4W9IC

Pvhl:elob:eloc in complex with (2s,4r)-1-((2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 35
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9iC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9iC01
3ZRCC 5LLIC 4BKTC 1VCBC 3ZTDC 1LM8V 3ZUNC 3ZRFC 4W9HC 4W9GC 4W9DC 4W9LC 4W9JC 4B95C 1LQBC 4B9KC 4W9EC 4W9FC 4BKSC 4W9IC 4WQOA 4W9KC 4AWJC 4AJYV 3ZTCC 4W9CC
chains in the Genus database with same CATH superfamily
3RGVD 1G43A 2MPVA 2ZG2A 4BK5A 2VR7A 2GHWB 1C08A 4G9DB 1JIBA 5IQMA 1LE5A 4P8QA 2DLTA 2Y25A 1T1XA 3VGDA 4DQOH 1ZGLP 1H5BB 3VWKA 2BLFA 1ES0B 3BIKB 4H7VA 4UUJB 4ODUB 4XC1H 4H0IA 7FABH 4LCCC 4MJ4A 2YJLA 1FYTD 3MLVL 1HS6A 3S37L 2E7LA 2LVEA 1A9EA 3BUIA 2V3EA 4WW1B 3T9WA 4NRXB 1FO0A 1SGKA 1QKZL 4HWEH 3F62A 2CGZA 1S9WB 4L1DA 3QDGB 1DQML 2BS9A 4JQXC 5BO0D 4G82A 3LRMA 1RURH 3FQRB 3WLBB 5DCCA 2VCOA 1OARL 2QZQA 5HGAB 3AFLA 1CCZA 4JFUA 1MCOL 2ZKWA 4LSRL 4BA0A 1MN4A 4FD0A 4QF1B 1RK1A 1OAXH 1TDQA 1A1MA 4HKZA 1DLFH 1TZIA 2JK5B 2W92A 1U3JA 3SKOA 4HC1L 5GGRB 3FT3B 5C0BB 2F7RA 4XNZB 3JV6A 1WBXB 3IK2A 3F85A 1MY5A 1ID2A 4NRZA 1XGRB 1AGEB 4FG4A 4YMPA 5C92A 5F8QC 4S0SD 3STZA 1IQWH 2CIIB 3DA0A 5D7JD 4M93C 5DD1H 3UJTH 4YLQT 5T1LB 4ZQKB 5ILTH 4D8OA 1KJVA 2GAZB 1I8KA 3IDJA 4V1DB 3UCQA 3MRFB 3C08H 5IGXH 4UTCA 3VH8A 5HGBA 1P6FA 2DY2A 3TEYA 5DT1L 3WN5C 4P9MH 2OQJA 4U6HB 2EEFA 3CFIC 1YEJL 1CF1A 4JFXA 2CKBL 4TUUA 3RKDC 2PYFB 4WJ5B 5D9SB 3AU1A 1MAJA 4XN9A 5DR5L 1KFGA 2ITDB 2DM4A 3EYQC 1OAZH 3MCG1 4IGBB 1UCBL 3QUKB 5JQIB 4U4IA 5DJ8B 3ZUCA 3V6OC 1FA4A 1KN4H 3KPRD 2VMDA 1IM3B 1ITCA 5IW3A 4N1CA 4URTB 3ARSA 4JPVL 4ZODA 2VW6A 5LJYH 2A9NL 4XAKE 2JSFA 2NW2B 1AO7B 1VCBC 3WUWG 2PTTB 1AQKL 1SN0A 2Y1AA 4MZIA 4P2QA 1OV8A 3QA3B 4LGPB 3WGVB 2BDNL 4QPEA 4JG1H 2AP2A 4ZMWA 4DKTA 2UZYB 4YO0B 3GLDA 1XAUA 4J1UB 1DDTA 2J6EA 4DCQA 3X13A 1FIEA 5F7YC 2VZTA 4N2BA 1LO0H 4ZG1A 2GSGB 3FTVA 3V0IA 5AW4B 4XVJL 4V2BA 4PJ8D 1S3RA 3MRCA 2NY0B 5F96H 5JW4R 2HMIC 4JKPL 4M93B 1D5MB 2GVYA 5FO9B 4MQTB 1D6EA 1TUPA 2BZ7A 4PPTA 1JDDA 5BOZG 1G9HA 4WSGA 2VDLH 3I74A 4HWBA 4LLMA 4PRNB 1XF3B 4NSKA 1MG3C 3KPLB 2R8SL 4MCZB 1U9KA 1FLRL 2IANB 4Y4HD 3BWUF 2CKNA 3H9ZA 3WD5L 1V10A 5HHMB 3P4NA 1YNKH 4YIQA 1KENH 4NZUH 1JZ3A 3BYTA 4AGMA 3MRBA 4BELD 2BSSB 5FF6B 4G6KH 1BV8A 3ARWA 3RBGA 1JN6B 2HJLA 3FUHA 1H3PH 1SBBA 2J73A 2ATKA 3INOA 3MO1B 2Z64C 4GLRH 4LCCB 1Q1PA 1WIOA 2B0SH 2Z34A 3JV6B 4UQ3A 3RJOA 2PN5A 2ZOKA 4YLCA 2EILB 4RA3A 1X5FA 1LNUA 2WP3O 2YOCA 3CC5A 4KTDH 1V3KA 3QEQE 3OKNA 5IB2A 5EZIL 2NY6C 3RVUC 5AOIA 3VX1A 1IVLA 4YHMH 4YXLL 3PP3H 4FULA 4N4YB 4KDVA 3PNRB 4Z7OE 1NJ9A 3C2AH 3QG7L 5JIIA 3ENEA 1CTMA 1B6UA 3K0WA 3UIYA 2AJSH 2J44A 3Q0HA 4Y4FC 2WYHA 3T0EC 3QDJA 2XZZA 1O9VA 3CMOL 3NK3A 4PJDF 1YJDL 4PJXB 1GC1H 4MJID 5KANG 1O5DT 4WEEA 1DQDH 3SKMA 3VJ6A 1WBYA 4YSCA 3PP3K 5JOPD 4MA3B 2PPAA 1DLFL 2X2HA 1BXVA 3LQMA 1U36A 4U05A 5K33A 3P30H 3MLWL 2R0LL 4D7BA 4Z1PA 4JZJA 1RP9A 5B38A 5BJTA 4FNUA 2CR6A 4PBWD 1FCGA 1IM3D 1Z9SB 1OM9A 1D5IH 1I1YB 4PJ7E 4X0NA 1WIPA 1J9RA 1XX9C 2E7MA 4IGBD 2PWEA 3VVWA 4XE5B 2TSAA 1H6EA 4HAKA 4J4PC 1DDHA 3ZTNH 5GPRA 4PW3A 2XV3A 4K3HA 1MCWM 1MCPL 3W38A 1PD0A 1BAFL 1BIIA 4WFGD 1BVKB 2BSTB 3ABGA 1G1CA 1IBFA 1ZV5A 2H5UA 2VSDA 3LXCA 3FF8A 5C0DA 3F83A 1XH3B 4LBAA 3GZOA 1JAEA 1X4ZA 1IM9B 4JAMA 3VXQA 3KAAA 3OAWA 4I13B 4AQEB 4GRLC 2C9RA 3AY4C 4WU7A 5IM7B 3NJFA 4NQXB 1OF2B 3CSYA 2GTWB 4Y2DB 3PJNA 3BWAB 4A55A 5E8EA 5IHHA 4U2YA 4ICXA 2VW4A 5JHDB 5A1AA 3HZVB 3MCKA 5ACZB 4DK3A 1A6WL 3AU0A 4X6DF 4JUSA 5IFJA 2WXIA 2EVGA 3LQAC 3OZ9H 1J48A 2I24N 2Z91B 3NIGB 4F7CA 2VDQH 3H85A 3HMXA 4QHNA 1UVQB 4EDXA 1KPUB 4GEIA 2NY1B 2F53D 4HOZA 3RTQD 4LCCA 3WY4A 4NI3A 1HWWA 2Y2WA 2FECL 3V6ZB 4PJIF 2DIAA 4HQQL 4XPAH 4XXCA 3RVWC 1C7SA 2F19L 2P52A 5EMYA 5HJDA 2R69A 4F8QA 1QUNA 3MR9B 3C8KB 3HAEH 4CSZA 3ZN6A 1NH6A 1D6VH 4KKNA 1UACL 1N59B 3WIIH 3CFKA 3FCGA 1TTFA 2Z0BA 1OTUC 3CSFA 3KM1A 4YSOA 3I85A 4JO4H 4LSVL 4FI7A 3NSFA 3PHOA 4AKPA 3VXTB 3ZGIA 1I9JH 1KLGB 1AHKA 4OZGB 4IQHA 1F0LA 5F0LB 4I5BA 4C56A 4TPRH 2WAHA 2E27H 1KUMA 3UJIH 1UURA 5JDSA 5FW8A 2OTWA 5AKRA 1BAFH 4IM8A 3MRHB 3IU4H 1SDDB 4NAQA 2ZXQA 3FUDA 2I85A 2FEEI 3QXVA 3MLSH 2Z8WC 3ULUC 1L9PA 4AL8C 4MNHA 2JKXA 2YXFA 1FGVH 3TBYB 3QSKB 2W9DH 3AB0B 2WM0A 4K8RH 4YHNB 1T2JA 2OR9H 3L2MA 2VQUA 5C7ZA 4ECNA 1E5BA 1M7DA 3PP4H 4YFDB 2X9ZA 4C8XA 3MV11 5CLZA 4JEGB 1ZPLA 1LEKA 4I8DA 2K7PA 1CGVA 3OZKA 4JQXA 4JY5L 1K5WA 5ISZB 3J27A 4R84A 5K9QG 1LE9A 3D0LA 2EABA 4JREB 2R2CA 1PMYA 1TZHA 2VERN 1GGCL 1NC4D 2IQAA 4C58B 2QQKH 5GZND 4MBOA 2KZKA 2O6EA 4LKCA 3BE1H 2DYPD 5C09A 2F7PA 3PDOA 5M7QA 3D07A 4R5VA 1G1OA 4IOIA 5DYOB 2CA4A 5BXFB 4K3EL 4FLRA 4ZTPH 1IL1A 4Z7VE 5GGUB 3QRGL 5KBKA 1TFHA 1GC1L 3SYPA 3F7RA 4KI5E 2JELL 4QRRB 3UDWA 4B53A 1OAYH 1TT6A 4PLKC 4H8HA 2PW2B 4W1TA 1P4IH 5DVKA 4PJBA 4AQ8C 4NPYB 4G83A 3NJKA 1JNHB 2G5BA 3MGOB 3QHZH 2H2SC 3BZFB 2VRQA 4R3SB 5AL8A 3X13B 3VRLF 3MTXA 5C2UB 4OZHE 3UOAB 4AYDC 3UPCA 4JHAH 4AENB 5I1EH 4J3BA 2NY3D 2MRYA 1A6UL 3CVHL 3UC2A 2BY1A 3DURB 4GH7B 2B15A 3RWGB 3D1MC 3IU4L 4NP4H 1JK9A 1URZA 2EYSB 5F1IB 3IDMA 4U1NB 