4W9IC

Pvhl:elob:eloc in complex with (2s,4r)-1-((2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9iC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9iC01
4WQOA 4AJYV 4W9EC 4W9JC 4BKTC 1VCBC 1LM8V 1LQBC 4W9IC 4W9KC 5LLIC 4B9KC 4B95C 3ZRCC 4W9LC 4W9GC 4BKSC 3ZRFC 4W9FC 4W9HC 4AWJC 4W9DC 3ZUNC 3ZTCC 4W9CC 3ZTDC
chains in the Genus database with same CATH superfamily
3V5HA 5LBVA 4L2YA 1KTLB 2Y2TA 4IMLB 1IEHA 3TBYA 1NPUA 2ZOLB 3OAWA 3EF4A 2OCFD 4UANA 4GAJH 1HZLA 1UB5B 1H9VA 3B1TA 4XVSL 4K2UL 1E5YA 5ITFA 3LRKA 5TFSL 4PGCA 4IRJD 4EQ2A 1BYPA 5BV7H 4KITB 5FW8A 2DLHA 3MOAL 1KPRB 3QFDB 4K15A 4FG4A 2ZG1A 3SO3B 5GRUL 2GSMB 4FYTA 1FLRH 1BZOA 3CQPA 4EDXA 2P5WE 3O9WB 1S9WB 5KG9B 1DEDA 4U1KB 3BCFA 2YUZA 1S7QA 4N2IA 3DX7A 2H3XC 4JGJA 1JWUA 4B5ZA 1JZJA 1OOWA 4EDWL 3MLVH 2NY1D 5CKGA 3UOAB 1TJIH 2MNJB 4OCWL 3ASWA 2QPFA 2X4PB 1UOLA 4FA8A 1J1PL 3KXFD 1SDDA 5KYXB 1BVLA 1TJHL 3I02B 1P4LB 5GGVL 1I7UB 4HHAB 5E2JA 3WXWH 4HU8A 3NIFE 2MCG1 2AEOA 4MNQA 1VEMA 3KWVA 1BGXH 2YEZB 4XMLL 4FF9A 4FEIA 3PNWA 4G6JH 4HBCH 5FUZH 5EBWA 5AZUA 2ROYA 2J8OA 1XF5B 2ZX5A 4A63A 1LDPL 4C4UA 4JLRA 2ZZUT 4PS3A 1FL5B 4MYPA 4JFFE 3W2DH 4QRSA 5J13B 2KQNA 4PIRF 5HYSA 3KEDA 3IMBA 1KEGL 1A0QL 4NLHA 1BFVL 5DTFB 2DM3A 5FEBA 2MKWA 3PFUA 3AAZA 2JCCA 3VFWB 3T09A 4WWKC 2BNQB 4DN4L 3I75B 4BH7A 3C2SA 1P6FA 3SPCA 4JPVH 4P2OB 3SQRA 3LPFA 5E9NA 1MAMH 1BECA 1PQZB 5BO0D 4ZTEA 5FO8A 2J7LA 2BVQB 4OZHF 5JZ7D 5IOKA 4JHAH 1QLFA 2KZWA 2JTDA 3O81A 1F3JA 2OYKA 3OHXB 4MAYA 3DV6A 4R8WL 3ZE2B 3ZU8A 3M17B 5KJRL 2F74A 1DANT 5CZRA 3ZHFA 3NEOA 3RTQB 3OR7A 1QUPA 3RZCA 3ARFC 1QLEL 3QJFA 1AMXA 3IGAB 2XZQH 1MPAL 5J12C 3RVTC 4PRPB 4A7QA 3CX5J 2HVJA 1JZHA 2DWEB 5AAWC 4WTXA 4AQAB 4I4WA 3GZPA 3KBEA 3N43F 4K7PX 2D03H 3VXME 4YMPA 1MIMH 1P1ZA 4F93B 2VLME 3OKNB 2WJ7A 4F3FB 4QOKA 5J6SA 4H8QA 1EZVY 4EIZC 4JFYB 4UZSA 1KJ3L 1JDAA 2IJ0C 5AQ0A 1AACA 3D5OF 3K4DA 5F1IA 5IJBC 4HKBB 2WVTA 2G9KA 1JV5A 3WL9B 4XNXH 1P9MA 4TVUA 1JXKA 3P9LB 1A66A 4ZMOA 4K0OA 3OSVA 1T21A 3GDCA 2FVNA 4Z7UB 4CMMA 1R3KA 3S4SA 5KSBE 1GSKA 3ATBA 1HKLL 4OGZA 1OCRB 1CU4H 2IXQA 5GGRB 1PZ2A 2R56H 2WLIB 5DJYA 2DQGL 2BHFA 2HRHA 3RDTD 3I9GH 3M1OA 4W81A 4PJGB 4QO1B 4GI6A 4U3XA 4PMEA 4UTAA 3IMTA 1WYJA 5IVOA 3RI5K 3RX8A 5ID0A 3OMAB 3AG3B 1AGCB 5GS2D 2X87A 4J39A 1JGLL 3AFLA 4X6CA 3NA9H 1T04B 4IDJL 2C5DC 2ZP9A 1JOIA 3VDBA 3L3GA 5TE4H 4XHJD 2CNZA 3K2IA 2YUXA 3OJVC 3P9WB 3ZZ1A 3SODB 2QFPA 5JA9A 2PR9A 3MRBB 3JBG7 4B0MB 1HXYA 2WW8A 4G2AA 4NZUH 5IB1A 5C07A 4BZ1A 2XN9E 4FYRA 5B1AB 3S5YA 5CZXC 3PP3K 4LRNH 4XCYB 4LNRA 5AW8B 4LSSL 1XGPA 4NAJA 3VGHA 1MFBH 3VXNB 3OGCB 3QXTA 2DLTA 1NFDA 4OCNC 2IPTH 3C6SB 2WOBA 2DWDA 1L7IH 4BIKA 1NMAH 3HE6D 4CSZA 5D93C 4FQ1L 2A1WH 4U1HB 4P2OC 3BWAB 4YBLC 3DV4B 2EYTA 3GYRA 4R4BB 3VE0B 2BSDA 3WEOA 1UD3A 4MAZA 1KYFA 2M83A 4CJ0A 4HJ0D 4ODXB 5ANMB 3GBLA 4S2SB 3GB7B 1KXTB 2KC0A 4YEFA 3QDJE 2W88A 4XCEA 1WEJH 3MREB 3G6JB 3UJIH 4LLUB 2MQCA 5ACZA 3ETTA 3DDGA 3RTQC 5KBPA 4XC3H 1A3QA 2F08A 3DC0A 2QVIA 4G42A 2VLKD 3KPSB 5CNHA 5B3JE 3N1GC 5C0CA 2CJ3A 4G1MB 5DF0A 1URZA 3NPZB 2IF7A 4E36A 1XZ0A 4G8IB 5G4NA 4S1RL 1QO3B 3ZTNL 4XBGA 5FGBA 3DDFA 2IQ9H 3O2WL 2X4UA 1QHQA 2ZCHL 3B8SA 4FNQA 4PQXA 2PWEA 2WTOA 3PXHA 2WO3B 5D2NA 1HINH 4OCYH 1YYMH 3DX4A 1LE5A 3S35L 3UJJL 3T4YA 5IR1A 3KPMB 3ML9A 4H2AA 4ZPTB 1KB5H 4OM0L 3OB0K 2VLJB 4YS4A 3CSYB 5JHDA 5DYOB 2H32A 1AZNA 1LEIA 1NCDH 2ITEA 3V7AE 4RMTA 4TTDC 4B9JA 4NYLB 3FKUS 4OCMC 3R0NA 2X0WA 3DETD 4MQTB 1MWAL 1OAQL 3MLYL 4YN3A 3KGUA 1FNFA 1U91B 3CDGB 4PRNB 4XCFL 5A3IC 4HAGA 3ML8A 1NLBH 1HXKA 2DTML 2E27H 3LNDA 5FK9A 5HHPB 3DNKA 1HH9A 2V2WA 3D39A 1Z9PA 4ODSL 5IHUL 2WVVA 3BX7C 3IEAA 2E9JA 4HX1A 4LO9A 3CHQA 4MSWA 2PTUA 2XG5A 1EJOH 2V17L 3BGAA 2VOTA 4MNQE 4S0TD 1C12B 5F88B 1LO4H 2XWEA 2VMCA 2YQ2A 3CFKA 3O9WD 4MB5A 5FUOL 4RZCA 3VFOB 4BK5A 4G8AC 3Q1EA 1T1YA 2NXYC 3Q8AA 1TTAA 3COOA 1ANUA 4G5AA 2C8NA 2YXVA 4G9FB 3KZ8A 5EUKB 1WSST 4Z7VB 3LD8C 3U4AA 3U2SB 2HMIC 5E6IC 4I1PA 4L4TA 3WFBL 4DP7X 2Q6WA 2EUXA 5EPMB 1B2WL 2RBLA 4KI1A 3FB7B 2R39A 1RHHB 1GIGL 4AW4A 5T5FL 1CGTA 2ARJA 5GGQH 2AK4A 1RZJL 3ZK0A 5EEWA 4GAYA 5EF3A 1VFBB 4MGXA 2BIOA 1SVZA 2WUCL 5K1NA 4GRWH 1EHNA 5B4MD 4LLVB 3VXUA 2XFXB 1CE6B 2WZPA 3GSXA 3EO1B 2ATAA 4GSXA 2NY3C 3N40F 3D4CA 1WIPA 3IRCA 4M8QA 4OFIA 3BFQG 4XNQB 2MMXA 5JW4N 3ERXA 4UTCA 3HFMH 2BNQD 1A4JA 4GT0A 5TJWK 1ID5I 3SDCB 5I19L 3B6SB 1KTKE 4MJHA 2CKBB 3GRWA 4P2OD 4YZWA 2IANE 3FHEA 2YXFA 4HF5H 4OD3L 1KCSL 3DXAB 1FG2B 4Y4HA 3QDME 4I77L 1H0DB 2EDJA 4MDIA 3ZGIA 5SWZE 5DWUL 4UU9B 3B43A 3B2UC 3BWZA 2WLKA 3QP3A 4FQLH 3IFPA 2BNRB 4JG1L 4JUSA 3CMOH 3FUKA 1RZIA 4NFDA 5BVPH 3DJRA 4JPQA 3OAUH 2WP3O 4OQ1A 1BFSA 4O02H 4XCCL 4UTAH 2Z0BA 1E4XH 5E2UH 4PRPD 4W6YB 1E43A 2GIMA 3VWKB 2UY6A 3BP4B 1AI1L 1M7DA 4R6UA 2FJSA 1YUHB 4LSTH 1GYUA 1ZANH 1KDIA 3LSOB 4MAUH 5BOPA 4PJ6A 1F4WH 1OF0A 2GAZA 3NN8B 4MTMA 4N8VA 4TLUA 1DBBH 1CT8A 4ZT1A 1IZKA 3ZDXE 2EVHA 1JHLL 2FEEI 4BZ1H 2ORBH 2V7NB 5ADPH 4DO4A 4QRRA 1MWOA 3BP6A 3EYFB 3V4LA 3SDDA 1U8QB 4ICXA 5DJXA 1H3UA 4KKLC 4LVHC 1E65A 3VXRB 3MLTA 4PGEA 2ZOOA 