4W9IC

Pvhl:elob:eloc in complex with (2s,4r)-1-((2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
140
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 35
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9iC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9iC01
4W9KC 4W9JC 4AJYV 5LLIC 3ZRFC 4AWJC 4BKSC 4W9GC 4BKTC 4W9HC 4W9DC 1LQBC 4W9CC 4W9LC 3ZTCC 1VCBC 4WQOA 4W9FC 3ZRCC 4B9KC 3ZTDC 3ZUNC 1LM8V 4W9IC 4B95C 4W9EC
chains in the Genus database with same CATH superfamily
4HJJL 4NWUH 2EC8A 1BF5A 4IBWA 3P4MB 5FM5M 5I8CA 3NQIA 1IU1A 1HXMB 4K0OA 1GKOA 3LNFA 3WGVB 1IBHA 4ZO6A 4M6OH 1JWSB 3CFDB 3LHPH 4KKQA 2FSDA 2GBTA 3IDXL 4X4YB 2DQUL 4QRQB 3BC9A 5DYOB 1ZT1B 3GMNB 2GJJA 4G59C 3P73B 4J3OC 4OD3L 3TTYA 2CAKA 2B5IC 3VGGA 3DX6B 2VJXA 4EZMA 1PD1A 4GMSL 4NFBA 1E28A 1E5YA 3BXNA 3U46A 2JCCA 2BOBA 4PB0H 1SEQL 1K8IB 2M83A 3BI9X 2O5XL 2XTLA 3DXAE 3GHEH 2ESVD 4XN5A 1QLEB 2JXMB 5DGRA 5CZRA 4HS3A 3CK0H 3RUGF 3TA4D 5AOJA 1NGXA 3NJIA 2V4LA 4S1SL 1HH6B 3K2MC 5GS2H 3VXME 3LB6D 3FTZA 2CUHA 3O3BA 3O6FB 3Q2VA 1URZA 2Z92A 4NKMA 4OH2A 3UG4A 1J5HA 1C7SA 3FOLA 1BM7A 3RX9A 4D94A 1XBDA 3L9EA 1SY6A 6TAAA 2QQLH 5J5EA 4LO9A 4HJIA 2BNRE 1JF5A 2BSED 2LTQC 1CG9A 1HJBC 5CSZA 4BGLA 1MFDL 1BQLL 5F9OH 3LRHA 3SZKC 3C6LC 3LRKA 1KN4L 4BINA 1CURA 5C07D 2JKNA 5LGJA 3FTYA 4G6JH 4KV5E 5IW1B 5IVNA 2WCPA 3CBJB 5EO1B 1AZRA 1URIA 3K81A 3D50A 1G9ML 3PQYB 1U21A 3PWPA 4KDTA 4KQ3H 3CDGB 2EE2A 1VPOL 2XWTA 2UX6A 1WA0X 2V6HA 5KSAD 1MLCA 3RWFB 4U0QB 4H0HB 1ZA3A 2XWXA 4OF7A 1KFAH 2H3KA 4HUWA 2PR4H 2OJEA 3RZCC 4MJIA 4I0PD 4MKMA 3GXNA 2A4EA 3LRSA 5I26A 4F8OA 4GO6B 1NC2D 3CCHB 2Z0BA 3GF8A 3P3YA 3VGAB 1Z9LA 4YLQT 2YD1A 2P1YA 5EUOF 5IW6A 4MRCA 4EBQH 5CBAB 1DEDA 4ODSH 5D7HA 1JI1A 5JPMC 4MS8C 4PB9L 2NY7L 1QQDB 4U1LB 1JGUL 1IVLA 3B9EA 3FT1A 1WJ3A 1P6AB 1PPIA 4X42A 4BZ2A 4CW1A 2UZXA 4G70B 1XEDA 4R4FH 1ZHLB 3QQ9C 4KTEH 1ZD6A 3WKYA 1QRNB 2R7EA 4JGHA 3H9SA 1SBBA 5LGHL 2XIDA 4QRRD 3PREA 2MTPA 4P59L 4OCRL 5F1OB 3V9EA 7FABL 1FIGL 4Q58C 5SWZB 2YEZA 5TQ2H 2IWGA 3FTUA 4PJ7F 5E2JA 3RUGE 3IRZA 2FLRT 3P77B 5HVFB 3BKYH 4R90H 1TYEB 1QSEA 4FTVD 4UQCA 4V1DA 1UWGL 1DVFC 3RRQA 5LGYA 1LHZA 4JQXA 1IILE 3BAKA 1ET7A 3QAZC 2XZQH 3BLKA 2XG5A 4XNMB 3R19A 4XN8A 5JORB 2FATH 3LIUA 3KG5A 4FFTA 4PJBB 4P5TA 4ZAKC 4N2GA 2O5ZH 4ZQKA 1UVQA 3F65A 2LOEA 2B1AL 3UCRA 3RPIB 1JGLL 4GW5B 2ESVE 5GGVL 1AQDA 3QFJA 1FNGA 4KHXL 3V55A 4YHZH 4G7VH 1T22A 4FQIL 3C2SA 4M6MH 4MCNA 1R3JB 4PPTA 4M5SA 2EC9U 1GIGH 4ZYKB 2BCMA 2ERJC 2ZWLT 4QNPE 5HYJA 3TEYA 3O6KH 4CAGA 4Y4KB 2IALB 1KIQB 1ZLUK 3MV7A 4KGLA 3QDMB 2Q76B 3DGCR 4V2BA 3BAIA 1GHFL 3QWRA 2OMXB 5FM5O 3GSWB 5HI5D 3ZGIA 1P2CA 2BY0A 2I32A 3ELQA 3F6JA 3PJNA 5EUOE 5KWYC 4W9HC 4FADA 3NIGF 5KJ7E 4ZFGH 3Q1EA 2CGRL 1Z6JT 4MRBA 3D3VB 3IXTA 1CL7I 3ZE1B 4HEPA 2OL3L 5FB8A 1QFHA 2R2BB 2OW7A 4ZFZA 3BVTA 3E3QC 1A6TB 1AGEB 2IADB 5E0QA 1FV1B 4W6YB 4PTUB 1QZ1A 2VWEE 1WPCA 2TRYA 5D7JA 1FE8L 3TU6A 1A6WH 4ZD3L 3HRZB 2WQ8A 3O9WA 2JK5B 4N6RA 3R06A 4I3GA 3HKFA 4KGJA 4X6DA 2JJTA 3WFHB 3HVDA 3P3UA 4PY8I 3GB7A 4YLBA 2IBBA 1LJMA 4YFLF 4PJ7E 4NCC2 4ONHA 1UFGA 2NZ9D 4UNTA 1K4CB 1ETZA 4OFYD 1MRFL 2WQWA 1AOZA 4M6NL 5F88B 4GT0A 1MJUL 5FOJA 3C75A 3ULVD 3GSNH 1T5XA 1JPGA 5DEGA 4XTRD 4TF4A 1KJ3L 4FYSA 3ARGD 4I18B 5HHOA 2P8LA 3QCUL 1SLVA 1R17A 1E4KA 2XPGA 3QNXB 4P46B 2VXQH 1OARL 4FTVE 4TUOA 4MQSB 3ES6A 2ITEA 2I25N 3I75A 3KPSE 4RMQA 2NY4B 5IB1A 4OJFH 3ULVF 1CG9B 3HR5B 2CLVA 1MHCB 5CSZB 1RUAL 4ALAC 3KLKA 4AVHA 4G6KH 4AQAB 1AXSB 1OB1A 1ULVA 4QO1A 3BPOC 3KWWA 1HSBA 3SDAA 4WW1A 2LFGA 4XWGL 4TSAH 3VQMA 5MEOB 2BSRA 1MLCB 1J87A 3NA9H 3NIGE 1SF5A 4OIIL 1H6UA 1E50A 4OGXL 4WNSA 2H5UA 3MACH 2BNUB 2FGWH 2Y2TA 4XNXH 3K4ZA 4JRYB 4P9HH 3HZKB 4CBPA 3VMOA 1S46A 4LMQE 3MOBH 1L7TH 2CA4A 4U1GB 5C0NC 3F3HA 4WY7L 1JHTA 4KKAD 5IW6B 4DGVH 4PLKC 1QVOA 4ZOAA 2HTKC 5I0VA 3Q0HA 4UAOC 2AZAA 3QG7L 1ZS2A 3QO0A 2R8SH 3UZQB 1LE9B 4R26H 4A67A 3OHXC 1W8EA 5F9JA 3RJDA 3O2WL 4QGTA 3P4NA 5F7UA 3MROA 1YUHB 4IDLA 2NNAA 5T5FH 4DGIL 1AGFA 2D7NA 1A4CA 1C5CH 5LCVA 3TZVA 4AMXA 2R7EB 1GC1L 3H9SB 4U1SA 3KNBA 1JCVA 2CJ3A 4HJTA 4LOUD 1NCNA 2WIIB 3SDYH 3T0EB 3ASOB 2Y2YA 3FO9B 3PHOA 4UINH 4NQSB 1IM3B 4X50A 4EAEA 3EYQC 3F83A 4R7VA 4MBRA 3UJJH 1NWPA 2IGTA 4HCRH 4PR5B 5CGBA 4XXDB 4XPGH 2W0FB 2NR6C 4TULH 3IDGA 1FL5B 1QI4A 3F12B 2DQIL 1QKZH 4L18A 1C5DB 4WI8A 4JDZA 2ICWA 2AXGA 3BYYA 5ICXB 3V0GA 2CBOA 1Q1JL 4K15A 2J5LB 2OQJB 4Z7NF 3ULVE 3VWJA 4ETQA 4NUQA 4AEIL 1OF0A 4ELKA 1J11A 3DX0A 1TENA 1AG0A 2H2SD 1TZOA 4P2OA 3I6KA 5IV2A 4UU9A 1I8MA 1BXUA 4PP2B 1ADQL 3QFJB 3CDYA 4L1HA 4LSUL 1HILB 1M6UA 3EO1B 4K3HA 5FYLH 4YE4H 1W2KT 2JH2A 1EK3A 4UANA 3L4XA 1XZ0B 5CSGA 2K9FB 1IGFH 3VACA 1BJ1H 3GI8L 3MBXH 2ZUYA 1OCZB 1CFNB 3CFMA 4LE8A 1CFTB 2OXGB 3PG2A 5F3HA 1LO5A 3NFNB 3K1KC 1FC1A 4MX7A 5HDBF 4QYOA 4MLSA 5DLLA 2AJZB 4QT5A 5GSVA 1ZLSL 5C0IB 3HI6L 2XKSA 3GTTA 4QLRA 2V7HA 2FIRT 1P2CB 3CH1A 1I85C 1B0GA 1AO7B 3GHBL 2FIKA 1HDMB 3NACL 4GG6A 2YGOA 3WENA 3QDJB 1E4XH 1SLUA 1RJLB 4OFPA 5I2IB 5CIPH 1UKTA 2F8IA 4FQPA 1FLRH 4TVSa 5IQMA 3QHTC 2YOAA 3SDCC 1EEQA 3G5ZB 