1KB5H 3E8UH 3FOLA 1RCYA 1SXZA 2WXOA 3MDJA 2IO5A 1IAIH 3GTNA 1OAQH 1A3RL 4Y5YC 1ZE3H 3JSSA 4WUUD 4TM9A 5FGBA 2WSPA 2YGNA 3H3PL 2F54E 3X3GH 4PJ5B 4BKLA 1IC4L 3DX9A 1Q9OA 3PXHA 1JFHA 1KYFA 3ZTDC 3WIHH 2OL3L 2DKSA 2ZXCA 3T1FA 5B7FA 1YNLH 3T0BA 2XX0A 5DJCB 4UI2A 4N0UA 3RWHA 1NKOA 4B3VA 3MJWA 4OM1L 3L4UA 4FYQA 2P8LA 4M5ZL 3HZ3A 3FT2A 5JYLA 1QEXA 4HJ0D 3IWVA 1SVBA 1F4AA 4CGUB 5A2JH 2UUDH 4ZSOB 2P4AB 4K7FA 1ETA1 2V7HA 3QXAB 4E41B 3IPBA 3AM8C 4QRFA 4DERA 2BP8B 1HHJA 3EFOA 4Y4HA 2WB7A 1A1NB 3VDAA 4HPYL 4K7PY 3THMH 3L48A 4PRIB 1W72B 4MWFB 1TTGA 4XPFL 1PLGH 5IMLB 4Y88A 1NEUA 3O3DB 1S7QA 1JGLL 4G8IB 1AMYA 5K9JL 1SLUA 5EC2A 2Q8BL 2ZCLH 3HMWL 1ZJAA 1U3ZA 4X7DC 4HOMA 4G6JL 5AVTB 4ODVL 2AJZB 1OALA 3GMRA 1YYCA 3P73A 3JWNC 2X87A 1BZDA 2Y07H 3IFNH 3ZX1A 4NP4L 1YEDB 2E27L 3FRPA 4H0LC 3U9WA 4LVOB 3VWKB 5I6XC 3O2WL 1GPOL 4A2EA 4N8PA 1EAQA 5E8NA 1DJSA 5AWNH 4R8WL 1F1DA 4NENB 1JUFB 3OKKA 5D2NE 4ZX6A 3VXSD 1IGYB 1Y7VA 1HYSD 2D2CC 1ID5I 1NBVL 1JWUB 3B3IA 1HQRB 5TE4L 3NJNA 3WFHB 2LLNA 4XGZB 3IGKA 3WLBA 1TVHB 4FFVD 3IDYC 4KFMA 1DJWA 3GMLB 4LSUH 3RRQA 1UJTA 3E6FB 2BIQA 2BVEA 4GRLA 3HZMA 1HILA 3GZQA 3SGJA 4FNTA 5E2TH 4EN3A 1MCRA 1OHQA 1YN7B 5DQDL 5K59E 1UYWH 3O6FB 4TMPA 4FC3E 1WA2X 4PG9A 4UIKL 5D7JA 1C8QA 3MMEB 5GGSA 5B1BB 4BQ6A 1OVZA 3FU9A 4Z3JA 2D4DA 3D85A 3QHTC 2BNQB 2WLIA 3HAEA 3QUGA 7FABL 4IBUA 5AVXB 1E9QA 4FFYA 2F9BT 4JFWA 4NI6A 5B1CA 4AEIH 5EIIA 3STBA 4DKAA 2H6UA 1QKZH 4W9EC 3WFCH 4M5TA 5AVVB 4GQ9H 2FSEA 2WO3B 4PY7B 1RUAH 4AMKL 2JJTA 3WHE1 4DGUA 1QBLH 4TVSa 1UVQA 1F42A 3NSXA 3DX3A 4GI6A 4KTEL 3DGGB 3VFPA 4EDXB 2AJYH 3WXVL 4AITA 1DFXA 2NY6B 2V7HB 1HCYA 2DM3A 3OHXC 3QXAA 4J6IA 4E41A 1F90H 1LO3L 4J8RA 4ES8A 2NW2A 1FYTE 3W39A 4IIZA 1AR1B 4LXFA 1QYGL 2JCCE 1CDCA 1R5IB 3ZKJA 1DE4B 4PG2A 2O5ZL 35C8H 5A2FA 3BX7C 5F70A 1C5BH 2J6WA 4X6EB 3VFUB 3WN6A 5F1KC 4Y4FD 4CJ0A 3RY6A 3U48A 3WTYA 1P4UA 2QBWA 1EHXA 3ARBB 1FFPB 1YNTA 1QSFE 3N1PC 3QXDA 1KGXA 4L5FE 1AKJD 4MCYA 3L95B 3A47A 3QQDA 1Z9MA 3BAJA 3VXSA 1MELA 3QJTB 4G5ZH 4PJ5D 1QWHA 4P4RB 1FO0L 3OHMB 1GGIL 4FQHB 5GS1C 2FJSA 4FA7B 4UDUB 4ZOEA 4JFSA 3SO3C 5I1KL 2VDPL 5ETUA 3IJHB 1NDGA 4OKVB 5D1XC 5KBDA 3VFSA 2E75C 3D69A 3PYCA 4JGMA 1G7HB 3KYKL 5I5JA 2DW5A 2IAND 5E9DA 5SV3A 5DJXB 3SGJC 4AYGA 4HFWB 2P5WB 2BNRB 4KK5C 4YXLH 3ECBA 3KGTA 1SXBA 3D5OF 2D73A 4GFXA 4U1MB 3PGCA 2GPZA 1CJYA 1KELH 4UV7H 2J43A 4YN3A 1VGKA 3SQBA 2SODB 4JKNA 4UYPA 3ULVL 4AJVA 2CJ3A 2X0UA 2CRIA 3A6BL 4L3ED 5HYIA 2ADGB 4MD0B 3Q7JA 2E5EA 5D7LE 3WLWC 5I5RA 2IPTH 1QBLL 2UWEB 3AMLA 1CYWA 3K4DA 4JHZA 4IRSC 4L3EE 3F7LA 4G1MA 4QO1A 1I7ZA 4DF9A 1ZHNA 1HESA 2FBJH 2XPGB 2Z93A 2ENPA 3B6SA 5K9KB 2YUWA 5DUMH 5FYLL 2AAAA 3CZKA 2MNUA 4TUJA 5IVXF 1E5ZA 2X10A 3WFDH 4TQPA 1BQRA 2ARJA 1G9NH 1ASQA 2VDRH 3Q1SL 1U8KB 5F6IC 2YC1B 3AQDA 2FBRA 4PBXA 3L9YA 3Q48A 4HXAH 5AD0A 3DARA 2P43B 3ZIMA 1QLEL 2HT3D 3MGTB 3H3KA 3KBPA 3LKOA 4G6ML 1RIUH 5CILL 2YQ3A 5H4ZA 2JKTM 2DYRB 4UBDD 3FSOA 3IDXH 1NGPL 1QSEB 1QTYT 2EO9A 4GKNA 5A2LH 2ZP8A 3TZVC 2AHIA 3V5HB 3WIHA 1PZCA 4NKIH 3SDAA 3WDJA 2MKLC 3QJRB 4RA0C 5G55A 3JWDL 3FTXA 3EUUA 2Z92A 2XHNA 3UZQB 2OMUB 1U92A 3FUEA 3ME0A 5LGJB 1Q72L 4KZDH 4KX9A 1RZKH 4XI5C 5FGCB 1S6NA 3RPIB 3W1ZA 5L9DH 1MJJB 4UDTB 2A74C 1Q0YH 3MV01 5GGTH 2IWKA 4HJJL 1J0JA 3FCSB 3OJ2C 3HBPA 2QMKA 1Q9OB 4Q6KA 1AKJB 4D0DA 1FC2D 2UZPA 1QFUH 3QJXA 3V95A 1BYOA 3HW7A 3EO9L 3IMSA 3KGSA 3I50H 2XG5A 1WZ1L 2B4CH 1BGXH 1UH3A 1KBKA 3LCYA 1GHFL 4Y4KD 5CSZB 3E1ZA 5E2WH 5IOKA 1LJMA 5FB8B 1MFDL 3P0VL 3Q2CA 2C9UA 5E4OA 4OFKA 3TYFB 3V0HA 5CU9A 4N9OB 4PJFF 4L8CB 1LLAA 1HHGA 3PU7A 4Y5YA 3F3HA 4ATTA 1L7IH 2ALAA 4F5CA 1UWFA 3IN2A 3O81A 3L3IB 3HNSL 4DJMA 3IETA 4F37K 1EEZA 4FFZH 3BZ5A 2KKQA 1OZUA 2FYYB 2ICES 4AOFA 2DQTH 2ODHA 3UGEA 4WKZA 5GS3A 1GIGH 3BPOC 4I5BB 5FUZL 4C56B 1Q9KA 1R5WB 4MAYA 2WNGA 4R9HA 2OXGA 2YAQA 3VFMA 5E6ID 5EEXA 3GMOA 4GUQA 2TRHA 2X0WA 4Q2ZB 4GSDH 1ZT7A 2CPCA 3C08L 2RIKA 3T0DA 1RIHL 2CD0A 3OHXA 4OCWH 5CS7A 1KIUA 2GIXA 4AYMC 4C4KO 3IPFA 1VZGA 4RDBA 4L1TA 3J2PA 3ZY7A 5T5NF 3V4VL 3CNKA 2L0DA 3HMXH 1QW8A 3II2A 3GTTA 2VL5A 1LD9B 2COQA 3FPYA 1KBBA 5K9OB 3V6OE 4LCWB 3LB6C 4K15A 2FJHB 1RJZA 4QXWA 1N59A 3CU1A 1RZFH 1CDIA 3LS5L 3BDYH 4G3YL 3T4AB 4ANWA 4L8SC 1BP3B 3DUSB 4PB0L 1G0DA 5DMYA 4ZXBC 5KUMA 1N6VA 2X4SA 1Z9OA 2W60B 5HD8D 4JFQA 4X7TB 5CZXC 3HA0A 5IUSA 4M6OH 5DHYA 3UCRA 5IMMA 5AVRB 5C0IB 3LPGA 5D1ZD 1SN5A 1T66C 3EYVB 5ELIA 1NSNH 3FQ1A 3ZVVA 1JZ5A 3FSVA 1XFPA 3SBQA 15C8H 3O3BA 1DQKA 2E76C 4XAWL 1JNNH 1BGXL 1JPTL 3LHPL 5F7MC 4DO5A 3WNLA 3I6GA 1NBQA 4MA3A 3M86A 2KT6A 4I0PC 4NEHB 3DMMD 1LO2H 5I82A 4BV1A 4FFYL 4DO6A 2Y72A 2OM5A 3Q44A 4NKMB 4BM7A 3IVKB 1R3LB 5IVZB 2IALB 3MRDB 5K93A 4KNTA 4OUUA 1IX2A 4GXVL 3T3PB 3L13A 4BFEA 4BH8B 5IB5A 3L5JA 3KWVA 3FAXA 4HP5A 2MOVA 1FNFA 2Q7YB 3CN4A 2Q3AA 4AENA 1KWGA 5MP6H 3SY6A 5BW7A 1MCDA 3N42B 3O6FD 5IB1B 3NTCH 3NPZB 4K5OA 4N20A 5E5MB 1JK9B 3A4AA 4BFKA 4OZIA 5D6DA 4FFWC 3QZWA 3VXNA 2ICEA 2VZSA 1WS8A 2Q8AL 2EE2A 3K71B 5KUKA 3M17B 4JJHA 1XZ0B 1NFDB 4OLXH 2VOTA 3OBAA 4KXDA 1DVFD 4I0PA 5E6SB 4EQ2A 2C9XA 2HJKB 2N56A 