3ZTCC

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
141
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 37
structure length 141
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3ztcC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3ztcC01
4W9EC 4W9GC 4BKSC 3ZTDC 4W9LC 4B9KC 4W9JC 4W9FC 3ZTCC 4AWJC 4B95C 3ZRFC 4AJYV 3ZRCC 5LLIC 4W9CC 4BKTC 3ZUNC 4W9IC 1LM8V 4W9DC 4W9HC 4W9KC 1LQBC 1VCBC 4WQOA
chains in the Genus database with same CATH superfamily
2BRRL 2EDKA 3TCLA 4AJ0A 5C0FB 2OPCA 3WAJA 2E86A 2YSSB 3QIUC 5C0DA 1ET8A 1G9NH 2DIAA 4DVRH 2E4TA 4E68A 5J11C 3KPOB 2XWJA 3RVUD 4YDVB 3FOMA 3KBPA 2GT9B 2D03L 1YYMH 1INQB 3FMGH 4N90D 4R0LB 4AGMA 3U48A 1TQSA 2NYZA 4H1LG 3SDCD 2G75A 5CS7A 3L4UA 3WNOA 4QLWA 3NCFB 3W82A 4U33A 5D70H 3ZT6A 3ZK0A 8FABB 4D0CA 3F7LA 1T7WA 35C8H 4HKBA 4YE4L 1N64H 2F2HA 3HNVH 4WQOA 4JVPA 4KO6A 3DPDA 4PIRF 3WI9A 2FX8L 4GG6F 4E9QA 1P4IL 1OPOA 2PR4L 1MCWM 2B0SL 1FRGH 3GHBL 1NCCL 5TE4L 1C16A 1IM3B 5AZEH 3S5ZA 4JPSA 5B8CA 1JPSL 2FIKB 1KCUH 2NYKA 5EEUA 4KI5F 4U0RC 4A2GA 2OP4L 1HAUA 1RHHA 2WC7A 4ZPVB 3SZ6A 4HLZG 2VM4A 5E8OA 3MJ9H 3QA3A 4EOWH 2I85A 4FC3E 3CNKA 4MAYA 4LCIH 3UACA 2H2PD 1KGJA 1FV1A 4MVBD 3AS2A 3MZGB 3RI5F 4P2QE 2IDUA 4JZJC 1A65A 3GZQA 1CXFA 3RWGB 4P46B 2YRLA 4XNZC 1U42A 3OAYH 5HDWA 1A6UH 1DTUA 4U3SA 1HE7A 4XP4H 2AEQL 1J18A 2A6JA 5IIEA 3WV0A 3FTSA 1RJCA 1EHKB 1BREA 4NSKA 5C8JB 4MQ7B 5D2LB 3M6DA 2BLFA 3MRGA 2IJ0C 1V3JA 5HYQA 3AM8A 4P5TB 5BZDB 1M2VB 4Q9QH 3RFZB 1DEEB 3VYPA 2J71A 1GPOL 1PQZB 4LSTH 1SUHA 1SJMA 2YGPA 3CTTA 3MRBA 4UM9A 5GGRB 3NFPB 1P7HL 1X7QA 3CMOL 3QIBA 1V3MA 2R83A 4P4KA 3SJVA 5ICZB 4TYUA 4UBDC 3WEOA 3GLAA 3RDTD 4OZHB 4HYTB 3BZFB 3KM2A 3GIVA 5LBGA 2FR4A 1QRND 2HPTA 4QRSA 5IHLB 3WIFB 1XF4A 2SEBB 4OT1H 5SWZE 3FQXB 3KL5A 4F92B 2WJ7A 3HN3A 4ZFFA 1C8QA 1E2VA 1PJWA 1CD9B 4WW1B 3UJTH 3VCLA 3OG6B 1FG2B 4QXUH 3IU4L 4Z0XB 1CD8A 4ZTEA 1YEFH 3OQ3B 3SYAA 4XWGH 3N55A 3MRFB 4WWKC 5DA0B 3ARPA 4JHVA 2ITFA 3SQRA 5C0EB 2BVPA 1K8DB 1I1AD 3FZUD 4LHUB 3RZCC 5IROD 5KYYB 4PJ5D 3CLFL 4R84A 5MERB 3H55A 3UCRA 3NCEB 4PJAE 4HJUA 4FCHA 2XN9A 3VH8B 1CDYA 1JGVH 4OQTA 2GFBA 2UWEB 2YQGA 3FONA 1HNYA 2WYZA 3ARFB 4LLVB 4UTBL 1C8PA 1JV5B 2C3HA 1HSBA 5F1KC 3O41A 1QEXA 5LO7A 3C5SA 4H88H 3P0YL 3WJMB 3ZYZA 3O8XC 3P73B 4FQ2L 3AT0A 1RUQL 4XPBL 1ZPLA 2UYLA 4JKKA 1YNLH 1GAFH 3SPGA 1KBVA 2WWKO 4LVEA 2NY5C 3AADB 2OCCB 2LHAA 3F58H 