3RAJH 3VDBA 2QLYA 3LKNB 5ITBL 1MFBL 3IXAA 1CDIA 2Y7QA 3CVBA 3K6FA 4A2DA 5IFJA 3NA4A 5F71A 1PLBA 1IUZA 4N2BA 4JEGB 3EFFB 4PWIA 5EWIL 4BQBA 3OB0H 4JDTL 4R0LA 4Z78A 5ITFB 5KVDL 4EOWH 7PCYA 1RFDH 1NBVH 3ARRA 4M43H 4PJ5B 4F7KA 1DDTA 3IU4L 1X5AA 2BSSB 4HGKC 1SQ2N 1DVTA 1RJYA 3V0JA 2OS7A 4Y9EA 2QHRL 3LH2H 4KH9A 2WXPA 1BFOA 1AY1L 1QEXA 4X5WB 4OI7A 3PGDB 3C5JB 4LU5H 4DTGH 3NTCL 4IKIA 4A6YA 4Z7NE 5LNGA 1E4WL 3QORD 3DOHA 4OGYL 4FS0A 5FGCE 5HHOB 4X6FA 2BINA 2GB2A 2HFGL 3K0YA 5D7KE 4UV7H 1SOKA 4X4XB 2QVIA 4OZ4A 4AQEB 4ZSOA 1AYOA 1XD0A 3T0WA 1NKOA 3FCSA 1A1MB 4I8DA 3CVHH 2GTWA 1PY9A 1D7DA 3C5ZB 4OI9A 5L2JB 1JHKL 3ES6B 3QHFL 2CXGA 1R6VA 3EUUA 3PDOA 1KGJA 1TPXC 4ZTOL 2D7MA 4Y4FD 4B5ZA 5K1NA 3HNVH 5HDBE 5HI3C 2XXGA 3VXNA 4DWHA 3QIWC 3TBTA 2BZCA 1HC1A 5GS0D 2BSRB 3IKKA 3WTSA 1WSST 3IK2A 2F7QA 5KW9L 1AZVA 3LAFA 4N2MA 4QXUL 4BZ1A 4JO1L 2WQRA 1TJHL 5DFVC 3WNLA 2Y5EA 1ACYL 5FGRA 3U36A 2QQKL 4NN7C 2GY5A 3MJ7B 3ZDXF 3QIBB 2VB5A 3QC6X 2HRPL 4YDLB 3F05A 3SODB 1IGIH 3JWOH 4LCWB 2VLLB 1OF2A 4HJ1A 3MJ9A 1RU9H 1QA9B 1FN4A 3OZ9H 1J0ZA 5JQ6L 3D06A 4OD2B 2YJLA 3ALXA 5GRXG 2EDWA 2VR8A 3CMGA 2PCPA 3MROB 4OFQA 4J4PC 3QZLA 1X5JA 3CFNA 5I74C 3QCVH 5D2LF 1QAWA 2E5EA 3HIZA 1GVIA 4ZUVA 4U1SB 1O9ZA 3RVVD 4OQTL 1KBGL 4TLSA 3N9GL 4FFVC 1X7TA 1WC7A 5EPMB 3VFOB 5EU4B 2PXYA 3ARSA 5KVMC 3PHOB 5E9DB 3ARDB 3Q8AA 1A2YA 1D5RA 3H6JA 1X5FA 1DJHA 3H85A 4TL4A 1E5ZA 2H3NA 3VE0A 5CCKH 1BFSA 4W68A 5IM7B 2I27N 1HHKB 3VD2A 4JM2D 4QAWA 5AYTA 2GSIB 4KROD 5FYKL 3O0LA 1PZCA 3MRKA 1JXJA 3JV0A 3UAJC 4UM9B 1S5IH 4TYUA 2XU9A 4IKKA 2O4EA 2MHAB 1F3JB 2UWEF 1MRCH 3I6KB 3U2JA 4WO4D 4KY2A 3MLTB 3SQBA 4DPCX 3VFTB 1R5VA 3ILDA 7CGTA 4LKXB 3E8UL 1AJ7L 3WNOA 3C87A 1FRGH 4K71C 1DUZA 3C8KA 4Q6IA 4AY0A 1D7BA 1C9SA 3QA3B 3FU8A 4AZ8B 2Y2WA 3VRLF 5HVGB 4X2UA 3VWKC 5E0FA 4KKRA 4Y4KC 4Q6KA 5DQJB 4UBDC 4ZFFB 2E6QA 4JFFD 3O11B 4C83B 4Y1TA 1QFWL 4R84A 4HEPG 1HYSC 2NTFB 5KTEH 3ZDXE 3PUCA 3RVTC 1AZUA 2PYFB 3GBDA 3VFSA 5CKGA 1B0GB 3U7WH 2ZXGA 3EJQA 1N4XL 4PP1C 5EFIA 2NXZB 4AYFA 3LQMA 1UZ6F 4HHGA 3PGFH 5I73C 4IHOA 1AHWA 1MIEL 5K9OA 2BP0A 1NDMA 3TV3L 4D8PA 2R1WA 15C8L 1F4YL 1U8IB 5F97E 2X4QB 5E2TL 3ME0B 3CLFH 5D2LE 3X1EA 1VGEL 4HBQA 4PVNA 5D6CA 3ZTNL 4A7TA 1I1RA 5EZIL 3KYNA 3L1OH 2FJHB 3ZHLA 1M4KA 4NO0A 1KIPA 1M6OA 1TZIA 2Y25A 2HN7A 5SWSA 3UJIL 5L2KA 3ARBD 3AAZA 1BIIA 1K4DA 1W9XA 1ZTXL 2AKRA 2F19L 4PEEA 3TBSB 4ZMYA 3GK8L 2K3HA 4R0LB 4Z78B 4FLOA 4LSRL 3PDDA 3TFKD 3B3IA 3Q2LA 1DVXA 5DLMH 1HKFA 3WEOA 2XCMC 4LCIL 1X5KA 4F3FB 1N19A 5I15L 2JFCA 2XXMB 3VXTA 2F53B 5FXCH 5IHZB 3QRFM 1X3DA 1JTPA 4QHNB 1OSPH 1UFUA 3G7TA 4XVTL 3U9PH 1PCSA 1CGYA 1AR2A 2NQ3A 4FMKA 2NTSP 4M7LL 2JIXA 2UWEE 1FG2A 1FZKB 3C08H 4N9GB 5AVVB 3EGSB 5GSRA 2WZAA 5A2IH 1T5WB 4M29A 1KWKA 3FMGH 1KGYE 4KKNA 3F5WB 1G6RA 2HWZH 2K8QA 1FJ1B 2NW3B 5CEZD 5DS1A 4UT9H 3S0PA 4OB5H 3PDOB 2VZVA 2MOVA 4HP5A 3TYFA 4BM7A 3LQAH 3KPRD 3L13A 3SD2A 2Z31D 4KRNA 1DZBA 1OP4A 1S8DA 5IVXB 5EU3B 3HC0A 5CJXA 1XVSA 5LWYL 5JDSA 4XO5A 1ZT7B 4XB8A 5GGTA 3SO5A 3CFEB 5K9JL 4YXLH 1AXTL 3ATDA 3IRPX 4TLKA 1AR1D 2DYSB 1PG7W 4PMEA 4DP9X 1LO0H 3FONB 5AWNH 2NXYB 1BOGA 1KB3A 2OK0L 2DQTL 1JV5A 3NN8A 3MBEB 4AIZB 1AOHA 3BAEL 2AGJL 4N8UA 2VLJE 5D4HA 4YGAB 1S7VA 3IDUA 4ZXBA 4P57B 2AV7A 3HC3H 4UI2A 1QR1A 4JFFE 1JAEA 4UOW1 4P5MA 5DF0A 1VAHA 1CTMA 1FWXA 1U3YA 2EEBA 1PZ5B 4G43A 3S34L 2OR7A 2IH8A 1V05A 1IBBA 1MAJA 2Z65C 4JLRB 4F7CA 5IB4A 3I50H 4NAMA 1WYJA 1RUQL 5TGBA 1SJMA 1JBJA 4OLVL 5T33H 3ZTJG 1EJFA 1E27A 1F4WL 4Y89A 4XVJL 2EO7A 4HJJH 4Q0XH 5KUKA 2BC4A 2JV6A 2F08A 4JX0A 1OGAD 1S7QA 3RWEA 1J1PH 3HAEB 3UTZB 4NOBA 3U0TB 2EXYD 4J6IA 5C97A 5DZ9A 2PXYB 2AMUA 4TKWA 2DZEA 3RGVB 1SXNA 4DVRH 1RHFA 2OL3B 3IDXH 3FQXB 3AQXA 3UO1L 5I24A 2DQUH 4AJYV 5D7LA 2YZ8A 5DTFB 2CR3A 2HFFB 4OD3H 1I3GL 1U8MA 2MMXA 2QGBA 2DLTA 1TYJA 4JUTA 4CMMA 1T0NB 3ETBJ 1ZIAA 2N0MA 2HKHH 4IRZH 4OSUH 3WU1A 2DLFL 4P4KB 2PO6B 3HZ3A 4MJ4A 1WV7T 3V0WL 1SEQH 3PPSA 4W1TA 2XVGA 5F9WC 1R9FA 2VUYA 2O5XH 3DTDA 5C71A 1U58B 3WKNA 1NCAL 1YMME 4DZ8B 1DBBL 3II1A 3JWDC 3MV8B 4CDGC 2ODHA 2HT4D 3F2LA 4MA7L 5JQHC 3N40F 2RCSL 4WJKB 3D18B 2CWRA 1IEAB 1WIOA 1AKJD 1OM3L 4JJ5A 5BMFL 1DUZB 4JHZA 1QFWI 5F9AC 3VYOA 1KCWA 3LKRA 5JNYA 1MFDH 4UTAA 2H8PB 3AB0B 1CK0L 3I74A 5B1BB 5CEZE 1KN4H 2DWDB 1RVFL 3MCYA 3ZE0B 2V5RA 3EJYD 3II2A 2GJ6E 5FGSA 3AS0A 1W8OA 4R3SB 3KPRE 1PAMA 1U93B 4O9HH 5L6YH 3S5LB 3QARA 1VPOH 1L3NA 3C5SB 1DN0A 4OVVA 4EN3D 2WJ7A 2O61B 1WFOA 1FVCA 1S7RB 3QI9B 2CO7B 4JPQA 4OIFA 1MAML 1V8HA 1SN5A 2PYEA 5JPNB 1W72L 5ACZB 3ISYA 4HIIA 1V7ML 4JB9H 4G9DA 1BZQK 3I2CL 5DDHA 5L7XL 2DF3A 4YEFA 5E2UL 4WK0B 2XN9A 1IQWL 4AEHL 5GZOA 1TUPA 4PBDA 2Q7YA 3VD3A 3CAFA 3F84A 4LLUA 4TVPD 5L0QB 2G75B 3ALWA 3PLYA 1GJWA 1ZMYA 2F6AA 4OJCA 4DPBX 5SWSB 1EEYB 4HJUA 2HT3C 2IPKB 4MQ7A 5DQDH 3TCTA 4CNIA 4Q89A 3G9VA 4NC2B 1ZPUA 2AQ3A 1I3RA 1KTKE 2FT8A 3O9WC 3CXDL 4MB4A 2YO3A 1YDPA 3UACA 3QISA 2JJTC 5I75C 1XV8A 3A67L 4TNWF 4HK3N 1XCQB 2QBWA 3OVUB 1T03L 2XN0A 4P59H 4MD4B 3QG6B 4FXTA 2WC7A 4G7QB 1OGAE 2ZF9A 1FIGH 5EEVA 3GBML 3IDIB 3JTTA 5E8EA 1M71A 2P48B 3VXTB 3WY3A 3LS5H 