5BNXD 1OTSC 2YD0A 2ADIA 5TD4A 1DUYA 5CP3H 1NMBH 3OQ3B 4G9FE 5EN2B 3IRZA 1QMUA 1TYJA 4XOAA 4YDMA 2R0WL 4OSUH 4EN2A 4GG6B 3GSUA 1DQVA 3HTLX 5DSCB 1LQSR 1EAJA 1IEAA 3QDGA 2AGJH 3HUJA 3QQ4B 4X0KB 3WAJA 4K73A 4PJBB 3RNQA 1DCEA 4XTRC 3BP7B 1HTYA 4JFVA 4M6OL 3RGVA 3GQFA 4NKOA 1PKQE 4PWFA 3R19A 4MASA 1XF4B 4A37A 4Z7NE 3EJJX 3EJTA 1ZGLM 5KN5B 2JJTC 3VXUA 1QLFA 2DD8H 4QNPE 4MCYB 5J4MA 4OZ4A 3FUMA 2I60L 3NIDF 4A2DA 3U0WL 1ED3B 4FQXB 1CFMA 4HULB 3HI5H 4ELKA 1QEWB 1UKTA 5K9QI 1QUNB 2QEJA 4UQ9A 5T1LA 3P4MA 3DUUA 4URKA 2VLJE 3W82A 3V6FA 1MI5B 2MSPA 2JLPA 3D25B 4P3CH 4FLOA 2B1OA 5ICYA 4KO5A 4IOFC 1G87A 3T71A 4QI3A 5IB4B 4CVZA 1XO8A 4PRID 3KWWB 2O4EA 4B0MM 1IAII 3QDJD 2LGNA 1BZ9A 4XPFH 1J8HD 2X28A 5JW4Q 4RNRB 1DUZB 1YHPA 2V2XB 1PD6A 4GG8A 5D96B 3TC9A 2JCWA 3SPHA 4E9QA 4QCIA 4OZFA 3S4SB 5D5MA 4XOBA 2GC4C 1KYAA 1IEBB 1DBBL 4MJ5B 1SDDA 1CE6A 2FDBP 2FIKB 1Q94B 1QAWA 1NFIA 3WO4C 2BY0A 4B50A 1ZAGA 5FYKL 1EVUA 1EHAA 5B4MD 1JD9A 2BP0B 1I75A 2VISB 2OMNA 3KXFB 4NZTH 2QELA 4NZFA 3VD7A 1HIML 3KS0H 1B90A 12E8H 1TJGL 2VXSH 3MCLH 3RNKB 4F2EA 2JFCA 4JFED 3UTOA 3DVGB 4DVBB 3TZVA 1PD1A 1SXAA 1G5AA 1FZKA 4JHUA 2HKAA 4P3DA 3GMLA 2ZZUT 4DKEH 5BRPA 4IIQC 4LIQH 3ASOB 4MQXD 3CQQA 3UBXA 3RWDB 6PAZA 2Y7MA 3S8GB 5A3ID 3KPNB 4LEXH 1S7VB 2XZCL 1I4FA 5EORL 3KLSA 4CC0A 3IGLA 5DRWB 5CLWA 1M6OB 5EC1B 1KTJA 1NCAH 4S0HA 1F2QA 4FNLL 2AQRA 1MFMA 1WGVA 3ZLQC 1NMCC 4G7RB 2NY7H 3PUCA 1UWEH 4ADIA 2PPCA 1JUFA 3OKKB 1IT9H 4YDNA 4IRZL 2NR6A 4JPKH 5I0ZA 5HHXH 1NGXA 4KNUA 3MUGB 4ZFGH 7PCYA 4XN4A 3KGUA 4K5PA 4IJTA 4QRSA 2ZOLA 2VJXA 5DZLA 5ESAB 4NJAL 4AYFB 5D7LD 1N67A 4PMFA 4UT6H 3U36B 3O2DH 4PJ7A 3AQYA 1RIVH 1VJSA 2J88H 5F21B 3I9AA 1LO4L 1O6VA 4W6XB 1P5UB 3VM7A 1MFEH 1H19A 3BPCA 3VYPA 3FCUB 3T2LA 2NYYC 5AOZA 1XGTA 2VMJA 5F7NC 3RVXC 2H0FA 2Z31B 2HFEB 5BCAA 4LL1A 1NIDA 1R5IA 3CZNA 5FO8B 5FYKD 3TNMA 3HG1D 1FPTH 4JR9L 5TGBB 1JV2B 3VRJA 1QYGH 1E65A 3LRLA 2WO2B 3KLKA 3N6YA 3E6HA 4KJWC 3AG1B 4LBEB 3LZFH 3WTTA 3MXVL 2NY1D 4AQAA 1FGVL 3ARED 1A2YA 2Q3XA 2Y6SD 5AWNL 1ACYH 1MWAH 4X8CA 2OSLA 2VDLB 4N2GA 1V8HA 3X3FH 3PP4L 1P7QA 3EYUL 4ZI8A 1Z9LA 4WHTB 1C9SA 1JZEA 1H8LA 4KH9A 1N19A 5FYJU 3FCTA 1NICA 2WXFA 1MCQA 1T4KA 2Q76B 3ESOA 2KLTA 5FV2A 3WDIA 4CN4A 4PRPA 4X5WB 3ZDXB 3NFNA 3LKRB 4GBXA 4I3SL 3UYRL 2XV2A 3FFDA 2Q6WA 3H7LA 3QEQA 4PB9H 4EDWL 4RGMC 5C6WH 3B2VL 1CT8A 5C0FA 4HAGA 3UBGA 5A2KH 6TAAA 1B0GA 1Q90A 1KG0A 2FTAA 1Y1UA 5EIQA 5EOQH 1NGWA 1DSWA 4R2GB 3V6OA 3OZLA 1X7SA 3MVSA 3BAEH 2ZPKL 1V7ML 2VDMB 2FGWH 3SSGA 1EFXA 1MCOH 5HGHB 1DSFL 1AXSA 5FW7A 3WBDA 5I76A 2P24B 2D31B 1ZY9A 2J88L 3QISA 4FXLA 5LBGA 3BJLA 5EDXA 4B9FA 3G6AA 4LPYA 2P48B 4GRWH 1U8IA 3T77B 4O51B 4PRIE 3KPQA 3I6LD 1P9MA 5DD1L 5CU5A 3UJTL 2AJYL 3QR0A 4JRXD 3WXVH 2APSA 3FRUA 4RMTA 2IGFH 1D5XB 2H8PB 4I1NB 5SWSB 3K8MA 5JHDA 1RU9L 1M53A 3FNKA 1HOCB 2CJUL 2LT9A 2ZOUA 3BAIA 4JG0L 4W81A 2IQ9H 1WISA 3MUGA 3BZ4B 2OSWA 4K94H 1T04B 3PFUA 4NNYB 3WNIA 3B8YA 12E8L 1TJGH 3MCLL 4DP5X 3QVAA 2WBJC 2B0SL 1KY6A 3H3BC 3Q2LA 4R0LB 4WFED 3QPKA 4PTUB 3OPZH 4FG2A 2EXYC 2J2ZB 1O5PA 2N59A 4KHTH 1WAAF 1LEGB 3TPUB 3R4RA 2QVMA 5TDPB 4PI2A 2H2PD 5LGJA 4XCCH 2QVIA 2HG5A 1TLKA 1G7LB 4JGJA 3ZDXF 2DQMA 4DGIH 5MENA 3HE7D 5D2NA 1VEOA 1TQCC 3OKOA 1MQ8A 4ISVB 1E8WA 4D2NA 2F54B 4HWUA 5D2LA 1BFSA 3A67L 5GJTL 4LASH 4JFFD 4KK5D 1UZGA 1P2CB 2XYBA 3DX7B 1Z32X 4G7VL 4PJ9D 4R4NC 5IIEA 4HEMA 5HHVH 2XBDA 3UP6A 4IS6A 3ETTA 1Y07A 4D9RD 1CTNA 3GC3A 3PFQA 5A6LA 5FDWB 1FNSL 5HHQB 1KZYA 1VGEL 2YPVA 3DLQR 4D0BB 3WTUA 1HK6A 4TULL 1CXKA 1FC1A 2FEEL 3N85L 3IJ9A 4NQDD 4AKQA 3WY2A 5EOTA 3U4KA 1ZIBA 5I17B 4J39A 2CO7B 2WTRA 3DIFB 3QI9D 1P53A 4KROB 4B9YA 1A3LL 1H5BA 5IWLA 4L29B 5B7MA 5JOFB 1NL0L 1U8NA 3D3VA 3OLIA 1AHWA 1MW1A 4YXHH 5G5DB 4ZNCD 5I75B 5C6TH 3FONB 4PJ9A 3SGKC 5BO1H 4XX1E 3V5KA 4KXBA 1TNMA 5GGTA 2Y4SA 3KPSA 5F9AC 2J7LA 4GT0A 3VSTA 4KK6C 5DHVB 3U2JA 5HPOA 4CU6A 4ESKA 1DL7L 2OPCA 1IUZA 1NCUA 1EMTL 1KB9J 2G2PA 4QXUL 3PWPB 1MHEB 4PGCB 4R0LC 3O41A 4PUBH 1HHKB 2UXTA 3RWEA 2C9VA 1I85A 1H9VA 2FX7L 1KNOA 1YY9D 4AEEA 3TFKC 4R8WH 2E7DA 1TZHB 3QPQC 3N9GH 1ZLWK 3AROA 4F7TA 1NCIA 1U58A 4HWBL 1AG6A 4O4YL 1NEZG 5DD5L 1YEWA 2X4PA 3BCFA 4HJSA 2JCCA 2XWDA 4HIEA 1IEBA 1Z0MA 4CC4A 3BXNB 4G6KL 1U8QB 1H6UA 1T4WA 2DZEA 4LMQE 4LOUD 4FNRA 3EFDH 5GRJH 3T0EE 3FT9A 3F6LA 2W91A 3BSZH 1PS3A 1BBJB 4U31A 3DMMA 4NQCD 4QRQA 5IBTL 2YA0A 4ZXBD 4WWKD 3ZYIA 3QUML 3QFJA 4IIQA 1I8AA 1XF2A 5BVPH 3TBSB 1F3JA 1S78D 4GW1A 3T4YA 2R0ZH 5IKCB 2X89A 1KXQA 2WN2A 5EBLA 3C6SA 4UINL 3TS8A 1AYRA 1TCMA 4OF7A 2J8OA 5DJ8A 1PW3A 1CICB 4OZIF 4LCYA 2AAVA 3LIZH 2OJEB 5DMGD 3HC3L 2H32H 5GQBA 1ZLVH 3PV7A 5C0AB 3KHQA 1RI8A 4U1NA 3ATEA 3LD8B 3FO2B 2NZ9C 4OF0A 1ANUA 1WICA 1K4CB 4AJ0A 3IBOA 2CGYA 2SEBA 4GMTL 4JZJB 2E9GA 1FJ1B 2H32A 4HEME 5CF3A 5EC1A 4G8GA 4P2OA 5T3ZL 2NZIA 1MSPA 1KJVB 2JTDA 2X70A 3CFTA 3L5HA 5E2WL 5IEKB 4P23B 3UTSD 4FXKA 4PJAB 3MUUA 1OP5H 5L8JB 1IGIL 2X3BA 2FT8A 4PRPD 3SD5A 3ASNB 2C34A 4FQIH 3MLRL 3RWHB 5B3SB 4YX2L 3BUYA 3F8UB 5EZLA 5E23A 2WBXA 2ZSWA 3TVMC 1EEYB 5DK2B 5FYLD 2CJUH 1UFGA 3QUKA 1MFBH 1XZ0A 