1JWUB 5IB1B 4O9HH 5IVXF 4RDQG 3EFOB 3WHE0 3QUGA 4OQ1A 4ZNEE 1IGYA 1QR4A 4NOFA 3AZUA 2VSDA 1N67A 1SRDA 3FKUS 3P4MB 4FQLH 4ZTPH 5B38G 1XF2B 3IWUA 1FH2A 1X5IA 2HRPL 3H3KA 1RK0A 3DVGB 4KAQH 4XVSL 3TBYA 2IWKA 5C6WH 3PGDB 5I8EB 1V7MH 1EHAA 1N8ZA 1MJUL 3G08B 2CHDA 2G4GA 3F5WA 3N3EA 4A66A 4HDIB 4C56A 4OGAD 3PY9A 3UTTE 5DS8A 1JNHA 1N8ZB 1T03L 2DICA 5E2VL 4KX7A 4I4WA 5I8EA 1VAHA 3GNML 5BO1L 4U1HA 1FI8C 1IBFA 3AXLB 4LCUA 1M1SA 2HX7A 5D8JH 1PZ2A 4W9IC 3O9WA 4WFHE 1RK0B 3L5XL 2WXMA 1VF5C 1CICB 2XZZA 1OE3A 2XXMB 2P1YA 2OJZH 2VLJA 3PU7A 2KQNA 3U0TA 2P8PB 5H4ZA 3SQBB 4YDJA 5INCB 3SYOA 4PWHA 2DIEA 1I8KA 4QTHA 1MOEA 3HG4A 1OGSA 4LCCC 5I6XC 3X11B 5KYWB 1WWWX 1FSKB 2BOBB 2VXTL 3SGKC 3UGEA 1TMCB 5EIIG 5ITFA 4L3EA 4HIHA 2F61A 1A4AA 2EILB 2O6EA 5IQ7H 1NLDL 1DBKL 3MV8A 2PTVA 4H26B 4N86A 3B2DC 5F7UA 1FC2D 3ARQA 5AWNL 4LEEA 3ML8A 2NY3D 3MLWL 4I1RA 5EBMA 1IMHC 2DWDB 2UWEA 2X9YA 1NUNB 1QFPA 2NY0D 3VH8A 3EBHA 3AGWA 5D7LE 1YY9D 1EBAA 5I8OL 5C2UB 3H54A 2FX8H 5TK4A 1M3JA 2APXA 1A6ZB 3BDYL 5DZJA 1J0HA 2FUQA 3SKMB 3TA3C 5EU4A 5DRWB 1SYSA 2LT9A 2PETA 1PBYA 2WQXA 4QEGA 4XXCC 1JSYA 5L88L 1AC0A 4HIIB 4BJLA 3RL2B 1FG2A 4HF5H 4N2FA 1QWNA 3RG1C 2YGOA 1NGZB 1T5XA 1HIMH 3IMRA 2UV3A 1A6AA 1W0YT 3RPIB 4V11A 5DHVA 4DAGH 2MCAA 4XMWA 1Q1JH 2ALAA 5CGYD 5E4AA 4ZS7H 5EZJA 2FO1A 4NPYB 1QFUL 1IGTA 2NNCA 4NQCE 2BSEA 2YPKB 2ZUQB 1CIUA 2MPVA 4N25A 3FCTB 3MV8E 1L9RA 2VDLL 5GGRA 1M1XA 4E2OA 3MBWB 4UM9B 4N2NA 3ESVF 1F86A 3VXRB 2EUZA 1URLA 4OLZL 2E9JA 2JNZA 1K3IA 4XPAL 5C0NC 3Q5YA 1DEEA 5ERWB 1E43A 2AEPH 4QRPD 4U1JA 5KVEH 1NBZB 3C6LB 3FTGA 4LCWD 1T7YA 1PVHA 4N8VG 1BX2A 1MFUA 2A1WL 3MRMB 1UENA 5D2LA 5T3XD 4Y9GA 3KJ4B 3VGAB 5L2KA 3MV9E 1TZGH 2E9IA 4G7QB 3V4UH 4XMPL 2FLBT 4P46A 3GI9L 4GKLA 1MFDL 2O5YL 1HHKA 1FV1B 4DP1X 2WLJA 4JN1L 1S4IA 5IBLD 3ZUNC 2YD4A 3IMTA 2BFVL 5I30H 2PMZA 3PWUB 5HSFA 5J1TC 2VDNH 4GXFA 4OJAA 3ATAA 4PLKD 1KXVC 3U7YL 1BD2D 2ICEA 5H94A 3VFSA 1MNUL 1GGIH 2F8OA 3DX6A 4IMKC 3QISA 3UYRL 4CN4A 4B95C 4YVUA 5CXPA 1M42A 2QBWA 5GGSY 4XNMB 3ZDZE 2UWEE 5KYUA 4K5NA 3FU7B 4KTYA 4HKBB 4HG4J 3QDGA 5JYMA 4I0PB 2ICWI 4Q7DA 2W0FB 3E6HB 4FQXA 2XI9A 1VPOH 4BE5A 4X4MA 1R33A 4LRIA 4JPWH 3OQRA 1ZK5A 1H3TA 2EE3A 2F54E 3CC1A 4QD2E 3U46A 4NUMA 2B8OT 4AM0A 5AEAA 1QBAA 2OSXA 1J12A 2PTUA 4V1DA 1ZVSA 2ALWA 3GXFA 5IM7A 5DQDL 1IKNC 5D7IF 1OAYL 1ZT7A 4JG1H 1XH2A 3HUJF 3LMJH 5B1JC 3HB3B 2GITA 5KSVA 1MHEB 