4MNQE 3ZYZA 2O1AA 4JY5H 1I8AA 4QHPA 3PNRB 4IDJL 5C0EB 1UACL 2WZPA 2JIXB 4OZHF 1UWGH 3FSAA 1HTYA 1KTLA 4WVRA 4OQTA 3T1FA 2E8ZA 3QQ4A 1ZLUH 1T7ZA 1RZKL 2B20A 4K5NA 2EIKB 1BDYA 2WBJB 3C5ZC 3J2PA 2H1PH 2VJ0A 5HYFA 5FGBA 1OZUA 4Y5XA 3UYRL 2B1AH 2JKJA 4BFKA 5F70A 3TYFB 4MBOA 1F18A 1TIUA 5GGVH 4XMTA 2YEVB 3PY9A 3D8MA 4K94L 4KHXH 4FLSA 5DEFB 4CU7A 4ANWA 4FQIH 2A6JB 4KK5C 1OM9A 3QEGL 4FABH 4ODXA 4NBXB 5AW2B 4YX2H 1IC0A 1Z5YD 3ZKMD 4J3TA 3SDAC 4XCEA 3IDJA 1TCRA 3BVDB 2ZP8A 4H13C 4B0MM 4KNTA 3U83A 3V2AR 3JV4B 3C2AL 4HKBB 2FX9L 4YDZA 2BNQB 2X2HA 1U8QB 4EI5A 1E90A 2AV7B 1KYUA 1CIUA 3V9CA 4Z1PA 5EF3A 4MXVF 4PW9A 4U33A 3HAEH 4FL4B 5I1LB 4PRID 4P2RA 4XPFL 1AXIB 5T1DL 4HT1L 3ZHKA 5E5LA 1VFBB 1A14L 2DYRB 5FDWB 3VTMA 2W60A 3A4FA 5AYUL 2CLRA 3GS7A 3OMNB 2NY3D 2CRYA 4GG8A 3K7UA 4C56B 4NN5C 2WTPA 2AJ3A 5HP5A 2YLHA 1FE8H 1S7QB 1QOKA 4TVPE 1AGCA 1I7TB 4JFEA 4ZD3H 1ZSDA 2WY3B 3P9LA 4DP2X 1FYTD 2HVJA 4DZBA 3FCTB 1HU8A 3AITA 3FQWB 5CZXD 4KO5A 4NGHL 3SKJL 4L8CA 1TSHA 4OR1A 3B56A 3MX0B 3B83A 5IKCA 2A38A 2HVKA 3ARDC 4YHOH 3ZHFA 4XWOC 4GBXB 4PRNA 1XGTB 1MRFH 5G4NA 3FTXA 3BQUD 4PJ9D 3K8LA 2IOOA 1QMUA 1OO2A 2C1OB 2JVUA 1OAZL 1KJ3H 3CPUA 3OQ3B 4Z23A 1OB0A 1PKQA 4CKVX 5EEYA 1K6QL 2WO2B 2W0PA 2ZOKB 3ZN6A 5ID0A 3QCUH 5JHLA 1XF3A 2GQHA 3VWJC 2VQUA 4NRZB 5IGXL 2FL5B 5I9QC 2R29H 3TWYA 4LLYA 2R15A 2JJVA 4LPCA 4FQHA 1CE1L 2MSPA 4JAMA 3LCYA 3LS4L 4PRBB 4G9FD 3SGDI 4AMWA 2YK1H 4J3XA 3EYVA 2DBLL 1JVLA 1A1OB 5HGBB 2P5WA 5JNYB 4A7UA 3D4GA 1SJVA 3VFRA 4L1LA 3CC5B 5FS5A 2B0SL 3JZYA 4G11A 1SYVA 1CLYH 4FGMA 2Y3NA 4OY9A 5JXED 1AZBA 4U1IA 5DURB 1RCYA 4RWHA 3TBYB 2WQXA 4QRUB 1TCMA 3VG0L 5K9QI 2AEPL 3AREA 4FULA 3HNTL 4QJ4B 2BVTA 4OGXH 1E30A 4JANB 3UC0L 2BP8A 3RP1A 1CF1A 3CBKB 3LEYL 3N91A 2NXZC 5HI4D 3GLDA 4DP0X 3L3KB 4XNZB 4W70A 3FFCD 5GIRA 5FV1L 5SV4A 1ZDSA 2WKOF 5AW1B 1G9MC 2C9AA 1QUNB 3L95B 2I07A 1J0YA 2VTFA 3QG7H 3NAAL 2C9WA 1M42A 3LKQB 3OC8A 4PRIE 4BGDA 1G7PA 1PX8A 3MSPA 3Q3GB 5I6MA 3OTTA 4M1GH 4F8QA 1WZMA 3NZHH 5G4MA 4FNRA 1VEOA 1SRDA 4UV4L 3MRPA 3BVNA 4GAGL 4DGIH 1BVOA 3IPBA 1YDPB 5IR1B 1NFDB 4R0LC 2IANB 2BCKA 4MA3B 5I1EL 2F1AA 2WBXA 1CXEA 1MZYA 4H2CA 5A2CA 5CINL 1MLBB 2WWKO 1BD2A 4R83A 1J9SA 2D73A 2YRPA 4LQFL 5I17B 2YD0A 4Z6AT 4F9PC 1FYTE 3CSTA 3X12B 4NO5B 3IMRA 5J6SA 4Z3FA 3ISWA 4XX5A 3UTPE 5BUGA 1XGQA 5D8JL 2DQIH 3KYAA 1SF3A 3BH8B 4UIMB 3ZTEA 4K3JL 3T1FB 2X10A 5J6HA 4G1EB 4PLNC 1Q1JH 3NZ8A 4Z8FL 1F86A 1R3HA 2KT6A 3TV8A 1GZPA 3H3BC 5D93C 1DJWA 3QRGH 4XNBA 4MNGE 1HH9B 2VLKD 3N41F 5T1LB 1W0WB 4M7KL 3QJFB 4H25A 2JB5L 1UB6A 4UQ2A 3LXAA 3QJRB 1SJEA 3HCVB 3GKZA 2FRGP 2EDQA 2BW5A 1FCGA 1B0WA 2A9ML 3MRBB 3FRUA 2QKIA 1FH2A 3QH3B 3VDAA 4GO9A 3GSNA 1NCWH 3DDFA 3SYAA 3Q5TA 4G9FE 5E08L 1TCRB 4XAWL 3GI8H 3UZEC 2PETA 1SN0A 2EVIA 5DK3A 5IBUG 4HOZA 4OZGF 4LLQB 3VXUA 3WHXB 5LBVA 3GTNA 5DD0L 3UGUA 4MYWB 4UCFA 1YN7A 3DGDA 3M8OH 2R4SH 1UD8A 2VXQA 3MBEC 3DRQA 3HI6H 4IRJB 1ZLSH 3QNZA 2Z7YA 1SBSH 3VB8A 3TESA 4YVUA 4YXHL 1TTCA 2A6IA 1Z0NA 4WI7A 1IC4H 3GQFA 5C7ZA 3NACH 1ZXQA 1A9VA 3CFJB 2J20A 1ZK5A 1O9WA 4ZUTA 5BRZB 4D9QD 2NY0C 5DRWB 4A7VA 3EFDH 1ZCRA 5AB1A 3P69A 5K1JA 2IFGA 2ZUXA 5GGSB 1YEDA 2A83B 1B4JL 2C3XA 3FFCE 2F61A 1MFBH 3OJ2C 4XBPB 1DN2A 2E9IA 2QQNH 2UXTA 1JF6A 2GTQA 4JFEB 3VGFA 1IGML 2HTLD 1I82A 2EDMA 2HVJB 1E9PA 3E1F1 2FLMA 4CILA 1G5AA 3C09B 4R96B 5KVDH 2I60L 3ISRA 3CSFA 3S96A 2PXYC 5A6LA 3IU4H 1RI8A 3PDGA 3BZEB 2WWOA 4PJIF 3ZW3A 2QHRH 4RZCA 5FCUL 1U8NB 1SOQA 3NG5A 1FCCA 2SODB 4M4RB 5DJXA 3TWCL 2E4FA 2O93L 4ODHH 1IBGL 4OGYH 4CU8A 5A16A 3DX1A 1MHEA 2D2OA 4QRPB 1A3RH 1JZDC 2WVSA 3G6JE 1K8DB 2AK4A 2DTSA 3FB8A 5E70A 3SDDD 3WTUA 3SE8L 4DPRA 4Z77A 4D7BA 5I16A 5I8KL 2GC7C 4NI3A 2Q5BA 3MUGA 4K8RD 1TR7A 2HXAA 2MQ0A 2J7LA 3Q7JA 1XT5A 2O26U 2A9CA 3MLYL 5CLXA 1CFVL 5AVYB 3SGJA 2DJMA 2ISDA 3EYVB 1XF5B 3TEUA 2IMNA 1B6DA 4TVUA 5TJWK 5ETUB 4RLDA 3T2PA 2FO1A 1RMFH 1SEBA 4Q6IC 2VLKE 1QPXA 4HCRA 2HZHA 4Y9CA 5IQOA 3BSZA 1GZQA 1PGRB 1N7MH 3GIVB 4IU3B 3OLIA 1R0AL 3MNMA 1WBZA 2YPLE 4AV0A 4KJQC 4JS7A 1NMAH 4IK6A 1IIKA 2B9BA 4LVHB 2QGEA 3FHAA 3TN0D 5KW9H 1YEKL 4ZUSB 3LN5B 3CH8A 3EDKA 3UIZA 3QZOA 3EO0B 2Z6FA 2WSPA 4H4NA 4M8QA 5JPNC 1ACYH 3C60A 2A74B 4AUJA 1ORQA 2QQKH 5DS8B 1AHWC 5DUBB 1DQKA 4XVUC 1HZLA 4M4PA 3LYRA 5E5RB 2HRPH 5ESAA 4GRWH 1ET8A 3NFSH 2WQVA 2AZUA 1TETH 4PJCB 2Y1AA 4WWKD 3OKOB 4IM8A 4NM4L 3KMDA 5L0QC 1MHPL 1UXWA 3F04A 3V4PH 2WLHA 3ZTDC 4K3GA 3NSYA 4NFCA 4WUUA 4D9QE 3KH3A 4HFWA 1WIPA 1LP9B 4NP9A 4OCWH 2WNKA 4RAVA 3BVNB 4TUJB 1OTTD 2EDJA 1JPSL 5E6IA 3QEQA 1YN6B 4OCSH 1WUZA 3LZQA 1KBGH 4PJIE 1BXXA 3GHPA 2X4TB 5I1HL 1MCPL 1D5BA 4JPWH 4NKOA 1INEL 3L2MA 1TQBB 4X7EC 1DO5A 3P11L 1ZLVK 2ZXAA 3MKGA 5CIPA 3TPUA 1M9SA 2ZOWA 4F1SA 3UBFA 2W59A 2Z91A 1A9BA 1LILA 1RH8A 4JFOA 2NSXA 4AC4A 1EAPA 3QT2A 5D1XA 3GWJA 1JZ6A 5F0PB 3UOAB 1UXLA 4WSJA 2UXGA 4NJAL 2WGNB 1YPZF 2EXSA 4IK7A 1I8IA 5IT2L 2KYIA 2Z1KA 5C2BH 2BVUA 5TFSL 2D4FA 4U3XA 4FYRA 2X6AA 1NGQH 2E86A 2WBJC 2HPTA 1I4FA 5E2VL 3D5OF 4O51A 1IC7L 4GW4B 5I1CL 1YNKL 2ROXA 2VC2H 1JPFA 5F89A 4G8IA 2LV4A 3E8UH 4ACPA 1IBZA 2H6OA 3E6HA 3OKKB 