5E8PA 5I5IA 2K4WA 2GUYA 3V7AG 4RIRA 2FATH 1YZZA 3IETB 1NKOA 3FTWA 1Y18A 4YE0A 4ZPVB 4JO2L 2K6WA 2X0VA 1W8NA 4X6DB 4PJ7E 1PG7H 1A65A 3P54A 4LAQH 1IGMH 4WU7A 4C4KT 4FQXA 3C9NB 1GHFH 4A6YB 3OD3A 4ABVA 3F62A 4L4VB 5KSAA 5C08E 2ATPA 3REVA 4OLWL 5I1JH 5E23A 1C1EH 1SLUA 3K6SA 1ZS2A 4NAMA 4ZO7A 1TZOA 3O45A 2IPKA 5IBUB 3WNOA 3RRQA 3TCLB 2Q76B 5BQ7B 4XVOA 5ACLA 4QRPD 3HS0C 2KDYA 4OTXL 4JFQA 4WFHE 1XTLA 4YE4L 5D7IB 2H0EA 2XIIA 4HIEB 1IGFL 4IRJA 4AL8H 5HVHB 5AEAA 1MCQA 4AW7A 2IH8A 3FO0H 4JQXC 5DK3A 3N1QC 5DK2B 4XGZA 3BAJA 4DQOL 4AIZB 1E5BA 3QWOB 3SDXA 2BP0A 5CCJA 1JVKA 4Q4EA 25C8L 3GSUB 2E7MA 5T3ZE 2HKFH 4F7TB 1XGUB 1MLCA 4B7LA 3NIDF 3SDCC 3CN1A 3H7BB 4GSRA 3OKLB 3P9MA 4LEOA 3UFIA 1JTPA 5IK3B 3IJEA 2V3FA 1KGCE 1UT2A 2WWNA 3KYAA 2H32H 5LCVA 1HWGB 1BW8A 1ZWIA 5A6MA 2F53E 3BUBA 2GUOB 2GVYA 2JJSA 4XO5A 2RA1A 3KXFA 5IQMA 3LNEA 1I7RA 3Q13A 3INOA 3VI4F 1R47A 3KPSD 4L1LA 4V2CB 3CFBA 4RSYA 4N8CL 5CCGE 4WLCA 4XMTA 1P4IH 4NAQA 2ADJA 5ETUA 2D0FA 3NJJA 4XP4H 3VI3A 4R4ND 1OIOA 5TTRA 1DBKL 4CN1A 1M1SA 1M56B 3L4WA 3UH8A 2PYEE 1OGTA 2GHZA 3U7WH 4B9CA 2BH0A 3A0OA 4KROC 4ZUUA 2W59A 4OF8A 3RUGA 2B16A 2BVPB 1DVXA 1MAKA 4QHUA 2ZWLT 1ETB1 4I7ZC 3MACH 2VLJD 2NY5L 2UUDK 2UXGA 1A64A 3CBRA 1LP9F 1KT2B 1MHHA 3AJ7A 5F0JB 4QXUH 1L0QA 4HMDA 5EOCH 2Z1PA 4TUUA 1U58A 2XJKA 2R9HD 4PUBL 4AYMC 4M1DL 3WAKA 1FL3A 2F6AA 3DVGA 4U6HB 3BAEH 4BH8B 5CJ5A 2EDNA 1OGSA 2V9RA 3UTQA 3HZYB 2F5AH 3O8XD 4Y5XC 4W9KC 1YAZA 4R5VA 3SYCA 5ALCL 1QYGH 4OR1A 2F58L 2DMKA 1AGBA 1MDTA 5B38B 1J18A 1N6QH 4RWHA 4WHTB 1L3WA 1L7TH 1I3VA 1TJGH 1W8OA 4MD4B 1GGCL 4YLQT 2CLZB 3LXBA 2H45A 4L8BA 2VN3A 2W1NA 4A2EA 2PTVA 4FI6A 5I8KL 4BXSV 1YYLH 3VFRB 1UZ8B 1OP3H 2D7TL 1ZGLM 2EACA 4C83A 4UOW0 4G9FD 3GRWH 3CZFB 1K6QH 3CFEA 3N1PC 5C8JB 4F33A 3UTSB 3ATDA 4LASL 1NFKA 1DO5A 3IT8D 4WGWB 2XWTB 3DO4A 2GK0B 1KLUB 2B8OT 1V7NL 3QT2A 4PG2A 1TPXB 3RWCA 4LHJB 4XVJH 3VFMA 4XNDA 3P3TA 2P8PB 1BAGA 1VJSA 1FBIH 3DMMB 2DZEA 4RGNE 3WNIA 4LMQE 2FIRT 5FOBA 1E3ZA 2ITCB 2VE6B 5EU3A 1W6WA 4HZLA 1QBML 4P5SA 2BS8A 4EI0A 3B7YA 1R24B 4YHLL 4RLDA 4DK6A 1QZ1A 1IV8A 3QCTL 1E2WA 4WEBL 4AENB 1DQIA 2BSEA 4YQXL 2A9ML 3L3OA 4E0RB 2NQ3A 4YDZA 3PL6C 4ALAH 3BQUA 2YZ1A 3X1BA 1DLFH 3LX9A 5DVOA 2JB6A 3LKQB 1U41A 4CADB 4K3HA 2GCYA 2AV1B 4MMYA 4NQEE 5T3XD 5TE7L 3DXAD 4OVVA 3N06B 3LRLA 5AVTB 2A7BA 3NFPA 3HE6A 5BO1H 2ERJC 1SYSB 1JYWA 4QRRE 3BSZA 4PCTA 3UPAA 1VFOA 1ZV5A 3BE1H 5GXBB 1GC1L 3BHBA 5HJ3A 4WI4A 3MRFA 4NQCE 3WAJA 1NMBL 3V0DA 2H2PC 1UQSA 1UXLA 3VWKD 2BZDA 3MNVA 1WPCA 2RH0A 1J9RA 4R9HA 4NNXA 5D6DA 3T9WA 4OCRL 4PJIE 3VFGL 3HPJB 3MRLB 4ZZKA 1JPGA 1PZAA 4ZFGL 1IC5L 1UT1A 1QX1A 4YSTA 3CH8A 2VLKA 4QD2E 4LGSB 1J8RA 1QRKA 1D9KD 1OAYL 2HRPH 5DUJA 1V55B 4NRXA 4DSYA 2VTFA 3DX9B 4ZRGA 3D0VA 4C56E 5FYLL 3QQ3B 3G6DH 1RIUH 3WU1A 3X17A 4LBEA 4JO4L 2C3WA 2DQCL 2XQYA 3VXRD 3CHXA 4G7QB 4NENB 3QISA 2VDNL 4NBYB 5IB3A 4JBSA 1ZAGA 1KBBA 1X9UA 4Y4KD 4ZMYA 5K9JH 1JRHH 3X3GL 2K8QA 1PJWA 3KLHC 3L3JB 4ZXBA 3NIGF 2WLJA 4A37A 1RZ7H 1D5ZA 4W9ZA 2J72A 1KCVH 4W4OC 1DLHA 2XIDA 3BGMA 4HJUA 5T1DL 3CPLA 5DJ8A 3TBSB 3GHBH 4QDGA 4BGDA 3VX0A 3EFDL 5E2WL 1KTLA 2LFGA 1IGYA 1SXCA 4XNBA 1QR1B 2PO6C 1D5RA 1WAAF 1P7BA 2G2PA 2PPDA 3DMMC 3K6DA 4HQQL 3KLSA 1OANA 3CFTA 3KJ4C 2R1YB 2JB5L 2WJ5A 4Z8FL 2ZX6A 1KPRA 3I3BA 3MV8B 3FAXA 3HCVB 5IGXH 3UO1L 1ZT4A 1T3FB 2VC2H 3FFOA 2FSDA 2D8KA 4TSAL 3O9WA 4MX7A 5DD6B 5KG9A 4WNJA 4ES8A 4I8DA 1WIUA 3U36B 1Q8MA 1T4KB 5KAQG 3SE3C 5KS9B 4BINA 3QEQB 3RG1C 2GPZA 4H1LA 4HK0A 4Z95H 1OAZH 2WWOA 1DE4A 3FFCE 4GT7A 3PWNB 3T77B 3NJFA 4N28A 4R90L 3HR5A 5GGTL 4FFVD 3QDGD 4I9WD 9CGTA 3QHZL 4LNVA 3QUXA 1VACA 2X4PA 4G5ZL 4Q4IA 4HJGB 5J6GB 3GLDA 3WUWG 3OKEA 4A2DA 1E27B 2VZ1A 4I48B 4F9PA 5KYXA 4OLZL 2MCPH 5IHZB 5AB2A 1I7UA 3CVCA 4FFYA 2BMKB 5E8OA 2G9HB 5AKTA 2DI8A 1QKZH 1WJ3A 2YEZA 3WLBA 5E5MA 3MV9B 5FKPB 3ULSB 1LEGB 4HEME 4LARH 1O7SA 1XF5A 4PW3A 5KJ7E 1VGEH 5JXAH 2HCZX 2Z7ZA 4XNMA 5FECB 3NP4A 5DMKB 2VR7A 2BIPA 1CIUA 2HA1A 2OR7A 2P24A 4UT9L 4KDTC 4AGPA 4MBRA 4QGTA 5F72S 4FABH 3LQAC 3ZOAA 1I9IH 1MFCH 1CD8A 2WZAA 1DUYA 3ECVA 4RNRA 2DWTA 1Q94B 1DTUA 1YLBB 2BNQA 4O2EB 4AYDC 2YJLA 1C9SA 1EQWA 2D3VA 1NGZB 3QH3B 1PQZA 1MFEH 2X4NB 3BWSA 2B1AL 3FHQA 2XN0A 5T1MA 2NW3A 5EC2B 5ISZB 2BVQA 1ET7A 4ZO9A 1HHGB 5AVYB 4FDWA 4UM9D 1CZ8H 2FIKA 4QRTB 2YC1B 5GGSB 3V0IA 2J6WA 2JCCF 4PRPA 5DMJB 1J9SA 1QSEA 2FT8A 5GS2H 4AQAA 1A4BA 1RULH 4M61B 3VGEA 3O6ML 2VITA 4OLVL 4WW2C 3WY1A 4QT5B 3NJXA 4JFYA 5DC2A 1D3CA 1UA6H 2B0SL 4PI0A 2O72A 1GY2A 4HKBA 2YQBA 1GZHC 2EXWD 2R69A 5JOPD 5E2VL 2KBGA 1XD1A 5DDHB 3GIVB 1LO2L 3SBPA 3KDMB 3E8UH 5DQJB 3DSNB 4GKOA 3UTSD 2DI7A 3GXNA 4AIOA 4GRWF 3QG7H 3IPFA 3L9BA 4NUMA 1IT9H 4PJ8B 4FHJA 4XAKD 1YG9A 4N1EA 1P6WA 1KTDB 2M26A 1UFGA 3ZL4H 4BUGA 1MNUH 4PGDB 1Q0EA 4WI9A 3BSZH 4LDOB 4OFVA 4QO1A 2AQ2A 3T0VA 2VLLB 1GS6X 2PCYA 1CDGA 1LO0H 4F9LA 2QL1A 1KELL 2EH8L 1V7ML 3GXDA 3IKCA 4FQIL 4N9GA 3UX9B 1HCYA 3O2DL 1KCLA 2PCFB 4QRPA 4DESA 5FHBL 4GRMB 1B9KA 4OIIL 3CSGA 1ZY9A 1C08B 2ZKHL 1HK6A 5AW7B 3S5LB 2KQMA 4AITA 5AW1B 4YHIA 4Z77B 3FQRA 1ZLSH 3WFCL 