2C7UB 2HKFL 3QUZD 2VN4A 3IKCB 3TEXA 3VXQB 1J8SA 2XT1B 3JZ7A 2W5PA 2ICWA 5JHDE 5IP4A 3OAZH 1QUPA 2YMXL 2WXJA 4LLWA 2Y24A 1L9NA 3EXLA 1F97A 4EI5B 1FG2B 2JKRM 4QNPF 3QZOA 3MLTB 3JWOL 5F97E 4Q7DA 4Z7VA 4XO8A 4QTHB 4H8WL 1MOEA 5D1XB 3BPLB 4LFHD 2Z91A 4JS7A 4UIMB 4B7LA 1GGCH 4NKOB 4F7CB 2OXHA 2ESVD 5E03A 4K9EH 3K2UL 3QAZB 1H3VA 2OSLB 4JL2A 2Y69B 3KBEA 1NCHA 3FCBA 4IHBA 5IHUH 2CDFA 1KEMH 2ZKMX 2BS8A 4PJCA 2Q2EB 3SDDD 2R29L 3G5XB 3LXAA 5FB8A 1B3IA 4QXVA 5C8JA 3NZHH 4PP1D 3BD4A 2YBRA 4RGOH 4XPBH 1NUNB 1SXNA 1KXTB 4N5UA 4N2CA 4QLWA 5CR8A 2FB4L 5L7XH 2NNXA 1AR1C 1AZCA 3HG5A 1U8OA 2WXHA 5CIPA 5EDSA 2EACA 3EOTH 4X80L 3VO0A 3GUFA 4FABL 1BYNA 2FBJL 4F7PA 5DJ2A 5LGHH 3VYNA 4BSVB 1GA2A 2GSIA 5KYYA 3HG3A 2N4IA 3DXAD 5JUEL 4RX4A 5JQ6L 3KCWA 1LE9B 4IRSD 1WCBA 3GRWL 1CE6B 2MOQA 4WI4A 3Q1SH 1AANA 3U25A 5KN5A 3BQUD 2XXFA 3HB3D 5D7IF 2FX7H 4QHKJ 5I73C 2PXYA 3K74B 1DN0B 4KK9D 1T7XA 1VLXA 5AAMA 2WWMC 2VH5L 3LRHA 4P2YA 1OTSD 1UM6L 3QJSB 4FTVD 3AREA 3LNHA 2X2JA 2EAEA 3KYMB 4CW1A 4YBLC 4WK4B 4F2ME 3VA6A 3DJTA 2JJWA 2XWJB 4KGJA 4D8PB 2V17H 5IJDC 1UENA 4KWUA 1ITBB 2EXWD 3FYEB 5FM8A 4F58H 4FXTA 2VZ3A 5KYUA 3T6VA 1GVIA 4HMEA 2XZQH 3QYNA 2C4FT 5EIIB 4HZLA 1RZKL 1SEBB 4JQIL 4BFJA 4YHPA 2WNXA 3MV8B 4KBPA 3AAZB 2FD6H 3LQZB 4KKAD 3Q43A 2QQKL 1AQDB 4P23D 2GKIA 5FO2A 3O9WB 5IHUL 1UWEL 4EIUA 1K4DA 4FQ1L 1TJXA 4DP8X 1OAKH 2ADJA 5E9DD 2ID5A 4Y2OB 1NCAL 3SPJA 1FVEA 4NERA 4MLIA 2GCYB 3MOAH 1T0MA 1KLFB 2D7NA 1SJMA 3T8MA 5L88H 1NGXB 1CBVL 1WE5A 2VDNH 3BUQA 3M1CA 1GS6X 5DD0L 5I1AA 2OYLA 2OTUB 4U49A 4ZFFB 2BSRB 5IESH 4R3SA 4X80H 2J1KA 2PCFB 4YDKH 3NDYE 3RU8L 5J6HA 2WV3A 4GY4A 1L7IL 4U3SB 4HUUA 4NCDA 3FMGL 4KRPB 4WCYL 4YAQB 4D0BA 5DVLA 2YGPA 5T5FA 3RWDA 3S96A 4POZD 1XGUB 1XCTB 4PV1C 3ZDZB 5CD5D 1BOGB 1RD6A 3KLAA 3AACA 2P5EA 5AOJA 4WJG3 1P4IL 3QHFH 4P2OC 2JTYA 5ALBH 1FN4A 1HH9B 2BIPA 3QZBA 4MMXA 2WZPA 5ETUB 2FQDA 1I3RA 1MIEH 3J8F7 4QRPD 3SDXB 1MFUA 1DHKA 2XQYK 1XF3A 1YMHB 4WFFD 4AQEA 3UTTB 2FZ3B 3VI3A 2OMVB 4XXWC 3GSOB 2EIZA 1MXGA 2D0GA 4JO3H 2AJ3A 4PSRA 3N43F 3Q8BA 3FH5A 5CCHE 3WEMA 2OCFD 3WJMA 3GSVA 3Q9PA 5BW7C 3KYOB 2J8UE 5AYUL 1DJXA 5AKVA 1A6TA 2VLME 1GCFA 3AG4B 2DMKA 1RZKC 2E9BA 4Z3GA 5I0XA 4AV4A 3ZQ9A 2EADA 2X40A 1CFSB 1I7RA 5LDSA 4UB0L 2OMBA 1MRFH 3AADB 4NQDA 2D4FA 3KPOA 1LMIA 3II3A 3O8XB 1QLFB 3FRPG 4ZW6A 1E28A 3T6ZA 3PGFL 4I3RH 5I9QC 3P54A 4FAAB 1AOZA 4KOCA 4MCMA 3PAZA 3OMIB 4K07A 1OP3K 4OM1H 4X9GA 2EDHA 1R3IL 2W94A 1I1FB 4HETA 4OCLC 1YMMD 5DTFA 5C0EB 1I7UA 5BMFL 1JV2A 3BH8B 3VFVA 3QG7H 2ZPKH 4X9BA 1VFBB 1JG9A 1XH0A 2WKOA 2K3TA 2WC7A 1GGTA 2C3XA 5DRNA 5AD0B 3FJTA 5J8OA 4X99B 3FZUD 5CSBA 4DEWA 1I85C 1ZTXL 5C07D 1VFMA 1S9VB 3LNGA 1JGLH 4BRJA 1M1SA 1WFNA 2DTMH 4XB7A 5C0BE 2YK1H 1MFDH 1MCIA 2R29A 3P0VH 3NFPB 4OFVA 4LVOC 4FABH 1E3XA 3THML 2VLKD 3JWNH 1JWSB 1JSYA 5AVZB 1Y6MR 5AVUB 4CJ1A 4LQFH 1GAFL 3UADA 5JO5A 3BVDB 4FZ8H 4X7SH 5DHDA 1A7PH 4P0DA 3QDGE 4DW2H 2ODIA 4AC4A 2DLFH 3CSBA 5I1DB 5ERWB 2UY6B 1NANH 2IQ9L 1D5IL 1P6AB 3QC5X 4UQIM 3CPUA 5TF0A 4OGXL 3T3MB 1BWWA 3LQAH 4S1RL 4OJEH 3IF1B 3SQOH 1ONQB 5IF0A 2IGFL 3HFFA 1YNKL 1B0WA 3HLAB 1ZVYA 4JFYB 3MRRB 5JDJA 3S3CB 5IK3A 4PLNC 3BDXA 4MZ3A 3WNJA 3V4VH 1CMOA 1AZNA 1TTCA 2GUYA 3MI6A 2DJ4A 1YUKB 2Y2YA 4MJJA 2IDTA 5L0QC 5JPNB 2Z7ZA 3WY3A 2DQJH 3AT0A 3L1GA 2B9AA 1NIAA 3GKWL 2CO3A 4QOKA 5I76B 1UT9A 4KQ3L 5IWLC 1V3JA 4IW4C 5GJTH 3T6XA 4TVPL 4I9XA 5ADPH 2FO4A 4WEBH 4OFQA 2HLAA 3VFWA 2QKSA 2D03H 2WSDA 5LCVH 3PWVB 5L6YH 4J3OH 1N9PA 3PWUB 3ROLA 4AMXA 4ODWB 3HB3C 4Z78B 3WSQH 3IDYB 5KBMA 4R4ND 2WLIB 4GI9A 3QXWA 3TO4B 4AJYV 2VZUA 4GLRI 1CLOH 1JF5A 4YWGH 2W0FA 1KELL 5DMJB 2R0KH 1D9KC 5KSVA 4KI5F 2WN3A 1J11A 4XNUH 4EDWH 5JPMC 3WUWB 3IBEA 2DI9A 4WI0A 2FX8H 1FNSH 3DGCR 5IHZA 4FI8A 4QRSB 4Q52A 4Q2ZA 3L4VA 4OCXH 1T83A 1CQYA 2YD4A 1CVSC 4ORGA 4YDKL 5HGDB 2HFFA 2IV9A 2NT0A 4HLEA 3N55A 4EI0A 2ZAGA 5JW4M 2ZG3A 3EJZC 3L9BA 4FHBD 1X6LA 3L3OC 2DWSA 4TNVF 4PLOB 2KERA 4C59B 3L5IA 2G3ZA 3TWCL 3IJHA 1F90L 1KN2L 4Y19A 2R0LH 2D9QB 4PVBA 3Q3GA 4DGWC 3VI4E 5BRZB 4L2LA 1YPZF 2EYRB 1U91B 3G6JE 4QHKI 4PV9B 4L37A 3MRIB 3GSRA 3GMRB 3MBWA 4KZCA 4N87A 4OLXL 4XVUC 1BD2B 4BGLA 3UEZA 1GZQA 3IRPX 3N40F 4WY7H 4WGKA 5HVFB 5T3XL 3DETD 2VN7A 5SWZE 2ZG1A 1JK8A 2KL6A 1CLYH 4GUPB 3JYCA 2BIIA 3CBRA 3U6RB 3SZ6A 3R7QA 5FFGA 1S46A 3UTSA 1DN2A 5DHXB 4PREA 3N1GC 2F5AH 2YKKA 4X4XB 4QRAA 2ADFH 2O6CA 3EFOB 5DHEA 4LZKA 2XG4A 1OCCB 3G6JF 5J11C 2DL9A 1Z0NA 1OP4A 3QCVL 3TFBA 1NFDF 4Y2DD 1JWUA 1G84A 1OCZB 4JFOB 5IG7A 1DZ0A 2NR6C 3ESPA 4JDVA 5DK0B 2F1BA 1URIA 4WW2A 1CXHA 1V55B 2R0KL 3BGMA 4ANXA 4HWZB 4JRWA 2YAEA 1UGKA 5A2IH 3ARDA 4L8BB 4RMSA 1KXQE 1DANU 4BH7B 4EIGB 1CFQA 2F74B 5BPPA 2XN9B 4LRIC 2MQGA 1AI1H 3FQUB 4GMSH 1E6JL 1NBYB 2GUOB 4HSCX 1IBGH 5HYSB 3TO4C 5IVXB 1DQTA 4FERA 1ZLUK 5DMIH 3QDMB 4O2EB 3O6FA 5T5FH 4LLMB 1ZRUA 3T0EA 2KUTA 2IWEA 3HHSA 1EZSA 3I6KA 3AREC 1IL1B 1UA7A 4B9CA 8CGTA 3ABMB 3LNEA 1AZUA 4AG4H 2JIXA 1RIVL 2EEAA 5AB9A 1OF0A 4R7NB 5FA3A 5EU4A 1AAJA 1FE8L 5FHAL 1D5BA 5JMOC 2EDQA 3U6XA 4DUWA 2EUWA 3ZOAA 1MJJA 2EECA 1DYZA 3BP5B 4MNGA 