2QV4A 5CJXC 3BD5A 4NFDA 3OXRB 4K5OA 3X1FA 1D2OA 2B77A 4FFWD 4NUGL 5SWQA 1Z5LB 2P46B 1C16A 2JELL 3TYGL 2B59A 3STLB 2RFXA 3NIDB 4OLZH 5I1DB 1EGJL 1JVKA 3EG9A 4N87A 1G7JB 4C57C 1F8TH 1SPDA 3CVHA 2BIMA 2ADFL 4WKZB 4XGZB 3NRPA 4G6ML 5LAXA 1GJIA 1ZA6A 4ZXBC 3ULAB 2VMEA 3P54A 2JKLA 2AJUH 3WG7B 1EEZA 5KVFL 1ZHKA 1I1FA 3KDMB 4OM1L 4DP8X 2Z7ZA 4DETA 3WD5L 3ENEA 3TV3H 4Y19D 3WS3A 3DO4A 1M2OA 3FT2A 2X4RB 5E2TH 1VGEH 1GS7A 1R46A 2AK1H 2XQYK 4FG6D 2VISB 4MSWA 1MCKA 3BZ4B 2KZ1B 3IF1A 4G3YL 4ZAKD 5EZIH 5F7KC 2E27H 3R18A 3R7QA 4EXPX 4WWPA 4BHUI 3H7BB 3AUVA 1AP2B 4UB0L 4XH2A 2G9HB 3D39B 3QNFA 4DW2H 3FOMB 1W72B 4MD0A 5CR8A 2F19H 1I1CA 1NANH 2Q7AA 1GPOH 5D9SB 4M3JA 4F7MA 5FKAA 3AS3A 4LSRH 4I7ZC 4PRHD 4PRPD 3DMMA 4HWNA 2OSLA 1PJWA 3KW8A 3K80A 4LCIH 1CFMA 4KJPC 3V0VB 3AVEA 4RZCB 4Q9RL 5I76A 2ADJB 4X6CE 2XIBA 1YPZE 2CPCA 5CO1A 4PGDA 4FFYL 4JCLA 4X0KA 4BFIB 2YD4A 4BKTC 5DO8A 3X11B 5ILTH 3VQ2C 4L4VD 5FKPB 1U95B 4IGBD 1B88A 4NB7A 2QR0A 2WSDA 4EI6A 4ZX3A 3LZFL 1N3NA 2AV1B 3RL2A 1T0OA 5DUPL 3BDBA 2K78A 1TJIL 1AS7A 2P8MA 4XP6L 3DBXA 1AZNA 2BIIA 3PRZA 4E42A 1NDTA 3GLAA 4OF5A 2ADGA 4HKJA 3Q44A 1PG7L 4Y4HA 5EU6D 2A6DA 1T7YA 1ZT4A 2A73A 2AQRA 2DIJA 1F0LA 4CL7A 3T9WA 3TBBA 2RH0A 2V2XA 2R1XA 1AXTH 4KXAA 4OCXH 1R3IL 1CTOA 1MEXH 3MXWL 2CHDA 2M26A 4GO8A 2VT0A 5EN2B 3S3BB 1BYOA 1N6VA 1FFRA 4JPVL 4GIPD 3MI6A 4K3DL 2DQTH 1AIZA 2VQ1A 2X2YA 3BP6A 3X1NA 2WYZA 4IJTA 2YBRB 3IBOA 4L29B 4W9KC 1YEGL 3TCLB 5I0XA 4XR8C 3O4LD 1NC4B 1CD0A 4AYDC 2DDQL 4KTGA 5K39A 2VDMH 4IS6A 3ZKXB 5BZZA 4L0YA 2IEPA 2DKSA 2XBDA 5F6HI 4YWGL 3FQTA 5J12C 4DCQA 1V3KA 5GZOC 4N0FA 2K0RA 4P3CL 4UUJA 5GRUL 1L6ZA 3E2HB 4RCAA 3WDJA 5HVHC 3HMXH 5FW7A 2R9HC 1MCRA 3UAAA 2BVQA 1RUQH 4H2AA 5MENB 1I8KB 3EW3B 3ZHNA 2IFFL 2HPOA 1QSFE 3EF7A 1F4WH 4G6FD 3LMJL 4RAVB 4Y19E 3SDXA 1BLNA 1P6WA 3T6WA 4AGQA 3IE9A 2R2HA 1IFGA 3D85D 1F2XK 1USZA 1NKGA 3KPMA 2EDBA 1H3UA 2CO1A 1ZWIA 1OT1A 4AUUA 3UO1H 3L4YA 1Z3RA 1EO8L 5FHBH 2FUTA 4ES9A 4GKZA 5D2NE 1P69B 4PRHE 4ZMWA 4PRPE 3TBVB 4QOKA 2DLIA 3QZNA 2DOCA 2QPSA 2DLFH 4ODVH 3KJ4C 3N44F 3PXHA 4Z0BH 1I8IB 3TNMB 2VLRD 4YHIB 3U1SH 3D0AA 4I88A 2VNCA 4WEMB 3BGAA 3VXQB 4MD5A 3LTVA 1N5YL 3W2DH 4BHUA 4YDNA 4L4VE 4PLKD 4A66A 4MA7H 2BNRB 3AUWB 2CR0A 4Y5XC 3VD0A 4HG4J 1FFOB 5J11C 4QR7A 1EO5A 3S2AA 4S1QL 1RK1A 3HB3C 4UYQA 5IMKB 1S7UA 4BQ6A 2AAVA 4M48H 4Z95L 4POUB 5BMFH 5LUMA 1I9EA 2FWUA 2NNRA 2XRAL 1EVUA 1WICA 3OR7B 2OZ4H 1RVFH 3SGKA 3E3QE 4U7MA 4NUJA 3SPIA 2CU9A 5EU6E 5B39A 1A6UL 1J1XH 1KTJA 2JTDA 2W65A 5T1KA 4ANVA 4JPSA 5LAXB 4P3WA 1DBAH 1UH4A 1AZZC 32C2B 4MHHI 4XVOA 5TK2A 1MAMH 2X0VA 3T2OA 2CNZA 3LN4A 4IRJC 4EI5C 4NPJA 5J89A 5DD6B 4AQZA 2P5PA 1W72H 2NR6D 3AQZA 4UT9A 1NGPL 3GO1L 1T4KA 1V7MH 4LL9A 3EYOB 2Z3FA 1L5GA 3UTSA 4LARL 1IQWH 3FN9A 2XICA 4Y1AE 4YZFF 5HDWA 4BH8A 4ENEC 3O4LE 5GGQL 4BK4A 1CT8B 4PS4H 3UBXI 4NX0A 3WXWH 1GGTA 1NJ9B 5FF6B 4MMYB 4L3EA 4KX8A 4XH2B 4U4BA 2O30A 4QD2E 1KIRA 3UMTA 5HDQL 5TQ0L 4N2EA 4RQQA 1FL3A 5MI0B 1KTBA 3MOQA 5FKAB 3V4UL 5LXGL 3IGFA 5BQ7B 5L88H 3KPTA 2OSLB 3A67H 3D51A 1T03H 1SJXA 2Q3AA 1MDAA 5F7EL 1TDQA 4K55A 2ATKB 4N8VB 4DP1X 1O6SA 2E6JA 3GBMH 3ROOB 1QHQA 2YUXA 1KB5L 1L7IL 4IDJH 3N1GC 2BWQA 1UACH 3H9ZA 4HH9B 3VFVA 2J1ZA 2ICWJ 4LBAA 2QR0B 3QQNA 1KENH 1OAQH 1HAWA 3QUYB 3WXVL 3RB5A 3VI4E 2XA3A 2WKGA 1QZNA 1EZVX 3WO3B 1TZAA 1RP9A 1RZKH 4CA4A 4KNQA 2VDOH 3PHAA 1ZHBA 3S3PA 3UYRH 1TTFA 3D4YA 2X70A 1HWGB 2VLRE 3SDCD 3SJVD 3BHBB 3VXRE 3B8YA 4KKCC 4PY8J 2J43A 4I3RH 5AAPA 3RIAK 4FG2A 3P2TA 2Q7NA 1QBLL 2WPGA 5I66A 1YJDC 5AW6B 5DJ2B 4ELMB 3QEGH 2YPKA 3CFQA 4IRZA 3GGWA 1A4KA 4JFTA 3QB7C 2GW5A 2X89A 3G08B 4P99A 1UH3A 1NGYB 4UZGA 3R0MA 1MELA 4NXSA 4QHMA 3RWCB 3PFQA 2APSA 3C2AH 2XKNB 1D6EB 2FX9H 4LVHC 4XE0A 2P24A 4BSWA 25C8L 1R5IA 4QJ5B 3MRLB 3WE6A 4PJEA 3HZMB 4MKTA 4YZFE 3OSKA 1X7SA 5K39B 1JNNH 2CO6B 3RBGA 1EVTC 4AWJC 2A74C 2H26A 3TO2A 4APXB 5ECJE 1FL6A 2YPVL 4N0FB 1J9QA 1TQTA 3OF6D 2F74B 3G9AB 4NLHA 4WTQA 3K72B 3ARFD 5AB9A 2CUMA 1LYQA 3VD9A 2BVYA 1A14H 2ZSWA 2UX7A 4GP4B 4QRBA 2ZTBA 2ITCA 3PFUA 4U6XA 4P9MH 4MLIA 1JNLH 3NCJL 5E94A 3O6FD 2BY1A 2G2NA 3MJ8A 4NQUA 5F2FA 5CD5D 3KLAA 5BOJA 1I7ZA 3ZE2E 4HLEA 1VFUA 3PS6A 1G7MB 1RQ5A 1MNUH 3KPMB 1E8XA 3Q6FB 3O3DB 4JHUA 4BEIA 2IC2A 3IGAA 4XMUA 1L9OA 1R3LB 4LOVA 5HI3D 2D3JA 4JHWL 5LQBL 4EQ2A 1QWUA 1XIWB 3PQYD 5C0GB 3FO1B 1MWOA 4WK2B 3AG1B 5D6DC 1CXHA 4UMGA 3CSPA 2AHIA 2GUOB 3RE0A 5EMYA 2LHAA 3KPOB 1OAZH 3FJTA 3SBRA 3KGSA 5FECA 4AENA 1QNZL 1K6QH 3IN2A 3UBXA 4HLZH 4UNVA 2YKKA 4K9JA 4YLCA 1A7NH 3OWEA 1LO2L 5IGXH 3KPSB 3NH7L 1CGUA 3TBWA 1CE1H 3G5YA 5IB3B 3UXFA 1HQRA 3PGCB 4NQDE 3LS4H 2YARA 4DQOH 3OGCA 1MKFA 3OLGA 5MEQB 3RKDC 1M7UA 4U6VL 5EC1A 5GGUA 4XRCA 2QSCH 2X88A 1Y07A 1N5AB 3GZQA 4OJDH 1JHLH 2GK0A 3MRFB 2B0SH 5EBWB 3TA3D 3MLXH 3SJVE 3IEAA 4DERA 3T0BA 3CN2A 1QRND 4NZTL 4RFNC 5EBMA 1E7VA 2VR7A 2BFVH 4ZMPA 3FRPA 4P23A 2B2XH 3BO8A 4Q2ZB 2IXQB 4WW2B 2AEPH 1BA9A 2EACA 4PQXA 4U6HA 1KBBA 3LN4B 4HPHA 1XF4B 4RAUA 3U4EA 4L4TA 5SWZD 1P5UA 3GRBA 4X5PA 3UC0H 4Q9QH 3BGFB 2ZIDA 2PKDA 2OJ1A 1YY8A 2VAAA 3LEYH 3QR2A 3N55A 