5EOCJ 1L5GA 3ZDXF 3BAYA 3VXNA 4BSWA 1ZCRA 1G7LB 4TNEA 2ICWI 1BQUA 3QJOA 1KGYE 3NTCH 1DVYA 5JMOC 1UFUA 2OTWA 4X6CF 4AQZA 4W9HC 3VXOB 1F4XL 4NM8L 1IKFL 1WS8A 3FN9A 3MJ6A 1S3KH 4RFOL 4XPHH 2ZXQA 4JKWA 3DJTA 4B3VA 2ED8A 1EVUA 3QC5X 3IXAB 5G4OA 3O2VL 1ZT1B 4L9LC 1I4FB 3GB7A 1KXTA 1W91A 3IDGB 3L5HA 3OVUB 2ARWA 4FG2A 5DD3H 3HRZC 1KY7A 3QO1B 3JWDC 5I73B 1S7TB 3QGVA 3OHMB 4EZLA 1NPNA 1RVFH 5AAMC 2QTVA 5HHOB 2HFFB 1FVEB 2CGRH 4IS6B 1NFDF 3SGEI 3CFDB 3KPSA 2CH8A 1RZFL 2KZBA 5DD0L 5J1SC 2ADFH 1Y1UA 5E6YA 4K9EL 1SXNA 3MRIA 4LCWB 4XMVA 4PVBA 2D9CA 4YK4B 1IFHH 4OT1H 1QO3A 1PD6A 2P9RA 3IBEA 2J8HA 3EJJX 4NKIL 5FW7A 2QDVA 4BQ6A 4JNXA 4RRPM 4IEFB 2BPBA 1AXTH 1J8HB 4JDZA 4Q9QH 3VVWA 3GI8L 2EE2A 4Z3JA 2EEAA 1J88A 3OLIA 1I8KA 3ZIMA 4HKXB 1R46A 4OUUB 1CD1B 1HH6B 2ATKB 4RWYL 3AGVA 5I1LB 1WA1X 4G6ML 3CSYA 2E7HA 3IDMA 4H1LH 2C7FA 4PJ8C 3SQBB 4QMEA 2O61B 4HOMA 4NYLA 3H42L 3G5WA 5GS3A 2UZIL 5H4ZA 4MJJA 5FM5O 5DR5H 2NY4D 1BWMA 3EYQC 3NSCA 2WV3A 4PRNA 5IB2B 3EJYC 1W0YT 2LT9A 2CA3A 1I82A 3BIAX 4FFYH 3US1A 2BZCA 3O8XA 1IBGH 2PR4L 3L6FA 3MRNB 4FL4B 4PB9H 5FDYA 5TDNB 1XH1A 1U95B 5CZVH 2YD5A 1NAKL 4DQAA 2DDQL 1OL0A 3HNTL 3RWGA 2ITDA 3LRSA 3MV8D 4R26L 3L2NA 1B6UA 1C12A 1KJ2L 4NDMB 1BQHA 1BLNA 1NCAL 5IT2L 5E6ZA 3ZZQA 2DY2A 4YDKL 2MCAA 4CGUB 4KZDH 4WHCA 3QEQD 3MRHB 1O6SB 5DLML 4G9FA 2PPEA 4R2GB 5EUKA 4Z7VA 3FUNA 4XPTH 1R3HB 1N2RA 1YEHL 1MG2C 4XPGH 3T0DA 3W11D 4GQ9H 2F61A 2R4RH 1ZVNA 2J56A 3T2NH 2IG2L 1MRDH 2AJSH 5TDPA 2R4SL 3FB7A 3SCMD 2XPGB 1T5KA 3QEUA 4QHLA 2BNQE 1KLGB 3ARGA 5A2LH 4DNLA 4U2YA 1MCCA 3OR6B 1T7VA 3U4BH 3MV9D 1T0OA 5LGHH 4B5EA 4GG8A 3HZKB 3FDWA 4WW1B 2LHAA 2AGJH 1MCDA 3IDUA 1P4BH 4P59L 2Y1VA 2WWKT 4QXGH 1DANU 3EOTH 2XFXA 3TV3H 1CE6A 5DEFA 3IGKA 2GT9B 3EO1A 3ZE2E 4P23C 1BVNT 1R34A 4M7LT 3TJEL 2WKOF 3VCLB 4AH2B 1MVFA 4QF1B 1B0RB 2B4CL 4MA8L 4XNQA 1MRFH 4PRPE 1PZCA 2VKWA 2PUQT 3TYFB 1C5CH 3VAEA 1DBMH 3FO1B 3TPUA 3RNQA 4E9TA 2VABB 1MCRA 4G8GB 1VFUA 5F7LB 2CKBA 3CFUA 5EA0L 4A2HA 4Y9GA 4JREC 4NRYB 2JKLA 2ZUXA 4I3RL 4P46B 3VGAC 3AREB 5GRXG 4JRWA 4MWFB 5ISZD 2LU7A 1G9EA 1MCIA 1MKFA 2J21A 5BZXA 2FGWL 3T0WA 4C59B 3AY4A 1CE1H 4HFUL 5ESAA 2WQ8A 3K72B 5CP3A 1ONQB 1BVOA 4XVSH 4K2UH 3S3SA 1LEKA 3U7AA 3U6XA 4Z7UE 5FYLD 1O5DT 4GI9A 1CWVA 3D7PA 3GTTA 4IU2B 1AGDA 2B08A 3VWKA 5DRWB 3WJMB 3BP4A 5MI0B 2I9TB 2Y7OA 4LIQL 5GRUH 5BW7C 1QPXA 1YEGH 5TPWL 3BZ4B 4FL4C 3K81A 4WEMB 2UXVA 4PJGE 1MIEL 5L4IA 4LSUL 1B4TA 2J1KA 1D9KA 2GJ6E 1GR7A 5ADOL 1EANA 4O58L 3NG5A 2X88A 3IB4A 4OZIA 1ZT7B 4PJ9C 1NA8A 3CFIC 3SOBH 3UTPE 3EYFA 1U8QA 2WBXA 3KPOB 1PEWA 4G3YL 4UQEA 3SE4C 1FORH 3HC3L 5IROD 2FUTA 1MWAA 3S8FB 1TJHH 2H0JA 1G43A 1K8IB 1E0OB 2YK1L 1SEBB 4HUKB 4Y4KA 5CGBA 3VXSB 1ED3B 1AVAA 4HXAL 1F3DH 5I1AB 2AC0A 1DL7L 1EHAA 1HOEA 3HI5L 3IWUA 4Q0XL 4HVBA 1HC1A 1X7QB 3EIFA 4X6DA 2CG9X 1TJXA 3BP7A 3C9NA 4Z78B 4A6YA 3HKZA 4A2MA 4TNWF 2F68X 2BERA 4WSGA 3MTXA 4C57C 2IDCA 3GDBA 4IMKC 2WUBL 1MVUB 3WEBA 1UWGL 4HXBH 5JIHA 3CAFA 3RBGA 1S9VB 3EHBB 2VQUA 4RFNC 5BQ7A 4NOFA 4UT6L 3SD2A 1KPUB 5SX4I 5E9DD 5ANME 2X6AA 4PJIF 4PMFA 3OXRA 5I76A 3L1OL 5EU5B 4ZMWA 1HXMA 4DN4H 3G6JE 4LOUC 3HG2A 2WB1A 3FYEB 1SDYA 1H6EA 4J8RB 2WBJA 4LCYA 4OIBA 5HGHB 5JHLL 2APWA 5J56B 3KPSE 2EDBA 1UEMA 3MGAA 1WP6A 1WICA 4KKRA 2OJ1A 5TH2B 2DLIA 4KRPB 3QRLA 4YHNB 4NBXB 3V6OA 5T5FA 4XPBL 3SGJA 5KJRH 2XV3A 1UGNA 1G7QA 2DB8A 4LT7A 5IK3A 4P46C 1NDGB 4BCZA 4MDJB 3HKFA 2EKSA 1I3RA 1QLEH 3W0WE 2FYYB 4CN4A 3V0GA 1UM5H 2VXQA 3HB3B 3M8OL 1A5FL 1HSBA 2H26A 2ZKXA 5JOFA 2YOCA 1D7FA 3QDGA 4KK9D 3KYMB 3OG6B 4Y5YC 3GUTB 5HHOD 1GZPB 4GQZA 5B21A 3BPOC 5EZOH 3SDXF 2VLJE 1IIIA 1LHZA 2A6IB 1C5BL 1N67A 2UY7B 4LCWD 1JP5A 5MI0C 1COBA 3BIBX 4KTEL 5JPNB 2HH0L 1FNHA 3CV5A 5D8JH 4ZI8A 3U0PB 1VKXA 4IRZL 1OXYA 4FI8A 3TTSA 2CJSA 5EOTB 4RDQG 3CZSA 2Y1AA 4KC3B 4HMCA 4GAGH 3QG6A 4AYEC 1A6UL 3ARDC 4OV5A 3HG4A 4U1JB 1S5IH 3UBHA 3F00A 1S9KC 1NINA 1CFNB 5EHFA 1I8UA 2FWOA 5DT1L 2OMZB 4ADGA 4CMHB 4X5XB 1EAQA 5FW6A 1JZ7A 1MI5E 1U8CA 5F89B 2HLFC 1JAEA 1MREL 3CK0H 3WEXB 5EU6B 3IMVA 4NERA 1SQ2N 3N44B 3VI3F 4KZEL 2R2CA 2X6CA 5JYLA 5GZNC 3F83A 4FZ8L 1ZPUA 3QUZC 1ZEAL 3G5VA 3F58L 2E9GA 4YDIL 3X12B 3GMLA 4PM1A 3A4DA 4U6HA 2WQVA 4UM9A 4YXLH 3TBTA 4OFPA 3FUHA 5DZAA 3TO2A 3RUGF 1PBYA 2YHGA 4G9FE 2C3GA 1N5AA 3MTRA 1QI4A 1RPKA 4PJAE 1VZIA 4NQXB 4LSSH 5I8EB 1PMYA 3EHBC 3RA7L 3TJHC 3FBQA 2BHYA 1EIBA 3KYOB 4PJHB 4WHTA 4LHQB 2GITB 3RY5A 3NSFA 3WHXA 4ZNEE 5C3IA 3P3UA 2RB8A 4NUGL 3BT2H 4ONOA 5DS8B 5FA3A 3OZ9L 2GJZB 4P57B 3VFRA 4AJVA 5DA0B 1KXQA 1UZ8A 2WYTA 3ZL2A 4I0PC 2X6VA 4HK3J 4R2GD 4Q2ZB 2CKBH 4PVLA 4JGHA 1TQBC 3CZFA 3MXWL 1EXGA 5C8JA 2ICES 1G1KA 3QPXL 5T3XH 4YHZL 3UTSA 1A9BB 1A47A 1KYOJ 1SBSL 3CFQA 4XP1L 4WNQB 5J0BA 3TEZA 5KTEH 1SF5A 3BH8B 2P42B 4ESKA 4OLYL 3U4EB 2NTFB 1KLUA 4FLRA 1RIHL 3ILPB 4UDTA 2J6EL 5CP3H 4F15C 1FNAA 4WI6A 3V0WL 2I7OA 1MCJA 2YMXH 3ZTNH 1M3IA 1XB8A 3DXAE 5F3BA 2P8PA 1DCLA 2Z8WC 4WU5A 5T3XE 5AOMA 1I8IB 2J88L 2QGBA 3UADA 5BNXD 7FABL 1YYCA 2X4RB 1M2OA 4F2FA 2PCXA 3EGDA 1A6VL 4GY4A 1YMHB 2BNRE 2RQEA 1V3JA 2VE6A 3QORB 3BN3B 2DWXA 