODSL 2O5XH 3HI6L 4GEIA 3DTUB 4TSBH 5IHZB 3RWIA 1TQBB 1UWXK 1UD4A 4WUUA 3QZNA 4XMVA 4YVNA 2W0LA 3D8MA 4G1MA 4J2XA 3G9AB 1EERB 4QXUH 2AV7A 3CZLA 2I07A 3DUUB 4F5CE 2XFXB 2ZXAA 3ZLQC 2BC4A 2KZBA 3GMMA 2DM3A 3PLYA 5IESL 3D0VA 4LHUG 2C9AA 1MJJA 5D1XE 5A43C 3VJ6B 5LCVH 1R9FA 2BP8A 4F7MB 4GSDL 1CLZH 3VFVA 4L3CB 1MWAA 1PD6A 3L9YA 4QO1B 1MJ7H 4RMBA 4AEEA 1KJ2H 2HT4C 4E41B 1U8OB 1FN4A 4NO5B 3S97C 1IE5A 2GYSA 4FXGA 3IJ9A 2LQRA 1M7IB 1MAKA 5FLVA 5D9SA 4R8WH 4N8VG 1U8MB 2IXQB 2QVKA 1RZKC 2ADGB 3UTPE 3FRPG 4FG6D 1T4WA 2B8OT 3MLRL 3PDOA 4FKKA 2G3MA 4IBZA 5CCHE 1FNGB 3CSTA 4N8CH 2MSPA 4F3FB 3JV0A 1JSYA 4XR8C 4BH7B 5F6HI 5C0AD 1T04A 2Z8VC 3BGFC 1DQVA 1UCBH 1MW0A 3P30L 1T1YB 4TUJB 4MDJB 4LNVA 1BM3H 2X6UA 5CKGA 1R46A 3IWVA 4MCMA 3D2TA 3LIZH 3JXAA 4MAYD 4HGMA 2Z7WA 3N41F 4CN6A 5JZ7C 1NCHA 1ZE3H 5IIEA 2AQQA 1EAOA 1RIVH 4HPYH 1NBYA 4HA1A 4I2XB 1NCNA 2EC8A 3L7FB 2NUPA 1AE6L 3ARDD 3KD4A 1A7BA 1M3IA 3GMQB 1IVTA 5AOKA 1QZ1A 3R4DA 1I1FB 1T89C 4LCCC 1QRNE 2K6WA 4BCYA 2X9ZA 4PJHE 4A7SA 3O2DA 5IMMB 3F7VA 4PRDB 4PRBA 2V7NB 3CPLA 3IFLH 5IW1B 2WLZA 3U83A 1J5IA 4MQTB 4N2MA 2XUWA 2R2EB 2ZUQC 5AALA 1OAJA 3QIWC 1WCBB 4LCUA 1I9RL 1OB0A 3O6FB 2RA1A 3WFDH 3S5LG 4LQ1A 1R3JB 5CEZD 3ZE1B 3P4MA 5EUOA 4JFED 3MRHA 5LO7A 1RD6A 3PP4H 5JIDA 3ZQXA 4S1SL 1KB5A 4JJOA 3EJSA 5ANME 4KJWC 4BD4A 5E94A 4YHIB 3F7LA 1LO0H 4MJID 1AAJA 4A67A 1P4BL 3GLZA 2QQQA 5HYEA 3IDMB 4A38A 3QQXA 4B9PA 4RMVA 1B4JL 4PB0H 1HEJC 3NP3A 1UWFA 3I6KA 4KY1H 1Y6NR 4K23L 4U6XA 1IKFL 1T20A 5D7IF 1XAUA 4N24A 2WCGA 4BWUA 4AYBA 4KHTH 5I1GL 1UYWH 5C6WH 4Q6IC 1P1VA 5E6YA 1XDTT 4AEHH 3RWGA 3PAUA 5FYJL 2J1XA 2WOBA 4NJ9L 3QUXB 4X6EA 3L6FB 4IRJA 1CE6A 5BRZA 1ID2A 2CDFA 4AEIH 4XB7A 1JUFB 3IGAB 3S4SA 3VW3H 2GCYA 4H13C 3JV6A 3L3GB 4ZDHB 3TNNB 4I87A 4J3SA 3ZE0E 4PJAB 5EZJB 3ULUE 1K3ZA 5C92A 2ZCKL 4KKPA 3ZL1A 1R0AH 3Q5TA 4LVHB 4H8PA 1ES0A 5T3ZL 5IB4B 