2ETWA 4OJAA 1SDAB 4JG5A 4NPKA 4PGCA 1HL9A 1EJOL 3BPLC 1A6ZA 1DQLL 4LPTA 1A25A 1CFSA 1SYSB 3UAJD 3MRIA 1JGDB 4RX4D 3Q05A 3IJHA 1T0MB 1H6FA 2IOMA 4FHBD 4L3EB 5JMOC 2CRZA 3BKCL 4PJ8B 2BRRL 3PIQB 4D3CL 1KCVL 5FR3A 5BXFB 2NNXA 3KYKH 2WAHA 1OL0A 4AT6A 3KXFA 3H42H 1MCQA 1BSIA 2BXZA 3ZJAA 4XP1L 4UT6H 3V5DA 5I1EH 2WHVA 1X6LA 5T5NG 2EDYA 1O6SB 4XXWC 4RMUA 1H8LA 2P28B 2HRGA 4MCZA 5CINH 1TVHB 1I1YB 4XO3A 3MCLH 4JFPB 4YO0A 4FQXB 4Y4KD 1E3XA 2EEDA 4PJBF 4YC2B 2R69L 3DVGA 3GKWL 3O2DL 4ABVA 3NSDA 1Y18A 1HYSD 3DNKA 3QDMD 2YGPA 3GSOB 1DFXA 1BVKB 1OHZA 3FTGA 4UIKH 3QDAA 4CGTA 4Q4EA 1E65A 4HHAA 4BFNA 1NCDH 3SKMA 2MPAL 4Z8FH 3T6VA 4KAQL 1IAIH 3GD1C 1TVBA 35C8H 1ZHBB 3A6CH 4RISL 4M7KH 2JB5H 2DL9A 3LV3B 1S7TB 5JIIA 3SGJC 2VN6A 3HHRB 2UY6B 2Q86A 1OSYA 4GKNB 4FQ1H 2GJRA 5A2AA 5I66B 4Z7WB 3WSQL 4YN3A 2OR8A 2XWCA 4NDMA 5HPMB 3RTQB 1EEUA 4ZX4A 1A4KB 1SGKA 3FN0H 4XMLH 1DE4A 1Q94A 1XGUA 4U6YB 1RL1A 2DY2A 4HQQH 5E08H 5FC9A 1H5BB 3UEZA 1IVTA 1P4LA 2F5BH 4PCKA 1VKXB 2D31A 5C0RL 4AH2A 1CR9H 3O4OB 5DD0H 3UTQB 5DQ9B 4E5XA 5FUCC 1GGBH 1JK9A 3MO1A 5CFHA 5DHVB 1Q1PA 5L4JA 3A5VA 2R29A 1LEGA 2OM5A 3SY0B 3BP5B 3PWNB 4JG1H 1QRNE 1ZRUA 2VMCA 5DD3H 3CXHJ 4IRSB 2BZDA 5HYEA 5HD8C 3C60C 3TO2B 2ZX9A 5IROA 3HPJB 1QW9A 4HIXH 3C8DA 3CDCA 3ZKXC 3G6DL 1FGNH 1QW8A 2W94A 4LDCA 1JOIA 4XNQB 4BRVA 1GSKA 1UM6H 1RZ7H 5SWZE 3TO4A 2DAVA 3E2HC 2VN3A 4OFVA 4FF9A 3EHBB 1HZHL 4G5ZL 2D9CA 3KPLB 4P46D 5D7EA 1B4JH 1MPAH 1I7ZB 2BVOB 3RFZB 4A7QA 3QUMH 2IQAA 5JOEA 3HHMA 3K6SB 2NY4D 5I8EA 3U0PB 4IU2A 1V10A 5E6IC 3RVXC 1SXAA 2AERT 4PJBE 1HINH 4FA6A 1OE1A 3SYCA 1Q0YL 1UA3A 2L3BA 3LXUX 4PUBH 5I6PA 43C9A 3HUJA 4IMKA 4JFDA 3DTUB 4AQ1A 1EQWA 4TL5A 1X5GA 2PW2B 1MJJB 3ZLQC 5FCUH 1P4IL 2W9DL 4CSPA 3FUNA 1BZEA 1UXSA 3VYPA 4A39A 3D25A 2FYYA 1MCCA 4N1EA 3L4VA 4NHUB 4QI3A 3V6FA 5D1XC 1IBGH 1ZY9A 2HCZX 4XB3A 3VI3E 1RZ8A 4PWJA 1NDGA 1ES0B 3WN6A 4G80A 4PGBB 5T3ZL 3E6FA 3S3JA 1TTRA 4JRYD 4OF6A 3ZBMA 3SE8H 3UPRA 4M7LT 4GSXA 3IJEA 5I8KH 2XVKA 1MWAH 3GNMH 1TVDA 1U2HA 1I1AA 2QSQA 3ZT6A 3H2WA 5B39G 2XWDA 4ZS7H 2ARWA 3QUKB 2BERA 3QDGE 4M61B 4LSSL 5D71L 1FZJB 5BS0A 4F20A 2HFEB 2XI9A 3D3VE 3EGXB 3MFFB 5D1ZI 5E00B 5EBLA 4MCYA 5D5MA 2A77L 3ZE1E 2GPZA 1DFBH 1R0AH 5DCCA 3WY2A 3AY2A 1QASA 5PCYA 5LNEA 1G7HA 2ZPKH 4ZO9A 3FRPB 1DLFH 1HOCA 1PG7X 3T0ED 1YNTB 3B9KA 4I3SH 5DK0B 1IM3D 4W9ZA 3GXDA 4X5XA 1SM3H 5J6GB 3QFDB 1SHWA 4OLEA 4OM0L 1YY8B 5D4IA 4E9XA 1KTDB 1XGYH 5B38B 4FXKA 5CN1A 1ZEAH 2RAMA 3FSZA 4ZUWA 5EEUA 2V17L 3WL9B 3WUWB 3OKDB 3QW9A 1I7RB 1L0PA 2IPUK 4N4YB 1JMXA 1I9IL 3LH8A 4M5ZH 4MNHB 4NM8H 4JDEA 1ZLVH 1JPTH 4PJAA 3ETSA 2DQMA 1Q4NX 2PTVA 1MHPH 3D2UB 5LN4A 4M7ZC 3L7FB 5I6NA 2C3GA 3TJHC 5H37A 3AT9A 2Y07L 3TT3L 4M7JH 4OUUA 2OXHA 3AZUA 1D7FA 3A6BH 3KH4A 5T5NF 3IAPA 4M00A 1D9KA 1AANA 1JPSH 2OCJA 1FF5A 1X9RA 3L3OA 1I75A 4LEXH 3ULVH 1NLBH 3L5XL 4AM0B 3GJFH 4BWUA 3KLHC 5I1HH 3CLEL 3QUXA 1MCPH 1T1ZB 4LNRB 4HV8B 1T1XA 4NEHB 5E56A 5I1IL 2NUTB 3BCFA 4YSUA 3V9FA 1Y18B 1R75A 1YEJL 4HGWA 4X8GA 3VH8A 1QEWA 2UUDH 4N0UA 5E8DL 4BCXA 4D7PA 4MDJA 3GMPA 2NSQA 2XN1A 1BZ9B 3K3QA 3PWPE 4NJAH 4Y0GA 1FUNA 3SKMB 3DUUB 1VFOA 4MWFB 3ZMEA 1AO7D 1DJGA 4KNUA 3GSXB 3K2IA 1ANUA 4BELD 2YD3A 3QDJD 5GRJL 4TLTA 4LVNC 1URLA 3T77B 1HQ4A 4R4NC 4XCFH 4QYAA 5D7IB 1PZAA 2E7LA 1FH5L 1PEWA 3GRWH 5E2VH 2AJVH 3SD5A 3NCYP 2VKXA 1LDPL 4JRFA 5I1CH 1U41A 1YNKH 1ODAA 2MPVA 4QTIL 1FFTB 1GGUA 5DHVH 4Y4HC 3OX8A 3SYQA 1GTNA 4LLWA 2DWEA 5CP7A 1P7QB 1KXVA 4GKSB 2ZG1A 3BGMA 5F1NB 3GBNL 5JIQA 4QXWA 1JMZA 2JE8A 2APXA 2PF6A 3L3HA 3IDNA 1RURL 3ZZLA 4Z7UA 2UV3A 5IUCA 1EGJH 5AOLA 1FORH 3BEWA 4X7CC 2DM7A 3AQDA 3BT0A 4PJ5D 4NKIH 1RSYA 4G6MH 2Q6WA 3IM1A 4PS8A 1RIUL 4P5KB 4OZIA 3MR9B 2ZAGA 1AC0A 3H9SE 3OR6A 4CSTA 2BFGA 4FI6A 3O6ML 1E8ZA 4ZK8A 2X9XA 5C9JB 3JV6B 5F3BB 3FDWA 1S9WB 1ZVSB 2K7QA 4K3EL 3F7VB 5IBLD 5J13B 2GT9B 5J56B 1W91A 2F15A 1KLGA 2AQ2A 3C5ZD 5F21B 1OP5H 4G7YH 5D1ZA 4UB0H 2FD6L 4WK4B 4PI2A 1U8PA 3WFCL 5CCGE 4ZNEA 1F42A 4H0LC 3DURB 3V4VH 5EH1A 1KXTB 3NZSA 4HF5L 4JHAL 5B8CB 1M7DB 2R1YB 4KK5D 4FX5A 3BT2L 6PAZA 3LZRA 4NZJA 1QTYT 4WENB 4AW4A 3BH9A 3QFJE 3UBXG 3FO2A 3D4CA 1S7SA 4Q9RH 4HEME 2UYLB 4P2AA 1ZKAA 1U6AL 3VXSA 4AYEC 1CF8L 3RI5F 2YD2A 1CICA 3NUKA 1RZ8B 2IQ9L 4XPHL 4CVUA 4HSCX 5HYJE 3BUDA 4N28A 4HKZB 3RDTB 1VADA 1WZ1H 3EOTL 4U1MA 5HJGA 5IIEB 4N8CL 4CKQA 3FB6B 1HVXA 3EFOA 3UAEA 4LCYB 2R4RH 4L8SB 3ZSSA 3LXCA 1TJIH 3BWAA 3QIBD 4XP6H 3W39A 3FQUB 2J6WA 4PJXA 2CDFB 3WBDA 3BJ91 2VRKA 4FQLH 1KC5H 3EBHA 3L9RB 2LU7A 5MEPA 4LCWD 4LSQL 4H26A 3QUZA 1ZHNA 1AO7E 1KB5B 2BS71 4KWUA 4UMSA 3MRMB 2P9RA 1QFPA 5E8PB 3AWEA 2EH7H 3QDJE 2PTTA 3BUQA 5GJTL 5EBLB 3OM3B 2A9NL 3REWB 4D0CB 2ITDB 2KHAA 4RIRB 3H9YA 3HE7B 5CCJA 4TPRH 1G7HB 2CBTA 1KY7A 2XWZA 1ETJA 5EIQA 3FQNB 2YHGA 3UTTB 5KS9A 1HOCB 3L81A 4YNYA 4IMLA 1NEPA 2V0AA 2VLJB 5CSBA 2ZKHL 4JPVH 2CHXA 5FHAL 5E9DD 3WJMA 3P4OB 4GRMB 3ARDD 2CDEA 2DQFB 2V5TA 4FP8L 2VUKA 4XWOD 4YPJA 3T3PB 1RZFL 3OKNB 5DT1L 4X6DE 5E5MB 1N59A 2LR4A 4F8TA 3FQYA 1Z9MA 4BE6A 4PJ5E 4EUPB 1GJUA 3DC0A 4Q56A 3H3KA 4IKLA 5C0DA 2F7IA 4B6ZA 5TD4A 3QXDB 1I53A 