3LB6D 3NAAL 5EZLB 2XWZA 3Q6GH 2WLMA 1KJ3L 4QY8B 1WVZA 3SPVA 2H7WA 3FCSA 2OMWB 5IHBA 2C7UA 1AE6L 3U4BH 1QRNA 1N10A 3QIBD 1DANT 3H6JA 2W07B 4PHXA 2Q1EA 4YL4A 3S5LB 3NH7L 2XBTA 1RKRA 1L3WA 2DI7A 2D3VA 3CZFB 4FHKA 1RK7A 3U0PB 1MH5B 1IARB 1JZJA 2O6PA 2RQ8A 4YVNA 3FTWA 3GKWH 4BFIA 2ZYHA 1A6VH 1SJXA 4ABUA 2EKJA 1WGOA 2GC7C 2J25A 4BDVB 1T5WA 2NXZD 2X4UB 4WV1A 3RDJA 4CN1A 3E7JA 4JKMA 2V9QA 3HE6A 2PYEA 1CFVL 1AZBA 1IFGA 5GISH 3GSVB 4H44C 3D05A 3HAEB 3MLZL 1M2OA 1S7XB 3RJQB 4B9JA 4BQ9A 5I19L 1BD2E 1GOHA 3L95A 3QDJB 3MBWB 2CO6B 3QNXB 4OBRA 4Q9BA 1KCVL 1F45A 1AFVH 3CSGA 5CXPA 1NANI 1R0AL 1LE5B 3B83A 2XV6B 3RUGB 4DHLA 2EEDA 2H9GB 4WVRA 3ZZ1A 1Q0YL 3CH1B 2RJMA 2Y5QA 2GIYA 3ARPA 3NCYP 4IKLA 3DYOA 3GMNB 1UM5L 3NG5A 3VFOB 4JCWA 1XIWA 4X42A 1MIMH 1ZLSL 4MAYD 2I32A 4APQA 4Z3TA 1HHHB 4Q6IA 1KBVA 3GLZA 4H1LA 2LE9A 1EDYA 3CC5B 2QLVB 1UZ8B 1PLGL 2FJUB 1IJ9A 2HWZH 3NIFB 3LH2L 4PHZA 1RAMA 2ZCHH 5F6HJ 1DE4A 4MA1C 1H0DA 3FU3A 4WWKB 3I2CL 1B9ZA 1ZV9A 2ZCLL 2E8YA 4JZOB 5HGAA 3L1FA 3IFPB 3EO0A 1E5UI 3EGXB 2WMPB 3P2TA 2X4SB 3WE1A 5KVEL 2R1WB 4HV8B 2HVKB 3UC0H 2BP5M 1A1MB 3OJMB 4RFOL 3V9FA 4U6TA 3CFJB 3AWEA 2WBJA 3D2UD 3MJ7A 1P7KB 4F33B 4RMWA 3D18B 1AGBA 1U58B 1AE6H 1U95A 4HGMA 5C3IA 3NA4A 3QAZC 3PIQB 1F56A 4JKWA 2V7NA 5AW5B 7CGTA 2ITFA 2CIKA 4ATWA 1IM3A 3EBGA 1HFUA 4UBDC 2FJHA 2PR9A 3G5ZA 4UAOB 5HDRA 2JXMB 1TZOA 1GZPA 4WU7B 2F15A 1QSZA 1RIHH 4WU5A 2AJUH 3FT1A 4L1HA 4LOEA 5HYJB 5I16B 2BCMA 5DFAA 1E67A 3O6LL 2QQNH 4A7TA 3H3PH 1OD7A 3NESA 2OYMA 1U8HB 4BHUA 4UTBH 3JQOB 4QHMA 4FNPA 3S5YA 3PLYA 4ODHH 5KSBF 3TURA 3PGCB 4JM2B 2XQYG 5BOJA 3HG0A 1BREA 4I3SH 3UYRH 5EH1A 1SMOA 1X5GA 1CIUA 3HS0A 4GRLB 5CJXA 1F3DH 1MW0A 1DN0A 3GM8A 1E5YA 3KPMA 3ZL4L 2FQFA 1XR9A 3UTPD 4MDJA 4WAFA 1L7TH 1E4HA 1EK3A 2WBWB 4WTQA 4OFYA 5EV7A 1IC5H 3IDIB 4XNYH 1E4XH 1OCWH 1T6BX 3FUJA 2PPFA 3W0WE 5D1ZI 1FF5A 2OULB 3N2JA 3TIDB 3DHMA 5J9PB 3KVPA 5CGMA 4ZPTA 4QKXB 3L4WA 5E2JA 1MNUH 4XPBL 1JRHL 3QDMD 3MBXH 4L0PB 3BKCL 3HI1A 2PWHA 3DHPA 3ZDYB 4K5MA 3E38A 1XGZA 3APMA 3H9SB 1ORQB 3LQZA 3VAEA 1IB5A 5KS9E 2HMID 3L5XL 5FWQA 2LTQB 3MV9A 4J5VA 3CFNA 3CDYA 4ZFZA 2KZ1B 5IZ7A 4HG4K 5CM1A 1UWGH 2Z8SA 3K7UA 3BIAX 2MTAA 4Q4IA 4KXAA 2VITA 3V0DA 1HXMB 1I8MB 1DVZA 2W8CA 4KXZI 3U9UB 2XRAL 3V4LA 4EBQH 5A6MA 2AV1A 5C2BH 4MQ7A 4LNVA 5CN3A 3ZGHA 1DEDA 2ZCKH 1KGUA 3OB0K 3SGEI 5B3JF 5SX4I 3SQRA 4P46C 4FLQA 4ZYKA 4AH2B 1F8TL 1MUJA 5TDNB 3EFDL 2X5PA 3IE9A 3ECWA 4ZRGA 1ACZA 3G9AB 1SQ2N 2AXJA 2OAAA 3CDZB 2BIMA 3MROB 4XO5A 4S1QL 1GYWA 4ODBD 4X5XA 5LO7A 3T3PF 1HCZA 3OLDA 4LSDA 3RIAF 3ABZA 3LRGA 5I1LB 4QRPB 2V3DA 1R3JB 2YN5A 4WI2A 1MZYA 2FZ3A 1XB8A 4QDGA 1G7IB 5CZXD 4Z77B 3VH8B 4LNRA 3K6IA 3VXME 4QTFA 2QADC 2L7UA 4Y5XA 4K3EH 2YEQA 5DMGC 1THCA 3NN8B 4UOZA 4QRTB 1FL6A 3GXIA 4TUKH 2J3SA 1SOSA 4DGYL 2OI9B 5TH2A 3VTAA 4MAYB 3VFMB 4Z76A 1CR9L 5GZNA 1XD1A 2PABA 2A3TA 1DJGA 3I2CH 1S78C 2NZ9D 1FLRH 3K81A 5M95B 2Z35A 4FL4B 3K6SA 1Q94A 1MFEL 3ARXA 1JXJA 3D2TA 2QHRH 3SKOB 2OTPA 3X12B 5KVDL 3QIWB 1JRHI 1JYVA 4XPHL 5CMAA 5E9NA 1IEHA 4QJ4B 5BZDB 2YLKA 4N8CL 2BZCA 1IC7L 3BN9C 1M6OA 4PP2A 2NY2D 1A7OH 4XRCB 43CAB 1IAIL 4GKSB 4YUEL 5BQDA 3QHFL 5ALBL 1TVDA 1WA1X 2XCMC 2HCZX 2YA1A 4PW9A 4APQD 2R2BA 3QPQD 2VE6A 3E3QE 3X3FL 4Y1SA 1CB4A 1HSBA 1QNZH 3HBZA 4N1EA 3LY6A 4HU8A 2ETWA 3X3GL 5F7FA 3TA3A 1F8TH 3N44F 2KPWA 3B2UC 2ICWI 3MRQB 3RZCA 5EBWA 1EHLL 1EHKB 1SHWA 3NFPA 4W4OC 2B59A 4M6NH 3JTTB 2IIJA 1U8JA 5BS0A 4Z23A 3DOIA 1KPUA 1T89A 3BP6B 1E5AA 2J5WA 4CADB 4HT1H 1N3NA 2X88A 1BOYA 4LHJB 3BOVA 4WK2B 4EN3D 4LIQL 2DDQH 3JVGA 4P5SA 5B1AB 3TOPA 2NY5H 5FGRA 3TT3H 1Q9LA 4PU2A 1OLZA 1IAKA 5E8DH 5B39G 3ZE2B 3IN0A 2CMRL 2ZT9C 3N04A 4R7XA 1LWRA 4TXVB 2F58H 3SZKC 4YVUA 3GIVA 4ONHB 5JQHC 2X3AA 4WNSA 1P4LB 3DI3B 4PGEB 4R96A 1B4RA 1XDTT 2P5ED 1M42A 1KNOB 5B1JC 3Q13A 2EZ0D 1O7SA 4HUCA 4G6FD 5EU5B 2JJUA 4ADGA 3QRGH 1QD0A 2VLKB 4PIRF 4YC2B 4HUUB 1RY7B 5I1CH 5I5MA 1O9WA 4NJAH 4PM1A 4PWGA 3CDZA 5C9JA 1E6OL 1PL3A 2VDLL 4FQQA 1EJ8A 1UD4A 4HD9A 3WNOA 4W6YB 3U2IA 5E4AA 2WQ8A 1ZA3A 1RQ5A 1FVDA 1CO1A 4RFNC 5ID0A 3IU3A 3HNSH 1G7IA 1QX1A 1HYRC 4FFZL 2E9JA 3M8OL 1KLUA 1GAFH 1KGWA 3CVBA 4OM0H 1KOAA 1CDBA 4MMYA 5DSCA 3IDUA 2FYYA 1JHKH 4WW2C 3DVNA 4ABVA 4E9SA 3GF8A 3NA9H 1LDPH 3RE0A 4OVUA 4BYHA 3DROB 1MWAL 1RSFA 1ZEAH 5H35A 5GRYA 2H2PC 4CVWA 1T22B 2RB8A 4NHUA 5ID1B 1YC7A 1AHMA 1AMXA 1X44A 4E9YA 4XXWA 1X6NA 3QIWA 5JR1H 4KAQL 2WVUA 2CBPA 4HMDA 3BH9B 2BNUA 2PKDA 3QR2A 4KY1H 2Q87A 4E0RA 5J0BA 4X6DB 5A16B 4XP6H 3WKPA 3MTRA 1C16A 3OXRA 4KJYA 4UILL 4PJGE 5K9OA 4NRYB 5DYOA 1CI5A 3Q2VA 2E4FA 3QEHB 1S7RB 3VRIA 3QUZB 1NCNA 4RMVA 3QR1A 3HG1E 5HYJA 4XNXH 3M1OA 1FNLA 2C9SA 2V2TB 2AQNA 2AXHA 4K9JA 3OB0H 4HS8H 1PU0A 3TYGH 1FFTB 4PJIB 4CKVX 4N3TA 3WG7B 1G6VK 1BIIB 1S9VA 1CI3M 3AY4A 1YEFL 3BUYB 4OCSH 4R2GC 5CINL 5F7AA 2E9IA 1E0OB 4UZGA 4DWHA 1IFRA 4RX4D 4F7EB 5JHAA 1IGJB 1JZDC 1T6WA 4JG1L 3PHQB 4XCYB 5KSAB 2CH8A 1B3JA 4YHZH 4KHXL 1MREL 1WO2A 3WJJA 1PKQB 3I84A 5D2NC 4DGYH 2K9FB 3SKNA 1LO2L 4J3WA 3EHBC 1NFIB 3GBML 1WDAA 5K59F 1YPZA 3SBRA 1NFAA 1OPGH 3TBWA 3GK8H 2AERT 