4W9IC

Pvhl:elob:eloc in complex with (2s,4r)-1-((2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
140
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 35
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9iC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9iC01
1VCBC 4W9FC 4W9GC 4B95C 4W9DC 1LM8V 4W9LC 4AWJC 1LQBC 4W9CC 4BKTC 3ZTDC 4W9EC 5LLIC 3ZUNC 4W9JC 3ZTCC 4W9IC 4W9HC 4B9KC 4WQOA 3ZRFC 3ZRCC 4BKSC 4W9KC 4AJYV
chains in the Genus database with same CATH superfamily
4MMYA 3K6NA 4U1LB 4DW2H 2E9GA 4L3EE 4FP8L 1P4UA 3FNKA 4XPTL 3HUJB 1GOHA 1GGBH 4K3EH 2VMDA 4XPFH 1WFJA 1JF5A 4QY8B 1XF3B 4WI4A 3HC4L 4JFVA 2QHLA 4UTAL 5JA8B 2ITEA 5KJ7E 1F58L 2ED8A 5HJ3A 3SJVA 4XOCA 4Z7UB 1XAUA 1TQBB 2PXYB 4RFEB 5TDPB 3V10A 3F12A 3HI1A 1DVTA 2AHIA 1ZTXH 1QSEE 1UFGA 1T4WA 2J5LC 3R7RA 2IBZY 2YAPA 2ZUSA 4F15C 4ISVA 4S2SB 2R1YB 5A43C 1IC5L 5MERB 3RPBA 1K8DA 5EU5A 2QSVA 1OAQH 4MQ7A 3T0WA 1H3VA 4M1DH 3STZB 5F7YC 3HMXL 3T9WA 3ECBA 2FHCA 3L4TA 4X6BA 5GXBB 5B38G 2WQRA 1BXAA 2X4UA 4S1SH 2VXUH 4H40A 4L0ZA 4KNSA 3MRJB 4IKJA 3SO5A 2DOCA 4A2GA 5JHDB 1BMZA 3PRZA 3QNYB 4LSVH 1XBDA 2KQMA 3QJQB 3QI9B 5BVJB 4M6NL 4OZIA 5EUOA 1MHHB 4KUZL 2YPLA 1CE1L 4Y0GA 2H1PL 1G94A 1U8QB 1J1XL 2PW1B 3A5VA 5DZNA 1FE8H 3COOA 3E6HA 2ARJQ 2Q76A 1M42A 3MROA 2I07A 2YEZA 4KJYB 2HTLD 1ILUA 2UY7A 2OPCA 3HI5L 4W1TA 4HKXA 1E30A 4XOBA 2NY4C 3VVWA 2ZOKB 3ZRFC 5DRZA 1N8ZA 1EHKB 1YNLL 2OJ1A 1I9EA 3FHEA 2J73A 1E2ZA 2ROYA 4XP4L 1NGZB 3BPLC 1NL0L 2HT4C 1SY6L 2H2SD 4W9GC 1HAWA 1WIPA 3P40A 3T3MF 1BEYL 1BDYA 4BUHA 2IDQA 4MWFB 4PW4A 3WE1A 4PY8J 4HH8A 4YHPA 3EOBA 5B3JF 4PJXE 3F64A 2WBWB 2E6QA 3MU3A 4XAWH 4DP7X 4BINA 1KJMA 3REWB 3BH8B 3S35H 5EU6B 1N4XL 1KCUH 1N7MH 2GB2A 2PW2B 3GHBL 3RX7A 2NX5B 4FTVB 1PD6A 1YNKL 4YE0A 4S11A 2A74B 1ACZA 2GY7B 4JGHA 4YWGL 4P2OA 3FCTA 5EEVA 4FZ8L 2X2IA 3BAEL 3BGMB 5CCHE 4JREC 4N24A 2BSTB 4XO9A 4YO0A 1D5MA 1DBAL 4AQOA 3FPXA 3O3DA 2A1WL 1TO4A 4GO9A 3LPGA 4NYLA 1HU8A 3WFBH 1D9KA 2PPCA 1U8CB 5D1ZA 5I6XC 4LKCB 1YEHL 5ADOH 4FQQB 4Q6YA 1SYSB 4YFEA 4YSAA 1B4RA 5CD3A 2Y7OA 3JZ7A 4JW3A 3MJ8B 3QA3A 4KTEH 3T71A 1G7HB 4LL4A 3O41A 4MMYB 1Z5HA 2YBRA 5GJTL 5FCUL 5F9OH 3M1OA 2DWTA 3N1MC 3SKJH 3ELQA 3NP3A 5E8DL 1Q90A 2PO6A 1Z3GL 2EILB 4WO0A 3GBNL 4WUKL 4O02H 2YSTA 4DGYL 4KDTC 5FM5O 2VM3A 3OAYK 1SMOA 5HJ3B 3SJVB 2JH2A 3BWZA 2WNKA 3FTWA 3HLAA 3JWOL 2NY6C 4MAUH 3KS0H 3HI1B 1I7UA 4X99B 3W39A 5C6PB 3BIAX 3CFTA 3AXHA 5ELIA 2K4WA 1OAKL 3HRPA 5IESH 4POZC 2VXSL 4ISVB 1W9XA 1QFWM 5EEYA 5HVHC 2GUOA 1CL7L 4IDJH 4J5VA 4IHOA 4IEFA 35C8H 4FNLL 1K8DB 5EU5B 4MQ7B 5FOBA 1TZGL 4D94A 5L2KE 1C08A 3P0VH 4XN8A 4LU5H 2QQKL 3I75A 5E03A 3RKPA 4X6BB 3IGAA 4Y1TA 2ZXCA 3HEIB 4MCYA 2X4UB 2GJPA 1A5FL 1UGNA 2HTKC 5T5FA 4YDIL 5A6IA 1TQWA 5IJCC 3HNVH 4FHKA 3BMVA 4GRWH 4JUTA 4OR1A 3JV4A 1QTYT 1UA6L 1TITA 4ELKB 1U8NB 4ZS6D 1FL3A 3I74A 4OZIB 5EUOB 1T21A 5I1AA 5LNGA 2YPLB 3BZFA 1R1CA 2ZG1A 1BFOA 5EZIH 2NXZD 4P2RA 4PYGA 5FO2A 1C12A 2EP6A 3E38A 4GMTL 4HAKA 1A22B 1JXKA 3PIQA 4K23H 1MSPA 3E6HB 4GW4A 3SIKA 3NCWA 4LCVA 5E24E 2Q76B 5DTFA 3MROB 4L1DA 2I07B 2YEZB 1TTBA 4X9FA 1R33A 2UY7B 3B7YA 3D4ZA 4HKXB 4M8QA 5DRZB 1N8ZB 4LCCA 3PJSB 5DMIH 3JTBA 5IUCA 4LSTH 4IYKA 4GP8B 1XSJA 1FI8C 4RISH 1SUHA 4ZXBC 4LQFH 1TYRA 4EJ1C 3ENEA 4BSVA 2VZ1A 5FO7A 4JPVL 5LB1A 4OM1L 1KN2H 2WIIA 2QHRH 1ORSA 4UILL 3IRCA 5DDHA 2F5AH 2VJXA 4F57H 3BKYL 2PP7A 3BIKA 3EOBB 5E1IA 1XR9A 2P49B 1NUNB 1RJCA 4N90E 1KJMB 2VKWA 1CU4L 3TBTA 5DHEA 4QWWD 4ONHA 2DYPA 1NOFA 4FFWD 2PXYD 5A2LH 5IWLC 3QRBA 1BQHB 3CZUB 1KELH 1TVHA 3TWCH 4P2OB 3FCTB 4BH7A 1CB4A 1KV7A 4K7PL 3RVWD 3WY4A 4YO0B 1D5MB 5TTRA 3CXHJ 1M57B 4DP4X 1PY0A 3O3DB 4HETA 5KBLA 5A2FA 3UAAA 4LVOC 1MQKL 3CDFA 4NWTL 2YGQA 3LN5A 1D9KB 4NOBA 5I1LA 1BVOA 5D1ZB 2X89A 1CXLA 4Q9QH 2F9BT 5E7BA 2PYEE 4Q9BA 4B9KC 1A6VH 4M1CD 1I1CA 4LRNH 5CD3B 3MO1B 1UGKA 3BZEB 1U6AL 3MDJA 4DKFL 2BHZA 1IBGL 4JR9H 4NCC1 4PV1C 2YBRB 3L45A 3AABA 3SYPA 3EJYC 3G6JE 1B4TA 2K0RA 4H1LG 3K6FA 1NH6A 3L13A 2PO6B 1RAMA 3RUGE 3A6OA 2R29A 1J86A 1GZQA 2AEPH 1CYGA 3AREA 2E46A 3SGEH 1YPZF 1FH5H 4NKDA 3LNEA 4GMSL 1BQSA 1JV2A 2WKLA 4M1GL 3CVDA 3H7BA 3GMQA 3I9AA 3MLZL 3LKRA 1N0XH 2AJYL 2JFCA 3NJLA 2B39A 3HLAB 4FXGB 3N3EA 4G8GA 4HIIB 2A4CA 2YD1A 4YQXH 2EYRA 1I7UB 3MLWL 2HT3D 3HJEA 3CZEA 2EE0A 2J8HA 1SJMA 4BFEA 5I8OH 1KFAH 4CMHB 4KV5E 1KEML 4TPRL 1BIIA 3ARFA 3D18B 1KPUA 3AMLA 1E4WH 2JQMA 3VWJB 1OHZA 2RAMA 1IGCH 2GUOB 3S3DB 3HNSH 4N5ED 4IHOB 4IEFB 3WJMA 2BCMA 2PPFA 2XTLA 4PGZA 5FOBB 4HF5L 5C0BE 3UAJD 1C08B 4I8DA 1NLDH 3HRZA 4APQA 3CFUA 3GI9H 3I75B 4YX2H 4FNRA 4K5PA 5LCVA 3IGAB 3ZU8A 4DEPC 4MCYB 4MXQD 1FQ9C 5FGBC 5CJ8A 3WO4B 2VOTA 3JV4B 4DIXA 4N85A 5JHDE 5EU6D 5AAMC 4Z3FA 3IDGA 2YMOA 1FL3B 2NX5D 3Q6FA 1T21B 4FTVD 2W5PA 3QI9C 3NCXA 2I9TA 1G7PA 3BZFB 3KLSA 1BFOB 2VLRB 4P2RB 4XP1H 4TQEL 3BZ4A 2YRPA 1C12B 4MBRA 3EOAA 1J0KA 3U83A 3VXUB 3PIQB 5IFHL 2V2WA 5AEAA 1HE8A 4GW4B 4CC4A 4P5KA 5D8JL 5DTFB 2O61A 2VLME 1K72A 4EUPG 3IJ8A 2GI7A 1FZMA 2NW3A 1B9ZA 5E5RB 1YO4A 3FU6A 1P2CA 3O3EA 4M8QB 3UGEA 2UXTA 5JTWA 3VD9A 1QAWA 2PMZA 3OKDA 