3RWJA 1NFIA 4XBGB 1D7DA 4PWGA 5D71H 3VH8B 1V3LA 2CQVA 1EH9A 1YHPA 2F54D 5CWSA 5IMLA 3QG6B 1JVKA 2VDNH 1HHKA 3DO3A 3RL2A 3SPHA 3ARGC 5FM4A 5DO2D 5F6IB 5KANI 2XN1A 2C34A 1INEL 3OKOB 1E6JH 3EGDA 3KBHE 1J9QA 2X3BA 1ZDQA 4Y4KA 3QSKB 3AXHA 3LEYH 1TCRA 3BCFA 3SZKC 3ZBMA 3OKNA 4UT9L 4H4NA 1LEIB 1BD2B 5DCCA 1FSKB 2Y5TB 5D5MA 4B50A 3O4LE 1OPGL 4HVBA 3BIAX 3FUFA 2FECI 4KUZL 1KCVH 1UZGA 1ZEAL 2B4CC 3P3UA 5A7BA 4YDZA 2C9VA 4YGAB 5AD0B 1RZJC 2WMPB 4HUXA 4KMTH 1KLGB 4NN6B 1AR1D 4FJZA 4L4TD 2EIZB 2ADFH 4Z7OF 4MHHI 4LBEA 3TPUA 1A0QH 3GT6A 1GTFA 4IU3A 3QJVB 1ND0B 4J3WA 4XMKL 15C8H 1U8IA 3AREC 3GIVA 1ASQA 4M29A 1T1XB 4N0FB 1N59B 4QKTA 2CALA 4PMFA 1YPZF 4G8GB 4QRQB 4BFBD 3G5YB 1TLKA 2FJSA 5TTRA 1Q1JL 1WZ1L 4G8EA 4FOMA 2XY2A 2EO7A 2YUWA 5E8PB 3W0WA 3QNXA 1PAZA 2P3YA 2IH3A 2A6JB 1NTDA 1WIPA 1CFQB 2VLJD 1FDLL 4RMTA 4I48B 3TBSB 1GGYA 1OLZA 3P11H 4GPVA 4PJ5E 4YDMA 2IFFH 1S2EA 1KBGH 1E4JA 3H53A 4AKQA 5I1EH 2UZIH 3S35H 5JQHC 5L6YH 35C8L 1PDKA 3MV01 4J3XA 4POZD 4A68A 1DBAL 4KXCA 4WI6A 3UMNA 3B5HA 4WFFE 4E68A 1ERNA 3DXAA 3IEAA 4UIKH 3QNFA 4ZXBD 5AZEL 4NZ8A 1H0DA 5F71A 3TH2T 2AEIT 4ELME 1DLFL 4KJQD 3QUMH 3SBQA 2FYYB 7CGTA 3UPRA 3MLSH 4O9HL 4QGTA 1R34A 1GZHC 2WQUA 5IEHB 2V3EA 4QY8A 5DA4A 1YC7A 1I8MB 3L1GA 4PMEA 4KAQL 1BOYA 4XOCA 4AMKL 1D2PA 1WA1X 3C5JA 3NIGE 1T1ZA 1BDYA 4FJYA 3KR3H 3IDNB 4EVNA 1T5XB 4HKBA 4J4PD 1JZGA 5AAMC 2EXWC 5E6SB 2OSYA 2BX5A 1ZTXE 4X6CA 4CADA 1XCXA 4XAWH 4MJJA 2MH4A 2DS4A 5GGRA 2Q8AH 2Z0UA 4DTGH 1G7LB 4NNPH 1QR1A 3RGBA 2AXGA 3QAZC 2WW8A 4HS6A 1RPKA 1IT9H 3WKNA 3X1NA 3N40F 4HT1L 2K3HA 3ZZLA 1A3LH 3QIBC 4QXVA 4HWEH 3MA7A 3MV9A 4FA8A 4OIIL 2V37A 2J20A 5I6PA 43C9B 4G72B 4JPSA 4PJCA 5AKVA 4OJDH 4EI5B 1J9SA 3S37X 1T21A 5FYLE 3OBAA 5HVGB 5SV4A 2BSSA 3PHQB 3EADA 4GRWE 4PTUA 1NPUA 3NZ8B 2FTAA 3F83A 3H56A 1JGEB 4BK8A 4UNVA 1E50A 5L2JA 2QTVA 4XPTL 5SWSB 4ZG1A 5IFJB 2K8QA 3IXAB 