4G8AC 3QPXH 4FKKA 4HUVB 2V6HA 1VERA 1S7UA 2XWBB 3POCA 4NXSA 5ANMA 5F0PB 5C0AD 1OANA 5JPMA 4Q9RH 3GLAA 3N3EA 2KDGA 2GJJA 2ZWZA 1T66D 4KKCD 4P2CG 3IDGA 3INUL 3K3QA 1JPFA 2EH7L 5DC2A 4I85A 5AAWA 4YUEH 1NFDE 1JDAA 5AZUA 4W9KC 1GPOH 2NUTA 1H5BC 1JWMB 3OMNB 3QAQA 1E9QB 1RMFL 1WZAA 1D7FA 1CXFA 5I30H 4K5NA 3CZUB 1MVYA 3VXSB 2BVOB 5E6IA 4Y5VC 4C4KT 3U6XS 1JYXA 3CFUA 2HKHH 1ZA3B 3MKKA 4Q6YA 4G5ZL 5D4IA 3PXLA 1M71A 4PRAB 1U0QA 3GJFK 3I6KB 3O8XC 4JJ5B 3DX1A 5IEHA 2DQUH 2XDHA 1A6VL 4OJFL 1RZFL 3LS5H 4EJ1C 4MMZA 2ALWA 4FTVB 3GRWA 3SDCB 4NYLB 3TONA 3QQ4A 1GYUA 4H8PA 2WXQA 3UYPA 3IJ8A 4H1LG 2VSCA 1WSST 1TZAA 1UKQA 5H35B 4U3HA 1A6WH 4UM8A 1W0VB 4WSJA 5JHLA 4Y5VA 2PTUA 2HFTA 4X6FA 5TPWL 1I7TA 1XIWB 2YZ1A 2HTKC 1FL3A 2X7LA 1PX3A 3P73B 4LDOB 2J55A 1H6TA 4ZO9A 5AUMB 3L3DA 4K3GA 5TE6L 2O61A 4KMTH 2Y0SA 3IFOA 4JDTH 5HI3C 2FWUA 4IK7A 4MCNA 3WFCL 1X9RA 1ZT1B 3G5VB 3NJLA 4P2OD 1WITA 3QEHA 2J20A 2VQ4A 4FFYH 2BHFA 1BQLL 4GO9A 3B37A 3TCLB 4LCWE 3POHA 3FMGH 4WCYH 2BC4B 5E99H 2F8VA 3D0LB 4DKFL 2CR3A 4F8LA 4APXA 1K8IA 2AJVL 2OQJB 3WEXB 2VJ0A 5DC4B 2A6JA 1BYPA 4BZ2A 2WQVA 2QPEB 3QNFA 2CALA 2FHFA 3C5ZB 3CPLB 2HKFH 1E42A 3O0RL 3QNXA 3S4SA 2F1EA 4BGDA 3CX2A 3UDWC 1XB6A 2BIHA 1V3LA 3GMQA 3NJXA 4MXQC 4WHTA 3R8BB 4BRVA 1ULVA 3KR3L 1DP0A 2VR3A 3FOMA 1DJHA 1MFVA 1T1WB 3LN5B 4ZBJA 2AK1L 1U3HB 2Q76A 5E00A 1BXUA 1NEZA 4NHCH 4HUWA 2BVPA 4BK8A 4I3GA 4NZTL 2QQNL 2QSCL 4J4PD 4R7DA 3OKEA 4XHQA 4YHNA 3CVDA 3FQ4A 4NO2A 1IE4A 1BLIA 3WJLC 4M6ML 3V4VA 4G8GB 3MJ9H 2CDGA 1JHLH 1XCXA 2UZYA 4JCMA 5EPMB 4G6AD 4OKDA 4AVKA 4JFDA 3TVMA 3EADA 3F7QA 2YMTA 1ND0A 3IEAA 1PLAA 5CAYB 3HHMA 2RMNA 1CQKA 4DZ8A 4W93A 3OGCB 3KYKH 1OGTA 5IBTH 1XEDA 3ARVA 2N7BA 4PLJD 3LS4H 1NAMH 4HIJA 4HJ0C 2JIXD 3CFMA 2ERJB 3HUJF 3MRKA 4XNYL 1SXCA 2CXKA 2XWCA 3B9KD 3JTTA 4N0RA 1URLA 3TF7C 4NSKB 3JV4A 3QWRA 4ZFQA 3V9EA 3BZEA 4OIFA 5D96C 5AVQB 2K70A 3P2BA 2OMUA 1IT9L 2XSKA 1JRHH 5C7XL 4NDMA 1CS6A 1A7NL 4PGBA 3BUDA 1K85A 1GGBH 1Q9LB 3FH8A 3OC5A 2KPNA 1HEZA 4RGMB 2YA2A 4YSAA 2PW2A 3NVQA 1UH4A 5E99L 3TNNB 4DKFH 1RL1A 4AEHH 2MTPA 3FTYA 1KBPA 3VI4F 5I26A 3TL5A 4ANKA 2CO7A 3IM1A 1ZSDB 3QEUA 1KB5A 4YX2H 1FV1B 3ZUNC 3BI9X 3MV9B 3O0RH 4ZS7H 3DGGA 4W4OA 3R7RA 3US0A 1QSEE 1PAZA 3N41B 1LWHA 3DDFA 4P57A 4XPTL 2F08A 3FO9A 4M1GH 3D87B 5I1EL 4L4VA 4ODSH 1OGAD 2YQGA 3LVTA 5CSZA 4DP7X 3KVDD 2GFBA 1E43A 1KB5L 3E8UL 5GGVH 2IGLA 4I48B 1I8KB 3SDDC 3IAPA 3EJUA 1J87A 3ZDXE 3HE7A 4KKZA 2A9MH 2X53A 2KDYA 2WXGA 3O3DA 4JHWL 4UNUA 5EEVA 2OS7A 1XGQB 3MA9L 3RDTA 2PYEB 5HDQL 5DQJA 3BDYL 4G3YH 4AT6B 1CF8H 4GAJL 1A7BA 1R24A 2QADB 4AYBA 4YL9A 1MAKA 1E7UA 5DD3L 1Q9KB 3CFCL 4N0YH 3T0XA 1UYWL 4K2UH 2Y3AA 2BZDA 4CILA 1OIOA 4PCSA 3S2AA 4Q74A 2JVUA 1YEKH 1FAKT 4GUOA 4ODHL 2GJZB 1FFOB 3BPOB 4U7SA 1F6LL 3I6GB 3US1A 4MJIE 5J5EA 2VNCA 4R6UA 4UQEA 3FL7A 4XP5L 4MAUH 1KWKA 1HXMA 3JT0A 5IFAL 2X0VA 1GH7A 2B39A 5EO9A 2HA1A 5J12C 1SQMA 1WZKA 4UMSA 3RTQB 4GQ9L 1A7NH 1GHFH 1W2KT 2CO4A 3NCYS 4OU3A 3WI9A 5GZOC 1H3UA 4JO1L 3ZYJA 2YC1A 2Q7YA 4MA7L 1F4XL 5LGHL 5DFVC 4DP1X 1J1OH 1IZKA 4F8PA 4AQZA 4FQCL 5K9JH 1QSFD 5JA8B 2MPAL 2KZBA 3CH8A 5CLYA 1J8KA 4ZS7L 1SEBA 4DOHB 1PX4A 3E3QC 5IQ7L 3G6JA 2DL2A 5JXEC 3EXJA 1CTOA 2YKLH 2GJPA 5KTEH 2FO4B 5I6KA 3MLPA 3F5WB 4JUTA 3JVGC 2ZXDA 1IC7H 4OD1H 3ME0B 5HYSG 2VDKH 5AB1A 1J1PL 2Y7NA 4BZ2L 1OTUD 1QRKA 1NMBL 2V9TA 3MGTA 1W72L 2WQSA 3HE6C 3TNNA 3FTUA 3K72B 3MRBB 1GGIH 4HJ1A 5J13C 5JHLH 2NNRA 4JM0A 1QSEA 4GKNB 1QQDA 4NFCA 1MXDA 4LLDA 2IPUG 4JFZL 4KC3B 9PCYA 1UZ6E 3NRQA 5DVOA 1I1CA 4RRPA 5K1JA 5C0JA 3GHBH 5I28A 1A1OA 1R19A 2A7BA 5SWQA 4WWKC 3TT3L 3W81A 3WELA 4LL4A 3D9AH 4OLEA 1G6RA 4OQTH 4QRRD 1U2CA 2GCYA 3KXFE 2RR3A 1J0KA 4EN3B 3W37A 3FQWA 4EI5A 4G7YL 1ADWA 3BO8B 4UV7L 4MJIB 4A2MA 2C3WA 2RTTA 1OY3B 3MFFB 2KI6A 3LZQA 2WWKO 2DYPB 4EOWL 1U30A 4HA1A 2F5BL 4LLYA 5DJDB 3PV6B 3WNMA 2QKIB 2XIBA 1ZANL 4LHQB 4XMKL 5D7SL 5HYQB 4AL8L 4K7PX 5DUML 5FYLH 5L4JA 5T5FL 1EO7A 5HYFA 1P7HL 1SN2A 1PZ5B 2VDNL 3L1EA 3F05A 4HIIA 5DD0H 1KGYE 4M3HA 4ZAKD 1NDGB 2N1TE 5D4QA 5INCA 2EE0A 4M48L 3S8FB 1OAUH 3IMRA 1FFRA 1T21B 1I9JL 5BZXA 1SRDA 3UEQA 3QIUA 1R3KB 1M57B 5FKAA 3SY0A 4WW1A 1F5WA 2PXYD 1A9VA 4NCC2 2VDKL 2CGRL 4FS0A 5JIMA 1WWCA 1RJCA 1L9SA 1Z5HA 2X3CA 2DM7A 2PLTA 1HIMH 5I74C 1HHKA 5EF2A 4NZJA 4Z7NB 5LXGL 1BA9A 3CDCA 4JKLA 3RYMA 1VEPA 3ARBA 4HXBL 1M05A 4YSEA 1SHMA 1HXYA 4JHWH 5D9SA 2XWTB 1R46A 4UT9L 2BSTA 1BSIA 3GS4A 2DQHL 3ATDA 1HOEA 3MQIA 2IF7A 3BLBA 1MVUA 4H4NA 2HTLD 3O3BB 4KJYB 3CFCH 4M1CC 4N0YL 1VSCA 4RRPG 2Y1ZA 4M6NL 5MEPA 2ZF9A 3PDGA 2O6DA 3NJHA 4L4TA 3AVEA 3U1SL 4WFFE 3OKEB 4UT9A 5BV7H 1WHPA 3PJSB 3WHXA 5EWIL 4U1KA 4NUQA 1UEYA 3P4OB 1GGUA 4XWGL 3ZT7A 3S2CA 3KLQA 4JL1A 2EDTA 1J12A 2VLRD 1KJ2H 4DFIA 3CVHB 3ISYA 1NBZA 3KPPA 3JZYA 2DJUA 2HFGL 2C26A 4AGNA 1QOKA 1JGVL 3SDAB 3UROR 1BPVA 5JW5A 1BPLB 1QBBA 4Z8FL 3LH9A 4F80A 3GK8L 3MZGB 5F6HI 3QI9B 3N43B 2UWEA 2OJZH 2WY3B 3V79C 1NCBH 4XVTH 3EH5B 3P11H 4MSWA 4QXTA 2J8UA 5D7IE 1I7ZB 1PF3A 1KLFA 3GSWB 2WP3T 3MR9A 3L54A 1UB5B 5GS1B 2OP4H 1HJCA 3CZEA 4NN5B 4EE2A 1XF5A 4EZMA 3QUZA 