4FERA 4LCCB 1DJWA 5CIPA 4G8EA 4Q4EA 3KPRE 4TYUA 4PJCF 4BQ8A 2N1KA 4AGMA 4BSVB 3X1NA 3PAUA 5FO7B 5T5FL 4JQVC 1H8SA 1GSKA 2R0LL 4HUWA 1TFHA 3QARA 4I9WD 4KK9C 2W95A 2WIIB 1C1EH 1ORSB 1TQVA 3NJIA 3Q1SH 4XWOD 5DDHB 3B4NA 1V7ML 1CLZL 1JGUH 4FJ6A 3BIKB 1LK3H 4YHLL 2Y6SD 1XR9B 2Z35A 3PWVA 5LAXA 5TF1L 3IWVA 2VAAA 2F54A 2VRAA 3TBTB 3SJVD 4ONHB 1UG9A 2DYPB 4FQPA 1AHWA 4P23D 5L6YL 3DX0A 5FHAL 5FYLD 3ZHNA 1ITBB 2ZOUA 3MOBL 2IFFH 2YD4A 1TVHB 4KY2A 1ZSDA 1I8LC 1HXKA 4XNAA 4BH7B 3IB4A 2Z7ZA 4AJVA 4EI5A 4TL4A 1BM3H 1JPSL 5D2LE 5D5ME 2ALAA 4OLEA 5AYQA 5KVFL 2X6MA 4DKTA 2IH3A 2UXGA 5HYJA 3LN5B 2DM7A 5IGXH 1YQ2A 5DXWA 5I1LB 5C7XL 5HHVH 1K3IA 5IK3A 1PKQB 3ZKND 4LARH 2G9HA 4JPKL 2LABA 4AJ0A 5LBVA 2BDNL 3FDWA 4K4KA 5AW8B 3RWJA 4FXTA 4M6OH 3SE8H 2PCFA 2PR4L 2IPTL 2HLAA 2FHFA 2KPWA 1I9RL 4RMWA 1ZY9A 3PWPA 1NZRA 1RJYA 1RI8A 3AREB 3U46A 2LQRA 4F37F 4XP5H 1M7XA 1F4YL 4G7YL 4NKDB 2XWEA 1JV2B 1UZ8A 2Y1ZA 2YPLD 3B6SA 3GMQB 3H7BB 1O0VA 1IM3A 3SE4C 3LKRB 2X42A 4HLZG 5ALBH 1UD8A 3MV7A 4XR8C 3ZKMD 4UZUA 2EYRB 1R5WA 2OSLA 4FQIH 3S36X 5C0IA 2NY0C 3PNRB 4QXGH 2Z1PA 5FUZL 4BCYA 1G6RH 1HQRA 3ARFB 4JJ5A 2OFQA 1IC1A 1KPUB 5HDOA 2OK0H 1HKLL 2NYYC 1KEGL 4AK2A 1ID2A 1DJHA 4HJ1A 4X42A 4YBHA 3VGAB 4Z7QB 4S0HA 4APQB 3GSQA 3HRZB 3G6DL 4XOEA 5C9KA 4MMZC 2Z31A 3JTSB 2Y36L 4AV0A 5CJ5A 3K2MC 2R29L 1I1AC 3VD1A 4L23A 2C3GA 3G9VA 4KAQH 3GXDA 2YGNA 3N1FC 4DUXA 5BRZB 4XNQA 1F18A 2KL6A 2XKUA 2NNCA 3PQYB 2ZCLH 3IDGB 2VDLH 1AD0A 5LG1A 3Q6FB 3NACH 1BPLB 3IGUA 2I9TB 1G7PB 5EU4A 4JFHD 4RRPA 1A4CA 1PZ2A 5EUOE 3BZ4B 2BY2A 1EH9A 4P2OD 4D2NA 3EOAB 1F1GA 1V7NH 4KVCL 3W2DH 5HSFA 1KPVA 2Z0UA 4XHQA 2V2WB 2J1XA 1F4AA 1MCWM 4LEEA 1JN6A 4IJ3B 4P5KB 4TNFA 5JOPD 1DQDH 1EZSA 3FB5A 1BQLH 1FZMB 4U7MA 2K8QA 4JMNA 3ZL1A 2NW3B 5I1JL 2WUCH 1A6UH 1D9KD 1P2CB 3O3EB 3TO4A 4H5SA 3OKDB 5D1ZD 1I8UA 3A6BL 2DLHA 3LZFH 1F3DJ 1U8IA 4ELMF 1JRHI 3P3TA 4OQ1A 5CIPB 3T2PA 4G8EB 5LCVL 4KKLC 4LVNB 4XTRC 1RZKL 1YN7A 1M56B 4WTQA 5J12C 1QZ1A 2NTSP 4UOW1 4HUWB 1E65A 3BQVA 3V0WH 3KDPB 4EAEA 5FF6A 2PO6D 5KW9H 1G0YR 4JFSA 2NYKA 3FTVA 3PWVB 2Z35B 1IFHH 5LAXB 2AEOA 3F7VA 4Y5XA 2OR8A 4AXWA 1AR2A 2VAAB 2F54B 3ZDWA 2H0JA 1SHWA 2IBBA 2P5WA 2HX8A 1AHWB 2YQGA 3V9CA 3EG9A 1ET8A 4XNXH 1QI3A 1RJZA 2Q8BH 2X4SA 3KYKH 1ZSDB 3TS8A 3KJ4B 3TV8A 3TJHD 4GO8A 5DJ8A 5F93C 4ZFGL 1YAZA 1JI2A 2CHZA 1FGVH 2NOYA 3GBMH 4DFIA 1SJXA 2IGTA 4UMGA 4NJAL 4K3GA 4P5TA 2IH3B 1JERA 3S5LA 4WI5A 1DVQA 5IK3B 2G9HB 3P4LA 3OZLA 3I9GH 1XD1A 3X1FA 4NHUA 2PCFB 3FCSA 2HLAB 2VH5L 4EIZC 1MFDL 1CDUA 3WDHA 3WU1A 3PWPB 3LVEA 1YC8A 3UH8A 1VCBC 3UZQB 1RJYB 1JZFA 1JS4A 1IZJA 3WFCL 3E2HB 3BKML 3K4AA 4R96A 2YMTA 3MUHL 3FB7A 4YSQA 3VWKA 5D1QA 3PL6C 2XVKA 3A6CL 3CDCA 1UZ8B 1F00I 3B6SB 1S9WB 4EKJA 1P6AB 4IDLA 4JVPA 1IM3B 4R4NC 4R7LA 4UNUA 5E56A 3KJ6L 3MV7B 3Q8BA 4ZW5A 2JI1A 4FXGC 3UJTH 3V0DA 1QP1A 4IBZA 4LEBA 1R5WB 4OGYH 4YXHL 2OSLB 5C0IB 4NNYA 2A6JA 4L8SA 4RA3A 1HQRB 4JJ5B 4CMHC 4LE8A 4RWYH 1JGIA 1BPVA 2IQAA 1T1ZB 3ZKQD 3VWJC 3UTPE 4PGCA 4NUJA 1J0YA 4N9GA 4XGZB 2KKQA 1OOWA 3GSQB 4KZEL 2Z31B 3D2UA 1JUFA 3HN5A 4Q14A 5I6OA 2WZ0A 1BZEA 1AO7A 5K9JL 1L9RA 2YXMA 3UL4A 3OMNB 1OOAA 5T3ZH 1KLFA 2V3FA 3RY6C 3WO4C 4XNQB 2CR3A 5I5JA 1Q1JH 1QA9A 4HSAC 3VMPA 1AD0B 2WLYA 3K80A 5G5DA 3SBQA 4YDVA 2P24A 3CDZA 5EU4B 1BFVL 3EH5B 2D3VA 2BWIA 1WAAF 5ANME 2VLRE 4NPKA 1KPVB 4APXA 3VXUE 2BSCA 1EHNA 5EOCH 1BF8A 4LPVA 3FB5B 1T1YA 4LF3A 1HHHA 1OPGL 4NAMA 5A1AA 2AQ3A 3TO4B 3CZNA 1GMIA 4P59H 1BG1A 3VGHA 2X89D 3E9TA 1G1YA 1F5WA 1U8IB 1UM6H 3M8OH 3RZWA 4GI6A 2X44D 2FEEI 5F8QC 3PPEA 4K7FB 2Y23A 3QO1A 4L8BA 4F58H 1CVSC 5FDWA 3S3JA 1P84J 1OAZH 1YN7B 3IEAA 4UOJA 3WMSA 3L7FA 3N44F 3WIIH 2WC7A 3G6AA 5E7FA 5AZEL 4NC1C 3H3PH 2YPVH 3BCDA 3CNKA 3GIZL 3N04A 4NC1E 4X98A 5LBSH 1R24A 4TNEA 4WGVB 3WL9A 2OCJA 1EX0A 4L4VA 4L9LA 4E5XA 3F7VB 4Y5XB 4AXWB 4V2CB 5D71H 3KLAA 5F7LB 2P5WB 3EG9B 5E6IA 2BHYA 1RJZB 4GKLA 4LHUG 1NCWH 1ZHKA 2X4SB 3JWNC 1R3IL 3DX1A 3LPFA 1X6NA 3MSPA 4G8GD 1F8TH 1P7BA 1NANI 1NUDA 2F7RA 3JWNE 5E99L 4DSYA 4NC0B 1F2QA 4YHYC 3U0WH 2CPUA 5D1ZI 2UVEA 2DKMA 4S1RH 1AKPA 4EN2A 4F8LA 3RI5F 4E9YA 4P5TB 5DMYA 4PLKC 4QHMB 3O2VL 4BQ9A 2C4FU 3GI8H 3S5LB 3W3BA 1RZPA 2KLSA 4L3CA 1CBJA 4QRQA 5CSBA 3BJ91 4APQD 3R8QA 1TZHA 2GVYA 1PKQE 1KCRH 4CN6A 5BVPH 5DC2A 4ZMWA 3K3QA 3FCSB 4MJIA 1T7YA 1J88A 2F5BL 3M88A 3KYOA 2XPZA 1IGYA 2ZCHH 4HSCX 4S1DD 1AIFA 3L3OA 1JV5A 5FHBH 4F7EB 4Y9CA 4R96B 5MI0C 2BY0A 1DN2A 3FB7B 2ADJA 4KTDL 5D1QB 3JT0A 4CMMA 4Y4FA 5GGTA 1QASA 1KYOJ 2HAZA 4Z77A 3BT2L 5FKPA 5SX5K 1R0AH 1ZJAA 4MNHB 3OKNA 3CLFL 1X5YA 2XBTA 3P9LA 3PHQA 4YBQD 4NNYB 3Q5OA 2A6JB 4L8SB 2Y1VA 4GQRA 4X7TB 1KJ3H 2FD6H 2DQIL 3F01A 4P04A 3ILPB 1Z2KA 1CYXA 2C3XA 2IQAB 3B8SA 5L88L 1RHHB 3PREA 3NBNA 4PGCB 4DPAX 4N9GB 3EOTL 4NUQA 2WXHA 3MUZ1 4D0BA 2OJEA 5C0NC 4LVHC 3D2UB 1JUFB 2VN3A 1MRCH 3HRZC 1JZ8A 1EFXA 1X9LA 4QRTA 4OGQC 1QUPA 1FVEA 1ZTMA 4Z8FL 2EC9U 1WEJL 1J5OL 2GKIA 1OW0C 1Q72H 4ELMA 2EDMA 5G5DB 2R27A 5BRZE 1HK6A 1ADWA 4YDVB 2P24B 3CDZB 4LSRL 3PQYE 1LE9A 5FLVA 3UTQA 3ZZ1A 1YEKH 1A64A 1A21A 3P3SA 1EAJA 4MJ5A 4X6CF 1HYRC 4ATWA 