1JWSA 4X5WA 3UJJH 43C9A 4GSQA 1S7UA 4PBVC 2W80C 4OZGA 4D3CL 4MRCA 1OO2A 4OM0H 3RKDC 4AENA 5KYWA 4E0RA 1S2EA 3BVUA 4G83A 1E9QB 2NZ9D 3LKQA 1I8LA 3MV11 3PPEA 4G8GD 4U6YB 2SEBB 2EINB 3C8KB 2X41A 3L7FB 4M4RB 2XJLA 2YARA 3SSGA 1PPIA 1MWAH 3FU8A 4P3CL 2WTRB 4OFDA 3ARED 4LRIC 4JL1A 4L23A 1XR8B 1DSFH 2DTMH 4TNVK 4JN1L 1D5XB 2I24N 2R0LL 1A3LL 3CXFA 4IDLA 4JM2C 1FA4A 3VXRE 1EZVX 2YXWA 4J3VA 3M86A 4A6YH 2VDML 2DTSA 4WO4A 1ULVA 1MZYA 2VLRB 3BGFB 2PKDA 4DVRH 3KPNB 3LIZL 2V17H 2WBWB 2J5LB 4XMKH 3HPJA 3MBED 3QHFL 2FGZA 1U8NB 4XZ4A 3RWFA 3MJ7A 4I5BB 1R3IL 4AV0A 3L4YA 5BRZD 4UNVA 4KBPA 4K5PA 1OT2A 1NH6A 2VAJA 3C08L 2NOYA 1CG9B 4HT1L 4L3CB 3HOGA 2LAGB 2YOAA 4Y0GA 4L4VE 1I7ZB 1CD0A 1CR9L 1SOKA 2HLAB 5DFVC 3TBVA 3WTTA 2IADA 1CDBA 2QHLA 5FM8A 1SJHA 2K7QA 2QQLL 4OJYA 4PP2B 3WFBH 5MEND 1XAKA 5FB8A 4HS3B 4G1EB 2MIZA 2QGCA 3VXSD 3BDYH 3D3VB 5HHXL 1KJVA 3I50L 3AU1A 1ZD6A 2A3TA 5D7IE 1OVZA 5LB1A 5T5FH 3RPKA 2DD8L 2IDTA 1NCBL 1I9JL 5TE6L 1TETH 4EF3A 1JZDC 3V4UL 2JJVA 2VXQH 1RUQL 4PTTB 1XGYL 3TASA 3N41B 1GA2A 3BD5A 3IF1B 1DQDL 1JYNA 4M62L 2WNGA 3VFUA 4LPYA 4BHUI 3HNSL 3E1ZA 4AGLA 2RQ8A 1ZJAA 2AAVA 2AZAA 4O2CB 1AO7B 5GRYA 4ZDHB 1MCSA 3PYCA 4HJJL 4R5TA 1XEDA 2E7CA 4I9WE 3ZYOA 1HIML 1FCCA 1KXVC 5T1KD 2N0MA 1DUZA 2R1YA 4RMSA 5HBBA 4OD3H 3MV8A 3HCVA 4KZ0A 3FCUB 1EGJA 4YHMH 3LH9A 1TU2B 4W9LC 4PY8J 1T89C 3CNKA 1F41A 4JANA 2FTAA 4NS0A 1P2CB 2ZCKH 4KRPD 4JM0A 3HMXL 1RJLB 1OK0A 4JG1H 3C5JB 3SN6N 3S48A 4A04A 5CBAB 1T4KA 4ZW3A 5KS9A 3QEQA 4MD0B 5JW3H 4NPYB 4YHPB 3NJIA 1MCNA 3PWNA 3HB3D 3T77A 2OJZL 1UYWL 1U36A 2VMDA 1EJFA 3T2QA 5J6GA 2A4EA 3SPIA 1E27A 4I48A 5JUEH 1H5BA 1KIQB 4BSJA 3AXLA 4WCYL 3APCA 3SCMA 1HEJC 2I60H 4XP5H 1IGIL 2Y2YA 4KKNA 2CU9A 2E7DA 2BMKA 3POCA 5IBTH 1YQVL 2G9HA 1OLLA 4HIQA 3P4OB 3BGFC 1Y07A 1YJDH 1RY7B 3MV9A 5FKPA 5KBMA 4JFDA 1LEGA 3WS6C 5BOJA 5KW9H 3IFLL 4RQQA 4ZYKB 2QLYA 2VR8A 1TYEB 1FNGB 4L8DA 3RWHB 1DJZA 2ZUSA 3B2PA 5CEYB 5FECA 2ZT9C 3SBWA 4IGBC 4DW2L 5FO9B 5D1ZC 1NBZB 2BFGA 4NZDA 1ZLUK 1IAKB 1OTUD 4OM1L 1E2VA 4H8WC 1FFTB 2E9WA 2X3CA 3FT4B 2X53A 4JO2H 3EJSA 4NPKA 4HUWB 1Q94A 2R0KH 3HG1B 2IOIA 3RGHA 1RERA 4O9HL 2ICWA 4JY4B 3L3IA 3CZGA 3FN0L 2YAMA 5EU6D 3GMRB 2VN6A 3DPDA 4E41D 5B22A 5CJ8A 1CF8H 4FYQA 2FSEB 1CFTB 1MCOL 2BY0A 3AS1A 3G3LA 5INCB 3CU7A 3KM1A 3MRPA 4YX2L 4D94A 5DMYA 5K39A 2IV8A 4JR9L 4YE4H 4YVNA 3WYRA 5D7SL 4TYUA 3OLGA 5DUPH 5GGSA 5I15H 3RVUC 3O11B 1RV6X 3ECWA 1EMTL 1KTCA 3WGVB 3QNYA 4MDRA 4XAKE 4M61A 4PB0H 4W9GC 4DQOH 4L8CB 4MXVF 5EU4A 2HX8A 1AGEA 25C8H 1KV3A 4PS7A 4WFED 5IBUG 3RX7A 1PTZA 1TXKA 4OSUH 1S7VB 2HJFA 2AITA 4NHCL 4IBTA 1ADWA 2IBBA 3GIVA 3C8DA 1XBDA 5HDBB 2VQ1B 4X6FA 5DQJA 1NCJA 1EX0A 3CC1A 3MXVH 4CVXA 2XYBA 3QNZB 5KEZA 3AB0B 4QHMA 1IBHA 4Y2OB 4AGOA 5C0BB 2FO1A 2WINB 2AQ3A 2E6PA 4PGDA 4N8CH 2WKLA 4J3OD 2EE6A 2H1XA 3MUZ1 5I30L 4KJQC 4LCCA 2NT1A 1GGYA 3FBKA 1U8HB 4APQC 5JYMA 3T1WA 3FSZA 1F0LA 1HWWA 4Z7UF 3QORD 1OCCB 2OS7A 1TZ8A 4YXHL 1KCUL 2A6DB 5KVMC 5E9DA 5IFAL 1RJCA 1MUJB 2AXGB 4PV1C 5FKAB 1N70A 4IIQB 3RBSA 3S5LA 1Z9NA 2Y23A 4FS0A 4BQCA 3CLFL 5E00A 1JTOA 5I1EL 1TEYA 1G7LA 4POUB 4PUBH 3QIWC 4MJIB 3JYBA 1WT5A 3L95B 5C0DB 2OK0H 3LB6D 4PJXA 4J6RH 2WLHA 3P3YA 3IXAA 3T0EA 1J0YA 3L3HB 4U7KA 3WI9A 5I1IL 5FIEA 1YEEL 4AGMA 3OAZK 1YNKH 3HC2A 1NCIA 4YNYA 1FC2D 4TOYL 1U3HC 3QQXA 5DJAB 4UT9A 5DMGD 4GS7C 2OW7A 4XBMA 4PLJD 3CFDA 2JXMA 1GGCH 1CXIA 1NJ9B 1KUMA 1QSFD 3MRMA 2Q9OA 4FRWA 2HVBA 4LCWA 4JPSA 4RMUA 3VTAA 4ANVA 5I8KH 1OTSD 1T7WA 1J48A 4C55A 4ELDA 4L1TA 4QKXB 5B38G 2PTTB 1EGJH 4JG0H 5MEQB 3AT8A 4IEFA 5E99H 2KLTA 3D3VD 4ZNCD 4EO5A 4XBEH 4LDCA 4EZMA 2WCGA 3GBEA 3L3KB 3S88L 1A7RH 1N8ZB 1CD1A 4BA0A 3ES6A 4UMGA 2XFGB 2VIRB 3BWUF 3CDYA 1WUZA 2A9NL 3IDIA 3B7SA 3LIUA 3IJHB 3E6FA 1EBAA 2UYLA 3AB0C 4Y5VB 4Y89A 1FIEA 3TT1H 4Y4FB 4EBQH 5E4OA 2AJZA 4HGWB 4ILDA 3LHPL 1MFAL 1OHZA 4UBDD 1U8KB 3AT9A 4ZFQA 3LV3B 3GZKA 1Q9KB 4WEBH 4YQXH 1AO7D 5I75C 2A9MH 1TMQA 2B59B 5E70A 2HT3D 2OMYA 3T8XA 4HDIB 5IM7A 1YY8A 2VR6A 2OZ4L 4CU7A 2JELL 2X4OB 4HMEA 1J5HA 1A7OL 1M6OA 4CNIB 1RP9A 1YEJL 5TE7H 1DSYA 1S78C 1CGXA 1HQRB 1KG0A 4DGIH 4IIQC 5C0JB 3PHQB 5LQBL 2QSQA 4NDMA 3DYPA 1ZE3H 2ZSWA 4P4KD 4MNGB 2RD0A 2OTUB 3JWOC 4TLSA 3CDFA 4GP4B 1GC1H 4X7SH 5JDJA 1FNLA 4D0CB 3AADB 3FU7A 1FAIL 1O6SA 3MRHA 1ZVHA 3L5XH 4Y7OC 2FO4B 4P2CG 4MFHA 3MRRA 5I1CL 5EORL 3VFGH 5CHNA 2ZXBA 1L4IA 3FB8B 3O2DA 5EIIB 1EEYA 2VUKA 1I1AD 1KLGA 2ZUQB 1T2QL 1A7NL 3OR6A 1M53A 3ZW3A 1O9ZA 5FYLH 4OF3A 3HZKA 1JZEA 2WOYA 3LKOA 1BJ1H 4WW1A 2ZOWA 4GSDH 1UXWB 4WKXA 3OAYK 2DQCH 5KBKA 5ISZE 4FQ2L 3UBGA 5IMMB 5LN8A 3L9RA 4Z7VF 4UWQB 3V0VB 1M2VA 4JRYB 4URTB 4X98A 3VCLA 5AW4B 4DZBA 1ROCA 1B0RA 5DO8A 1ORSA 2E4TA 3ENEA 5CJXA 3UJTH 3QYMA 1JWMB 3QUYD 2EE3A 5IEHB 2NDFA 3IFOA 3FO1A 3HA0A 4MMXB 3HG1D 5EDSA 3V4PL 2VABA 2OLDA 5T1DH 4Y9BA 1JGUL 1BMZA 5J8OA 4EZJA 2H6PA 4N8PA 3AG4B 3HZVA 4YH6A 5I26A 1O5PA 5AWNL 3TNMB 1I85C 5E2WH 3AREA 4Z3FA 5K9OA 4X80L 3H2WA 3ULUL 3MO1B 4S1DC 4JX0A 1QBBA 4ATWA 3K72A 4Y5VC 3MRQB 1ONQA 4LQ1A 3T4AC 1OB1B 4D0BA 2IC2A 3DWTA 4Y16C 4ZS6D 3BLBA 1NC4B 