2ORBL 1KENL 5EV7A 5JXAH 2XKNB 1JZJA 1AQHA 3ZE0F 2XFXA 4RNRB 4JCLA 3UYPB 5F97E 1K4DB 2GIXA 2EYRA 2DEWX 3OKMA 1E8XA 2OMUA 2DD8H 1OANA 2QVFB 3SODB 4QWWD 4AVKA 1C5BH 2Z31C 1PD1A 4A7TA 3MV9D 3QCUH 3DA0A 1GR7A 2YOAA 4XTRD 1IC7L 3TYGL 4GKZA 2YKKA 1WAPA 3VG9B 3F64A 3RWEB 5FF6A 2K70A 5IMOA 3KW7A 4QRBA 5GPRA 4BWUA 4UTCA 4KQ3L 4YHZL 1G7HB 5KJRL 2CHZA 4L9LB 3GPEA 2WYTA 5EH1A 2VT0A 3O3BB 3NACH 25C8L 3QFDA 3VM7A 3B2PA 1GMEA 4UQ3B 1CPUA 4JO4H 1R0AL 2XPZA 1BXVA 1XR9B 2C3XA 5D1ZI 3Q1SL 4PHZA 4WIQA 5FGBA 4ZAKC 5C0GB 3QO0B 2A6DA 3N1PC 1BZ7A 4QKXB 3FK3A 5EEWA 5E6ID 2EUXA 4Y9CA 3HS0C 3VWKB 2YRPA 4GO6B 1TTUA 4DGYH 3LRKA 1I7TA 5T3ZE 4FQQB 1TIUA 3ARGD 4XAWL 1FYTE 4KJYB 1LDPH 4L4TA 2YOCA 5JW4Q 2QHRL 1K8IB 1SFDA 1EEYB 1RZJC 1WCQA 4U7KA 1FBIH 4ZK8A 2WZPA 2D3NA 2ITCB 3AB0B 3Q43A 4FEMA 4JM4L 3CXHK 4NX0A 3LNFA 4HHGA 1G5AA 3BCDA 4OIAA 3OJMB 3QIWC 4WUKH 2J8HA 1BD2B 2FYVA 1TCRB 3NJKA 5B7FA 4BQCA 5SWZB 2VL5B 2V2WB 4QNPE 2NY7H 5AB9A 3P9MB 5D7KE 3LKNA 4F57L 4M6OL 3MLVH 4OF0A 3N91A 1U93B 1NEZG 3ULUC 4N26A 2XBZA 2XWDA 4Q14A 1U8KA 1N0XH 3X13B 1KCKA 5IVXE 3DRTB 3V4LA 1ZGLA 1AD9B 1RZIA 3LIZA 3QIUD 4P5RA 5M94B 4HHAB 2JI3A 3NVQA 3S4SA 1KJ2L 4P9ML 4G6JL 2OZ4H 1CFTA 5E99L 3J07A 2ZOLB 2DQUL 4KTDL 4NKIL 3V0VA 3D85A 1A7NL 3L4YA 2DYSB 4UBDD 3SO3C 2CDFA 2Y4SA 5HHMD 3Q3GB 4KI5C 3NESA 5EF0A 1DUZA 4OF6A 5TE7L 3UG4A 1AGEA 4JHZA 3SPJA 4QRPB 2IOOA 4HGWA 4OM1H 1Q1PA 2CKBB 3L1OL 1QLEB 1S7QB 3CXDL 4OT1L 2LGNA 1A4JA 1IX2A 1G7IB 1YLBB 5KBDA 2AEIT 2CNYA 1MCOL 4YL4A 4DQOH 3TIEB 4F91B 1R46A 4IBQA 1F2XK 3ARYA 4TNVF 5IROC 4CKVX 3N5AA 4OSUH 3UDWC 1I3GH 2XN9D 3GFUA 4X9GA 1I85A 4YDKL 1BYNA 3S3BB 4IJ3C 3DO4A 1WZKA 2VDNB 4WI0A 3ZRSA 4ETYA 3PXHA 3LRSA 3S4SG 3E7JA 1TEYA 2JJUA 1DLFH 4PRHB 2VDMB 5JW3H 2XWCA 3RJOA 4UDTA 3RHWF 1NA8A 4LNVA 1KT2B 3IPFA 3DV4A 1GC1C 3O2DH 3H42L 2KZ1B 3MRCB 5A16B 1BM3H 2VDOB 4NN5B 4RBPK 1VCAA 1NICA 3MV01 4HWBL 3VI3B 5FUZH 1Z5LA 1U3NA 2EABA 4PJBA 3AWGA 3HJEA 2WLLA 3P1VA 4X7TA 5DMIL 4NN7B 1W2KT 4G6AC 3WFHA 3IVKB 3DDGA 1M9WA 1T2JA 3VXNA 5KVFL 1BEYL 2ROXA 3EADA 3DHPA 3MJWA 3D1MC 4PP1C 2X4SB 3LSOB 1GSMA 3QEQD 5E08H 1GGBL 1TITA 5AVZB 5IY5B 3QNFA 2CLRA 4FL4C 5MHSD 1SLXA 1N6QH 3GBNL 2Z93B 1ORQB 1R24B 2Z4QB 3SPCA 4DP7X 3P3UA 3JTSA 5J1SC 3M86A 1ZIAA 2NY1D 3GI9H 5ABAA 1GH7A 3N6YA 4OTXL 5DK3A 5I6MA 2I07A 3FO1A 4PJ5E 4CSPA 1CR9H 2B16A 3NJJA 1AGDA 3QDMA 4HKZA 2EDOA 1E90A 4CGUB 5HDRA 2ZUTA 2O93L 