1VZHA 4HU2A 2NCMA 5FV1L 3SBWA 3ROLB 3HE6B 1F11B 4G6MH 5HSFA 2LTQC 5FYKH 4HGWA 3O6KL 3TP4A 2P5EE 5E6UB 3OVUB 1JNLL 1PSKH 4W9GC 2V37A 4Y9GA 1XGUA 2TAAA 2FK9A 3JWDH 5AG9A 1RMFH 3LQAL 4F8OA 3SQOL 1ZPUA 3P0YH 1S9XA 1KB5B 3IDXL 4BCXA 2IH1B 4HJGB 4MAZA 4JFTA 4ZX4A 1IGCL 2WUBH 4JRYE 2BVQB 5ESQA 1SJHB 3TTSA 2OKMA 3BCDA 4NO3A 1EFQA 1XB3A 5ITBH 1XGTB 4DP4X 4XVSL 3MXWH 3P4NB 4J3OC 1NKRA 3OR6A 4GUCA 2WKOF 1FG2A 5DI8A 2IDFA 5CJ8A 4I77L 3VWJB 4XZUB 1T1YB 4N0FB 4ZUVA 4I18B 3OJDA 4G7YH 4FQLL 4YWGL 4ENED 2EIBA 2QSTA 2KQNA 4U7MA 3A6OA 1WZ1H 4AIEA 1MJ7H 4JM2C 2WINB 3WN5A 5CBAA 2XWTA 3RIFF 3QWOB 3MRIA 1U95B 2VAAB 1QFUL 3CUPB 2Q0ZX 3NZHL 4U6VH 5E1AA 4ODXA 1BF8A 2VZ1A 5AW1B 3IFOB 4MXWH 5HGGS 3DSNB 3EYQD 1J8HB 1PGRB 2R4RH 2WYZA 3GB7B 3OL2A 2MCPL 3RIFK 4U1IA 3P30L 3PUUA 5DO2C 1COBA 2D3NA 2ED9A 2NYYD 3L9RA 3S5ZA 1CD9B 1KXTA 1KV7A 1DZBA 2B5IC 1TF4A 3NTCL 4ORZC 1DQQA 2ZNXA 2W60A 3UO8B 4UQAA 3GBMH 3L3IA 2R39A 4MZ2A 5KS9A 3OAYK 5K1VA 4F7MB 2TSBA 4W6WB 3S35H 4EUPG 1WUZA 2VDPB 2DBLL 4CA4A 4OV5A 3U4BL 3L5XH 4BSVA 4N26A 2KC0A 3EYVA 2CBOA 5F3HA 5C1MB 1U3HC 3HLKA 4UM9D 2AKRB 2EVJA 3EH4B 4QT5B 3I02A 5AB0A 1RZJH 2F7QA 2MQ3A 3QGVA 4O5LL 5JW3L 4GUPA 3DO7A 4UT7H 2PXYB 1B2WH 5TDPA 1S2EA 3ZKNC 3FOLB 3L7EA 4PH8A 3GBLA 1XHHA 2D3JA 4PJAF 1I3UA 2XFXA 5F0JB 3VFTA 4JBSA 3PL6D 3TO4D 4GT7A 2EIMB 1OW0A 3C9NA 3QEQD 5I24A 4XT1C 4R97B 3RB7A 1I1YA 3BH8A 3D51A 3NSDA 4ZUUB 4AQOA 1R5VB 4U6XB 1XTMA 5BS0E 5CUSL 4M7LL 3IS0X 3ARDB 4GIPD 3QFDA 5C9KA 4OZHF 4MB1A 2H26B 4ENEC 4AKOA 1QVOB 1FH5H 5F9WB 4YHKL 3T8XB 5T1JA 4PRDB 4I9WD 4KKRA 5C97A 1NCWL 2CAKA 4KK6D 1IV8A 4PY8I 4BSJA 3S88H 4ZSOA 2XJKA 1EUUA 2WHVA 1JFQH 1YPZB 2XQBH 5DVMA 2ADJB 2EDBA 3BPCB 2DIBA 2R69L 1RERA 4OLZL 5L4FA 1P1ZB 1FHGA 2UY6A 3BWAA 1G7LA 3WIIL 4C54A 4S1SH 1ETJA 4ZUSA 1SLWA 1TJHH 5L2KA 4PWIA 2P42B 1CR9H 1VADB 4L3EB 4M61B 1OT1A 3DYMA 4EUPH 1W72A 4KMTL 5CHNB 1WF5A 2EIEA 1MCFA 3PNWA 4UV4H 5T33L 1RHHA 1FNEA 2FBOJ 5EEZA 4ZFOA 3H7BB 2XNAB 3LKSB 5FUOH 4X6BA 4DZ8B 3BEVA 3D4GA 3V0WH 2J6EH 1QFHA 4LLVB 4IOFD 4JM2F 4PS4L 5TF1H 2NQDA 5I17A 4PVLA 3QCUH 5FECA 3I3EA 5C07B 1GIGL 5FUZH 3OKLB 2XYCA 3FCTB 1U8QA 1YG9A 1H8OA 4DPRA 4X4ZA 1JGDA 4U1IB 2OR9L 1PJ9A 4M43L 4LBEA 1RHFA 4O2FB 4TTDC 1HHHA 1QPKA 4NHCL 4X4YA 5B8CA 4AQAB 2LFEA 2WWNA 2Z7YA 4YIQB 1KLGA 3VG9B 1DUZA 3JWDC 4LE8A 4NYLA 2QSVA 3WL9B 3O4LB 4HD5A 3CZJA 4UOJA 2APXA 3LZRA 4OCMC 4UILH 1MAMH 3AS0A 1DBJH 1BXXA 2AGJL 3UX9B 4Z95H 3QDHA 2AF2A 3MLVH 4PJ8A 5F7LB 1QFWI 4ERSL 3O8XA 3JTSA 5IFAH 3FQNA 3U2SB 2XKNB 3IMWA 3MLZH 1W15A 1J5CA 4B95C 5J57B 1FL3B 2ICWJ 4KJQC 4YOKA 2Y22A 2G75A 1W8EA 2NMSA 4I87A 5AW8B 4AQ1C 2HLFC 4ZTPL 1FYTB 3ASWA 4TQEL 1T7VA 3CIQA 4YPGB 2VZVA 3RVTC 5H2BA 5C0EA 4GMTH 5E2UH 1P5VB 2WIMA 2MOGA 3KEDA 1TSRA 1UQSB 3J7HA 4HC1H 1QRNE 4QRUB 4U1KB 4B5ZA 1JZ7A 4DVRH 3T6WA 1IGYA 3G6DL 3V0FA 3LKOB 4BE6A 2H26A 4F1ZA 1UB6B 2OMYB 3SJVE 3LD8C 4QWWC 4TQIA 2P24A 1CGWA 4OLVH 5LDUA 3UG5A 5F88A 1INQB 2DBLH 3BP6A 2ZAIA 4F3FA 4LHUB 3CHPA 3PF2A 1A22B 1LO3H 3MV7B 3SKMB 3VJ6B 2AJXH 4OF5A 2OMTB 5K39A 4L5FH 4Y9BA 5DLML 2G3XA 4QRRA 4TLSA 4G71B 4G8EA 1HH6A 5E56A 3EJCA 5MENB 1IGFH 2VXQL 3NPSB 1SLXA 3MLTA 1KGCD 1UB5A 2D8KA 3QORC 3ZL1A 5E6YA 3TH3T 2Q3ZA 2WZ0A 3ARFB 3HRPA 2NX5D 2A83A 3MNMA 2X4QB 3OXSA 4PJ5A 2OCCB 4ZPTB 1IBDA 2X6CA 4UTBL 4BKLB 3DX6B 4KAQH 2YD8A 4QD2E 5HTSA 4OLYH 1NLDH 3QUMA 1XSOA 1F41A 4L8BA 3RWGA 3ULUD 4J3SA 4A63A 1AD0A 3NGBC 1C08B 4U6YB 3G7TA 3K2UH 2JKJA 4TL4A 2WIIB 2VR4A 1QSFA 2D03L 2MQCA 5IMKB 2JI3A 2WTRB 1FHNA 3DIFA 3G5XA 3ZJAA 5D2NB 2A4CA 1JGDB 3B7RL 5AB2A 1OGSA 4NJ9L 4JFDE 4NBZB 4YJZL 2N0MA 1H8SA 4R4BA 2NDFA 2O30A 4JO5A 2ZX8A 1YO4A 1ZHLA 2Y5TB 2L7QA 2ZQKA 4JG5A 4ONFL 3HC3H 1VACB 4LSQH 5J89A 1CD1A 4IS6B 4U0RC 5ABDE 2Z1PA 3PGDA 1OL0A 3Q8CA 4K3JH 4N2HA 5TPWH 5K1NA 5HI5C 1MLCB 1JS4A 3LAFA 2WUCL 3DVNB 4P5TB 1CURA 2O5XH 3MCKB 5ACZA 2CNYA 4NBYB 1E4WL 1OQOA 1KCKA 1PZ5A 4ZMLA 5AEAA 3C12A 1V54B 3BQUB 5E5RB 4BFBD 3CH1A 1F58H 4XPHH 4FN0A 5IBLC 5SWZD 1XBDA 3DX0A 3ULUH 4LSTL 3WMSA 4AV0A 1EAPB 4GBXD 3O2WH 2LU5A 3C60D 2ZYIA 2CIIA 4X5XB 1C16B 1K5NA 2PP7A 3F7KA 6CGTA 5IT2H 2YQBA 1TENA 4X6CE 4PRIA 1VPOH 1K3ZA 3WJLA 1UXLA 4HH9A 5MEND 3T2PA 1OB1B 3L3GA 4RH4A 2G0LA 4KRNA 3EO0B 1IU1A 1DQQB 1RJYB 1DLHA 2CPUA 4HWNA 1CN4A 2ITCA 2YEZA 3PWLB 4OR1A 3T2NH 2QKIA 5F9JB 2KHAA 2UXFA 2ZP9A 4HISA 4YR6A 3RGHA 1WUNT 4WWNA 4HXBH 4P59H 1ZSHA 1UGNA 2MQ0A 2OX5A 3EH1A 4N2KA 4OGZA 1IQDA 4FRWA 3K4ZA 1Q72H 3ZRCC 3H2WA 3KPRE 3W0WB 4RVBA 5IV2A 2PNDA 2JNZA 1TSHA 4PJXF 3VTMA 2HN7B 4GP4B 3MREA 4L4TD 4FQ1H 1XF2B 2X6AA 4PI0A 1O0VA 4UDTA 3MYZA 3Q8AA 4I2XB 4FZEH 5D4JA 4E9XA 4Y19E 1UD5A 3QW9A 5IHWA 1INDL 1G94A 1TVHA 2EE6A 4X9YA 4EZJA 3APDA 4TUKL 5T3XD 3QWRD 3RJDA 1DSFH 1RZIB 1Z5LA 5IQNA 1KPVA 4P2RB 4EUPA 3E6FA 4NZRL 4AW7A 2WB1A 4ZQTA 3IMVA 4HUNB 2IOIA 3GBNH 3KPMB 1BFTA 3D12B 4N90E 4U6YA 3PIQA 2H6PA 2YUXA 1SLVA 4HS6A 3V5HA 3ZMRA 4OGAC 2K8QA 5ICZA 2P7TB 3OKOB 3TASA 4IBTA 2BNQD 3VGBA 3ZKMD 5CIPH 5MEPB 2ADIB 1PZUB 2Y5TA 3GJFB 5MP6L 1UG9A 4F8TA 1JF1A 3T3MF 4HOXA 5IIEB 4ODTH 4B41A 2RCSL 1GYCA 1W6WA 1EH9A 