2XA8H 1U3HB 4YWGH 2EO1A 3FHEA 4JRXB 3KR3L 5CU5A 1O5DT 4P3CH 5CJOL 4ZUUB 5HGHA 2ICEA 2MCPL 4GY4A 1X4XA 1GAFL 4UM9D 5DD1L 4TUKH 2VDKH 2FX8H 2IFFH 3HAEG 1T7VA 2OXHB 5KG9B 4CGUB 1OPGH 4ODTL 5HHOE 4LRNL 1U8CB 4PJ8C 1G9NL 3MCG1 1S7WB 2ITFA 4KNSA 3DOIA 4Z3HA 1NLDL 3FYEB 1QP1A 1WS7A 3QZWB 2V2TA 4GP5B 2V5MA 5DJYB 5A2JH 4JVPA 3UAFA 3KWTA 1V55B 2RALA 4DN4H 2WLIA 1EO8H 4XMKH 2AABL 3IJ9A 1LE5A 3IVKB 2IAMB 4HDIA 4JPIA 3L9YA 3O45A 4JGJA 4YC2C 4ZBJA 3R7RA 2VDQL 2DEWX 5F7NC 1UOWA 1GA2A 4CVZA 3CFTA 3MGAA 1DZ0A 3Q8EA 1SJHB 2JSFA 4E9RA 4FA7B 1LMKA 3KEHA 3CPLA 4FNLL 2ZWKA 3OZLA 5IQLA 2OMUA 5CHNB 3GMMA 2NXZD 1WDAA 5F0MB 4YHML 2DQGL 1L9QA 5ADOH 4XO4A 3IJSA 4EO5A 1L3WA 4C59B 1NCBH 3L3GA 4PRAA 5D70L 5IHUL 3MLWL 1F5WA 2OX5A 5E2WL 2TSAA 4WHTB 4PS7A 4BWWA 4CN4A 4WUKH 1DUYB 5GS0H 3T0VA 2EDOA 2XV3A 2XZAL 4LLWB 2DWEB 2OA9A 4MZ2A 3PABA 2WXGA 4X6BB 5CLZA 5EF0A 4Z95H 3DYOA 3IPEA 3HFFA 3IFOB 1ED3A 2XRAH 1CFQB 2D7TL 2GJ6B 4O2EB 4ORGA 1CVSC 5DMJB 4AGOA 4XZUA 4XCNB 3RTQC 4QHUA 2HJFB 2BIHA 4LCWE 2VO8A 1BX2B 1BWWA 3GSQA 1R47A 5IMLB 2ZCHL 1A6UH 2H9GA 4OZFA 1H5BC 4RFOL 5CGYC 3PHQA 5DZJA 1KPUA 3ZUCA 5D55A 1UT2A 1ZS8A 3FT9A 3SE6A 3RWGB 3V5KA 5H8DA 2I9LB 5GISL 4G8EB 3T0AA 2F53D 4KO6A 4ZMAT 1SMDA 2YAHA 3GO1H 1AAJA 4IRSC 5BVPL 2R0ZH 5E9DE 5LBSA 3OV6A 1UEYA 1G1YA 1EXUB 1GTFA 1T3FB 1DQTA 2Y9RT 5E6RB 5GGQH 4EDWL 2EKSA 3JWNC 1HEJC 5LHDA 5KJRL 5H35A 1CE6B 3TLRA 2VXVH 3EHBC 5DR5L 3F58H 3GEFA 2NYKA 3ZGHA 2GAZB 2FO8A 5E6ZA 4AG4L 2QZ5A 3ZU8A 3L3IB 2EYSB 3RFZC 4F2MA 1JK8A 1KJ2A 1JIBA 1SFHA 1S9VA 2D8KA 2JKSA 3V4UH 1DVQA 1BQHA 1F97A 1YMHB 5BZWB 3WIFA 4M62H 2EECA 3L4WA 1T2QH 4ZFOL 3TF7C 5F7EH 5C0BB 1OWWA 4KKZA 4Z9KB 5FA3A 1IAMA 4B9PA 3D2TA 2NYYC 2XTSA 4NZRL 4ZX5A 2ZNXA 5ERWA 2NXYD 4YDIL 1KB5H 1L7IH 1Q9LB 1RK0B 1VIWA 3D52A 2WBWB 4JY6B 4UTBL 1LLAA 3SQOH 3FULA 3MBED 4QGYA 3S35X 1MI5A 1ND0A 4F15C 1AKPA 4QRAA 3S3DB 1M53A 1YCSA 4DOHB 5JHDA 3LIZH 1S2EA 4HC1L 3WXVH 3SPGA 3FUDA 1DQJA 4PY7B 5G2NA 4NQEA 4TRPL 1NOLA 1F2QA 1AHMA 5DZVA 1FZOB 3H2QA 5IEHB 4AL8H 3QUZB 1ZHNB 4PH8A 1AD0A 3ATFA 1GSMA 3NRFA 2ZUUA 4O58H 1SVBA 4GRLA 3AMLA 4NQXB 3MRCB 1QBLH 2BDNL 4EUPH 2CKBH 3FT4B 4O2FB 4O5LH 3ARXA 3VSQA 3H0TA 1GRWA 3W0WB 4Q7DA 3BPNB 2QFRA 1I31A 5DFWH 1EMTH 3S37H 1HE8A 1EUTA 2PXYD 1IAIM 2AEWA 2ORBH 3ABGA 4MJ6A 4U2ZA 4P23C 4UNIA 3RGVD 1LEIB 4YS4A 3MMEA 4WV1A 1PNCA 5IFHL 1P5UC 3L2NA 1Z32X 6FABL 1FAIH 2PN5A 3UBHA 1IV8A 4H40A 1P0SE 3BKJH 3MV9B 4P4KD 2PO6D 2WWMC 2ATPB 3QJTB 4X7SL 4AVJA 4B9IA 2FHCA 4EF3A 3ROLB 1XDTT 4NRXA 2L7JA 5T3XL 2F53E 4YBHA 5C0CB 2OZ4A 2J2ZA 3CX5J 2YUZA 3F7QA 2FO4A 3KVDD 3MV8D 3RA7H 3KGRA 1G0DA 1VLXA 3U4BL 4RGNB 4ZSOE 3OGOE 5KSUB 4JQVA 4PJHB 5HJ3A 9PCYA 2VQ4A 3DK0A 4TNVF 1IBYA 4ZOEA 5T1JA 5CJQH 3VH8G 2V2TB 4QHLB 4IOIA 1EBAA 3UBGA 1S5HA 5KYYB 1BEXA 3KVQA 1OLZA 4MXWL 2WTOA 4HKXA 3GSRA 3MA9L 3VSUA 5LBGA 1OGTB 4XMZA 4KJQD 1WQVT 4KK8D 4HOXA 4H0IA 2ID5A 2HLAA 4HUXA 3GSUA 5IVXE 3BW9B 5INCA 5HYQB 4YZWA 2JWYA 4AIEA 2C9QA 3QI9D 4AITA 1YEHL 3BQVA 4GS7C 4BCYA 1IRAY 1BF2A 1QNZH 3IU3B 4DGYH 2Z34A 2WLJA 3MODL 5ICZB 1AMXA 4FQ2L 4JE0A 5KANG 4XVUD 3L3GB 2C7FA 3GMLB 5EZLB 2NY1B 5CWSB 4R5TA 1RK7A 3TIEB 2Q2LA 4WI2A 3NH7H 1M2VA 4DKDC 4RVBA 1AZCA 5DO2C 2M1KA 5E1QA 1IEBB 3LKOA 3PABB 4U49A 4W4NA 1LK2B 4OKVB 3WFZA 1KIUA 4U6VH 5SWSD 3HE6A 4XC1L 3QR0A 1DBML 2DQHL 3C5XA 5C08B 3WLBB 1KPRA 2VLME 4J12A 3QIUA 3RTLA 4RRPG 4R2GC 1NUGA 1IC5L 3FB7B 4NZTH 5DZOA 1UD2A 3TJPA 5C0FB 2P47B 5E03A 1ZGLM 5CJ8A 3SZ6A 5DJAA 1A4BA 4K9EC 3V52L 1MAKA 4Z7VB 5I1KL 1JWMA 2H6PB 3KPPB 4R7DA 1SDDA 2IBZX 4FJ6A 3AXLB 3TH3T 4DO6A 2VSMB 1M7XA 2VZ3A 3JVGC 1AGBA 2KLRA 3AW5A 5IEKA 2EDXA 1GKEA 2WW8A 1SLWA 3WYRA 2F54B 2JIXD 4Z0XA 1DQLH 4K07A 5DZPA 2ARJB 3STZA 4DKEH 3RPBA 3KBHE 4HWBL 1BJ1J 4P2QB 2DTML 2FSEA 1A7QL 5AALA 4QF1B 5J13C 2OMTA 2WBJD 1BAWA 4MA1B 3MLSL 3AU1A 3K71A 2WD0A 3C6EA 2WXNA 1J8RA 1P7KB 1O7VA 2GI7A 2KDYA 1JPST 4HZLB 2YAMA 5FW6A 5JHMA 2GCYB 1YAIA 4E0RA 1MJ7H 4OCYL 5JZ7D 1TMQA 4IMKC 4YMPA 4AQ1C 5JW5A 1J0IA 1W16A 4WCYL 5SV3A 1GS6X 1KCSL 1W8NA 2VAJA 3F7KA 3O2DH 4JDVB 4NIYE 2B15A 1HK6A 5I0DA 3HHSA 2BNQD 2NY5C 4DEPB 5IZ7A 2WJ5A 1IAII 2DYPB 2PCFA 2VM4A 2ZSVB 3ZE0E 2IH3A 5J4MA 4A7GF 4I4WA 3RDTC 4ZZFA 2FDBP 3D69A 1DQJB 3DXAA 3ZK0A 3MNDA 4L8SC 3OKEA 3FQRB 1I1AC 1YNLH 4LXFA 3VXMA 4JFHD 3WN5B 5FLUA 2EYTA 2IO5A 4YHPB 4F33A 1IEHA 4RH4A 5AENA 5DJZB 2BSCA 5GZND 1AC6A 4C56D 1A65A 3WSQH 3D08A 5IMOB 4G83A 4M9PA 1GGCL 2SEBA 3VD1A 3H0TB 4NQVB 3KYMA 5AZ2H 2XVLA 2FEDD 1BGXL 5EOQL 3HE7C 3SGEH 4NZUL 3CNKA 5DJCB 5EF2A 4TQEL 4ERSH 2B3IA 3NSFA 3TBCA 2IF7A 4U1NA 4JK0D 5SWSE 5C0RH 3B9KC 3HBQA 4NO3B 1JG9A 2EDRA 2X7LA 4KJPD 3VGHA 1B0IA 1CBVL 4LEOA 4TVPH 3MLUL 4GBXD 3TL5A 3WS6A 3HEIB 3F7LA 4GW1A 5FUZL 3CTTA 4TTDC 4FXKC 3BVVA 4DVRL 4Z76A 1C5BL 3M1BA 3VD5A 1S9XA 3EH3B 1FIEA 4E41B 3G5VA 4HBCL 1JNHA 4NRXB 4AXWB 2PW1A 2RQEA 2MCAA 3N06B 1A8JH 4L8BA 4K2UL 3BDYL 2Y5TA 1V7NH 1WT5A 3MNZA 3AY4A 4XNUH 4XP9L 3SOTA 4K7FB 2R0KL 1V5JA 5F7DB 1OAJA 2XIIA 4U1HA 4GXVL 1A66A 1TFHA 3ZMNA 3SIKA 1KTCA 3L3OC 1X7QA 5ANMB 2YGQA 4WQOA 4L3AA 2I9TA 2QGCA 2X4OB 3QUXC 4AYMC 