3PLYA 1ITBB 5L8JB 2JIXD 1BMZA 3VXTA 5EF3A 4UM8A 4Y2LA 4IRSD 1IKFH 1X9RA 4EI5D 2JKNA 3DV6B 2OYKA 4APXA 1FN4A 1T03H 4HUXA 1AE6L 2YEVB 1G9MH 4PSRA 3UBXA 4W4OA 2GVYA 3BT2H 3MRLA 2NY4B 3C60A 3TPUA 3UTSA 3WE6B 1TJMA 1GTFA 4FNRA 1U3HC 4BFEA 2WIMA 1I82A 4IIQB 1HL5A 3B3IA 3HI1B 4P3CH 3MO1A 2BOCA 3GF8A 2PW1A 4M62H 5DJAB 2JKXA 4TNWK 1XHHA 4EI5B 2Z8SA 4IMKA 1JTPA 4J3VA 3EYFA 4IHOA 1DP0A 2PABA 3A4AA 3BP6B 2YPVH 3IDJA 4WFED 1YNTF 5E5MA 2FYYB 3QRGH 3QUHA 4PV8A 1ZLUK 4DGWC 3U6RA 3NIFB 3ZKND 5C07E 3HEIB 4U3HA 1B4JL 5IVNA 5DT1H 3RWDA 5SV4A 3UTTA 5D1QB 3WIAA 4I0KA 4LHUD 1RL1A 4PREA 1NGYB 4U05A 3NACL 2QQNL 1W9XA 3KCWA 4YHNB 3VG0H 4MMZC 1OE2A 3HRPA 4H5SA 3S3CB 4GFTB 5A1AA 3EG9A 4EN3C 4IRZA 3FC8A 2C3WA 5BOJA 3SGJC 5EEZA 1OSPL 5FHBH 3AW5A 3OJVC 1CFQB 4MWFB 5DQJA 2DMGA 5ICYB 3GS0A 2WLMA 1P1ZA 1Y07A 4G8IA 1S6NA 4PMEA 3G6JA 5HGHA 1OF2B 1L0YA 4F20A 3KMDA 1PZDA 3B8SA 4EQ2A 3BH9B 3RDTB 1BJ8A 1P84K 4MD0B 2K78A 3X3GL 5KYXA 4ONGH 5D1ZC 1T2QH 4X5RA 3UDWA 3TWYA 5T1KA 3ILQD 4N2LA 2JKIS 3G3LA 5CD5C 2PXYD 3C5ZB 4JY5H 5DS1A 1I7ZB 4Y4KD 3QUYC 5IW3A 2L3BA 4KO9A 3TP4A 1D6EA 1N10A 1XGYL 4KUZH 1KACB 4I3SH 4NJ9L 4F1ZA 4PJHA 4DUVA 3U4BH 1MW2A 1FNEA 1T1YB 4YUEL 4A7QA 5FO9B 1NOLA 1DO6A 4U7SA 5AVXB 4LEOB 2CJTA 2GK0B 2A1WH 2JJSA 2VB5A 4GXVL 1D5RA 1NCDL 1N12A 1XL6A 1ZXKA 5C0CD 5SX4I 4ODBD 4OZGA 4AEHL 3T3PB 1AACA 2FGZA 5GGUA 2WQWA 3P3RA 3P0YH 3FN0H 1UXSA 3OSVA 4AVHA 4DP2X 5IR1A 2A9CA 3UBXI 1Q9KB 1YNKL 3EW3B 4W9HC 1ASQA 1QLEH 1VESA 1UGNA 3P77B 4OD1H 4I48B 4FZEL 5AD0A 5DI8B 1DUYA 4XODA 1HH6A 3KPLB 3SDAC 2MHAA 3ESOA 3K6SB 3BZEB 4WGVB 4IDJH 1SN5A 3IM1A 2YA0A 4OAWA 3AGVA 4OLZH 4CU7A 2A74B 4G8FA 4F7CA 2D0HA 3F01A 5DZPA 4PY7A 3SGKA 1NQBA 1VADA 4XNDA 2GEQA 2YK1L 5A2IH 5SWQA 3QDGD 2V5SA 3ZO9A 1L7TL 2XXCB 4ODHL 3JWNH 4OKVB 5T3ZH 4EZLA 2XX1A 2W0KA 1S9WB 3QUXA 4FNLL 4GFXA 4IIQC 1T6WA 4QYOA 3V4UL 2JKRM 5D7KD 4JMXA 1IBDA 3B2MA 2YBRA 3WL9B 1XGZA 2MNJB 5ESVA 2Z92A 1F2QA 1FNAA 3HC3H 3TH2T 4LEXH 4XE5B 4LSRH 4NUJA 1U8QA 5HGDB 2BFVH 3HIZA 3VWKD 1WFNA 2V7NA 1MW3A 3FHEA 4J27A 1NFKA 4FFYH 2WW8A 4DKAA 3VNZA 2VIRA 2ZOOA 4UV4H 4QXTA 4ZUWA 1JHKH 2Y5TA 1NKOA 3TWCL 2C1OB 3TF7C 4N5UA 1JPEA 4NQVB 3NCJH 3FH5A 1KPUB 2FUTA 2FL5B 2ZYHA 1XGQA 4X5QA 1BXUA 2Z6FA 3G5WA 1VFBB 3HAEA 2YMTA 3SDCB 3X14A 1CDCA 4S0HA 1I1CA 3CFDB 1BOYA 4OV6F 3DRQB 4PJGB 4RMRA 1TJIH 3FB6A 3E8UH 1I8LA 1P4UA 3BW9B 2F53E 4BGLA 4TLSA 1AXTL 5DEZA 