4LVOC 4P5TC 1NUFA 3JWDC 4I5BB 1OARL 3ASOB 1A7PL 2IDSA 2XVGA 4OZGF 4NQEE 2F58L 1J1PH 1KENH 5MHSE 2CBPA 3TA3A 1WVZA 2XZCL 3P73B 3NFSL 1HKFA 3ARRA 1O9VA 4NHUA 2YMTA 4NB7A 4P3WA 3AJ7A 4YZWA 1L9PA 2VMFA 4Q74A 3QUZD 3BKCH 1JHLL 1FE8L 1ORSB 2FO4A 3S88L 3VD4A 4PRHA 3WAJA 1UD5A 5IB1B 5L0QC 5G4OA 5J12B 4JO2H 1WWAX 1DBBL 2LABA 3O41A 5IWLA 3MLTA 3DHUA 1HNYA 4R0LC 4FF9A 5GJSL 1YEIH 1KB5L 3NABH 3SQBA 5JQ6L 2CO4A 4MKTA 2XWCA 5I23A 4OD2B 2XWTA 4NO0B 4ZJ9A 4GKSB 5AEAA 2OMBA 3U2JA 2GFBA 4R5VA 2OR7A 3HLAA 2HVJA 1EEZA 3GSNH 4L8SC 3L5IA 3TIEA 4N2GA 3AADB 3T3MF 5IB3B 3OQRA 3VGGA 1RVFL 2Q76A 3QZWB 2ZOKB 2IH9A 1E67A 2GBVA 3V4VL 2NZ1A 4OCRH 3VFPB 4ZMPA 1G6RA 1ZJBA 1EZSA 2DQ6A 4PV8A 3B9KB 4P9HL 1C9SA 32C2B 5BUAA 3U2SA 4IOSD 4CW1A 1N0XL 1W2KT 2BNRB 2DBLH 3OF6D 4J8RA 3HZYB 4WDIB 3L95B 5TQ2L 1YA5A 1N5YL 1GC1H 3BPNB 5FXCH 3TEYA 3VXSE 3KZ8A 1Z5LA 2Y72A 4NI3A 3SDAB 4L8BB 4RFEA 3W5MA 5IVXB 2HRPH 3OWRA 4NC1C 5AVSB 1NIFA 2ZSVA 2ZQKA 4CC4C 5EBMB 3KPTA 3P02A 4Y19A 1RAMA 4XCCH 4N90E 1NFDB 4I88A 1IC1A 4ZOBA 3BEWB 3UCRA 2J55A 4JM2F 1OSPL 3T65A 3R18A 1JXKA 4JHVA 2R1YA 3MJ8A 1B2WH 4OFKA 4LOFA 5DI8A 4LPCA 5D4QA 5GGRY 1YNTA 4FRWA 4S0TD 1D5ZA 1IC4H 2A73B 3TT1L 4U1SB 4ILDA 5D2LB 4J1UB 3SQOH 3MGOA 3BGMB 4U3XA 4YXHH 5T1KB 1BG9A 4LCYB 1EHAA 4X80H 3ARFB 4YLQT 4FNTA 3RKDD 4KK6D 4UWQB 3AZUA 1TG8A 2XA8L 4XMLH 1UKSA 4HF5L 2V17H 3E9TA 4JGUA 3M45A 4LLVA 1DL7H 2X38A 4H44C 4WWID 5D96B 3T0EE 4CGTA 4AGNA 1HYSC 2QDVA 1D5MB 2UXVA 3NZSA 4P9MH 1QWUA 3BH8A 3VXRA 1WO2A 3D85D 3QRGH 3FAWA 4DO6A 5ISZD 2CJSA 4NDMA 1KJVB 4XOEA 2HYMA 2NY3B 1JGDA 2ISDA 2RFXB 3WE6A 2WO3B 4OTXH 4OD3H 4U1KA 3HC2A 3T0XA 4QJ5B 1PZDA 4KPHH 2PPEA 1A6UH 3QRLA 3J8F7 5I15H 5KBPA 5EU6B 5EIIG 2AITA 2E7HA 3MUUA 4ZPVA 1HWWA 2VZSA 3LKQB 2YOAA 3MROB 3DJTA 5GS1B 4FTVD 3D25A 4IDJL 3IKCB 1HEHC 5F88B 3T04D 3SKUD 1J9CT 3S3SA 2D2CC 3MGAA 2ATKA 1OD7A 1OAUH 5K9QI