3RVVC 4A2FA 1I7ZA 4APXB 4EI5D 5JQIB 3SGDI 3Q01A 2FBJL 4I85A 3T3ME 3OPZH 2WXKA 1MDTA 4H88H 1NKRA 3AQZA 5HYJD 2VR9A 4LF3B 3ZZSA 5B3JE 1FNLA 1HHHB 1MIML 4EDWH 1NGWB 4PG9A 1SJVA 2DWSA 1JYNA 4QF1A 4OB5L 2A73A 1E9OA 4GRWF 4NZ8A 5IV2A 2Q5BA 3QO1B 3I50L 4MZRA 5FDWB 3VG0H 1NCTA 4E9RA 4AV4A 4FQ1H 3U1SL 5ABDE 2E27H 3LEVL 1MCWW 2VDOH 3L7FB 1JZ2A 3G6AB 1FFNB 5CILH 3PWPD 4ODXA 5GRJH 4UTBH 4X98B 4W81A 4DKEL 3RPIA 1MWAA 3NCJL 1CI5A 1R24B 2D7OA 4K94L 4FYSA 3L5HA 2G2PA 5F9JA 4KNTA 3WL9B 3QYCA 4L4VB 4E5XB 3GUFA 3GKWH 3GK8L 4LCYA 5CMAA 5IUSA 4I1RA 2EIEA 1FRGH 3NEOA 5FGCE 1IM3D 2DLEA 3B9KA 3FMGL 3QCTH 5E6IB 5F9WB 5B21A 1UUSA 3GM0A 3MV7D 3I3EA 4OD1L 4JANA 3OLEA 3LIZH 2OZ4A 1ROCA 1KZQA 1RZ8B 2NDFA 2HZHA 4PFEA 3TO2A 4UB0H 1JGVH 1TIUA 2H0PA 3GRWA 4X7EC 3GBEA 3NUKA 4O9HH 1JTPA 1Q0XL 4QRQB 3RBSA 5DFVD 2Z31D 1BZQK 4MJIB 4GOSA 4Q89A 5DUMH 1NBCA 4OAWA 3ZOAA 4NN7C 4WW2F 1IGYB 1YLBB 2ZWSA 4YAQA 2EIJB 1AIFB 4J6RL 3X3FL 1HXYB 2B3IA 2UX6A 1JV5B 3L3OB 4I7ZC 1TJGH 2ADJB 5FFLA 3FOLB 4PRBA 3RURA 4ZX5A 4CMMB 5ACLA 4Y4FB 4H8UA 4Z77B 1N6VA 4EN3C 5FKPB 5INCA 4TTDD 1MHPL 3O0RH 1NCCL 3KLDA 2EDNA 4DKDC 3FUFA 3H42L 3OKNB 5IIEB 2WYIA 5JW4M 3P9LB 3PHQB 5GGQL 4HC1H 2R2CA 1LO0L 3WAJA 1DFXA 1H3WM 3GS4A 3QORB 3TO4D 3N42F 4OF8A 4HMEA 2GCYA 3OAWA 2WWOA 4JHAH 5AAPA 2EC9T 2EDRA 2CK0H 3VXNA 1R3KA 2CMRL 3KDMA 1UOLA 1QG3A 4D0BB 3MCLL 4ZJ9A 3HG4A 2OJEB 4ZO6A 4IIQA 4LNRA 5D4JA 1CGSH 1A7RH 1EFXB 3PXHA 3FT2A 4FQLL 4OFDA 4QRTB 3QNXA 5CCKH 5L7XH 5GJSL 4NI3A 2E9JA 4M7ZB 3ARBA 3DBXA 2YD9A 2C5DC 5GGTL 4ELMB 2R69H 1S5HB 2VDNH 3ARSA 2P5WD 1EA9C 2ZOLA 5CEZD 2IWFA 2C34A 1WG3A 4F5CE 4OFYA 5BOPA 2ZSWA 5C0GA 5FYJU 1AYRA 1PLBA 4CW1A 2L7EA 1V55B 4GQPH 4MJ5B 1CCZA 1I7ZB 3CPLA 3UX9B 4LRIC 1MJ8L 1CYWA 3P02A 2AS5M 4LOEA 1E6JL 3BHBA 1M1XB 2J6EH 3OMAB 4ADGA 5MHSD 4JZNA 3WFDH 1FDLH 5FFOA 4PG9B 2XZAH 3J27A 3BX7C 4LSUH 3RDTD 3BCFA 4QF1B 2A73B 4RMQA 1E9OB 4U6VL 5IV2B 5K93A 1PX8A 5CN3A 2WLIA 1CD9B 1MRDL 4W70A 4PJGA 4UDTA 4MSWA 1TJIH 3P9MA 1W72H 4I0PC 4ODXB 7CGTA 1WS8A 2K4AA 2MRYA 2A9AA 1TJHL 1MWAB 3RPIB 2EACA 3FULA 1VZGA 5MENB 2ZZUT 5F9JB 3VWKD 1RIUL 5ICZB 2XTJB 3WY3A 4LCYB 5CMAB 1BBDL 1VRSA 1J87A 3D30A 3B9KB 1EXHA 1HCVA 2XFXA 2ZOOA 3OR6B 1P53A 4JANB 2P42B 3RTQC 2OYKA 2FEDD 3MJWA 4YHOH 3X13A 4HCIA 3MV9E 1MF2L 5HVWA 3C09B 2FJSA 5B1AB 1WWBX 3TO2B 4R2GB 5FV2A 4NO2A 5DHVH 2AW2A 3FCGA 2R1XA 3SDDC 1WF5A 3FT0A 4CDHA 2UZIH 1KGIA 1YPZE 3RVXC 2FGWL 1FYTA 5GS3A 4N2HA 4YHKH 4LCWA 3ARZA 1RUML 5F44A 1ZV5A 3U1PA 1YSOA 3B56A 1DUYA 25C8H 1LEGA 2BSRA 1VFAA 2EYSA 1MWAL 4WAFA 5GS0C 1C9SA 1AO7D 1NEPA 3GS7A 4OAWB 4P3WA 1YYMH 4YGAB 1MFCH 4FYRA 1E28A 4LAQH 1PFOA 2H2PD 4YAQB 3PABA 2QEJA 3O8XA 2PP8A 4XMVA 2R0KL 3SDAD 3TP4A 1SXAA 2VDQH 4ONGL 2XX1A 3EHBB 1MCPH 1THAA 1D7FA 2OZ4L 4H8WH 1YY8A 4O02A 1NMBH 2E3VA 3I6SA 4TVPL 5INCB 2H0FA 3NIDF 2ZICA 4DETA 1KENH 1SJHA 3C2AH 3WUWB 5CJXA 4JHWH 2KH2B 4CBZA 3GRWL 3DMMB 2WZ6A 5EO0A 1I8KA 3VB9A 1PG7L 2PCXA 2RA1A 2B9AA 2KERA 1QLRA 4KQ4L 5DJ0A 2GCYB 4C56A 3VD3A 4R97B 1AXSA 1J18A 4J8RA 4J3SA 2BWQA 3E7JA 1WE5A 3VXNB 4EIGB 1R3KB 3KDMB 4YSUA 1ZV2A 5EB9A 4TNVK 5C70A 3QFJE 4IIQB 4LNRB 2IXQA 4HS8H 2FE0A 3FT2B 3QNXB 4OCYL 2QV4A 3FQWA 4DW2L 4QOKA 5F6HJ 1X5AA 1VEMA 1XB6A 3ARBB 4N0UE 3DBXB 1GGBL 3OMZA 4L4VD 4RGNB 4K3EL 2FJHA 4NFCA 4XPFL 3D3VA 1K9TA 5L2JA 2NY3B 4LEXH 5D70H 3BVTA 4UNIA 1K6QH 5E6ID 6FABH 4K94C 2ZSWB 1NBZA 3K72A 5DQ9A 1DQLH 1TTUA 4PJCE 4CW1B 2GI0A 4PJDF 2L7UA 3NN8A 3VI4A 5ABAA 4OZGA 2R0WH 3CPLB 1BMWA 1ZTXL 4CGUB 4PD4K 1KOAA 4PRPE 2FBRA 3LRGA 1U0QA 1I9JL 3PGFH 1NSNH 3BHBB 2PWEA 5LWYH 1ZLUH 2IDTA 4JZNB 3ZTCC 5DZJA 4CSSA 1TTAA 2NNAA 3S5ZA 4YSEA 2FSDA 4Z7NF 3DYMA 3UGXA 2WLIB 1BJ1H 1NFDF 5IBLC 1OAQL 4PJGB 3U6XS 3CK0L 4M1DL 4UDTB 1UCTA 2VUKA 4MJID 3IFNH 3P9MB 5C09A 4Z0BH 1H5BC 1FZKA 4MYWB 5BQDA 3ZDZF 4S1SL 2VXUL 2VMFA 5B7EA 4FLHA 1W91A 4O2EA 2J8OA 3OXRA 4ENED 3CFEA 4HCRA 3R19A 2AJ3A 3AQYA 1NTDA 1MCDA 3FT4A 6CGTA 1ZA3B 4Y4FD 2WZAA 3UCQA 4CC1A 1WS7A 3HHSB 1J1PH 2XFXB 3AVEA 4FLOA 4RDBA 3GXNA 1PYWA 3MNZA 1FNGA 3WTUA 4WW2A 3X13B 1FE8L 1TZAA 2EIDA 3T2LA 3JWDC 3WJJA 4PJEF 2JJSA 5JPNA 2GG1A 3OLIA 1PFCA 4NO2B 2XXGA 4PJFF 4H8HA 3FOMA 3K5SA 1P4BH 2AXFA 3RGVA 2V2TA 1FYTB 1YJDC 1QTPA 4LCWB 2QPEB 1E9QA 4BFIA 1EFXD 1LEGB 1I1RA 2BSRB 1VFAB 2EYSB 4LLYA 5DWPA 1X5HA 4HX1A 1E28B 1U21A 1DZ0A 4HJ0C 5JW3L 3PABB 2DQHL 3VG9B 4XAWL 5BOZG 4EF3A 2WINA 3S35L 5IJBC 2FATH 1KCUL 1N7ML 3CZLA 4XMPH 1M7UA 5KVEH 3FO0H 1JYWA 4G70B 1YY8B 4O02B 3GSOA 2CJTA 2O6EA 3Q1EA 3ULUH 3M7OA 1QX1A 2ZG2A 3WXVH 2DIBA 1SJHB 4GKZA 5IREA 3RL1A 5K1NA 3GRGA 1YMME 5HYSA 3FPYA 3VFWA 5KVDE 4YEEA 2XQYG 5I0ZA 2BW4A 3C12A 2C1OA 5EO0B 1I8KB 5GRXG 1NAMH 3QORC 5C6TH 2X1PA 3L1GA 1QLRB 3WFBL 2ZCZA 3GF8A 2J5WA 3QVAA 5DJ0B 4C56B 5JPMA 3UPRA 1AXSB 2W94A 3BWAB 5FR3A 4J8RB 3O9WB 4X6CB 5SWSE 1T2QH 3UYRH 4WFFD 4KTEL 3LSOA 4OQTH 2IXQB 4YSOA 1QRNB 2K78A 1FLTX 5F9OL 3FQWB 1JP5A 3ISYA 5FK9A 4QOKB 3SKJL 1ODUA 4GPVA 4AVKA 3B7UX 4M9OA 1OF2A 3MRLA 4TSAH 2YQBA 3D3VB 5L2JB 2AV1A 2E6JA 5K9KA 4GRWB 2MCG1 4O02L 3B9KD 4DGIH 4ELME 2OKMA 4Y5VA 7FABH 4XODA 1NBZB 3K72B 