3MBEC 4RAHA 3BP7B 1L0XA 5AB1A 5KN5B 3IMUA 3O2DL 5BZWA 4BZ1A 4JFFB 1NZRA 3NFNA 3BUQA 3I6KB 3OWRA 4QHLB 5D7LD 5D96C 3W81A 5HVGB 1AOZA 4HWBH 1NEZA 2W80C 2DAVA 2XN9E 1MCRA 1MPAL 9PCYA 3STZB 2PPFA 2E8YA 4WI6A 3O3DB 1HOCB 2VQ1B 3BUBA 4DFIA 4EPSA 1D9KB 4B7IA 3S96B 1SJEB 2ADGB 3ULAB 4ALAH 2OL3H 2F8VA 5IREA 3IDIA 4JJ5A 3K81A 1JIBA 1URIA 2MPAH 3MYZA 3D50A 2KC0A 4KX9A 4JFVA 4JY4B 4M02A 5D2NE 2Z7WA 4YHOH 4DP6X 2F7QA 5HHOB 1SM3H 2QJDA 4JB9H 3BIKA 4WK0B 3PWLB 4Y1SA 1CFBA 2YS4A 5F93C 2Q2LA 3WGVB 2FK9A 3VGFA 1XSIA 1YMHB 3K6OA 4PGEB 4V2BA 4HOWA 4NRXB 1AQKL 1ETZB 3ZHDA 2WQUA 4X7SL 5AALA 3GBML 4O02B 3G04B 4IBWA 1SOSA 2RALA 4QJ5B 9CGTA 2LR4A 5EF2A 3GUTA 4RRPG 4RSVA 2VDOL 4XO5A 3V5HB 1IJNA 5CP7A 4NAJA 4NFDA 3NIGB 5DJ6A 4BH7A 1Y6MR 5AW5B 3MR9A 4EI6B 3QE5A 4NIKB 3UBGA 3ZTJH 3NH7L 3HI5L 4IU2B 4MKTA 3SDAB 4TNWF 2DEXX 1YJDH 5DO2C 5FA3A 1AO7A 5AW8B 1MI5D 1UT1A 3LPPA 3SCMA 1MFDH 5JZ7D 2GBVA 4KH9A 2WUCL 2FSEA 1WCBA 2UY6A 2YGNA 3PWVA 1S9VA 1RSYA 1BBJA 5AW7B 2IG2L 1DDHA 2K3HA 2YD9A 1NGWB 2FNWA 4XP9L 2W94A 4JAMA 2GTWA 4E41A 1BF5A 5LDUA 4Z7QE 2ICWB 3IFPB 1QNIA 2J20A 4UCFA 2JSFA 1LEGB 1OSEA 1UJTA 1T1XB 1Q94A 3RTQB 4Z3IA 3VD0A 4J28A 4JM2B 3HG5A 3EO1A 4JG1L 5HYSA 3WTYA 3VDCA 1CDHA 1YEEL 2EDNA 3SO5A 2W9EH 4AQ8A 1EJFA 4KRNA 3U9UA 3UO1L 1XWVA 3TNMB 1GYUA 3NSJA 5DVLA 1K6QH 4JCMA 3L3HA 1JJUA 1B90A 1CF8H 4LLUA 5L9DL 1U8MA 7TAAA 1RFDH 4JFTA 2P24B 4U0RB 5C07B 3L3DA 1JI2A 3C6LC 4H1LB 3PL6A 3X1EA 4LARH 4Z78A 5DDHA 4KZ0A 4X4YA 1PW3A 4KK6D 4LASH 1EHXA 1UACH 1T1ZB 3L5HA 3V6ZA 5HPMA 4UOQA 4X6EA 3O6FC 3WOVA 5IESL 5E9DE 1IGFL 1UB6B 4J1UA 2YD3A 3TV3L 2OTWB 3UAJC 3B1TA 3NCCB 3C12A 3SE9H 5BS0B 1J05A 5IBUG 3K6DA 5GQBA 5KSBE 2YD2A 3O45A 3ZTNH 4JFHD 4L3ED 4GQ9L 4C83A 1EJOH 4HK0B 2P46B 3ZZSA 5EWIH 4K94C 4QUOA 4PP1D 3DO7A 1FZKB 1U8JA 1D9KC 1THCA 1WRFA 5KG9A 4Z76A 1D7BA 3SPVB 3WD5L 2IAND 3DX3A 3CXDH 2G60H 4X5WA 4GS7B 1ANUA 2XRAH 3T65A 2NW3B 3WMPA 2PR4H 3PIQB 1U58A 4ONHB 1NBQA 1BVZA 2FT7A 3GBNH 3EJTA 5CHNB 2V2TB 1UVQB 4BHUI 5ID0A 1T4KB 3LRGA 1GCFA 3TTYA 2IDSA 4EF3A 1KCUL 1PL3A 3L6FB 1BFOB 4HJTA 1ZJAA 3QXDA 4F7TB 3MLSH 4L8SA 3MNZA 2FJFB 4LEXL 3VMPA 1YPZA 2CDEA 1SYVA 1LEKB 4L3CA 3V0AC 3V52L 2CBQA 1GKOA 4MA8L 3P4NA 2H1PL 3W9DB 4OGZA 3LEYL 3W0WD 2MNWA 4JZNA 1L7IH 4PJBE 4EDWH 4MCZB 3FH8A 1WA0X 4LQFL 4NKOA 4KPHH 4Y16A 5DK0A 2EADA 2JLLA 4OI8A 1S7RA 1BFVL 4OCWH 1NIBA 5LHDA 3CSYA 3E6FA 3M1BB 5DC2A 4XOAA 