2FR4A 2JB5H 4R7DB 3F6JA 3NMEA 5DD1H 4OGAD 5HHMB 3WJMA 5IFHH 1J8SA 3NRQA 5CN2A 5AW9B 3QJVB 4H20H 2I9TA 3FZUC 2QKIA 4Z76B 3BZ4A 1Q9OB 3MBEA 4TSAH 3ROOB 4DP5X 5I0YA 1ZLWK 1W16A 2L4OA 3BD3A 4JFOA 2XA8H 5BRZA 2G2RA 1WWBX 5A43C 1CLOL 1IBBA 4CKVX 1QACA 4ZG1A 5FCSH 1I1YB 4B50A 3MRGB 2YPVH 1HI6A 3QHZH 1B0GB 4QRFA 4G5ZH 4PRBB 5MENA 4CL7A 1USZA 4OLZH 3C60B 3VXSA 1SEBA 5I5MA 3G5YA 1ED3A 3FXIC 5I1AA 5C0BD 4L3AA 1EDYA 1K8DB 1JGVL 2ENPA 2FLRT 5LVEA 2WZ5A 5IJCC 1Y1DA 1GYWA 4Z78A 2HJLB 2V6HA 2CBMA 3L17A 3MLRL 5FYKU 1MVUA 1BEXA 3HG3A 4UT9H 5AW0B 3VRJB 1KJ2A 1H3VA 4F37K 3LQAL 4ZFOB 3Q6GH 2GI7A 4CSSA 3NZSA 2O5ZH 4S0HA 2F5BL 2Q20A 5FYKE 2C26A 4FQJL 1INQB 1RZKC 4X7TA 1V5JA 5EBLB 2HVKB 5F9AC 5EU5A 3ZKNC 1I1FA 4G11A 1SEQL 5T1KA 1BVZA 4J8RA 4X6DF 5A16B 3N85L 3VFSB 5DJ0B 2JWYA 4L37B 5HHOE 2IO5A 4YXKL 2DI9A 4UQBA 1OLZA 1ZVSB 3FUFA 4MJID 2ITFA 1A3ZA 1IRAY 1W9XA 4M7ZC 2K6YA 2ZUYA 4PCKA 5EC1B 5I74C 3VNYA 4YSCA 4WWOA 4YHNA 1WBYB 3INUH 3I74A 2YQ3A 3QAZC 4HUCA 3ARWA 3X1NA 1NDGA 4KHTL 4N0CC 1T0MA 4R97B 5BUPA 2X10A 4ADJA 4XCNB 1Z5LB 2FYYA 2KL6A 2OP4L 5AW6B 3E3QE 1J8HE 3W81A 1JZ8A 1HYRC 4J3TA 3ILQD 4LCVA 3DLQR 1DQLL 2W9DL 2A9AA 2XTSA 3QUMB 2F7PA 3B3IB 5C0IB 3BVNA 4FXKB 3M7OA 3RYMA 4G6KL 3QK0A 1F11A 2UY7A 4JRXE 2IGFH 3WIIH 3UBXB 2DF3A 4R83A 3GLZA 3E2HB 3F3HA 3F7VB 5JPNA 1GJUA 1JD9A 5CJBA 2R1WB 1LO2H 4XAWH 1H3WM 5I0VA 4GW1B 5EO1A 4N2MA 4FQQA 1MJUL 1RUMH 4AM0Q 1L6PA 1WS7A 3IRZA 1S7WB 2OI9C 1WRFA 3F05A 2JTYA 1W8EA 2W0LA 2OMZA 3P1VA 2MFNA 3BAKA 3V8OA 4OB5H 4PS8A 1N10A 4N2BA 43CAB 1MLBB 4MJ5B 5E8NB 1SVBA 4I2XA 4P3DB 5DYFA 4DP0X 3LNIA 3WEXA 2B2XL 2EH8H 1V7MH 2JIXB 4MXWH 3JQOB 3HR6A 3DTDA 4Y4FD 3T3MF 4E41A 2VXTL 4FQIH 4TUJB 2VL5A 4R7NB 3BPLC 3DHJA 2TAAA 4GQPH 2NUTB 2XRAH 2YD6A 3O2DH 2D3NA 4JFXB 4JHZA 2ZXDA 3U30C 2QVFB 4OF0A 5BZDB 5FHBH 3IVKA 3AMKA 5F21B 3RY6A 4GBXB 4PBXA 3I6GA 1Z3GH 4JPWH 4UB0H 3AABA 3UBFA 1KSRA 3ALXA 1LMKA 3CXHK 3FT2B 1YEWA 3II2A 1BBDL 4PJHA 1KBWA 3M1CA 4XWOD 5IHLB 5I1GL 4NM8H 5CP7A 5K1VA 1YECH 1YDPB 4RFOH 2XKNB 3S8GB 2MSPA 1NLDH 5D2LA 1LQSR 4N5UA 3D33A 4P57A 1Q9WB 4ONFL 2GB2A 4FNRA 3S5LG 1FFOA 3VJ6A 2VL4A 1PSKH 4P4RB 5F9WB 4F5CA 1A7PH 4Q2ZA 4XB8A 3JWDL 2DQUL 2VRAA 2WIIB 5HI3C 4AQ8C 3QRGL 1CF1A 4JEGB 3BH8A 4L1HA 4KZCA 2PLTA 4B60A 1RZFH 3E6HB 1WA2X 3CXDL 3FSWA 4K9EH 3QJRB 3AMLA 4G8GE 2QDWA 2P45B 3DHUA 4TRPL 1ZLVH 3UCQA 1JYVA 1YMMB 2VDLL 4L9DA 4WUUB 4HSAC 1S9XB 1I8IA 5J57B 2X4RA 4NKIH 4AXWB 5JHLA 1NSNH 4BHUA 1HYSC 2X7LB 5L88L 1AIZA 3GI8H 3E2HC 4JRYD 4NXKA 4OZHB 1E90A 4ZUVB 3QI9B 1QVOB 4JFZL 1AFVH 3OF6D 4RWYH 3ARFA 2NSMA 3EO0B 5I16B 4JW3A 3RFZC 2DQ6A 1Q0YL 5AAWA 4LL1A 1DHKA 5DFAA 4U6YA 2WTPA 4DOHB 4G72B 3C8KA 2WWMC 4TVPE 4M4RA 1TTBA 2DM2A 3HBPA 2CR6A 2WTRA 4LHUB 4B27A 5BS0E 1NGPL 3LXAA 5AOKA 1JXFA 3GNML 1JHTB 1XR8A 3WLWC 3FQNA 3LQMA 5FHAH 5JXEC 3BUQA 3QR2A 3RJOA 4HGMA 1MJ8L 4OZGF 3DX1A 2WXGA 4IRZA 1X5XA 1QW8A 5KN5A 4EN2A 3C5SA 1E4KA 4AQEB 4R26H 5F1OB 2X4SB 3ZXAC 2X1QA 4YBQD 3KPNA 4FKKA 1KJ2H 1WC7B 4I5BA 2J8UA 2MQ0A 4G8FA 2WXKA 2WKGA 1FVCB 2XN1A 5IT2H 2C7UA 4U3CA 4L3CA 1CG9A 1QSFA 4ODHL 4CRPA 5H94A 3SGKA 2BRRL 4PWEA 5C0RH 4M8VA 2XVGA 5DLMH 1JZ2A 3PCYA 2ICWJ 2MTAA 3F7YB 5CCHE 2ENYA 3OKMA 3QR1A 3U4KA 3MVSA 1ITCA 5ELIA 2OBGA 3SGDI 2AHIA 4OZFA 3C60D 5DQDL 4PGJA 4N2KA 3D3VA 5FYKL 2NY0D 2R4SH 4ODWB 4QKTA 4GKLA 4DKFL 2JV6A 3FTYA 4IK7A 3O4OB 4KQ4L 2DH2A 2XTJC 3R18A 2R0WH 5E5RB 2CXKA 4NC2B 1BJ1J 4UIKL 2KS0A 3ZZSA 1PLCA 4YLBA 1RZGB 1MQKL 4DKEL 5CILH 1CBVH 3S9DB 1KGUA 2F19L 2V2XB 3IF1A 3RHWF 1RZPA 4X50A 2ZD0A 5E4IA 1OCWH 4M93B 4ORGA 3RAJL 4A7GA 5L9DL 4JB9L 1BFOB 3TOPA 1H3GA 2YAFA 4MA8H 4TVSa 2VDKB 5SX5H 2YGQA 3WTXA 1IAIH 3AM8C 3O3DB 3B9DA 3EO9H 4KKBC 3AVEA 1NAML 3Q5YA 3GK8H 5BXFA 5EF0A 2ZICA 3QI9C 3HS8A 3EUUA 4I3RH 2ZAIA 2GJJA 4F7CA 2WXQA 3BFWA 1OE3A 3TU6A 1RHFA 1SXBA 1E8WA 1IQDA 3GJEB 3LS5H 3DURA 1P2CA 4ZTPH 3WENA 1E4HA 1XWVA 1EO8H 1X5HA 4P4KA 4HS8L 2BIQA 3GGWA 3WGUB 5LNDA 1FHGA 3PQYE 4NPYA 4YHPA 1ZSHA 5ILTH 3KYNB 4DJMA 4HIIA 1W72L 4M48H 4N0RA 4LIQH 1TUPA 5TPWH 4YHKL 1BG9A 4ZW7A 2OXGA 3PF2A 1FC1A 3LVTA 1I1AA 4O58H 4JM4H 5GS1B 5G5DA 4N0FA 2WN3A 3WHE0 2CNYA 3KW7A 3VG0H 1T66D 5EU6E 1U8JB 5GIRB 3T04D 1FNGA 4N22A 5DJ6B 5KS9F 2V0AA 2AKRA 1EA9C 2OJEB 3HC3H 4L3EB 2NYYC 4R96A 5CEYA 1CK0L 5SWQA 1NBZA 3X11A 4HXAH 3ULUD 2CQVA 4OKVB 1JCKA 2MOVA 2VDRL 1OPGH 1A21A 5FFGA 1OSPL 1AR1B 3QUYA 4QAWA 2UZPA 3H8NA 2DQHL 4CILA 1NPJA 3HG1A 3T0BA 2X1XR 2YFOA 3VW3L 3H9HA 4NZTH 1I75A 2F2HA 3HE7B 3QIUC 2WVSA 4WFEE 2JIXD 3VD0A 3HC4L 3LIZA 4XMPH 2WUBH 2BM3A 35C8L 3RGVC 2HT4D 1SVCP 4MRBA 4YPGB 3E38A 4H0IA 4B97A 3MODL 4FNPA 5KVDH 1CFTA 1H3PL 5D7JB 4X7FC 5HSFA 5INCA 5IB5A 2WXFA 3CLWA 2XKUA 2QT6A 4J3OH 4GBXD 3L1OH 2CBQA 3B1UA 3HNVL 1BIIB 4N2HA 1OP5K 1RLBA 3O11A 4M7LL 4M93C 5T5NF 3MOQA 5DVPA 5JHLH 4ETQB 1U4FA 4JY6B 4MQ7A 5LBGA 3P69A 4JDEB 5KVDE 3V52L 1WUNT 4U3SA 2AQPA 4FERA 3TT3L 4FFZA 3FAWA 2SODB 4UTBL 4UT7L 3F85A 4M6ML 3VB8A 2NX5D 4WTZA 3HG5A 5T1JA 1I1CA 4NNPL 5HDOA 3RIFK 4ZOEA 1X5LA 1YAIA 1DQVA 1WTGT 5KSUB 2V2TB 3NEEA 4YUEL 3RVXC 1IC4L 1VIWA 2AV7B 