5DQ9B 2EIKB 2YFNA 1IC4H 2GIYA 1XCXA 2CBPA 3NN8B 3DIVA 3VI4B 4N2LA 4QXUH 1EAQA 4OZGB 5JYLA 4MAUL 3FBKA 2BPBA 4L48A 4P9HL 5G2NA 4TVPD 2CE6A 4KXCA 4IQHA 4R2GD 5B7FA 3B1UA 2KBGA 5IESL 4NQVB 3UEQA 2A9BA 3E8UH 1ASPA 2NNAB 4MA8H 2Z93A 5IR1A 3QQ3A 4IDJL 3ZE1B 1DUZA 1A7OH 4NRXA 2GY5A 35C8L 3V0IA 1M7DA 2FDBP 4JHBA 4JRXA 1MG2C 4XPAH 1Y6KR 3P0VL 3BGFC 4LU5L 1OQOA 5IFAH 3PAZA 2C9VA 1YEDA 4MS8C 3NSDA 1FZKB 4UAOC 2WUBH 4WK2B 1KCWA 3DJTA 3VD2A 4G6FB 1ZHLB 3L4UA 1A2YA 5DEGA 3HNVL 3OXRB 4O2EB 4BYHA 2ERJB 3B2DC 3CFEB 1WQVT 2AJ3B 5J89A 3MODH 4ZMXA 1XMEB 3FT4B 2XTJC 5FYKH 5MENE 3KVDD 2DL2A 2HLEB 4OF6A 2XTJE 4AG4H 3VXRE 5ALCH 1GCYA 1LVEA 1PYWB 3K8KA 4A7UA 4OJFL 1FNGB 2V3DA 4PJ6A 3O3UN 4YMPA 1KCLA 2HUHA 4KRPC 4WTXA 1JGLH 3NIGF 4WW2B 2PPEA 4K23L 1TNNA 4MJ2A 1AACA 1A9BA 4CN4A 3AT9A 2Y69B 3Q8CA 4OFVA 3C09C 1L6ZA 2Q3XA 3B2VH 4HIXH 3FOMB 2AXFB 2MKLC 3RGVB 3TNMA 5DMIL 3F62A 1YEGH 2XG5A 3MCG1 4LSTL 4RLDA 5IB4A 4J4PC 2CBTA 3ZUCA 4LQFL 1E9QB 1ZT1A 5J6GA 3GXTA 4OFKA 4WF7A 3F65A 5D4HA 4LLYB 3PXJA 3OL2A 4JVUA 4HCRL 1NUGA 4HX1B 1AGFB 2QHRL 3R4DA 3EJRA 4RGND 2AV7A 1MREL 2F5AL 4F57L 1FAIH 1XF1A 3DETC 2DW5A 1B3JA 1R19A 5IT2H 3FN9A 4A68A 4BQCA 4L4TA 4F37K 1MCKA 5F0JB 1SVZA 1LO2H 2DM4A 4ZT1A 4OFYD 2OMZA 5IZ7A 1G9NH 2E59A 1TEFA 1KBGH 2Z65C 3LKNA 1T66C 2CGYA 3GSOB 1OF0A 3LKPA 3KWUA 3FS9A 4WHCA 1WT5C 1KELL 3IJ7A 1DQIA 4LFHD 4GKZB 1H3PH 3RL1B 3TWCL 2HLFD 3EJZD 3JBG7 5HYSB 3EH1A 4KGJA 2Y25A 3VFWB 5ABZA 2DKSA 1ND0A 3E80A 3DA0A 3ZSTA 1KF9B 2C1OB 5KN5A 3DMMC 3AB0B 5JZ7D 4OGXH 1ZTXE 4AQ1B 5JPMB 3UPRB 5C0AE 4Y4KC 4OLWH 1AZRA 1Y1UA 1JDAA 3LKSA 3OZ9H 1W6LA 1A6VL 4L1BA 4KK5C 4LRNL 1NLBL 1WZAA 2HA1A 2IV8A 3LSOB 3M17A 1WAAE 5DA0B 2X9YA 4QHPA 2VZOA 2WXOA 4LT7A 2AEPL 3RZCC 3MRLB 1AVAA 1FH5L 2AV1B 5K9KB 4H8PA 4LO9A 4Y5VB 2GITA 4P46A 1OEZW 2GJZA 3KXFA 2ISDA 5I18H 1N6UA 2EDWA 3O6KH 1N0XL 2O5ZH 5F7HA 1E3ZA 3VFMA 1RPKA 4QHKJ 4YQXL 3AS2A 2ZKMX 3NJNA 4WFEE 3EOYG 3QJTB 4G80A 3KM2A 2FT7A 4PCTA 1QFHA 2D7TH 4Y1AA 4P5MA 1KFAL 5AKTA 5I8OL 1EHLH 3SODB 1JK9A 3C8KA 4FHJA 5LXGH 2B77A 2H3XC 1RL1A 5J13B 3WS3B 1E4WL 2Y5TB 5IR1B 3WNPA 4KMTH 4HEPG 1IGCL 4LCWD 3HNSL 4NRXB 5IB2A 4G5ZH 3FH5A 1AG0A 4QGYA 1UFUA 5IBUG 1M7DB 4OJYA 1TZ8A 3AY4C 4JRXB 1L9OA 2AABH 2Q2LA 2HJFA 5AZUA 3GI9L 3QWOA 3QZMA 4YX2L 1WIUA 1YEDB 2VXVH 5C0JA 2O5XH 4FNUA 4X0NA 3RJOA 3O8XD 4DVRH 1A2YB 4GLRH 5DEGB 5B39G 2P80D 1HWWA 4P99A 3RB5A 3VXTA 2ZAGA 3QG7H 4QLRA 2F7PA 3M7FB 1CFNA 3BSHA 4ZMLA 4WJ5B 4CDGC 4Z7VF 2FUTA 4IGBC 4AIEA 4U3SA 4GKNA 5GS2H 5GZOC 1CFVH 5E9DE 2DBLH 1ZMYA 4C57C 1A9BB 1HYSC 1GZHC 4HHGA 4TTGA 3UFIA 3DX7A 2EDBA 5IROC 4FNPA 2GSGB 3TNMB 1F3RB 2XG5B 1DQQA 3CCHA 4YDLC 4TOYH 1CGVA 3Q0HA 5IB4B 1E4JA 1FYTE 3N91A 2CM5A 2V9RA 4QHUA 2FYYA 3QEGH 4OVUA 5J6GB 5IJVA 1JZHA 5AW5B 5TDOA 1BD2E 2R15A 3IDMA 5EU3A 4QOKD 1TO5A 4X4XA 1C1EL 1WTGT 1WWCA 3B7TA 2AV7B 3K4ZA 3OLDA 3Q1SL 1K85A 2JI3A 3C5ZC 1LK3L 3D3VD 3HAEA 4L4TB 3EO9H 3VG9C 4G7QB 2Y2TA 4RNRA 5DD5H 3CU7A 1N68A 3HB3D 4IBYA 3O81A 5FYJE 3LKNB 3V8OA 4DUVA 4DO6A 4LPTA 2IFFL 4Z3JA 2MIZA 3DX6A 2OMWA 1KBPA 4HFUH 4RAUB 1HHJA 3T1WA 4HOZA 1BM3L 4OGAC 5JYMA 4AYBA 5KN5B 5E6YA 1G6RB 2LT9A 5IGXL 5HHVL 2IV9A 4PJDB 2XHNA 4LARL 4C56E 5A7EA 5I0DA 3O9WC 4L5FH 1B0IA 3QJZA 4B53A 2AK4A 2SEBA 3T6QC 5C09D 4X6CE 3M17B 5FFGA 4M6OL 4WIQA 4YS4A 4PCYA 3PDDA 5AFAA 1QRNE 1QFUH 2D4FA 3GLZA 3Q2VA 4PTTA 4JFPA 3O4OB 1V3MA 2VUOA 3L3DA 3KD4A 3MRCA 5PAZA 2ZXAA 4JFWA 2J3SA 4XP5L 4Q74A 4ZO7A 1NFDB 4QRRA 5JIDA 4P46B 2GJZB 4GRWE 2VDLB 2Z8RA 3FTUA 4KROB 1X4XA 5ALBL 3VFMB 4JM2F 4X4ME 2A4EA 4FQIL 4G80B 1F11A 2H8PA 3O2DH 4JGMA 4Y1AB 4JY4A 4QXGL 3OGOE 4L4JA 4P5MB 4FA8A 1G6RL 3BSZA 1JK9B 3C8KB 3GMLA 5F1SA 4XZ4A 2D3LA 2VNCA 2YAFA 4V1DE 4YDKH 5BJTA 2OK0L 3RVTC 4UQ3A 2VAJA 4GUCA 1DVZA 5IB2B 4G42A 4U4BA 3ATFA 4ESKA 1BWMA 4YXLH 4AENA 2HJFB 3V4UH 3D05A 3QWOB 5C0JB 3TVMC 5J1AA 2P5EA 1JSYA 2G0LA 3ESVF 1S2EA 4PJFB 3MVSA 4AI7A 3HVNA 1MJ7H 4KAQL 4XCFH 4QCIA 5D7KE 2EE9A 5HHOE 2ERJC 2YPVA 2ZUQC 5SV4A 3VXTB 2ZUWA 2ZCLL 4ZUWA 2VDLL 5LBSA 5I6KA 4NO5A 3NACL 3ZT7A 1CFNB 2FECL 4XX1G 2EXWD 1LDSA 5IQOA 4IOFD 2CUHA 1SHMA 2HVJA 3W2DL 4U3SB 3QZNA 4WW2C 2W9DH 4F9PA 2PTVA 4XMLH 1BQLL 1XXDC 3DX7B 3RI5K 1E5CA 4H2CA 3Q2LA 2WUCL 1A6UL 5EDXA 3BH9A 2I9LA 4HG4K 4I13B 3IYLW 4XN4A 3CCHB 1DQQB 5J11C 1DHKA 1GJIA 3FZUC 5T1LA 5KS9F 1N18A 4QHUB 2FYYB 1XH2A 4HKJA 5TE7H 3HZYA 4A2DA 1GSMA 5TDOB 5MEQB 2AAAA 3SDXF 3V0WL 3IDMB 5EU3B 1D5XA 5HD8C 5A2BA 2KLTA 1HFUA 1UUNA 4NHCH 3SPCA 5KW9L 4Q4IA 4DJMA 5CR8A 3AZUA 3MRPB 1IX2A 1IFHL 1SFHA 4XVUC 2X4PA 4RNRB 1H3UA 3FONA 2VDRH 5IFJA 4JFYA 3N1QC 4KJPC 4XNXL 2YQ2A 4J3OF 2C8NA 2Q8BL 4RRPM 2ED6A 3KYKL 3ESUF 2J6WA 1RZFH 2LAAA 3DX6B 4TNWF 2OMWB 4YBLB 5AW6B 3GXUB 5I75B 1HHJB 1CR9H 1H8OA 3QDGE 4JFUA 4WTZA 4L29A 1FGVL 3GBML 5J6HA 5E1GA 2NLJA 5HHMD 2QADB 3U30C 3WNJA 4AIOA 4AQ1C 4WEBH 1B0WA 5KYNA 4JRXD 3I9GL 2SEBB 2XZQH 3NP4A 3AG4B 1V3LA 4M61A 4WFGE 1GXEA 4OH2A 4J3TA 5JIHA 2WCGA 4LMQI 4PTTB 4QT5A 4JFPB 4C59B 2CQVA 3L3DB 2IVFC 3MRCB 3QWNA 2BNQD 3GZPA 2QDVA 3DX9B 1GTNA 1L4IA 1NDMA 2JKWA 4QRRB 5LAPA 1CGWA 4K55A 5HHPA 