4DETA 3NJXA 4X6CA 3WE1A 2VW7A 1ZCRA 3QWRA 3O11A 5BQDA 3KPPA 5DYOA 4H13C 4GSUA 2VERA 5B39B 2QGBA 4HC1A 4NC1E 1R4XA 3BDBA 4RGND 5F89A 3Q01A 4ELMF 3KYAA 2HFFA 3LQAL 3NIDB 2EIZA 5ANHA 1MXGA 3L4VA 4AW4A 4JKWA 1M53A 1GZQA 1I3VA 3MRKB 5E2JA 3SBWC 4EUPA 4RETB 1ZA3A 2GHWB 4XZUA 3CFEB 2R1WB 4XNAA 2BVEA 4Y2NA 5DQ9A 3OXRA 2EIJB 4MKMA 2PWGA 5E23A 4AYID 4ABQA 2HCZX 1A4KA 2NY7L 1QABA 5D7IB 1QPXA 1GYCA 2XY1A 3IDMB 5DD6A 4J6RL 1R5VA 2AJZA 2R23B 4LU5H 3RP1A 4AQZA 5G2NA 2W9DH 2DJ4A 3AUVA 3L3JB 3WS6A 1RJYA 5CJ5A 3QZWA 3VD9A 1JVKA 5SV3A 3HC0B 3C8HA 3U4KA 1G6RL 1D5BA 1G0XA 1QVOA 3MCYA 2CO7A 4G43A 5HHVL 4J3XA 4ZJ9A 5DLLA 1N7ML 5HYEA 1BM3L 2VZUA 5T1KD 1PYWA 2A4ZA 2OJ1A 3NN8B 1GGUA 4I89A 2WKOA 3FFDA 4PD4J 5D4HA 2FEJA 2WBJA 4WW2A 3FU5A 1WTGT 1T2QL 2EE6A 4WWKA 5JTWA 3SIKA 2GJRA 5E8DL 4CW1B 1N70A 3H53A 1LWJA 4NQDE 1TJHL 4H88L 2B0SH 1MG3C 2Y36H 4LSVL 1NEUA 1MRDH 1G7LA 1E28A 2VWEE 4LESA 4UV7L 3F05A 5ICXB 5TPWL 3BZ4A 1OK8A 1E2ZA 4AYMC 4TSCL 3I9GH 1U2YA 2WQRA 1JDAA 2DMBA 3WNLA 4BM7A 2NQDA 2NX5E 2VGLM 1CVRA 1WWBX 2PCFA 1UWGH 2MTPA 4L5FE 4OLWL 3LCYA 1E4HA 1J0YA 1QTPA 3NPSB 4TNGA 4DZBB 4R7NA 1HHJB 4GBXC 4TSAL 3S35X 4GPVA 3SDXE 5JOPE 2H41A 2WIIB 3DARA 3FJTA 4PRHE 2YQ2A 1E28B 4GJTB 3S35H 3WS3B 1A25A 3FUIA 2YEZA 1XZ0A 3WFDH 3I3DA 3INUH 4Y5YB 3UPRB 4GG8B 3CVHL 3JTBA 4BSWB 2EVJA 1PDKB 1WP6A 4PQXA 1AZZC 5I6LA 4EO5A 1Z3GH 3G5ZA 1BZOA 2IMNA 1QFHA 3CN4A 3ZDYB 4RA3A 1B0GA 3CX2A 3ZYIA 4HJJL 3SYPA 2YAEA 2XV3A 3CFUA 3CH1B 3GNMH 5F3BA 4G1MB 2B4CH 1NCAL 4M62L 4GRWB 4JY5L 5IOPA 1S7WB 4KK9C 5I15L 4UIMB 5DF0A 2CO7B 4G43B 4JPKH 4NRZB 1SLUA 4ORGB 4TXVB 4Z7IA 5LGJA 3PXLA 1CL7L 4H25A 4EN2A 2Y5EA 1MWAA 1BQHG 4E0RB 4YHPA 5BS0E 5I6NA 3TBSB 1ZT1A 4KKZA 5GS0H 3MXWL 3L3JA 1KJVB 1RIVH 1XXDC 5KW9H 1PKQA 4PLOB 3EOAA 2FWOB 5IVOA 3VD3A 3P69A 2J4WL 4HISA 1FL6A 2R2BA 4FLHA 2AJUL 4H8WH 4FMKA 5HXMA 4U1SA 1RXLA 1HK6A 3D2UD 4HG4K 2X09A 1ZPUA 1ICTA 4I5BB 3HE7B 2W07A 1IILE 2GI0A 2ZP0T 4HA1A 1YNKH 2ZX5A 1KBGL 1QSEE 2YPLB 1H5BB 1RUMH 3TBWB 4OVVA 5AVUB 2GBUA 5GZNC 1NFAA 3UZQA 4EQ3A 3ARGA 4WGKA 5F7EL 1J0IA 2CLZA 2ENYA 2QPUA 1LK3L 1TNMA 3D5OF 5CP3A 4G8GA 2YXMA 4ES9A 1Q9WA 4HZLB 1P5UA 4JFXA 4ODXB 1WBYA 2BVYA 4FF9A 4K73A 1NFIB 4GI8A 4GI6A 1XF3B 5ISZD 5B3JE 2NY6B 2J8UA 3OF6A 5E24E 3BRGC 4KUCD 5HHQB 5HGBB 5IT2H 1GZHC 4IGBC 1LDSA 3D2UB 5DJYA 1P9MA 5L7XH 2QSTA 4WHTA 4GG6B 1S7XB 2IH9A 5BZZA 3D69B 2JMRA 3E38A 2JIXB 3IPEA 