1Q0XL 5BRPA 1BAFH 2VXTL 3QJSB 4F7PB 4MAYB 4N2LA 5K1VA 5T1MB 4J3BA 1BBJA 2HLAB 1Q72H 2B1OA 4AMKL 5DURD 2BRQA 4NT6A 5HY9A 3BLPX 4FTDA 5INCB 1MFCH 1GY2A 4PJGF 2X6VA 1PDKB 3G6JB 1J12A 5AZEL 2KZWA 3RUGA 3EBGA 1WGOA 4W9CC 1JZ8A 3I84A 2IIJA 3WO4C 3HLKA 3CHXA 5HGAB 3S36L 2EP6A 2H3XC 3HN8A 4JZJB 1RZIA 1GCFA 2BNQE 2R51A 3EGDA 4LMQI 4UT6A 4BUGA 2E7LC 1XR9A 3Q8BA 4FQJH 4ZNCD 1I9RL 3FUEA 3KWVA 3OKLB 4Z5RB 4G8AC 3FXIC 3VQ1C 6PCYA 4AV4A 2ESVA 4LSSH 4X83A 2KERA 5AW0B 1KXVC 4NYLA 5EC2A 2YPLB 3KBPA 2A77H 1FG9C 2B4CH 2QADC 2ENPA 4JJOA 1NCTA 2VABB 4IJ3B 3EXLA 3W9DA 4FNSA 4PWKA 4YFLI 4KVCL 3QJQB 2KMWA 1NEZA 4OV6F 4YPGA 2IAND 4JKPL 2XWBB 2GVYA 3LKPA 4JREB 4C56E 2BSEA 4MA8H 2JKIS 4ECNA 5JA8B 1IBFA 4ZMVA 3MGTB 4GFXA 4DSYA 5C07A 4YK4B 2XFXB 4G42A 5IEKB 1WFIA 4UT7L 3J27A 1IGTB 4I5BA 1EFXB 3QRLA 3CDZA 1NBCA 5EUOA 1TZGL 3DRTA 2WGXA 5KSAA 1NFDF 1I9IH 1K2DB 3LH9A 1N64L 2ZOLB 2ZXCA 3T8XB 4NERA 2V2WB 4I0PA 1BVNT 1GYUA 5DD5H 1NL0L 3H2PA 5AVWB 2DQEL 2F2HA 1NC2A 5T1LD 4NS0A 5D1ZC 2Y07H 5J8OA 4WHYH 3S97C 4JFQB 1YC8A 3I9GL 2GIMA 2G5BB 5KVDE 4WSGA 2P5EB 4KK9C 3RVWC 3QPKA 1A47A 1KPVA 1T66D 1QLFB 4G1MB 4ZPVA 4HK0B 5FYKD 1KBKA 2C7UB 4XX1G 4YSQA 2Y1VA 1J8HB 3DUSB 4PJ7A 5I1IH 3PL6B 4A2FA 1CGSL 3KGUA 4N86A 4N5UA 4DO5A 1YEJH 2HA1A 1AQKH 1X5XA 2LGNA 1ZXKA 1OANA 5CEYA 4Z7OB 3G6AB 5E8DH 5AUMA 4QRRA 3ULUC 5G5DB 3KPNB 2OMZB 4IRJD 2X3AA 4LNVA 4W9IC 4I4WB 5FFLA 4QY8A 3OAYK 4LLDA 1A7OL 1OTUC 3QUMA 3QPXL 2GITA 5KS9F 5EU7C 5GRJH 4XC3H 3OKEB 2X4UA 3G04A 4L37A 5BRZD 1A6PA 4L9DA 4HLJA 4Y5YA 5GGSY 4ENED 2J56A 4JZNB 3O8XD 2FWOA 4FTVA 3VNZA 3PP3K 2AXFB 3GLEA 5DMGC 1BVNP 2OCCB 4FC3E 2VDQB 4K23H 3QUZC 5DHYA 3WLWD 5F8QC 3I02A 5F7MC 2NY6B 1TJGL 2XN9E 1OP3K 1NZRA 4R9HA 5BJTA 1II4E 2QDVA 1X9QA 3PXJA 2VMDA 3KLDA 4JFED 2AJXL 2XN2A 4M8VA 5FK9A 4PLJD 4JFXB 3GMQB 4KTYA 5AW5B 1WF5A 1WWCA 1TU2B 1NCIA 3PWLA 4XOAA 1QATA 3L2LA 3ECQA 1NMCC 2EJ1A 3W37A 2DQCH 3ILPA 2Y7MA 3WJLA 1ZGLA 4UDTB 2YQ3A 1RIUH 2WLNA 3IMWA 4N3UA 3X2QB 3BP7A 2NZ1A 5AQ0A 1NFDE 3WFDH 2WK2A 2E0PA 2IANE 3ASWA 3I6GB 2L7EA 3M1BB 4NI6A 1THCA 5CP3H 2K1MA 3KEDA 3M86A 1KUMA 2FJFB 3O6MH 4OD1L 4XHQA 4FYTA 4DP4X 1WEJL 2XV6B 2Q20A 1MCJA 2QKSA 5A43C 5M95B 4QRPD 1TZHA 3BRDA 4ZTPL 5FO2A 2ZF8A 5ECGA 3UG5A 2ICEC 4IQHA 4GSDL 4C55A 2H32B 1FVDA 4NQCB 4HJGB 4QXTA 5FO8B 2DQ6A 4HWEL 1L9MA 1K5NB 4YGVA 3ZQXA 3GMRA 3DETC 5DRXB 1FDLH 4NC1C 4GFTB 2BVPB 4RGNC 4A2HA 1JGVL 4KKCD 3PE9A 4S1RL 1D5ZB 1NSNH 2VDRH 4BDVA 1RPKA 2VH5L 1RUKH 4YSEA 3SE4A 5FWRA 4HF5H 4JHAH 3FBKA 3WIHL 1WBXA 3HFML 2LTQB 3NSXA 3WTWA 4XOCA 4IKJA 4IOSD 4X6CB 1CZ8L 3HA0A 3SE9H 3VAEA 2CIIB 4NPYB 3QS3A 4YR6B 4LAQL 3C6LB 2L0DA 3HI1A 5CLWA 2K4AA 3MZGB 3NMEA 5I5RA 5IF0A 3REVA 1U6AH 1CF8H 5BVJB 4POZD 4NRYA 2IV9A 1FNEA 5FYKE 1ILSA 3SYOA 4I77L 1LEKB 5IOPA 3I3EA 2DI7A 5J1AA 5HYSB 3FS9A 2HRHA 1S9YA 4JHBA 4BRJA 1EA9C 1T4WA 4PJDB 2EEFA 4N8CH 4EMZA 3S8GB 4ZFOB 4KVNL 4OFYA 3RZCB 4LL1A 4OV5B 2NY2C 3MRDA 2DRUA 5TDPB 4HK3J 4KFMA 1JYWA 3H9HB 3GJFA 2NY1C 4YSTA 5JOPD 4LT7A 4YBLB 3BD4A 5EU5B 1JXGA 2A0LD 3X13B 4LSQH 3ARGA 3QNYA 4B7LA 4RFEA 4NYLB 3RNKA 3JUYA 5BRZE 2G3ZA 5JPMB 2P45B 3FU7B 4DGUA 3L1GA 4OGZA 2W38A 1F6FB 3U30B 4H8WL 3FYIB 5TH2A 1KZYA 4YPGB 3QJVB 2OTUA 3MC0A 2DI8A 4S1DD 3U9UA 3FSOA 1BBDL 4GKOA 5FHAH 2KLSA 1ZJBA 4PJCF 1IAOA 2UXVA 2R56L 4GQPH 3HG5A 4JFEE 1AVAA 5C07B 5HHXL 3I9AA 1RZFH 3RKPA 2H2PC 4C4KO 2F5AL 2J25A 3DWTA 3ZSTA 1EBPA 3GRWA 4HIHA 1LP9F 2EXTA 3TFBA 2WM0A 1SY6L 5KSBB 5TE7H 2IGFL 1ZLEA 3OMIB 1DVSA 3ZKNC 3CIQA 1RZPA 3O0RH 1OD9A 2E9JA 1QSFB 2XJLA 1H8NA 5H2BA 1TF4A 3BP4A 5DD1H 1NQBA 1B0RA 1KV3A 1WP6A 2VITB 3FB5B 1ZTXE 3H3PH 4F27A 4ODTH 4AEEA 4YHNB 1Y0LB 1G9NH 3WFEH 4YXKL 3S4SA 3Q6GL 2CH8A 4X9YA 2F58L 2LAAA 1FBIL 1R5WB 5ALBL 3MNWA 4F7TA 4ZPVB 1C12B 4F1ZA 4JN2B 3WI9A 4R4BA 1X6NA 3KS0H 4QRSA 3EH2A 4H5SA 2Q2EB 1WBYA 1Z9NA 4QDGA 5JIPA 4M1DL 4KZDL 3L4ZA 4P04A 5CXPA 5KVEL 3O3EA 3PAUA 4BKLB 3X1GA 2ERJB 2VDQH 1U2CA 4WEBH 4W93A 2J8UB 3BEVB 1F4AA 4KFZC 3LEXB 4FRWA 1PEZA 1JJUA 1Q0EA 3NK4A 3TIDA 2VERN 1DSFL 3KJ6L 4YHMH 3WEXB 5KYWB 4OGQC 1MFEL 2X4UB 3G04B 4B9FA 4BZ2L 3QZPA 1LDSA 3MA7A 5E5UB 1D5XA 5D70H 3QXAB 5HGDA 3GMOB 5C09B 3MLWH 3NIDF 3SB3A 3LKSA 1PL3A 4BQ8A 2OCFD 3Q8FA 4R97C 3FFDA 1P4UA 4J23A 5FFOA 4ISVB 2XZAH 3QGVA 3DPBA 4NKDB 4HJ0D 4HLZG 2VKWA 3UZVA 1IL1B 4XCYA 4YDVB 3D39D 4AQ8A 4J3OH 5JOPE 1KWGA 3K8MA 1A7RL 5FLVA 3T6ZA 4PJCE 2B08A 3ULSA 5ICYA 2VGLM 4MVBD 1FO0H 4ZW8A 3L3DA 4DAGL 1IT9H 2ZCHH 3CMOL 2EKJA 2Y69B 2NQDA 2H32H 3BFOA 3MTXA 2G60L 2NX5B 4S2SB 3VCLB 4WJ5B 1AIFB 3RWIB 1BZDA 4WV1C 2PLTA 5IK3B 2ZUSA 5GISH 1UA7A 4LQ1A 3O3AB 1A64A 3V0DA 4PREA 3LSOA 4Y1AB 2AJYL 3WHE0 3RL1A 1BD2E 2CK0L 2H41A 5F1KC 1I3UA 3A22A 4APQB 3SBWC 2XETA 3J07A 1GH7A 2WUBL 5LAPA 4EDXA 1AE6L 3RWHA 3MXVL 2WOYA 2UY7A 5ESVB 3ECBA 1AD9B 4XX1E 2LVEA 5AKRA 1OWRM 3VUAA 2YXMA 1M1SA 5TE6L 4YGVB 1P1ZA 3GMRB 2MFNA 4AKOA 4L48A 1MHHA 1NBZA 5EEXA 2MNUA 2WNXA 3OLEA 4XT1C 1ZSHA 3UDWA 4JQIA 4N8VG 4X80L 4A68A 3DSNA 1MUJA 2BSDA 4HMEA 4BYHA 2FHFA 1IO4C 3MGOA 1NBYA 4I2XA 4PSPA 3HI5L 4XMPL 4H88L 1JN6A 5IJCC 1YY9C 4MAUL 2RACA 