1KBWA 1ZDSA 1CDBA 2YQ3A 3ZBMA 1XZ0A 3TBSA 5IG7A 4WSGA 4OZFG 1T0OA 1M3JA 3S36H 3UJTL 4L8CA 1NCBH 4OGYL 2ICEC 2H8PB 4XWOC 4JY4B 1UADC 2M26A 4QR7A 2XBZA 3GMLB 2IF7A 3Q9QA 2OQJA 5BJTB 5T3XD 3WMQA 4P23C 4G42B 3BE1H 2H41A 2Y7MA 3SYAA 5FYLE 4AENB 4F8PA 4UF7C 4J12A 3WTVA 4OUUA 1NGXA 3ABMB 4FCAA 1V3KA 3V6ZA 5CHNA 2VQ4A 2P5EB 5CJBA 1ITCA 3IN0A 3WTTA 5KTEH 3ARVA 3HG2A 1OB1B 3A4EA 1CDIA 4QCIB 2XUWA 4WW1A 3UTTA 3QQ9C 1JHTA 3K4DA 4UTBA 3BYYA 1QFPA 3G5YA 1Q1JL 4PVMA 1HSBA 5AAWA 3IMWA 5J56B 1U2CA 4NO5B 5E08H 3IKKA 1KGUA 3HS0A 3BLBA 2HVJB 4H8VA 1Z9NA 4KXDA 3X14A 3LIZA 4EXPX 3LOWA 5LDSA 5IB1A 2CK2A 2EH7H 3BH9B 4LDLB 4P59L 1TZIA 2GTWA 2I9LB 3MAWA 4LSPH 1J8HA 1UM6L 2G0KA 2IH9A 3M8OL 3WEBA 3IAGC 1ZE3C 5D96B 4HKJB 3JQOB 2VTFA 3O45A 5DJXA 3HZYB 3ZKMC 2WBJA 3VFNA 1OAZL 1OTTC 3NIDE 5H37A 2QKIC 2EZ0C 2OI9B 3WIIL 3UCRA 2HRLA 5IHZA 4ECNA 3EDKA 3H3PL 2YPVL 3KL3A 5CU5A 4XBGA 1IM9A 5LBSL 4Y19B 4LOFA 3KLHC 2YAEA 2M2DA 2EECA 5F3HB 2AI0L 2X4PB 4RZCA 1RP9A 4YHMH 4FXKA 5D71L 1GOFA 4E9LA 3RHWK 3DTXA 3KXFD 3FONB 2NZ9D 3NFSH 2J56A 2X1OA 2FHBA 4JFYB 3U4KA 5FB8A 4OV6F 3CLEH 1NCWL 4PJ9D 3APNA 5CLWA 4OF0A 1F8TL 1J5CA 5DVLA 5LN8A 5I8KL 4M03A 4LLVA 2ZPKH 4A04A 3U0WL 4TLKA 3KG5A 3KPSB 2GJ6E 4L29B 4YHNA 2EE6A 4S1RL 4YIQA 5J6HB 1S3RA 4HC1A 5F7NC 2NLJB 5DK0A 5LJYH 3WNOA 3CSTA 3RY5A 3X1BA 1RSFA 3GI8L 2MOQA 4H20H 3IAQA 3B9EA 4PQXA 3K6DA 3S3PA 1O6VA 4UOW0 5T1KA 1W2KT 1IJNA 2FH8A 5CO1A 4ZBJA 4XAKD 3BQUD 4CN1A 4PJDE 1KCRL 5BVPL 1B0GA 1FWXA 1YEWA 3P3YA 4M61B 3RA7H 2H9GA 2BVUA 3AM8A 4F7CA 3INOA 3OAYH 5JOPE 2ZCHL 3B9AA 2NY5C 3MJ7A 4J6IA 4QT5B 4HVBA 4I18C 4GRLA 4ALAH 5FHBL 2R4SH 3W56A 1B88A 1NDMB 3ATDA 4Z7NE 5HHPB 5DK2A 1TMQA 5FUOH 1XZ0B 4GS7B 4PUBH 1NFDE 4PIBA 4WFHE 4OIBA 5IG7B 3TBSB 3WJLA 1TVBA 3QZWG 2APWA 1R0AL 3STLA 4FL4B 4L8CB 2EXTA 3ZDZE 1UD5A 1UT1A 3AUWB 5HGHA 2NT0A 1WUZA 2X2YA 1KJ3L 2FD6L 3MTXA 4Y2DA 1CQKA 1JPGA 2OQJB 2P52A 3NVQA 5CN2A 3EYOA 3VDAA 2RFXA 5F3BA 3TTYA 4O51B 1JHKH 2WLMA 4KKBC 2FNBA 5BQ7A 4PW9A 3HS8A 4U33A 4YC2B 1RKRA 3ZKSD 2B1HH 1MW3A 3HN3A 4OUUB 1NGXB 3LRMA 1MRCL 3V6ZB 2O1AA 5CHNB 2D7NA 3FB6A 3T3PB 3MBWA 3IE9A 4H13C 1EQWA 4NC2B 4PJEE 2VDOB 4XBPA 1DDHA 4XRCA 3UTTB 4PJFE 1OGSA 4WW1B 5I1GH 3VFOA 1JHTB 4U1SA 3IS0X 1Q72L 3G5YB 5HGDA 1HSBB 3C60D 5KS9A 4N87A 3VFSA 5GS1C 2BSED 3G5WA 2BNRA 3S7GA 3MNVA 4LOUC 1UVQA 3HS0B 1FIGH 5IW6A 1YCSA 2JJUA 5DCCA 5I82A 2FJFA 1L9TA 3X14B 1YDPB 5CZKA 3OPZL 3W1ZA 2FZ3A 1NGPH 5EC2B 2JVUA 5E5MA 5I1CL 3OHXA 1WA0X 2XY2A 4LLUA 1G5AA 4NQEA 4G82A 1ZXQA 4GY4A 4X5QA 2QADD 5IB1B 1K5NA 3FQRA 4EDWL 2DQJH 2MMXA 1TZIB 2Q20A 4AQ8A 3BD4A 2C9QA 2PCYA 3V0VA 1J8HB 4YFLI 2V6HA 5DHVA 5TE4H 3OSVA 3JVGA 3GQFA 3ZVVA 3Q6GH 2AK4D 3SOBL 3C6SA 3GSVB 2IGLA 3O45B 5DJXB 3VG0L 2WBJB 1HL5A 3VFNB 4FQ1L 4BK5A 2E27L 2CO4A 3ZDXF 2VDOL 1Z0MA 2EE2A 2G5UA 4FJZA 1PPIA 2OX5A 2CCWA 5CILL 5GRYA 5IHZB 4A2LA 3B5GA 4UTBL 4XBGB 4UCFA 2A3TA 1IM9B 4J39A 3MFGB 4ONFL 2GPZA 4H1LH 4K9JA 1WH0A 4RZCB 3GKWL 3QDAA 3KW7A 4FXKB 4QRRD 1DBJH 3DTXB 1FRGL 3HPLA 4Z18A 3QCTL 3MBEC 4JPWL 1U42A 4FFYH 2MOGA 1RLBA 3EYVB 4HFWA 5D7LD 2VYRE 3ET9F 3LIZL 1N2RA 2XWBB 1OTSD 5DD6A 3TM6A 2Q8AH 4LLVB 4JAMA 4XHJC 5B4MD 3DARA 3RQ3A 1SUJA 2Y7SA 4YHNB 3N40F 5JXAL 4YIQB 1JGVL 4HMCA 2Z92A 1T20A 5DK0B 3WFHA 4F9LA 1FSKB 4O9HL 4KKAC 5IF0A 4IMLA 5T1KB 1BVLA 3ILDA 1B0GB 1AE6H 3QZLA 3HMWH 2F53A 1QLEH 1U41A 2P5ED 2H9GB 2B4CH 2XN9A 2I60H 4RIRA 2VN6A 5DUML 4A63A 1WC7A 4FABH 3MJ7B 4CU6A 2HP4A 3BJLA 2D3NA 3TFBA 1LXMA 4GRLB 1TJGL 5SWZA 1Q0YH 3I02A 1R47A 4X6DF 3EIFA 1XF4A 4TQIA 3QDJE 5E0QA 4MVBD 2WO4A 4NZRH 5DHYA 5FW8A 2FECI 5DK2B 5C0CA 5T3ZE 2VDNB 4ANKA 5SX4H 1OGTA 1CI3M 4WVRA 1TVBB 3EYFA 3O0RL 4HWBH 4PJAA 4A2MA 5HPOA 1TSHA 3HZ3A 4OCRH 4HC1L 2XDHA 5HGHB 2XV2A 4OU3A 2B15A 2XY1A 2W81C 1GZPA 4OLUH 4Y2DB 2XVBA 1JPGB 3EYOB 4HUMB 1AC0A 2RFXB 5CU9A 5F3BB 1QWHA 5T1LD 3UABA 5BQ7B 5I1EH 4JHAL 2F74A 1FFOA 2Y7NA 4ELDA 5M7QA 2CK0L 3NZ8A 2FB4H 1CGSL 3FB8A 3NIGE 1A7RL 3FB6B 4BE5A 5CCKL 3FCUB 3MBWB 4JFDA 4MZ3A 5L7XL 4ZNCD 4XBPB 1DDHB 5ICXB 4XRCB 2EVFA 4NZUH 2H47C 3VFOB 4U1SB 4B27A 5HGDB 2OL3A 2OMUA 2VDNL 3CWGA 3NQKA 5KS9B 3VFSB 2X1XR 5IEKA 3MNVB 1UVQB 3DPDA 3N50A 5ERWB 4KY1H 4PJ8A 1YN6A 3DX2A 4Q8BA 4OIAA 2DM2A 2FJFB 5DD1H 3IVKA 3GZKA 4AQAB 3BAYA 2FZ3B 4NQCA 2J1WA 4KC3B 5E5MB 4LLUB 4NQEB 3DUSA 1OTUC 1FDLL 4PJHA 3WFDL 1K5NB 3FQRB 3SPHA 5E2UL 1BAWA 2VZVA 3VI3A 4NX0A 2XZAL 4NM8H 4LSUL 3V0VB 4UBDC 5J0BA 5BUPA 3LJ3A 5DHVB 3BOVA 3WTXA 4YGVA 4FKKA 2BRQA 3UBFA 1KCBA 2G5BA 3C6SB 5DD0H 1R9FA 4PI0A 4QDGA 3R18A 1BZDA 1I82A 4BA0A 1KGJA 2OX5B 1RUAH 3RIKA 4N9OB 3ZKXC 1KWKA 2F0CA 4FLQA 4TF4A 3ZE2B 4B3VA 2YR3A 4BQ6A 1ROWA 4AT6A 2QT6A 2JB5H 1E0OB 3NA4A 2WVVA 1O7DC 2QZQA 4GP4B 1O7DE 5DRWA 4Y19E 2D8KA 5LUMA 3WFZA 4AZ8A 3HPLB 5CNHA 4J3BA 3OG4B 4MASA 4HFWB 4LP5A 1N2RB 5HDWA 3DSFH 4HLZH 4YHOL 3RGHA 4JAMB 3CZGA 2E7HA 3WS6C 5EFIA 1X9QA 3MFFA 1RK0A 4GXFA 2RMNA 2Z92B 3QQXA 3F6JA 2BXYA 2IPUK 3KW8A 3KPSE 5AZ2H 3S2AA 4Z0XA 3SZ6A 3J8F7 3NSJA 1CS6A 1T83A 2EEXA 2UZIL 3WFHB 5KSBA 3NJKA 3VXSA 1NAMA 4XH2B 5JHAA 4YHKL 5IF0B 4IMLB 3TCXA 1BVLB 1IKOP 3PFUA 