4YUEH 5FOJA 3KEHA 2I60H 3B6SA 3UC0L 5ID1B 1N6UA 3ZIMA 4ANUA 1DQJA 3CFJB 3KPQB 1TMQA 3TO4B 5F8RC 1Q9OB 3FF7A 4ABVA 4K8RH 1FP5A 5AG9A 3Q8EA 4AK2A 2BRRH 4WSJA 4I18C 1EANA 3RIKA 2XDHA 3BQUC 4JLRB 1K2DA 1KGCD 3ARGC 3GSOB 3QJTB 3QORD 4XCNB 3S3SA 1CFSB 1EDYA 1TJIL 2NNAB 4M1CC 4HUUB 4XAKE 4XP5L 1ZLUH 2QKIC 4HALA 5E4IA 2OJEA 4APQC 5EU5A 3GSNL 2ZWNA 4PFEA 3QZMA 1W0VB 3MRPB 4XO8A 4XTRC 3ESPA 2Y23A 4JRXB 1WZMA 4LOUD 4QHNB 2I9TA 2P5EE 4YSOA 4J6RH 5F21B 5GIRA 1S9YA 5D7SH 4R2GB 1BEYH 3L3OC 2YJLA 4P2OC 3ULUF 1MI5A 1SBSL 4H8HA 4NDMA 3GMMA 3QUML 5AOZA 4AIOA 1ET7A 2AI0L 2JH2A 3ML9A 4DPCX 4PRHD 1G1KA 3LVTA 3QDJE 5HHMB 1CXHA 5DDHB 3C8KA 3T8MA 2VLKE 2XPYA 2TSAA 3DUSA 1P7BA 2QQLH 4GO8A 1J5OH 2EXTA 1JHTB 2XOTA 3KE0A 4HAFA 3VA6A 3LQAH 4JFQA 1DQIA 2D0FA 1KJ2A 5HJGA 4ETQB 4L1BA 3U9UB 2XKUA 2C3GA 4F37K 4PS4L 5DVNA 4CBPA 3R4DA 3TWCH 5SWZD 1T1XA 2BNRB 1XIWB 5DFWH 5ENWB 4LMQI 4NO0D 1TVDA 4O58L 1DO5A 4JAMB 1EDHA 1GJWA 4QTIH 5FFGA 3OR7B 3SOBL 2VDOH 3PG2A 3DX1A 3LVEA 2GJ6A 3OHXA 3PS6A 4PWIA 3T6ZA 1DVFA 1Q38A 5JLZA 4F3FB 4PGDA 5IKCA 1KLGB 3PWVB 3U36B 4DJMA 2FSEB 3DK2A 3LHPH 5DR5H 3EXLA 4KOCA 5E2UL 4Y88A 2A74C 3HOGA 4HAKA 1T5WB 3U30C 5AB2A 1PG7W 1Q0EA 4GMSL 4N2EA 4OZGE 2XIDA 1JK8B 1FL5A 4WJ5A 1P1VA 2ZT9C 4YSTA 4X0KB 1RJLB 2DWXA 4LSTL 5JA8B 3STLB 3HPLB 3HC3L 4JHAL 4EI6A 3MR9B 2WSPA 4R9HA 3NCYS 4ZNCD 3NSXA 3EFDL 5EU6E 2XYCA 3BQUB 2PYEA 3QIWB 4BDVB 4HKXB 5F1IB 4RMUA 3QCUL 4PJFF 3MPCA 1A22B 1IC7H 4Z7UF 3TURA 4MNQE 4KVNL 5ELIA 1KIPA 5EFIB 5JORB 2WWMD 3HC4H 4WNQA 3VD5A 2X6VA 4NWTL 2ED6A 4G3YL 3TO2B 4GQ9H 4LBAA 3ZHNA 4AZ8B 1QHPA 3K0WA 3PABB 4XNQA 3IU4H 3MNDA 2DBLL 4N8UA 5HHOA 3WTVA 3ALWA 2FT6A 1A66A 4ISVA 3IAPA 3EDFA 4PJHE 3VU1A 2AMGA 1X6NA 1FF5A 2DB8A 2BIHA 2XRAL 4OZ4A 1F18A 1KYOK 5IBTH 3T3PE 1OTSC 2J6EL 2AQPA 4OLXL 1V7ML 2ADGA 2KERA 5GRZA 2WNKA 1PG7X 5HDBB 4LASL 1ACYL 2DLHA 2EXYC 3LNEA 3PREA 3S96A 3ZHFA 3DYMA 2YN3A 3SKJH 2E3VA 1BMGA 4RZCA 1B4RA 1MCFA 4NAMA 4PB9H 5D6DA 5TQ0H 4HBCL 1ZSDA 1IQDA 2ZG1A 5IP4A 2WCSA 3QB7C 3KBEA 2PWEA 3GDCA 1YJDL 4NQSB 4FQJL 1LP9A 2R8SL 4AZ8A 4EE2A 2FJGA 4KKBD 2AXHA 3BSZL 4IJ3B 5DUML 3X14B 2WV3A 5DD1H 4Z7WF 4W9CC 3B9VA 5KSAB 1E3FA 3SDYL 2FL5A 4QMEA 3SSGA 4MA3B 3RIAK 4EIBA 2PNDA 1NKRA 2G60L 2J3SA 2W59A 4JFSA 5F7DB 5F1IA 4HKXA 1ORSA 1QRNE 2DLGA 3EOBB 3IDGA 2OMXB 3U2JA 1MJUH 1U4FA 2V7NB 2YD8A 3ARDC 1GYVA 3N0AA 4HZAA 1NGQH 5I74C 2NOYA 2N56A 5EIIB 