2FH6A 4AKPA 1Y6KR 2GSGA 3RJQB 1LTXA 3B2VL 2UZIL 3BPOB 3REVB 1L9SA 2RJMA 4HUUB 3EIFA 4NZRH 3RFRA 2NLJA 5SX4I 4YDIH 1ERNA 5ENWB 3MBWA 5H94B 1FSKC 3FO0L 4PV8A 2BOCA 3VI4B 1DDHB 1GMIA 1MQKL 1PYWA 3NIDE 2VL4A 3VTTA 3VXUE 2Y7OA 5HD8D 4AYBA 1NC4D 4PJFB 3ZHDA 1QNIA 4WU5A 2FJSA 5IJKA 1T6WA 3RWDA 3B8SA 4JZJC 2AVFA 5DJ8A 2ROYA 4QPEA 1PX3A 5E8NB 4GP8B 4TRPH 2CO3A 4GQRA 1MVYA 4ZMNA 3VXRB 3QORA 4BA8A 1BG1A 1EHNA 4LDLB 4KQ4H 3HLAA 3N85L 2JJUA 4IW4C 5MEND 2FNBA 3DVNA 2N0KA 2CBQA 3QRBA 3HE6C 3BE1L 1SLXA 2OKMA 4AJWA 5TH2B 1BECA 5C3IA 5A6IA 3TT1L 3OHXB 3L8QA 4PGEB 3EYSH 1WVZA 3RVXD 3QIUC 3QE5A 4U1KA 5I19L 3GUTB 1A4JB 1DQDH 1N0XL 3IETB 4PG9B 2RTTA 2AEQL 1XGRB 1ZLDA 5F44A 4HGMA 1U8LB 5I23A 1OD7A 3OJVC 4G8GA 3QQ3B 3DV6A 4Y4FA 4QKXB 4NNYA 3ESUF 4G8FA 4S0HA 1DL7L 3QCTL 4YSPA 5C0AB 2CLZB 2P8PB 3OMAB 1A5FH 4PBWD 5D1QB 5IFHH 4YK4C 1D5IL 3F6LA 4G7SB 3NRQA 2N4IA 4HCGA 1G7LB 1C1EH 2ZT9C 1IKFH 2WTRA 5K9KB 1U91A 4MMXA 2PUQT 4M5YL 1VESA 4X7SH 3DHPA 1BOYA 3T4YB 2FZ3A 3DVFA 4FXGA 4UQ3A 1IZJA 3MRRA 5D2LA 3BAWA 4GAYB 4D9RD 1UJTA 3ZE2B 1FZMB 1IC1A 2LLLA 3KHOA 2Z9TA 2BNRD 2AK4E 3U4BH 4HX1A 4LHUB 3MNVB 5DXWA 4LSVL 1U3ZA 2OMYA 1E9OB 2ENYA 4HCIA 2RGSA 4FD0A 2YGNA 4UM8B 3N1PC 4QRSB 2DMHA 2WP3O 1KGXA 2WCSA 4PV9B 4X5QA 3ZXAC 1FVEB 2BSTA 2VZOA 4PBXA 4KVPA 3IPFA 1XAKA 1U92A 2WLLA 4BFEA 2DD8L 3N43B 2OMVB 2VE6A 4ODBD 4MDIB 4X98A 1N9PA 3D0VA 1YEHH 3MRGB 3MDJA 3B1UA 4KV5F 3LRMA 2UWEA 3MODH 4PTTB 4WEEA 4TOYH 4FQ2H 3EOBA 3HS9A 1UCTA 3VNYA 3W82A 4Z3TA 2Y6TE 5DHEA 5ISZB 1N6UA 5EB9A 5HGDB 3OPZH 3WAJA 3WTTA 1R33A 3NIFB 4LCUB 4NQDB 5LCVL 2HMID 5KSVB 1RJZA 1VACB 3NEXA 3T0DA 2CUIA 3EOAB 4H8QA 3T09A 4JM2A 2BVEA 2BM3A 2Q8BH 4YDJA 3VMNA 4E9WA 4WNQA 4IBZA 4TTGA 3TJHD 3FUKA 2V9RA 5DS2A 2B1HL 3U25A 3BZFA 4XC1H 3EJSA 3GBLA 4OI8A 3CZNA 3ZO9A 1S7XA 1NIAA 2CM5A 4HW6A 5EO9A 1DSWA 4WO4A 1N8ZA 1X5MA 4F57L 3EKCA 3OKMA 5F96L 5GJSL 2X2JA 5MENE 1T20A 1IC5H 4WI0B 5BO1H 4X4KA 3LIZA 3MU3A 1CL7L 1E2ZA 5ANHA 5AVZB 3L5WA 1KG0A 2NUPA 1LQBC 3WS6C 2R0LL 3B2MA 5J0BA 3RHWK 4PRDB 3VFNB 3P0YL 1JZ3A 4B96A 2ZX8A 4RMWA 2A9DA 1IAKB 4JFFA 4QCIA 5IESL 5SX5K 4AJ0A 2I5YL 1RUPH 1NFIB 4N90E 3QUYD 4HS6A 1LO3L 2CKBA 4ALAH 1FHNA 4HWBH 3WJJA 1Y6MR 1HSAA 2YWZA 3GSVB 2YC1A 1EZVY 2F8VA 5I6XC 1U8OB 1A7QH 1P1ZB 1WT5C 2J73A 4R4ND 5C70A 2FTAA 3AY4C 5AD0B 1XCTB 3MYJB 4F58L 1ZAGA 4GUQA 1OAUH 5E1IA 1SXBA 5IVZB 2B7DT 5BV7C 1JXFA 1HCFX 5KYXB 2VL5B 3EJUA 1OSEA 2WUCL 5HXMA 5CN2A 4RMSA 4D9RE 4LIQL 1Z9OA 5EIIB 5AG9A 4Y2OA 3HNSL 4I2XB 2MWCA 3V7MA 1TPXB 3VRIA 3HPLA 4PBVC 4UTCA 4LCCA 2VN7A 2ZG3A 1MVUA 5C0JB 1UZ8A 3ARBA 1QR4A 3X3FL 5AAMA 2X4SA 2OI9C 5CNHA 1MRDH 2BLFA 3V79C 3QIWB 2X4PA 1GOHA 1T6BX 2HKAA 3IFPA 1QHPA 1A9EA 5HTSA 3ESNA 4L8DB 3FU9A 2Y24A 1HXYB 5AKTA 1E5BA 1HHHA 3WGUB 2J6EA 2YSSB 4QRTB 4QNPF 4GI8A 3V5HA 1KNOA 4F7EA 4LLVB 3QEUA 3CN0A 4XHJD 2K6WA 2MQ3A 1N0LB 4NHCL 1LD9B 3COOA 4PHXA 3W1ZA 4NN7B 1XH3A 3D9AH 1E2WA 4YBLC 1RD6A 2H47C 3PWVA 5EOCJ 4Y88A 4N2FA 3CQPA 1I3VA 4BE5A 3LOWA 3EBAA 4I0KA 3NQKA 1N2RB 4E2OA 5IQ7H 3OJDB 1T1YB 3LB6C 1FFPA 4E9VA 4FFZA 1QO3B 5KVGL 3EJRA 3U30C 3QJHB 5I74B 1M9WA 2D3LA 1BGXH 4A6YL 4L5FL 4YQXL 4LF3A 2QMKA 2OZNA 4CBZA 3KPRA 4H1LH 3DV4B 4G8GB 2Z31A 4Y4FB 5EZJA 2HH0H 3CSYB 2C1PB 3VVVA 1CBVH 1XIWD 1L9PA 3T2NL 3C12A 4IIZA 3CE1A 2F18A 4JFUA 2W95A 4P4RB 2VR3A 4KXZI 1T04B 2BXYA 2R83A 1NAMA 1VFAA 3S4SG 5KSAC 1U8JB 1UQSA 4A04A 1UWXK 4FQQA 3VJ6A 1WCQA 4UQ3B 2NW2A 1HT6A 3X3GL 4F37K 5C2UB 1KCUL 4JPKL 4K2UH 3UERA 2OV0A 5HHQB 3DTXA 4ZOCA 4I0PC 5KN5B 4KMTL 4JZOB 4N0CD 4XP4H 5F93C 2H0FA 1UCBL 5DZLA 2G4EA 3KPSD 3N0AA 1HNFA 2WMPB 4BXVA 1KT2A 1HNGA 1TMCB 2R0KH 2VWEC 3CFIC 3P9MA 1DLHB 1H0DA 5DRZA 5IUSA 4FOMA 4G2AA 2DMKA 4LVOC 5DEJA 3QAQA 4JY4A 2J1XA 4BZ1L 4F9LA 3ZYIA 1Q0XH 2R23B 2VN4A 1OXYA 1X5HA 2EDHA 2VXTH 3U2SB 4K71B 3PP4L 3IGKA 4V33A 3HG1B 4OLWL 5DC4B 1JD9A 1OGAA 4U1JA 5ADPH 4AMKH 1U92B 5GS3A 3VI3B 3VWKB 4WWOA 1WO2A 3CFCL 1HHGB 2APVA 4GAAA 4ELME 2XNAB 2VXUL 2JKXA 5HDLA 1BM3L 3MJ9L 1VB9A 3B7TA 1G84A 4FLQA 2R27A 3PWJA 2HJLB 4KHTH 3U6RB 3EDDA 2I26N 3S36H 4QXGH 4X8XA 5EUKA 5HHNA 2FVNA 4WZ9A 1QLRB 4F2EA 5I73B 3QDGB 3Q43A 4BV1A 1I9RH 3GS0A 4H20L 3VW3L 4X7TA 3VRJA 4WW2F 3DSFL 2ICWI 2P42B 1Q9WB 4PJ8D 3MLVL 2MTAA 5DYFA 1H9VA 4J8RA 4KPHL 4L3CA 2DW5A 3SPCA 2XBTA 1OCWL 1SXCA 3OKMB 4A7SA 3WIAA 4KVCH 1DVYA 4MXQC 5I8CB 4E9YA 4JKPH 2YMTA 4PW4A 1AKJA 1F58L 2VDNL 4IBQA 1M3IA 4QHKI 4YHLL 3WJLC 4YFEA 1LK3L 3INUH 2VM3A 1KG0B 3V4LA 2ZP9A 4IKNA 2A9BA 1QLEH 4FQXD 3Q1SL 3UC2A 4UT7H 1HKLL 2CXKA 2AMGA 3M17A 1RZJL 5TE4L 5LGKA 1QSVA 4EN3A 1XL6A 4OW6A 3VD7A 4HS6B 2XG4A 1X9UA 2WIMA 1E28B 3NEEA 4APQC 4PFEA 4PVMA 3BXNB 3U46B 2JCCB 2ZXEB 3VGDA 2BOBB 1O75A 4JVUA 1NGZA 5GHWL 3BMWA 2X6UA 2XPYA 1NL0H 1UENA 5CBEA 4XPBH 2CG9X 3VFMB 4HS3B 3P30L 1NGXB 3X1BA 3CVIL 3L7EA 4PU2A 2HJKA 3TONA 3WTYA 3Q9PA 1MCSA 3I9GH 3O3BB 4NKMB 2Z92B 3OAYH 4XCCH 5I1AA 2W91A 3FOLB 1UWYA 5E7BA 1MCHA 3SE4C 2FR4A 4PGZA 4FZ8H 4G72B 3RTQD 1M05A 1C8QA 1CYXA 2WXHA 1CU4L 2R39A 1THAA 2JKWA 5LGJB 4OZHA 3CZEA 3QXTA 3PWPB 1VERA 3AS2A 3TNNA 2XWTB 4P3DA 4B41A 1NA8A 4O2CA 3CJJA