4PRHB 3KGUA 3JV5A 25C8L 1IZKA 2X2JA 4RIRB 1UWGL 1BZ7A 1WC7B 1YYML 3LS4H 1G4RA 3CFMA 3NCBB 1MFCL 4MQTB 4LAQL 3UTTD 3T4AA 5I26A 5CFHA 2GW5A 5HXMA 3MV11 3C6LC 5SWZB 1WUNT 3I02B 3LY6A 1XF4B 2IPKA 3GHEH 1A6ZA 4NN5B 5DHYB 2IPUG 4U6TA 3VH8G 4NO3A 4N0FB 5C0CB 1MCPL 2IMNA 4H8WL 1RFDH 2QQQA 4K3JL 1OGTB 2IEPA 5DHDA 1NMBL 3O4LE 3EYFB 1KENL 3UGUA 3C2AL 1FL6A 3VB8A 1PX3A 2ID5A 1XSKA 3H3KA 1CD1A 4LL9A 1G7JA 1GZPB 1I31A 2N1TE 3T65A 4I3SH 4QAWA 4EMZA 1J8HD 3SGJA 2V2XA 3TH2T 3MKGA 4LNVA 2D31A 1GCFA 2HMIC 3SQOH 1FFOB 3UC2A 4JZOA 4FC3E 3CG8A 1FZJA 1UA3A 1A8JH 4HOMA 4Z7VE 4RA0C 3NZ8B 4JKNA 4QRSA 2JJTA 3FB8B 4HS8L 3PG2A 1SHXA 1JXGA 4JFDB 3MZGB 3BD5A 5EBWB 1IM9D 4ZFQA 1PLCA 2NXYB 2G2NA 3R1GH 2JKJA 2J72A 2OL3B 2OMUB 2ZX6A 1VKXA 3CZFA 4LEXL 1S9XA 5D70L 4F20A 5I6MA 6FABL 3FO9A 1DSYA 2F7OA 2X70A 4PJ8B 1YN6B 5E5LA 4HIHA 4UQ9A 1D5RA 2R0WL 3V0JA 3IVKB 4X7FC 3NJHA 3TN0A 2IIJA 4NQCB 3LB6D 5BW7A 1IGFH 4IBTA 3SBRA 4R3SA 5LWYL 5ACZA 3DUSB 4PJHB 1CBVH 2V5TA 3TH3T 1QWNA 3D51A 3DK2A 5FW7A 3VI3B 1E3XA 3E6FA 5EA0H 1T6BX 4RMUA 4YGVB 1DVFA 5TF0A 4DP6X 3WKPA 2GSMB 1XCQA 2G5BB 2RCSH 4KTYA 5HJGA 2P45B 1R75A 3IKCA 3IFNL 1I3VA 3MXWL 2WBJC 4Z0BL 1LEKA 3V6OA 3D4GA 1AMXA 4OCWH 4AMKH 3KGSA 4P2QE 5GZNA 2OL3L 4GRLD 3UZEC 4AT6B 4AYGA 2WVVB 2ED9A 3RAJL 1QBLL 5DRWB 3T1FA 2WTRA 3U7YH 2KS0A 4AZ8B 5IJKA 1GW0A 4GUPA 3QAQA 1J1PL 1TQTA 3WTWA 4ZMYA 4UINL 5JXED 1M9SA 4ODVL 2BINA 3O0LA 3N41F 1J05A 1NWPA 1RZQA 2HFGH 3MGOB 4TMPA 5B1JC 4KZCA 5EFIB 5GIRA 2VGLM 1KDIA 4YSSA 1RK0B 5KYUA 2WZ5A 4X6DA 1W15A 4MYPA 1S7RA 4Z0XB 4P5SA 1G84A 2UY6A 2DLIA 1P4BL 4UQ2B 5KSBB 1U3HD 2ICCA 2YZ1A 4K15A 2MNUA 1NAMB 3VXSB 1FSKC 2HXAA 4TS6A 3LPPA 4UV7H 1BAGA 3DXAA 2DQCH 4Y4HC 1ED3A 4JM2C 4PLJC 1U2YA 1M6OA 5JHMA 3VQMA 1CLYH 3RILA 1MLBB 1BZ7B 4YDNA 3VAEA 3DVNB 1OGPA 4TVUA 2CG9X 1BA9A 3WIAA 3T4AB 2BOCA 4D8OA 2C7FA 4PJBF 4BFBD 4ICXA 2HKFH 1IKFH 1S7XB 3RDTC 2WK2A 3PNWA 3UP6A 2BNRD 2IPKB 1NCOA 1A6ZB 2FATL 3F7QA 3L9RA 4IRJD 2W07A 4FX5A 3B3BA 3FUMA 1RULH 4NO3B 3FO0L 2WD0A 3UBHA 5HI5C 5KVEL 4P3CH 3ULUL 3FFCD 1QSFE 4F80A 4JFFA 2WKGA 4M48H 1PKOA 4PY8I 1CD1B 1FBIH 4NQED 4Q9RH 1G7JB 4KX9A 1JBJA 3V5KA 3H2PA 5AVVB 1NAML 5C6TL 3K8LA 4UQAA 4Y2DC 1ASOA 3WNLA 2V2XB 1JWUA 2VISA 2FJUB 5I8EA 5DWUH 2D31B 1URLA 3ECVA 4JZOB 4KI5F 1UM5H 1AH1A 1LTXA 5T5NF 2DLTA 1T2QL 3KLQA 3UYRL 4YFLF 4A37A 1GMEA 1LD9A 1S7UA 4QRSB 2ADYA 1C16B 5DZOA 3W57A 2QPUA 3RVUC 4XN7A 2MWCA 4L8DA 4Z7OF 4PS3A 3T6VA 3E9UA 2VWEC 5D6DA 4TSAL 2VWEE 3H9SA 3CHPA 5E8PA 32C2A 1VKXB 3CZFB 3L3JA 5BRPA 4HW6A 2VLLA 3FO9B 7FABL 4QIRA 4ZYKA 5KS9E 1IC4L 2X70B 3DIFA 4N2AA 3T0XA 3TL5A 4HIHB 4QXUL 3ZDXB 3KPOA 4NKMA 2OLDA 5DFWH 2R39A 3CVIH 4ZUSA 2OULB 3SDXE 2V7HA 4XX5A 4R3SB 5ACZB 3SDAC 3IPEA 3E8UL 4KQ3H 2NUTA 2FX7H 1JD9A 4PGJA 1CGXA 1UACH 2MEJB 1H0DA 4MA8L 3GSWA 1UH2A 2OR9H 4JLRA 1A7OL 3E6FB 4P4RA 4FRWA 3MV8E 2JKNA 3APMA 1DVFB 4J3OC 1XCQB 1XAKA 4HA1A 4ZZKA 4WCYL 2F53D 4HJJH 1NCNA 3GRBA 3IKCB 4YFDB 3HNTL 5B22A 4B41A 2XN9D 5IFAL 1LEKB 1CURA 2WUBL 3EJJX 3MXVH 4WV1A 3ULVD 1KBKA 4K8RC 4U6XA 5SWZD 1ZKAA 2RGSA 4MAYC 1LILA 4E42A 1WFOA 1SYVB 3MODL 4N1EA 3SOTA 5FM8A 2WTRB 3T1FB 4ZZFA 5C0CD 4AG4L 4GUPB 5ALCL 4M8UA 5HDQH 4K7PX 1NPJA 1J05B 4P2CG 1JGLL 5D1XD 4XCNA 5CUSH 1I3UA 1SEQH 3GXMA 5DJ2A 2ZKHH 3R8BB 4LOVA 5GIRB 4XPHL 2WBKA 2E74C 5H2BA 5KYUB 2D7PA 1JD7A 4U05A 4X6DB 5F0LB 5ICUA 1S7RB 1GHFH 3QO0A 2NDGA 4HZAA 3B2VL 1KXQA 2UY6B 4HIXL 4ZPTA 5EUKA 4WHDA 3OLGA 3S8FB 1JIBA 2C9WA 1YEGL 2NY1C 4JS7A 4F27A 1BJMA 1WWWX 3DXAB 1SXSA 3EH2A 5I0WA 2X0VA 3I2CH 3OJDA 4M02A 4X5XA 1ED3B 2CAKA 2JB6B 4MNQA 1M6OB 4PRHE 3BRFA 1BFTA 4JFDD 4PRAB 4WUUE 2J7LA 2NXYD 3QJOA 4D9RD 3NZUA 1FAIL 2BOCB 4KKQA 5IT2L 1IQWH 4Q6IB 1AFVH 4WI0A 5SX5H 3PNWB 2DTMH 1LP9F 4U1IA 4AL8C 1LO2L 4MJHA 5EMYA 2W07B 1G9NL 3T04D 1KBGL 4PJ8D 4NZJA 3EBAA 4JPIA 3KAAA 2VDPH 3K71A 3UDWC 1SMAA 3VU2A 1MCBA 1XEUA 1H3PL 2CBMA 4JFFB 1HZHH 1AC6A 4M8RA 4X9IA 1JNLH 2A9NH 2VN7A 1OZTG 3MOQA 3MLSH 3KPNB 5C07A 4AYFA 3V5KB 3IMRA 1AKJA 4DO4A 3QFDB 1BXUA 4OGXL 3Q05A 2WO2B 1L7TL 2VISB 5I8EB 4XCEA 4DK5A 1VFUA 4OLWL 3D87B 5E23A 2BERA 1LD9B 1S7UB 1WICA 4DP2X 1GAFH 1J5IA 1LWHA 3POCA 4XVSH 5IVZA 3GO1H 2IAMA 2E0PA 4L8DB 2EIMB 2EUVA 3D2TA 4HGKC 5EBLA 1MVUB 5KYXB 5C08A 3X2QB 4NQSA 5JO5B 3H9SB 4UNTA 5E8PB 5IHWA 3BAJA 3L3JB 3LXAA 2VRQA 4G1MA 2HWZH 1ZLVK 3HG1E 3S5LG 2VERN 2VLLB 5DYOB 4ZYKB 1JGDA 5I18L 3N06B 3DIFB 1EEZA 2O5ZL 3O6KL 3ARDA 5DYFA 3KPOB 4NKMB 3HC3L 3EUDA 4Z3EA 4ZUSB 2G30A 3ULUD 4AYDC 4PAZA 1FC2D 2V7HB 2YO3A 5E4OA 1H6FA 2D7TL 4NS0A 4WDIA 5LXGL 2NUTB 1NFKA 2ZTBA 2RQ8A 2PNDA 4XNUH 4IBQA 3GSWB 3VXSD 4L18A 4JLRB 4P4RB 1ZLEA 4G5ZL 3ARGA 3ME0B 2ZCKH 3EBGA 1PLAA 3HS9A 2YA2A 5D93B 5I30H 2RIKA 3BFOA 4YXKL 2ZP0T 2VXVL 3PF2A 4I2XA 1CJYA 2X87A 5B8CA 3V7AE 1IAKA 2CXGA 2O5XL 4WV1B 1EEQA 4D3CH 4JY6A 1E4HA 1ZAGA 4ADIA 5EO1A 4OCXH 4U6XB 4DVRL 4ZW3A 5HTSA 3SDYH 4PBVC 4PP1C 4E42B 5AG8A 2FT6A 3QG7L 5AUMA 4B9IA 2RACA 2EUWA 1MN4A 1CICA 2ILLA 1F86A 4TNWK 4JQXC 4U49A 3NGBC 4ZPVA 3FRPA 3CC1A 3QSKB 3AWEA 1ETJA 1CFVL 2JCCF 4PRIA 5KVEE 4NDMA 2WXMA 5H2BB 5HI3C 2XIIA 4YE4H 