5FM5M 3QBTB 5GRUL 1MCEA 4ACTA 3KPSE 3AXIA 2YAFA 1NC4B 1C5BL 1KJMB 2ED8A 4LAQH 5I0WA 3BT0A 4P4KA 4OCYH 3RVUD 1TITA 3LPPA 4AW4A 4Q97A 3A23A 2AK4B 1E9OA 4JG0H 3GSXA 3TWYA 4AUJA 4G11A 4ZFOB 1RK0B 4FFTA 4TQ8A 5FUCE 1G9EA 5TFSH 3VVVA 5T3XH 1TLMA 2YGVA 1NUFA 3HVNA 3OD3A 4QEGA 2EDMA 5HI4C 1YEEL 2AQ1A 2FRGP 2BOBA 2W65A 2VDRB 3ARFD 1KGCE 1CLYL 2YGQA 3U0TB 2I5YH 3UTZA 3ZKMC 3HNVL 2EDEA 3TBVB 5EB9A 3UTSE 1Q0XH 1KDIA 4RISH 3CK0H 5E2TL 3ILEA 4HGKC 4WI8A 2CHZA 5HP5A 4O2FA 4NN5C 1U21A 4FZEL 2ITCB 2YEZB 2QVKA 3MV7D 1YEFH 1BBDL 3DHUA 3O9WC 4KJPD 5CINH 3VQ1C 3OAYH 4JRXE 4A2FA 3DX8A 4DSYA 1F2XK 5C0IA 3AGWA 2ITDA 4I9WE 1YEGL 2GYSA 3CUPA 1JPEA 1DQLH 2OL3B 1OB0A 2P8LB 3ILQD 4AM0B 1I7RB 1DQMH 2IH3B 4OAWB 4WTXA 5TE7L 2LOEA 1SHXA 4JY4A 3BWSA 1EGJL 5L8LB 2HFGH 1MFCH 3KPOB 3FW6A 2AV7A 3FU5A 2CR0A 3ECQA 3K8LA 1QHOA 4NUPA 5G5DA 4NFDA 3UBXG 5C0NC 3S36X 3EDEA 5CJOH 3LPOA 5DWPA 3A5VA 3BEWA 2ZSVA 1DQIA 4X7SL 3HI6H 5CD3A 1B0RA 3CE1A 3ZR5A 3CHRA 4J7RA 1SHSA 4NO5A 5HDBF 5IMLA 4PCKA 4C4UA 2NSMA 1A7QL 3SOBL 1JHKL 2I07B 1EMTH 4QXUH 2K78A 3NA9L 3UO1L 3W0WD 4QHLA 4HV8A 1ERNA 2R4SH 4OT1H 4KROD 4F8NA 1SBSL 3TN0C 4UM9A 2HLEB 3HRZB 2EDDA 4XN1A 3QZWB 3SN6N 2NUPA 2MNWA 1J05A 3RDTC 3GS7A 4Y0GA 3EF7A 4Q0XL 1YMME 2R27A 3D0AA 2W1NA 3G5WA 1NOAA 4CSPA 1PNDA 3MUZ1 5AZEL 4E9RA 1AQHA 2N01B 3SPCA 4O02L 1NMAH 2E8ZA 3RKDD 3TBTB 3Q06A 1EXHA 2QJDA 4R5TA 1TXKA 3B9AA 1UUSA 1H15B 2FSDA 1AO7A 5IBLD 1HSBB 5I8OH 4KJWD 5HVWA 4M3KB 4CVXB 3ZTCC 4WHYG 5IMOA 5GJSL 2YUVA 5FFLA 3LRKA 4ZAKB 3SDYH 3VE0B 5IB5B 3MODL 3IJEA 1K6QL 4PG2C 4LKXA 5IR1A 3HG2A 4IJ3C 3A67H 2X4OB 1XF4A 1B9KA 2AANA 4OZGF 4E42B 1UFUA 2FX8L 4PJCF 4JHBA 2HH0H 4NPJA 5HHVL 4WDIA 1L7TL 4Y16A 1JVKA 4CVUA 3MRPB 4PJDA 2LLLA 1BOGA 2M83A 1OGPA 4B96A 4MZRA 5HHPA 1QTSA 2VMEA 3NCBB 1X5ZA 2FT6A 4JO1H 4HVBA 1D9KB 5E51A 5FAAA 3TJHD 1ZXQA 4GKSA 1EANA 1OSPL 5J7CC 4KI5D 3SDAD 4ZUUA 1WLHA 3B7TA 5E94B 2OXHB 4WNQB 4AXWB 1BEYL 2XNAA 3LKSA 1G9NL 4QOKE 5ADOH 2AW2A 3Q5OA 3QCUL 3OMAB 4GW4A 4HPHA 4J6RH 4GXFA 3P9MA 4WFEE 3OF6D 4LLQB 3MLXH 4YDJB 2B59B 5LHDA 4QKTA 1C12A 3H9SD 1X9LA 1TQWA 4CADA 4J2QA 3N42F 3MXVH 4H5SB 5CFAA 5IUCA 4HJEA 4QHPA 2X2YA 4M6MH 4NQSB 1W72H 5IEHB 1YNLL 3RPBA 5AUMA 4U3XA 2BWIA 3QEQB 3EJYC 3BKYH 1D7BA 2VL5B 4TKWA 3QIWD 4X9IA 3VUAA 1CWVA 4DQAA 3L5WB 3DOHA 4MGXA 2L4OA 1MJ8H 4CKQA 3GIVB 4ONHA 2WYTA 4J3OD 4XNZC 2DIJA 4UTAA 3JWOH 1VFBA 2B20A 2HT4D 4RISL 4ZDHB 3SDYL 3KG5A 3PWLA 4N6QA 2EYRA 4PJGF 4FA8A 5J6GB 4Y5VB 2G2NA 1Z3GL 1DVSA 3VD1A 1CFQB 2F74A 4FMVA 1KXVA 1WD8A 5E0FA 3RX7A 5CBEB 4LPWA 1AGEA 4PJBF 1NMCB 2VLRA 1YECH 1LD9A 3FHEA 4IBLT 3DECA 3AREB 3DSNA 4YPGA 3F5WA 4IKKA 1LO0L 3T4AA 5ID0B 1NUDA 3NZUA 3U6RA 5DURD 2ENSA 4EXKA 1I1AA 3D8MA 1EGJH 3NJVA 1WTLA 3QUXA 5F7BA 2V2TA 3CXDL 2JE8A 4XMKH 1DCLA 1G9NC 3VW3L 3VM5A 3GM0A 2CWRA 5CWSA 4EXPX 4NXKA 4U1SA 1N6QH 4I2XA 4KDWA 4MS6A 4YLBA 3ILDA 1KT2A 2VLMD 3AS3A 2GSIB 5DUBB 3TWCH 5KYYB 4E9VA 1T89C 4L05A 5KSAA 1UWYA 4G6JH 1OTTC 4PEEA 1T2QL 4OIIH 2AKRA 3BAKA 1JWSA 4UV4L 1W16A 4OLVL 5SV4A 5DLMH 3WD5H 2BFGA 4J3TA 3MRCB 4N2EA 1ODUA 3DX4A 5FM4A 4HW6A 5KEZA 2VW7A 2CGRH 5DRZB 4YHIA 1WWAX 2BNUB 2J6EL 5HYSA 3GMMB 5HJ3A 1UWGL 3H2QA 3NMEA 5FK9A 1CLZL 1WK0A 4NRYA 4Y7MA 3V4PB 3KL3A 4DUXA 1V7NL 1NCCH 3HNTL 1N0XL 1WP6A 3KPRB 3VMNA 3HLAA 1KCSL 5EO0A 4XBEH 2XZQL 4MNQD 1NIFA 4PV8A 5D7IA 4U1JA 1HINH 4B5EA 4JFHE 5BV7C 2G5RA 4AZ8B 2ESVE 1HEJC 3ZIYA 2QGDA 3ERXA 4LSUL 3MNZB 3K71A 3CIAA 1H9DA 2RALA 4LASL 3TM6A 3EO1A 4MRBA 1MZZA 2AK4E 3DXAE 4FQLH 4K55A 3QZLA 1AHWB 5INDA 3CLEL 1FGNL 1LP9B 5ANHA 4Y2LA 3CAFA 3KPSB 1KGJA 1KTLB 4PVMA 1RURL 3ZHDA 2L8AA 4E9TA 4XC3L 4Z7WA 4AI7A 1VADA 4L3EA 5EHFA 1IBGL 1N8ZA 3COOA 4G80A 5HHOD 4RFNB 4MWFA 1NC2B 3CC1A 2PPDA 1U6AL 5D93C 3D08A 4RGOL 4YSUA 4UMGA 4AEHL 2P47B 4UOQA 3EYOB 2VC2L 2VN5A 4ALAL 4CDHA 4LSTH 4JO4L 4H26B 4LSVH 3DX8B 2XXMB 5HGHA 2I25N 3D30A 3HMWH 2Q8BH 3K6DA 3W2DH 4ETQA 4G8FA 1ZVSB 2XJLA 3WKYA 1I9IH 2YSTA 4JDEA 5KSAC 4ELKB 4X50A 3BSZA 4K7PL 1CC3A 2AI0H 2D7OA 3UP1A 2Q8AH 4PGDB 2GTZA 1CDYA 4XN2A 3V6FB 1M71B 1SXSA 4PRAA 1NUGA 2CUHA 4L4TB 3SDXE 1AXTL 1KLUB 2BC4A 3M46A 2WVVA 3LNFA 1QFWM 1QASA 3NH7H 5IVNA 3OKMB 1AZZC 1L5GA 4MX7A 1REIA 4PV9A 3TO2B 1U3HD 1L0XA 4OCRL 3F64A 4Q9CA 3MA9H 1G7PA 2O26U 4M62H 3O3EB 2ZYSA 3C6SB 1AS8A 4NO0B 5I1KH 4X9FA 4HDIA 2E4TA 5E1QA 4CSSA 1HNGA 2LV4A 4XCCL 5IJKA 3F84A 1AGDA 5PAZA 3FT3A 3MCYA 3SE4C 5I0VA 2BXYA 3UGXA 2EDKA 2NUPB 1IIIA 2BP0A 4XC1L 4NNPL 5DC9B 2Y9RT 1BX2B 2XG4B 1CK0L 3IJ7A 1FQ9C 3NUKA 4LT7A 4ZQKA 2DMBA 1U2YA 3MA7A 3OJVC 3LKNA 4A68A 3BP4B 1IC5L 3MV7E 4FNQA 3ZXAC 5EO0B 3D48R 4X6CB 3K8KA 1QO3A 5I0DA 2K45A 2VKXA 2GTWA 3AZUA 1ZANH 2EDOA 2P3YA 4R26H 2FJFA 4MQXC 1QFWH 4WUUA 4MVBD 1X9UA 2JKIS 5B39B 4OGQC 2PYFA 4WJ5A 4F9LC 4MDRA 5D1QE 3BP5A 5CEZE 5ECJE 3GSNH 3ULVH 4HIJB 4IEFB 4RAVB 1CGTA 2XWRA 4MNQA 3RY4A 1UWXH 2VDOB 1YN6B 5BV7B 2IH8A 5FIEA 2NXZB 3GRBA 1TZGL 1A1OB 1F4HA 2WLYA 3QPXL 4EPSA 4UZUA 2Z31D 5KTEL 1G6RB 5I6OA 3TV3H 3U46B 4FP8L 5JPNC 2ZKXA 1S3KH 2HPOA 4Z7IA 2JIXB 1RIUL 2ZOTA 5D6CA 4Z3IA 3LEVH 4X4MA 4ZTOL 3NCXA 2VYRE 1KJMA