The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
141
|
structure length |
140
|
Chain Sequence |
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Transcription elongation factor B polypeptide 2
|
| publication title |
Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb |
| source organism |
Homo sapiens
|
| molecule tags |
Ligase
|
| total genus |
35
|
| structure length |
140
|
| sequence length |
141
|
| chains with identical sequence |
F, I, L
|
| ec nomenclature | |
| pdb deposition date | 2014-08-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF01847 | VHL | VHL beta domain |
| C | PF17211 | VHL_C | VHL box domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Elongin C; Chain C, domain 1 | von Hippel-Lindau disease tumour suppressor, alpha domain | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | von Hippel-Lindau disease tumour suppressor, beta domain |