3UZQB 4Z7AA 2VQ1A 7CGTA 4WZ9A 1Q38A 5KWYC 3K6IA 4DP6X 2IALB 2NR6C 4NQDB 1T0NB 5C0BA 3O4LA 2WINA 5IW6B 1C5BH 1A6AB 1PKOA 2X6UA 1QG3A 3PWPB 3QS2A 3GQFA 3RL2B 3L48A 4YVUA 2FWSA 1R3JA 1OTTD 1YMMD 2HH0H 3FU9A 4WUUD 4U7SA 5BO4A 3BZ5A 4IRZH 4F7PA 2BJML 3M07A 1IGJA 5JPMB 1J5IA 5GS1C 4LSQL 4LFHG 1E9PB 3BW9A 1HNYA 4UYQA 3CSBA 3D87B 4FXGB 1G6RB 1D6VH 3HMXA 4PRHA 5AG8A 1DJGA 3TBWB 1Z5YD 1JXJA 2A6DA 4JDVB 2ENQA 2IWKA 5DT1H 1MUJA 3BN9D 5FKAA 4FXTA 2AMGA 4OAWB 2PWGA 2VLRE 1Z0NA 4YJZL 4BFOA 3AWEA 2AI0H 4JZNB 2Q7YA 4G71B 3VFVB 3AW5A 2R23B 3CSFA 3MRCB 2JJWA 2DLGA 4JCMA 3WCYA 2DV6A 2FX8L 4LHUD 5A2FA 2IBZY 4XXWA 4H2CA 3DI2B 3PP4L 5C0DA 2EDKA 1MHPH 5KOMC 3VXTA 3Q8EA 4P5TB 1KWGA 5DHDA 3U1PA 2CDEA 4AYGA 3MV7D 4PJ5B 1MFDL 2YD1A 3RA7H 3DRQB 4U1SA 3KLLA 4ZODA 4YDJB 3D3VE 4XHQA 4Z7NE 5G55A 5DJAA 1EJ6A 4NN7B 1VRSA 3B3BA 3BUIA 4JY5H 4M9OA 4PJFA 5EU7C 4QTHB 2BW4A 4LVNB 4XE5B 1NJ9A 1WAPA 4FP8H 2WD0A 5CINH 4K71B 1MELA 4PJXF 3BJLA 3AROA 3NZUA 2MPAH 4XXCC 5AZ2L 1QSZA 5BRPA 3EXLA 1OF2B 4YIQB 3MXWH 1U8PA 1JGEB 4XRCB 4X0KB 4X4MA 4JO3L 4WQOA 4CUCA 4Q74A 3QQ9C 1U2YA 3LNHA 1AO7E 3NJNA 4XPAL 5E6SB 2CZNA 3D50A 5C0GB 3HS0A 1S7XA 2XV2A 2CHZA 1E5ZA 3L3KA 1RIHH 2OMTB 1N8ZA 4FTVB 2C4FT 5KANI 1UWXK 4GMSH 2FE0A 3CIQA 4PLKD 4YSUA 3D2UD 5FAAA 3V4VB 3MUGB 3ZHDA 3P02A 4JQXA 2JLPA 3P11L 4NM4L 7FABH 2EXYC 2J88H 3IAGC 3IJHA 2H0FA 2P7TB 1N9PA 1A6VH 3IMSA 4Y4FA 1FNEA 2P80D 1DVSA 2AK1L 4HGWA 3CFNA 5L2KD 2EIBA 3KS0H 5I18L 3WIFB 1CLYL 1U8KA 4WV1C 3KPLB 3NCJH 4Z0XA 1MDAA 1Q9KA 3NIDB 4ES9A 1V10A 1QPKA 1C16A 2B59A 3DIDA 4BGLA 3N0AA 3H6AA 4J3OG 2IAAC 4HDIA 3V10A 3E9TA 4M5SA 3BVTA 1NGXB 3GSRA 1MJ7L 4KXZI 3BC9A 5IG7A 5ESVB 3SYOA 4WENB 1GYVA 3AQDA 1N3NB 3H3PL 5EEXA 3UACA 4CNIA 4X9HA 4P3CH 3WN5A 2WXNA 2YD2A 4KK6D 4NWTL 3VI4B 3WNPA 2VWEE 1TZGH 5IIEA 2FUQA 3UTOA 3NACL 4MNGA 5H2BB 4HGKC 1A3LH 1K2DB 1N64H 2WGXA 4MCYB 5FUCC 3U0TB 3JV5A 4ZK8A 5IF0B 2OL3B 1X5AA 4WI5A 3JXAA 4OJFL 2VDMH 1V27A 4A38A 1B3IA 1QFWI 2ZX9A 2H9GB 4UAHA 3P73B 1I3GH 3LIZH 2UZXA 2E86A 1OP9A 1INDL 4IHBA 4GO8A 4M43H 1KIPB 3D08A 3PV6B 3WXVL 1R3IH 4NGHH 3LHAA 5EOQL 3EDJA 3GIZL 1XMEB 2V8MA 3SB3A 2ILLA 1RU9H 1KB9K 2LLLA 2Z31B 1F6AB 3C08H 4F80A 1K4DB 1M71B 4FOMA 3U1QA 1CR9H 2XXGA 1LP9B 3D0AA 3K4AA 4JKNA 2G0LA 1E67A 2ZJSL 4DPCX 5I2IA 5BV7B 4FTDA 1RSYA 3V0VA 1JK9A 4ZD3H 1LGVA 3ETSA 4LP5A 4FFZH 4IQHA 5FYJD 3QCVL 5HHXH 5ICZB 1S7RA 5A1AA 1SN2A 3I9PA 3UL4A 4Y5XA 3OF6A 1CFSB 1GGBH 1NC2B 2DD8H 3AU0A 1AR1D 1JWMA 5TE6H 4KUZL 5IEHA 4EI5C 3FQWB 2GBAA 3HBZA 3V4UH 1RJZB 3MBXH 4KO7A 1RUQH 2NUPA 3HE7D 3VACA 4FNLL 1B0WA 1QWUA 1TF4A 4KH2A 1FUNA 2QPDB 3TNMA 1DQDH 3ASNB 2D0GA 1SMDA 1R5WB 2GK2A 3L08A 4KH9A 3TH2T 3JV4B 3HBQA 4KTDL 3HNSH 1NIAA 2DPKA 5CLTA 5D7JD 3NRFA 3MO1A 4M1CD 4A2FA 4FG6D 3RE0A 2XWBB 3KBPA 4HJJH 4X5QA 4BKLB 1AGFB 2CJUL 5HDBE 5HGAA 4HC1L 1HIMH 2B1OA 3GSNL 5K5YA 3MNZB 3QRFM 3U9PH 5IESL 1QOKA 4BZ2A 1QQDB 5IJVB 4JJ5B 3B2MA 4DCQB 1Q9OA 4P2RA 5GGSY 1FFPB 5CJQL 5A2AA 3HMXH 3NOIA 5EZJB 3E7JA 5JTWA 2HWZL 3FN3A 3QA3B 5IWLA 2LW3A 2ADIB 3FB5B 3GMNB 5FCUH 1YEDB 4YSSA 4M5TA 4N2NA 4OI8A 2OJZH 1UYWH 5A2BA 2EVFA 1BVNP 4BFIB 4XVUD 3LNGA 4PRDB 1XL6A 4PTUA 4WCYH 4XX5A 1A4CA 3EGSB 4OFYA 4NQTA 4NQDD 3V5KB 5HHQA 2F7QA 3DX6B 5EBMA 1IEBA 1BZQK 3PWPD 1FN4B 3ZYJA 1WD8A 1TEGA 2MWCA 3GXPA 3IFLH 2QSTA 1S5HB 3MRDA 2HUHA 2QVTA 3L4UA 4MJIE 3V5DB 4BFKA 5BVJA 3D09A 1DVFD 4TPRH 4DW2H 1XF4B 3NUKA 1JS4A 3QEGL 2X05A 1BMWA 3VRJA 1D5BB 4AK1A 2KERA 4OM1H 2EYRB 4XN2A 4OD2B 4G8EB 1F2XK 1OZUA 4MYWB 1AQDB 1U21A 1NGQL 3MBWA 4MZ2A 1JZ4A 3TM6A 3QQDB 2NYKA 4ZSOA 1XR9A 3TV8A 4J4PC 1XX9C 1MJJB 1BLIA 4KJPD 4QR7A 5BV7C 1AQHA 1JN6B 2QR0B 5BMFL 4OUOA 4LLWA 5D1XB 3H9ZA 5I6PA 3BZEA 3QJXA 4LU5L 4JDTH 3HS9A 4WDIB 3FN0H 3GBDA 4ISVA 4XTRD 5DJ0A 1G9MH 4AY0A 1UH3A 5EV7A 3ATFA 1C5DA 1YEKL 1AG0A 3LKPA 3MYJB 1WBYA 4YX2H 4CU8A 1VF5C 5FFLA 1NL0H 5TQ2H 4HPOL 4DP1X 2LAAA 2VZOA 2E7LC 4KU1A 4P5TD 3CGTA 3IPBA 2X4QB 3C5ZB 1M05A 4PJ5D 3LN4B 4IBLT 1ZV2A 4OCSH 2COQA 3ARRA 3ZDZF 4WI3A 1DJWA 2F54B 4KY1H 4N90D 4J2XA 1AD0A 4ONHA 2K78A 4M29A 5CEZD 3MA7A 2P28B 3P4NB 2WK2A 3E0GA 2BP8A 3NDZE 4N0YL 1FHNA 1UTDA 3GSVB 4UNTA 3NIGB 2FBJH 3ESOA 5LHDA 3P0YL 2WLMA 3DBXB 3F7VA 3WMSA 3V4PA 4RMBA 1RSFA 2R1WA 2OTPA 2G60L 4W4NA 5TGBB 3RFRA 3FF8A 4EE2A 2PO6A 4HLZH 4P2QB 1BM7A 5JORA 3B9AA 4ENED 3LN9A 4H0GA 5B1JC 4FTVD 4TUKL 4MXQC 4HULB 3B2DC 3AG1B 4RGMC 1FO0L 2DYPD 3P30L 3R7RA 43CAA 1MLBA 4HSCX 5GJTL 3CFCL 2A0LC 3EFFA 3SBRA 3ZE0F 1LJMA 5EZPA 5EO9A 2JIXA 1OAKL 2BVOB 1SHWA 4WWPA 4MNGE 2IWGA 1AS6A 3OXSB 1SJXA 2W81C 2VR5A 4HJ1A 5JIIA 4K8RL 4I13B 5IQ9A 5ID1A 5IFAH 3SE3A 2B5IC 2VKXA 2AJVH 3TBYB 4FLOA 5K9QI 4GBXA 3VG9C 1BXAA 2VJ8A 1Z6JT 3CLFH 4YGAB 3SYAA 3TBBA 3SDAB 1QNZL 2DIAA 4PGCB 1XF2A 1JNLH 3FT2A 3NZHH 1QAWA 3BYYA 3H4FA 1WWAX 1EEQA 1ZHNA 3WTVA 4WNSA 3N44F 5KYUA 2WQSA 2W0FA 1YDPA 4CVWA 4B0MM 1SLVA 4BE6A 2NX5A 4LKCB 3IJSB 4EDXB 3D18B 4XVTL 1D7DA 3ZTJH 4OLUL 1IKNC 3KNBA 4JO8A 4POZC 5ESQA 2H2SC 2K3TA 1QRNE 1S7QB 1Z5HA 1EPFA 3DX7B 2QV4A 3LZRA 1VZGA 3B2VL 3EZJB 3FO9B 4JRYE 5I66A 3CLEL 4NT6A 1FNSH 