4X8XA 5AVRB 4ZPTB 5EUKB 5IBTH 3TU6A 3O6FA 4R5TA 4TOYL 3EUUA 3EYQD 4KXZH 2I32A 2ETWA 5B3NA 3QEGL 1X7SA 3F7RA 1JFQH 3AFLA 2H6PB 2YSSB 1LHZA 4M7LT 5I0XA 4PB9L 3SE3A 2ZUTA 4KPHH 4YDMA 2JELH 2PPAA 3O3AA 3AW5A 4H0GA 4CJ1A 3EYUL 4WI0B 1WTLA 1QPKA 4KK6D 4S0SD 3EBHA 4U1IB 5B38A 5DD5L 5DURB 3QFGA 3K81A 4B50A 4MKMA 5D7IA 4AJYV 2JQZA 3VXOA 3NABH 1SXZA 4NPYA 3TN0D 2EDEA 3HE7A 1JPFA 4KOCA 4HFUL 1FV1A 5FO9A 4AUJA 5I1HL 5C07B 4XXCA 4AYFB 1J0HA 5KSAA 1W16A 2IDSA 2BZCA 3SZKC 4FQCH 4M8VA 2CHNA 2JKTM 4R0LC 2VCOA 4YNYA 1DVFD 1JWMA 4NN6B 3IMTA 2XC8A 4FQXA 4XCEB 3SGJC 3ZGIA 4NQQA 4YZWA 3M1BB 5K5YA 1LMKA 2PTUA 4TKWA 4AVHA 3OJMB 3B7SA 4GSXA 3BP7A 2JJTC 4KVPA 4NB7A 3VFPA 5IVZB 4LAJH 2IAMB 4EE2A 1PU0A 3SDCA 1QFUL 4PR5A 1F41A 3QGVA 1KNOA 4PP2A 5EBLB 3UO1H 2C9UA 5C08B 4NQSB 4AKPA 2AQTA 5EORH 5T33H 4G1MB 3DGDA 4L0YA 1ZLUK 3ISWA 4KO9A 5AOMA 1JGDB 3KS0J 4NT6A 4X6EA 1EEZB 2X28A 3APFA 4TV3A 2GJJA 5FYKE 5EO9A 3ZDXE 2B20A 2Q87A 1HIMH 4YUEH 2ZAHA 4AUUA 4WDIB 4DOHE 4MMXB 2ENPA 2AJVH 2AQSA 3L54A 3ETBF 2YXFA 3K8MA 4JDTH 4YDKL 4G7RB 5EEXA 1J8SA 3ARGB 2DEYX 1EVTC 2IWKA 3DXAD 2OTPA 1VADA 4YXLL 5I17A 3BUYB 1T22B 5JHLA 2GSIA 4QRAA 2VIRA 5G4MA 2JMRA 1IAIH 4I2XB 2A0LD 5B8CB 4C4KT 2QSQA 4NFBA 2FX9H 4JY6B 3O6LH 3DOIA 1MJ7L 4XCFL 5EO1B 1FHNA 4CAGA 4G9FA 3RB7A 5JZ7C 2EEDA 4RAVA 3U2IA 4WWPA 4ABUA 3T2NH 4NQUA 5AUMB 5A2CA 1ZK5A 3L3GA 2MPAH 4RQQA 3NJMA 5LDUA 5DS8A 1CICB 2GEEA 2W0KA 4H8QA 2VDRB 2WCSA 4XNZC 4ZPVB 5H8DA 3CFNA 3V8CA 1G9NC 5DU7A 2A2QT 1KXVA 1BF5A 4GG6F 1UXMA 1CD8A 2W9DL 1QHQA 4LEOB 1IVLA 4PRIB 4PJBB 5E9AA 1UENA 3IFPA 4NDMB 4XMLL 5I73C 1ZXKA 1XGPA 2WSDA 4JO1L 3TURA 1OCWL 1OP4A 4X6DE 3OF6A 5I71C 1HWGB 3O6FB 2DJMA 5J06A 2VJ0A 3JYBA 4BZ2A 1ANUA 2EIZA 1THCA 3L8QA 5IW1A 5TE7L 3BUQA 2JJWA 3T0VA 3TZVC 1Z3RA 1VA9A 5EEWA 3H4HA 2G3NA 2DV6A 2HB0A 3U0PA 4FULA 5D2NA 1KB5H 5ITBH 5E94A 5E2JA 5C0FA 3TV3H 3O3AB 2CHWA 4NHCL 4F8NA 1S9VB 3FQUA 2CHXA 5IHUL 3QNZA 4Q6IC 2QFPA 5B38B 2VDRL 2VLKD 5D7IB 5EH1A 3VXOB 4NPYB 3GKZA 1RZFL 4F1ZA 3HE7B 1JPFB 4PJIF 1KJ2A 3IXTA 4Z7OB 1CR9L 2BIOA 5DGQA 1A8ZA 1TJXA 5GS2D 4FI7A 1DSFH 4JFFE 5JR1H 5KSAB 2K3TA 5LVEA 2AGJH 2Q3AA 4D9QE 5CGBA 4FA7B 3PWNA 5HGAA 5BO0D 5EZLA 1CFTA 1H15A 3II3A 4YNYB 1JWMB 4FQXB 3VU1A 4WEBL 2X05A 2WY3B 4F2ME 1QSEA 2GFBA 2K1MA 2IO5A 3ILEA 5EN3A 5LNDA 2XZQL 3V0EA 3QXAA 5LGYA 2A9ML 3BP7B 1HX0A 4OTXH 1PIFA 3VFPB 3CQQA 1LDPH 3MJ9H 5F7WC 4PR5B 1KNOB 4PP2B 2RB8A 2Z1KA 3QJFA 4KBPA 1FL5A 4BHUA 1JCKA 3CQPA 4WGKA 4KX7A 2EAEA 5EIIG 4X6EB 4NT6B 1OHQA 1E5ZA 1BZ9A 2WXIA 4K3DH 3MUJA 3LZNA 1L3WA 5BZXA 4N2CA 2YGOA 3RKDD 1P7QA 4XMWA 2EEFA 5EO9B 2WPGA 1JF1A 1NCBL 1HHGA 3MRGA 1G87A 1NIAA 1KN4H 3NJXA 3ZMRA 3L5WA 4MLIA 2G5RA 1NCJA 2MCAA 3QXVA 1L0YA 2BP5M 3FH7A 2BIHA 4U2ZA 3O3BA 3FHQA 3HB3C 4JO2H 4WWKA 4XXDA 4HJGB 3BE1L 1Z32X 4GG8B 1VADB 3WHXA 2D7MA 1QFWI 4KU1A 2GSIB 1UWYA 3RNKA 3X11A 4MNQD 2E8ZA 2VIRB 4KO5A 3D0VB 1IGMH 3U7AA 1LL1A 3VXQA 1XDTT 4LLDA 3US9A 5KTEL 2YD5A 4G9FB 2EUZA 3BN9D 4NIYE 5ESVA 1NPNA 4RAVB 3IFLL 2EVIA 2AQ1A 1EMTH 2NW2A 5DURD 1CXHA 3L3GB 5C0DA 3IJSA 4RQQB 4GSQA 4H1LA 1KYAA 5I15H 5E08L 3L7EA 1C7SA 5DS8B 4OKVA 2K45A 5AD0A 1FLRH 5TDNA 5C1MB 2WN3A 4TUKH 3LD8B 2JLPA 3CFJA 1CF8H 3P77B 3TF7C 5I19H 4ZMTA 2Z0BA 3V4VH 4PJXA 4EQ3A 4BFOA 5A40E 4FFYA 5J3HD 1M71B 2E4TA 3IFPB 1AKJD 2GBAA 4NGHH 2YLKA 2VW4A 1BZ8A 1CTNA 4KK8D 5D7SH 1I85C 2Z7UA 1XX9C 4LSPL 4NM4H 1YUKB 4JE4B 2EIZB 4KKCD 2L04A 3QWRA 1WCQA 5IW1B 5J57B 3W0WE 3BAKA 3ZRSA 2FLRT 2HPOA 2EDJA 1HNGA 3BZ5A 3TBYA 4Y16C 4HISA 4LFHG 5D2NB 5E94B 1SOQA 4L5FE 2OMXA 5IY5B 1G5GA 3RL2A 2CLVA 4Y88A 5MEQA 2DQMA 4RSYA 4HPHA 3FT1A 2XPGA 3QNZB 2VRKA 4YHML 5GS0H 2UYLA 3NFSL 5BXFA 1G0DA 4NENA 3QUZD 2Q7YB 3ARDD 3CLEL 2AVGA 3RTLA 1JVKA 3IXTB 2F1EA 1LEIA 2YN3A 5EF2A 1WFMA 2ZPKL 1O6TA 5F1OB 4HWBA 3QPQC 3IWUA 1KDJA 2NR6C 3ABKB 4P9ML 4GSUA 4KDTA 3OAZK 4PMEA 3KPLA 3PWNB 1AZVA 3KVPA 3V4PH 4X9HA 4X83A 1UB5B 4BZ2L 5EZLB 3KHQA 1CFTB 1H15B 1VFOA 3RX9A 4H20L 1KGYE 2QJDA 2VC2H 4URKA 4U3XA 4NN6C 3IU3B 4RFOH 1QSEB 2GFBB 3N9GH 5F7AA 5DHXB 2ZNXA 3QXAB 3UYOD 2ZXBA 2J5LB 2NT1A 4GUQA 3RA7L 3HG5A 1CLOH 3WN5C 4F15B 3QYMA 4FI6A 2XV0A 1UATA 3RY4A 1U3JA 2HCZX 4ALAL 3QJFB 4OI7A 3CTTA 5ESQA 1FL5B 1TNMA 5L2KA 3U36A 5L0QC 3DO4A 5C08E 2WN2A 2GHZA 3T08A 5FUOL 1CICD 3IMSA 1BZ9B 4NXSA 5JLZA 2AZUA 4PUBL 2PTTA 3IGLA 2O4EA 4DUWA 4BIKA 3NMEA 4CKQA 1OE1A 1E5UI 1P7QB 3MLUH 3F3HA 4PRID 1HHGB 1P6FA 3MRGB 2F8XC 3NCEB 1EJ6A 3L5WB 1BGXH 4ANUA 3N85H 4QXVA 4ABQA 1FPTL 1X44A 1QTSA 4OF7A 4MMXC 5JIKA 2XJKA 3O3BB 1JHKL 3E1ZA 4WWKB 5CP7B 5JW5A 4RWHA 4N2DA 4Y5YC 2JCWA 3SQBA 1OCCB 1ZCRA 3WHXB 4QRPE 3I3BA 2B1HL 3PLYA 1QNZH 4LP4A 5E00A 3RNKB 3X11B 3EH4B 2WQWA 4B9PA 1O75A 1HJCA 5DO2C 2Y1YA 3CE1A 4CVWA 2FJGA 5AVXB 3VXQB 3ULVF 2NY4B 2XVGA 5ESVB 1XIWD 5I1GL 5CLYA 4ZXBA 3BPLB 4O58H 4AYID 2PCPA 5C0DB 2LFGA 4KJWC 3RBGA 3IJSB 3TA3C 5L4JA 4H1LB 1KXTA 1VB9A 3L7EB 4WO4C 5AD0B 4MJ6A 4OKVB 1TTCA 5TDNB 5E8OA 4M5YH 1FIGL 4NBXB 3HE7D 5HHNA 4GAAA 1XB3A 1OP3K 3CV5A 4PJXB 1QBAA 1YYCA 2N7BA 1OE3A 2CKBH 2WP3O 3HHMA 1NGPL 3MQIA 5AL8A 5KSAD 1ZT4B 4NRZA 3CC5A 