2EVGA 4KDTA 2BCKA 4YSOA 3RKPA 1EERB 1G4RA 4PJHF 1VFMA 1BVLB 2Z31D 2BDNL 4NLAA 2QGEA 4ODVL 1EHKB 2BWDA 2BSBA 5D2LF 2HT2D 1SMAA 4WUUA 3TLRA 1S9XA 3EYUL 5B1CA 1OW0A 1SFHA 3NJLA 4AXWA 4BZ2H 5C6WH 4AUUA 2X1OA 3P4MB 2X7LA 4H8HA 2E7BA 4L48A 1XGTA 3GBML 3UZEC 4JLRB 4HD5A 5JW4M 4L8SC 4MCNA 1T03L 4ZUVA 4ZUWA 1JI1A 1QVOA 4W70A 3S88H 3QIBC 5HYSB 1NC2D 1XCTA 3ULVD 5HHME 4QY8B 5I16A 5J6HA 1DJSA 1FDLL 4PJEA 2A9NH 1E30A 3UAJD 5BUAA 3GTVA 5IW3A 1KGWA 1HS6A 1RLWA 2BSSA 2JCCB 2OMVB 4FMFA 4J3OF 5G4MA 4QHNA 1BV8A 3AXHA 2WLYA 4KK5D 1UJ3C 2DQIL 2ZSVA 1JERA 1MFAH 2Q1EA 5C3LD 4AGNA 4Z6AT 1XFPA 5GJSH 3Q1SL 1J5OL 4M7KH 1XSOA 2IOMA 4ADIA 2HTLC 1F3JB 1RUAH 3DV6B 5GS0D 1ZGLB 3MV7A 2F74B 1EAJA 4GH7B 3BUDA 4AQEA 3OR7B 2OSLA 1L0PA 2XWCA 3RZCB 1NCGA 3D4ZA 2X4SA 3QJFB 2R59A 4HAFA 4TQPA 1S9YA 2AFNA 4GFXA 3MGTB 4LL9A 2X40A 3EADA 2V9QA 2BRQA 1FVCA 1P1ZB 2ESVD 4ORZC 3JWNH 4QOKB 5ERWA 3I6LD 2DEXX 4A68A 2B15A 1HNFA 1U6AL 5C1MB 4Y8AA 3V9FA 1SMOA 2RR3A 4P04A 5EORH 3IDXH 1F97A 4N9OB 1DBJL 1KZYA 1T21B 4HLZG 4ZMTA 3EUDA 4CMMB 5LGKA 5B8CB 5D1ZI 5DUMH 3S4SB 2EO9A 4AOFA 2BW5A 2ED9A 3QXDA 4PWJA 2IXQB 1T2QH 4HPYH 1D2PA 4PLNC 1A7NH 2J8UF 1GTNA 1AZRA 3D2UA 4MA7L 3QXUA 2KZKA 4HKZB 2ZWNA 4HWEL 5KVFH 4ZOAA 4PD4K 2VDPL 3NQKA 1O7VA 2W9EL 1UD5A 5ID0B 1FP5A 4ZUSA 2FL5A 1FSKC 1ZTXH 5L2KA 4X9IA 5JNYA 4X6CB 3U2IA 5EIIG 4M5YL 1KMGA 4XP9L 4L9LA 4U0RB 2FQDA 3LN5B 5KVFE 4QNPE 1FZKA 1UVQB 3T5WA 1AXSA 5D1XD 3V4PH 1HXYB 3MJ8A 5IB1B 4K55A 4GG6A 5C07B 3UXFA 4PJCE 1KXHA 4WGKA 1OB0A 5AAMA 2YS4A 5CF3A 4DUWA 1XGPB 3ALWA 1ORQB 4XWGL 3GJEA 1MQ8A 4MMZC 1NFDB 3CMGA 4JZOA 5DI8A 1A6PA 1AD9B 1J87A 1WHPA 1WFUA 5BJTB 3ULUH 1RAMA 4A7GF 3E80A 1JMXA 1A14L 2R2EA 3C5ZD 4O00A 3FRPB 4JGMA 4E5XA 4X9BA 5BQDA 3NRPA 4HD9A 3WOVA 1KGXA 3NCYS 4MAYC 4ZBJA 3CH1B 3RB7A 5ACZB 1FYTB 3K5SA 1QD0A 2NY6B 5A6LA 2YN3A 4MHHG 3BP5A 4G42B 4I9XA 3UEZA 5C0CB 1CLOH 2VERA 5E94A 2WLZA 2YBRB 2XQBH 5HVGB 2AQQA 3M46A 4IJ3B 1SPDA 1DVTA 4JKPH 2OJEA 1RK0A 2QADC 1M7IB 1OQOA 4XBGB 4DPBX 1WAEA 1TQVA 4PHXA 2I27N 3ARVA 2AABL 4OCXL 4NWUL 4P2QD 2AQSA 5D2NB 3QJTB 4OKVA 4UI2A 1CL7L 4WY7L 2PMZA 3GPEA 1P9MC 1SF3A 3T4YB 5IR1B 1K4CB 1PYWA 3DGGA 2FD6H 4FX5A 1ZS8A 3H9YA 3HZMA 2AEPL 5KVEH 4OJDH 2G3XA 3BI9X 2Z7UA 5AYUL 3CZNA 5JHDB 4XN9A 1LEIB 4KXAA 3D05A 3SBQA 2Y0SA 3OKKA 4OGQC 4YPGA 5AOIA 5CGTA 3KPQA 1FIGL 1BPVA 1AQKL 2F5BH 1E6OH 1RZKL 2HTKD 1CFVH 4UQCA 2WCSA 1FZOA 1F4YH 4L5FL 5JR1H 1F2QA 1SEQH 3L9YA 5F8QC 3D39B 4UNIA 3SDAD 3N1FC 1O9WA 4YXKH 1TVDA 4B95C 1GS8A 1GOGA 4HX1B 4TSCH 3L81A 4E2OA 4EJ1C 1X4ZA 5FDWA 4M6OL 1CDIA 4Q52A 3RIAF 4MSWB 1E5CA 3ZBMA 4F7EB 5T8IA 2XG5B 2FJFA 5ALBL 4CW1A 4YLCA 1J8KA 1YMME 3B8YA 4WUUE 3GSOB 1G9NH 2AXJA 3FK3A 3ZTDC 1CQKA 1HKFA 1SJVA 5CU9A 1T1YB 2LTQB 4WIQA 3STLB 1Y0LA 3WE1A 1BAWA 1DQMH 3FQXA 3BPNB 2YGNA 1JMZA 2Y9RT 3UZQA 3RURA 2XWXA 4N0UE 4OZHE 1TCMA 4RAVA 4P23A 4PN6A 1DQLH 4A39A 2EUZA 4U1MA 1A4KA 1U2CA 1TFHA 3V6FA 2IALA 4L4TB 4Z1PA 4F58H 1T0NA 2A5UA 1A6AA 3NPSC 3PWPA 1U92B 3N9GL 4DOHE 4PS4L 3RTLA 4KAQL 1NAMA 1RCYA 2ARJB 2AK4B 1MCBA 5L7XH 1DVFA 1B3JA 4GAYB 2NY6C 1VERA 1XF3B 3KPRB 3VXUB 4FXGA 1OV8A 2MPVA 3V55A 2LABA 3HHMA 2KPWA 4OGYL 1AZVA 3UBXG 4AL8C 1HJBC 1KACB 4OAWA 3DX2A 4M8QB 1O7DE 1XIWD 3CBKB 3ECBB 3VFVA 4ATTA 1JNJA 2EUVA 5D2NC 1UKSA 2R23A 4HH8A 5BW7A 2B2XH 1OOAA 3OZLA 1W72A 4RISL 1A4JB 2DKUA 3KR3H 3ZKXB 3TA4D 2D7OA 3BRFA 1JG9A 4DPAX 1NGYA 4IOIB 3W39B 4XOEA 3MN8A 1GCYA 4Y4HB 4MDIB 5IQ7H 3CN2A 4D9RD 3I6KA 2OSYA 3L3DA 3GHEL 4P5TA 5T1LD 2FX7H 4LPWA 1KN2H 3IFPB 3SQOH 5DHXB 4DIXA 4NN5B 2HKAA 4PJ5A 2XT1B 1TG8A 3WSQH 3UIZA 1QABA 3FTXA 3RZCD 4YDJA 5JIKA 5AENA 1BBDH 3O41A 2G4EA 2Y3AA 1TO4A 1D6EB 2UY6B 3VVVA 1SXAA 2Y5EA 5I1GH 3ZKMC 4H40A 2NQDA 3QXAB 1IC7H 1TMCB 1F8TH 1FRGL 4QOKD 2GAZB 1U3ZA 4N8VB 4W9EC 4WHDA 4S11A 1CT8B 1KFAL 1IE4A 2VRKA 1G7MA 1OF2A 2MHAA 4KV5E 4LB8A 4IMKA 1WIOA 2C9QA 2DQUH 4HCGA 3CBJB 4X0KA 4WFFE 5DJXB 1LWHA 2NNRA 3ALPA 3H7LA 3HC0A 3BEVA 3MLTB 3DVNA 5E8PB 5CKAA 2LTQC 5A7EA 3QUHA 1XCQA 4BKSC 4K8RD 4NKDA 3CN0A 2Y36L 3CXDH 2MNWA 3BVDB 1U8LA 1DJIA 1VEOA 2OMTA 4Q89A 3Q9QA 1EEZA 1TNNA 4FTVA 4PJFF 1Z7JA 1EFXD 2CCWA 4U1NA 2DYPA 4UQAA 2I26N 3V4VA 4H0HB 1CBJA 3LMJL 5ICUA 2TRYA 2CM6A 1RKRA 3FSAA 1T1XA 4FQXB 2A38A 1RUKL 2PWHA 4GMTH 1BAFL 4UTBA 2ATPB 3REVB 3K6SB 3KPLA 2RCSH 3TWCL 2NSXA 1GJWA 1C7TA 5DMIH 5I0XA 1IVTA 3TVMB 2ZUVA 3O45B 2IPKB 5EB9A 1NWPA 3ZUCA 1F1AA 3AQYA 3WKML 1CFQB 1EUUA 1NTDA 1NGXA 4OIFA 3F6LA 4JFQB 1Q90A 1N3NA 3BJ91 2DYRB 3LRGA 3HN8A 3D2TA 3GO1L 4MVBD 4Y5YA 3MX0B 3GJFA 4HIXL 2L7QA 2VO5A 5A2IH 4N2OA 5FYJH 5HPMB 3ZMRA 4XGZB 2R29L 1XZWA 3SDXB 3H55A 4X8JB 4NO3A 1OSZA 2X4TB 5H2BA 1MJ8H 4MQXC 4WEEA 4NOBA 4MCYA 1MLCB 2OL3A 3ZKXC 4L3EE 3FC8A 2Q3XA 3P9MB 3EOAB 3ZMNA 4NKOB 3MKGA 3FUIA 3IDJA 2H9GA 2OXHB 2H6UA 1USQA 2P1YA 4Y4HC 5E0FA 4LHUG 3Q9PA 3PV6A 5J11B 2YAPA 1HX0A 1FYTD 1I7RB 4JFWA 2YKLL 2Z31A 5HHVL 2IBGA 1F6AA 1J9TA 3DA0A 4KQ3L 1K4DA 4PYGA 1CL7I 3Q6FB 4TLKA 2Y6TE 4IOFC 5C0CD 2PW2B 1U4EA 3CFBB 3LEVL 1TZAA 1MW0A 1AYOA 2A4CA 4U6VH 5F7KC 3SYQA 4BUQA 4OBRA 1M7UA 3O3AB 5FLUA 1G0DA 3QUZA 2E9IA 2ICEC 3VI3B 2IFFH 5D6CA 5DQDH 4L4JA 1F58H 3H9SA 4GIPD 5ICZA 4DKFH 1FE8L 2VC2B 3VRIB 3QSKB 4ZUUB 4ALAC 1CFSA 4F8NA 1NC2A 2C3VA 3RUGB 3FQUB 4QHUB 4K23H 3SDDC 3FQWA 4S1QL 3WMPA 3FSVA 3FCGA 1UD8A 4M6AA 1BBJB 4IRSB 1MXDA 4DKEH 1TIUA 2Z4QA 2FQFA 5JHDD 1MHHB 4Z7IA 3V7MA 1IQWL 4FA7B 2VQ4A 3AT0A 3BKMH 3JV4A 1WDAA 1K3ZA 2JSFA 3FT1A 1U58B 3MNMA 1TJMA 5DJDB 5JHBA 1WBZA 4DKTA 4XC1L 1FL3B 1IIKA 1OGAA 1AGFA 2QVKA 3DVGB 3MAWA 4N85A 2QHRL 5H37A 1ODAA 5GRZA 4FJYA 1NAMH 3BT0A 3UTQB 2EABA 4QTIL 5IY5B 3D39D 4KKQA 5KSAC 4HCIA 4UAOB 3RU8H 5IJVA 4NQDE 4PH8A 3EH2A 4DCQA 1AGBB 3PWPE 4MHHI 4WI7A 4YFLI 5KJ4A 4CSTA 1MY5A 3ZHLA 2ESVA 1U33A 3ZTEA 2ADIA 4IRJC 3GMNA 3IAQA 1YEDA 3VNZA 2BX5A 4OIAA 5HYJB 4ZUTB 5ICYA 2QMJA 3QZNA 4TQIA 5DGRA 4P0DA 1W72H 4Q9BA 4BFIA 2E6JA 2EXSA 4BYHA 4Z7OB 5KVGL 4C83B 5FA4B 1ZIBA 2EC9T 3EFOA 4YHKH 3VGBA 2WQAA 2EDLA 3EGSA 4L4TD 1EH9A 2IH1A 5I6MA 3DX6A 1YNTA 5C86A 2I07A 5J1TC 3DTXB 2X2HA 3J7HA 3QO0A 2NY1C 2V5SA 1S5HA 5CJOH 3RWCB 3V5DA 5DFWH 4OJCA 3QJSB 1N68A 3GZOA 5B7MA 1CK0H 4L1SA 2B3RA 5CMAB 4N2GA 5CEZH 4G7YH 1Z3RA 3KPRD 2QZQA 4OD2A 2QQNL 3GI9L 1ND0A 4FQPA 2WZPD 2VDRH 5FOBB 5AUMA 1P5VB 3QQDA 4HZLB 3R06B 1NCCL 1MJJA 1JN6A 1X9LA 2QR0A 2DQFA 3OV6A 5IHHA 5I6XC 3WELA 1ACCA 3L4CA 4HUVA 3L3OB 2FLMA 1ACYH 1MRCH 3BQUB 3EG9A 2IH3A 1YNLL 2JB6B 5KBNC 1S6NA 4H13C 3SPVA 2GCYB 3OJMB 2WQUA 3D52A 4MMYB 3MODH 4IKLA 3UAAA 4FA6A 3L4TA 3UG4A 5D1QB 2BZ7A 3S3DB 6TAAA 3NFPB 3SDYL 4M6NH 3REWA 5F7EL 5IKCB 3V4VH 3VGFA 3C5ZA 3HNVH 3GLEA 2EH7H 3GBNL 4M7LH 2VO8A 1UM4L 2BP5M 2WP3T 2ZOTA 2QSCL 1DBAL 4MS8D 5HJ3B 2C4FU 2V9TA 1T6VN 5JZ7C 1ZA3A 4HETA 3TT3H 1HL4A 2NDGA 4FTVE 2BK8A 4UTBH 3P0VL 1QEWA 1UZGA 4V1DA 3PNRB 4TULL 4RBPH 2FH6A 2VLKB 4QAMB 4M9PA 4OY9A 3ZDYB 4NNPH 1X6LA 4YC2B 1E8XA 2YA1A 2N4IA 4QXVA 5B1BB 4YUEH 3K7UA 5CCKH 1BMGA 2B1HL 3D0VB 4AMXA 4HCFA 1BZ9A 3GJFH 5EULV 1YPZB 5TGBA 3IFNL 2QSVA 1TTRA 3NIDE 3ORJA 3QFJE 5M94B 4NCC2 4PREA 3JUZA 4R5XA 5IB3B 5CM1A 2Q7AA 4KVCH 3ABMB 1EUTA 2V33A 2DBJA 4NJ9L 4R0LC 2OL3H 5DGQA 1Q0XH 2QEJA 3IU4H 4ZXBB 5GQBA 1HHHA 2BJMH 2D9QB 5K33A 1QTYT 1PS3A 1F18A 3U9WA 5L4JA 3VI4E 4FQXD 2BVOA 3C09C 4LSQH 1NFAA 2DLEA 4YDLC 3S96A 1CGUA 1DDHB 2K9FB 1N6VA 3FUMA 3RDTC 4AKQA 4NO0B 4OLXH 4PG2C 1QFUH 3I9IA 4DEPC 2D7PA 1NANH 3EYSH 4X6BA 3TVMD 1IGYB 3ULUF 4ZTOL 4AM0A 3U9UB 4LCIL 4MA3A 1WHOA 1N5YL 1SHXA 1JZIA 3SDAA 2Y5QA 4KNSA 1U8OA 4XB7A 3RVVD 1QUNB 4XHJC 1I9RL 3FQTA 3MZTA 4Z9KB 2PW1B 3TH4T 1X9RA 2BFVH 1B4RA 2CRMA 2CPCA 1ZT4B 1UZ6E 4DP8X 3PP4H 1M42A 1NCNA 1WLHA 4LKCA 1QWNA 3IJSA 3Q01A 1LP9E 3D18A 4PW9A 4MX7B 3C6LD 3WS6A 4I3GA 4JQVC 4Y19D 3ULVH 2QQKH 4O5LL 4WKZA 2XWDA 4JO5A 1ZHLB 1INEL 4HJEA 1B90A 3O6KL 1CTNA 3FO9A 4H1LB 4HK0B 1OAJA 1VHPA 5D1ZA 2OKMA 3K6FA 1DE4B 4H5SA 3GSWA 3MZGB 3ZLQC 1PIGA 2Z8SA 3HE6C 3LKRA 1GGIL 3RPIB 4C47A 5F1NB 3HR5B 3NFSL 3TN0B 5IZ7A 2E3VA 2B20A 2CO1A 5I5JA 2Z0UA 1VACB 3MI6A 3QUXB 4U05A 3OKEB 1F13A 2YGVA 1XEUA 4NKMA 2AS5M 4HJ0C 5H37H 5LDSA 5GS0H 3WTYA 3U7YH 5E8OB 2J57A 5AZ2H 1ETA1 4LQFH 3WLBB 1F02I 5E5MB 3SJVE 1F5WA 3P4MA 1NBVL 4HALA 1TVBB 4P9HH 4CN6A 4XNZB 2N59A 3G6AA 2NY7L 2XXCB 3K1DA 4XNMB 3DK2A 2P24B 4MD5B 3R19A 4L0PB 4H44C 1Q1JL 2BXZA 5IJKA 4QY8A 2W8CA 4XO9A 1XIWA 1DUYB 1E8ZA 3MSPA 3P11H 3P3SA 3S5ZA 1NDMA 4RNRB 2OMVA 3CVBA 2J55A 4IRSD 5JIQA 1YEIH 5LG1A 3QZBA 1QBLH 1WQVT 1IKOP 1KEML 1X5YA 5I18H 3IN2A 1CLYH 4AQ1C 4JPKL 1AP2A 5T1MB 2NW3B 4PJBA 2I5YL 4GAAA 4HU2A 3V9CA 5T1LA 1ZGLA 1MJ7H 2BO0A 3FSOA 2FIKB 3K80A 3H3PH 4EZKA 2ZTBA 3DETC 4PJEF 4B9ZA 1UXMA 1P69B 4B6ZA 2XPZA 2CBPA 5IVNA 1QSEB 3MGTA 4HK3N 2I9LB 2VITB 2RIKA 4X4XA 2BS71 4AIEA 3L4VA 3HVDA 4HLEA 2CLVB 1FO0A 3A24A 5HYJD 4QJ3B 4JKKA 5HY9A 1ADQA 4APQA 4HG4J 3SO3C 1KN4H 2CHWA 1QFWM 1FH5L 5D55A 5AVUB 5FO2A 3O9WC 4F8OA 2P5ED 1M6UA 4XNAA 5B8CA 4HUUB 2EIEA 3GIZH 2EYSB 5ITBL 2BVEA 5D1XE 2H3NB 5HJBA 1EFXA 3D25A 5I1KL 2FEEL 2J43A 1SNRA 4HKZA 3ZO9A 2ZJSH 2FJGA 1VB9A 4F9PC 4P05A 4YPJA 1H15A 3WNNA 1KYAA 3QCVH 15C8L 2KZ1B 3IKCB 3CVHL 3KAAA 4N9GB 3WFEH 4KUZH 3LN5A 5HPOA 4I0KA 4PGBA 1FGNH 1UVQA 2IBZX 2F54E 4QRPB 1IUZA 4X2UA 4WFGE 4GUCA 2BSED 4AEFA 5B4MC 5HI4D 1IB5A 2AJXL 5BUGA 5C9KA 3S36L 2LVCA 3B34A 1U3HA 4KI5D 3BQUD 3GM8A 4FNLH 4B96A 5J13C 1KENL 2HFGL 4L3FA 4YHIB 3CFJA 3FQRB 5FWRA 3HUJA 3P3RA 1ORQA 5SWSD 1L5GB 4BSWB 3OM3B 4L0YA 3NIGE 3QR0A 1CDUA 4KV5F 1AD9A 4LE8A 5D1QD 5BJTA 4BKTC 2OTWB 4NCDA 4H0LC 2VH5L 1UH2A 2GG1A 3ZRSA 1H8OA 4I89A 1JFQH 2CJUH 2NXZB 2J4WL 4K3GA 1AYRA 2ARJQ 3FRPA 4BFRA 3MOBH 4PBWD 1BIHA 2V3EA 1ZJBA 3QPQD 4KNTA 3LDBB 3MUUA 4P2QE 3Q8BA 4JFPA 1JNNL 3LPWA 4GG6F 3E8VA 1WAAE 4F57L 1T20B 4HH9A 3OHXC 1ILSA 4YZFF 4AKOA 5CJQH 3CH1A 3I2CL 3EOBB 1JZ5A 5IREA 4JFVA 1FYTA 2MQGA 2L04A 5JOEA 2FAUA 1AHKA 1F6LL 2LE9A 4WUKL 2CRIA 5H37G 2CO4A 2XX0A 3PAZA 3BKCH 3TESA 2YAEA 5AYTA 4QXTA 3EDEA 3IK2A 4U1GB 2YBRA 3MRIB 1M4KA 1A1OB 3X14A 3A4AA 4LSPH 3RWIB 2VW6A 1M7IA 5AB1A 3OLEA 2IAMB 5EN2B 4QUOA 1JD7A 2EEBA 3C8HA 3LEYL 4TKWA 5SV4A 5L8JB 2R8SL 1TT6A 3TZVD 3FHAA 4XOAA 3CVIL 5DU7A 4JDZB 4WSJA 2E56A 1K4CA 5HD8D 1QSVA 1I8KB 4ZXBD 4DK3A 1WFOA