4PJBE 2NQ3A 5CF3A 3WEAA 3DYPA 1OLZA 2DQJL 1WAEA 1FO0A 1PZCA 3VJ6A 4FQXD 3EDEA 3HFMH 5IWLA 1KCVH 5DJ6B 4DNLA 3D34A 5TE4L 4NP4H 2WKOA 3TYGH 4A7TA 1QMUA 3Q6GL 4B60A 5DMGD 4JUSA 2G4EA 1HILA 1RMFH 3NA9H 3P3UA 4PJIA 4JREB 4ZO8A 2APBA 4WEEA 1MCLA 2A9CA 3QZOA 3TBYB 1YJDH 3SDCD 4UZGA 4WNJA 1QLEB 2GIMA 2OMXB 3RL2B 1MG3C 2CLVB 2YC1B 5EV7A 2JK5B 2PYEA 2ZWYA 5F7KC 5I6XB 2EVHA 4ZQKA 1WISA 3BT0A 2XPGB 4NAQA 2UYLB 1DBJL 5IMLA 4BA8A 5BXFB 2VDMH 1YY9D 1A1OB 2EIBA 1RJLA 3FU3A 3G6JA 4KI5E 5J8OA 4FFYL 4FKHA 1XSIA 3L81A 4XCCL 3RUGA 1NFIA 2IADA 4U7SA 1SN2A 4C83A 2Q8AL 1LEIB 2X3BA 1GGCH 3X3GH 4Z7OE 3OBAA 2WM0A 1UD6A 4NKIH 1YUHB 1Z5YD 4X80H 5KVDH 3B9VA 2NY6B 3NEXA 4IMKC 5GGUA 2PPDA 3A24A 4K71B 2NMSA 4GB9A 3CX5J 1EJ8A 3K5RA 4ACPA 4WEMB 3HMWL 1QLEL 1DJGA 1WLHA 3L3KA 2B4CL 5D9SA 2I60L 4FABL 4G9FD 4C4UA 3B2UC 5HVHB 3LIUA 1IBHA 1PMYA 1L0QA 1NC2A 5EWIH 3MRKB 1Q0YL 5ESQB 5C0BA 1UA7A 4QPEA 3MA7A 4G8IA 4NZRL 4Z3IA 2HKHH 5JLZB 3P4NA 2X3AA 2PTTB 3OVUB 4KUCD 1SY6A 4HUXA 4HWBL 5FGBA 4G59C 2BX5A 1X5MA 3FT3A 4ZMQA 3ERXA 2OXGA 2EJ1A 4OCRL 4FMKA 5GRVK 3MGAA 5C86A 5JHDA 3OB0K 5HDBF 5AAMA 4A7GF 1BYNA 4OLUL 2OMYA 3OF6D 3QI9A 3ZR5A 4HZLA 2P7TA 3FYIB 4PGEA 2NZ9C 3NSFA 1XTMA 4WI6A 3SO3C 5I1EL 5JW5B 4DKAA 2DI7A 1YNTF 2EDFA 4OIIH 1Y7VA 4PJ9C 2SODB 4ZUVA 3SQBB 3HBGA 4AW4A 1ET7A 5E00B 2BFVH 2X4NA 1E43A 3ZR6A 2BY3A 2FB4L 3GC3A 1X5XA 2FJGB 4KJYA 1KT2B 3GNMH 3ZE0F 4HPYH 3DX3A 4DP5X 1DYZA 3KPRA 1URIA 1DEDA 3L4YA 4ZXBB 5E5UB 4A38A 5HGBA 2PCPB 5DZPA 4YHIA 3UMNA 3N5AA 1KXTB 1NM4A 1J10A 4JQVA 2WO3B 4L3ED 4MJ6B 3GLAA 1PSKH 5E8OB 1D2OA 4XMUA 5HHNB 5EOCJ 2CXKA 2AXGA 2EDLA 4LSQH 4G6JH 3BP5B 3IMVA 4NRZB 4ZFFB 1Y6MR 3CC5B 5FUCC 3GJFA 5FUCE 1RLWA 3CMOH 4OF5A 1FC1A 1FO0B 3VJ6B 4NM8L 1FFPA 1LP9E 5E2TH 4K9EC 1J7VR 2P8PA 5FM5M 1QSED 1I8LA 1RZGA 2P8LA 3GDCA 1XGQA 5D5MA 1DDTA 5D2LA 4PJIB 5DD0L 3T0EC 3JUZA 4FG4A 3I85A 3T0EE 2CDEA 3WLWC 3TEUA 1RUAL 1WVZA 1P7KA 2DD8H 1AI1H 2W9EH 4N2EA 2JB5L 1CMOA 4ZQKB 3PWUB 4UAHA 3J07A 4G43A 5IMLB 4PBDA 3VFUA 4ALAC 3ZYJA 2YD0A 2WQ8A 3G6JB 5A6LA 2Y1AA 3LRKA 2DY2A 1D7CA 1G7HA 2ESVD 2MKWA 1DQTA 3PHAA 3RUGB 1NFIB 4DGVL 2IADB 1XF2A 4NZTH 3DSFL 2HT2D 2Z7YA 1QEWA 1PG7X 4C83B 1FVCA 3AS3A 5C0RH 4X9GA 4JRLA 2ENYA 4QO1A 3RWGB 1FO0L 2X6BA 3EJTA 1A1NA 1E27A 5AZ2L 3W11D 3C60C 3DURA 3MNWA 3SE4A 2WNXA 3QIUA 1UXSA 5JIIA 2X0UA 4ZTOH 3POHA 5GGUB 1INEL 2N7AA 1A7PH 1NFAA 2BVTA 1CG9A 1PLGH 2RQEA 4X99A 2ZE0A 2EXYD 3FU8A 5IOKA 3L3KB 5D9SB 1KC5H 8PAZA 3GBDA 2NY4D 3ZYIA 2IDFA 3EFFA 1JHLH 3LS4L 3TASA 4DTGH 2DQTH 1XXFC 3QHZH 2XOTA 1E5BA 1NC2B 2HT4D 5C0BB 5BOJA 1DL7H 3GHEL 2W91A 3MA7B 4L1HA 1JZGA 4G8IB 5F7MC 5HP5A 3VD7A 1S78C 4MMZA 1I3GH 1OCOB 5E2WL 2Y7LA 2VMEA 1RFDL 4DEPB 3P4NB 1I1AA 2XT1B 3F83A 4HUXB 3UJJH 1OCRB 3K1DA 3FT3B 3L4VA 4J1UA 5T5NG 4W9HC 4HHAA 4L1SA 3WIHH 2OXGB 2E7CA 3MUUA 4LHUA 3TEZA 1HNFA 4ELKA 1U8NA 3BDXA 4Z7WF 1HH9A 2OMYB 3BVDB 4HZLB 1LYQA 2P7TB 4N86A 1CXFA 4PGEB 2ZWKA 5LQBH 2YIHA 2WTPA 4WWKC 3SQOL 4ZUVB 1GGTA 2PKDA 1SLXA 2YA0A 1E2WA 1YRKA 2X4NB 5D7LE 1OTSC 3ILQC 1KTBA 4R84A 4RSVA 2QZ5A 4M29A 2JCCE 4R5VA 4G6MH 1G7QA 1RUQH 3EYSH 3KGTA 3R1GL 3LRHA 3KPRB 4ZFZA 3PJSA 1I3RA 1WZ1H 2RR3A 5HGBB 4N2IA 3D9AH 4YHIB 4ZW7A 3TYFA 5AKSA 1N0LA 3F7PC 4MRBA 3UO8B 1JGEA 1MI5E 3APCA 4PRNA 4AE0A 1SEBA 1AOHA 3NJFA 3FSOA 3GD1C 4GRMA 2AXGB 2J12B 2B14A 2G3XA 1IGFL 5F6HI 4NIKB 4PG2C 1P9MC 1LE5A 1T04A 3GXFA 3QHFH 1KIRB 1CBVL 3GJFB 3AAZA 1P0SE 1Z6JT 2ZYHA 3SCMC 3TNNA 1FFPB 2NY6D 2YGPA 2P8PB 4XO4A 3CHOA 1J9TA 5EA0L 1RZGB 1LWRA 1BQHA 2P8LB 1XGQB 2RCSL 5D5MB 5D2LB 3P30H 3T6ZA 4I3RL 1PQZB 3DDGA 5JQHC 3W38A 3ASNB 1MCOH 2CDEB 4W9LC 4Q52A 1EUUA 1P7KB 4LPYA 1L7IH 2OTUB 4OCWL 4AMKL 3BUDA 3UXFA 2B4CC 3OG6B 5L2KD 4GXUN 5DJAA 4DESA 1L9MA 2DYSB 4G43B 4J2QA 4XP6H 5BV7H 5HYIA 2VQUA 3PWJA 3VFUB 2H4EA 3THMH 5DK3A 1GH7A 3MO1A 3BZEA 1JL8A 2FVNA 5DGRA 4N8VA 5DSCA 3D1MC 5ETUA 3DHPA 1XF2B 2HFGL 1QEWB 5FYJH 4OZFH 1FVCB 4QO1B 3V9EA 2V5RA 3PL6A 3KHOA 4GXUM 1LO5A 4OJDH 1A1NB 1E27B 3F2LA 3Q13A 1G9MH 3DURB 3MNWB 3QIUB 4IRZH 1UXSB 2AJZB 4FXGA 3AACA 3FQ4A 2NY7H 4HIIA 4K71C 1CG9B 2NY0B 3K74B 3AXIA 2WWMD 3NJVA 5AL0A 3L2MA 2PWGA 5KVGE 2AK1H 1CLYL 2ZX9A 3EFFB 3LH2H 4AGQA 2XCMC 3D18A 3MRRB 4AV5A 1MNUH 5DJYA 2QKSA 3VWJA 3QEQE 5DVPA 4ZXBD 4AVJA 1E8XA 2A6KA 3UIYA 1FG9C 1IKFL 2HKFL 2OMBA 3ABGA 3GSNH 4PJ5E 2FAUA 3DX8A 3ATAA 5DUBA 4FFTA 2GAZA 5DUJA 4MMZB 1RULL 4TNVF 3FBQA 3GTVA 2DH2A 1I1AB 2YJLA 3P0GB 2PN5A 5HDRA 3FHAA 3QISA 1UM4H 4N90D 4J1UB 4JFQA 4HHAB 3RY6A 1RUPH 4WI8A 2AXHA 4M48L 3ZTJG 3A23A 3WELA 4Q9RL 4LVEA 4LHUB 4IOSA 3PXLA 4D7BA 2Z4TA 1OT1A 3KPTA 4GIPD 1HH9B 5GISL 3HAEG 4ZFOA 1SM3H 1S5IH 5ANMA 2VLRA 3UAEA 4LPXA 1RH8A 1UM5L 3LQAC 3VXUA 1ZOXA 3QUYC 3ZYOA 3WNMA 4IJTA 5A3IC 3FQNA 3TEWA 2WXLA 4MD5A 2XRAH 2CCVA 4RGMC 5HGGS 4GG6E 2H1LM 1G7QB 1C5BH 4C55A 4JM0A 2PYED 3WYRA 3MGTA 2ICWJ 4ZFZB 2H1PH 4F8TA 1I3RB 3MMEA 4HT1H 1JNJA 3TYFB 4LLAA 1B4JH 4PIRF 1BXXA 1N0LB 1QVOA 2EE3A 2HUEA 1IIIA 3IJEB 4B0MB 5J12B 1JGEB 1PAMA 3EJYD 1HXMB 5BNXD 4QI3A 3QUKA 4PRNB 1OSPH 1SEBB 2YAQA 1BG9A 3NRFA 3CXFA 4FXLA 1NDGB 4GRMB 3KWWA 1PZAA