1PX4A 1VB9A 4X0KA 3OD3A 4CL7A 3ZBMA 3SEPA 4QRQB 4GAGH 4L9DA 1JPGB 3ETTA 4XR8C 2Z92B 4L8BA 3S9DB 1CK0H 1R5IB 2V8MA 4BFKA 3OZLA 3QZOA 1OPGH 2K45A 4FQ1L 5CSZA 4F2ME 1EZSA 3EJCA 4PGDB 1YDPB 1DVFB 5SWSD 4DUWA 4F27A 5IUCA 4I0PD 4HF5L 3V0EA 4LU5L 5I5IA 4NQCA 2XJLA 4AGNA 2FBOJ 1IC1A 3NA4A 4N8CL 1INDL 3C2AH 4PY7B 2EYSB 4OCSL 4Y5YC 4G8FB 5D1XB 4F7CB 5HDQH 3DTUB 3UAEA 2O6FA 4I3RL 2RFXB 3MFGB 2HFEA 5EPMB 4J4PA 3BZEA 4P4KD 2WQVA 5D1XD 5A6MA 4YXKH 15C8L 5EU7C 1HFUA 1O7DC 2ITEA 5MENB 3LIUA 2MJWA 1OAQH 3JTTB 4KJQD 1QRNA 1CLOL 3S88L 2CHWA 4KX8A 5GGVL 1QWUA 2PWDA 3GMQA 4W6YB 3PF2A 4HIXH 3V4VL 2J1WA 5CJOH 1CLCA 2WBWB 4E42A 3NSDA 4QHKJ 5HVFB 3TCXA 1IC5H 2PWFA 1D7DA 4K2UH 1RZ7L 1P69B 1MI5B 4K9JA 2HT3D 4KO7A 4C59B 5F6HI 3BLPX 4Z3GA 1CWVA 5AYTA 5CEZD 1J86A 3KD4A 4LP4A 2ZOKA 3L45A 1BQLH 3HMXL 1G6RA 3REVA 1E4WH 4PJHB 2DKUA 4B96A 4JN1H 4JRXE 3T8XB 5EU5B 3TS8A 1KEGL 2OJEB 5KSAC 3WG7B 1YUHA 1DBBL 1ADWA 2WWKT 3DX2A 3MBXL 3VWJD 4NRYA 3JWOL 1CR9L 1I8IB 1K2DB 3TESA 4KROD 3RA7L 3HFFA 1S3KL 2VISA 4PN6A 2QV2A 4UQCA 1IAIM 1NKGA 3V8OA 4A2DA 4JFFD 4CU6A 4HFUL 4XPAH 3EYOA 4M7LT 1HWHB 4W1TA 2IPKA 4AV0A 1E9QA 2FQDA 3K71A 5KSBF 2AEPL 5FR3A 3OJDA 2X70B 1BWMA 4ZOCA 3BAWA 3CFJA 4Y4KC 3RY5A 3TCTA 2I24N 2IH8A 1NWOA 2FGWL 1ES0A 1Y1DA 3WDIA 3LB6C 6PAZA 4FERA 4NT6B 4P59L 2QQLL 5C0BD 5IW6B 3GM8A 3T6XA 1RP9A 1COBA 5DUPH 4G5ZH 1UUNA 5F2FA 1HKLL 4M3HA 4JNXA 5DJYB 3TJEH 2ZWSA 4XCFL 4XT1C 4HPYH 1UEYA 3V0FA 3LX9A 2R59A 3V4PH 2J88L 3I6GA 4X4XA 4CN6A 3SBWA 3HVDA 2K9UA 5A6IA 4MXVE 5ALCL 2X1XR 4PV1C 5HI3C 3IETA 5I30L 4PSPA 1EO5A 2ZPKL 4OM1L 1KIQA 2VLRE 1JGUL 1UHVA 2HRGA 4MJIE 3S34L 2XWTA 4WU5A 2WZ0A 4H8VA 1Q9WB 4AYFA 4J2XA 2VLRD 3CQFA 3DBSA 4UU9A 3JYCA 3LB6D 4HUMB 4IHOB 2NY3B 1KIUA 1C9SA 2D7MA 1MNUH 2IBGA 3K6IA 4W4NA 3KYKL 3LHPL 4ILDA 2P48B 4WK2B 1JUFB 4PJIE 1RZJL 5IFJB 4LCYB 5CLYA 5JHLA 2YPLA 2KZWA 1CE1H 2EUWA 4RLDA 2HUHA 2WYHA 1MKFA 5EZIL 2E46A 2BDNL 4UQIM 3OC5A 3MBED 3KG5A 5LGYA 3DYOA 1YPZE 3NEOA 4JDEA 1FN4B 3RFRA 1RIUL 3W9EA 4BQBA 4ZS6D 5GZOA 1INEL 1J10A 2JXMA 3N1GC 5I18H 1FORL 2W65B 1MLCB 5IJKC 3D8MA 4PG9B 1XBDA 3MUY1 2B59B 4PWFA 1IARB 4NRZA 4U1NA 4DFHA 3H3BC 2I07B 2BZCA 3FO1B 1JPFB 3ZDYF 4DQAA 4E41D 2GJZB 4AQOA 4QF1B 2AXGB 1OT4A 5EB9A 3JTSB 4EEEA 4MMYA 5F9WC 2Z4QA 4F33B 1JZ8A 2G2PA 4LO9A 1DBMH 2O6CA 3GSVB 4UQ2A 3FSVA 2WKLA 1EFXB 1T6VN 4NKDB 3BQUD 5FYLD 5BV7L 3LSOA 2W1NA 3H2QA 5HDLA 1XH3B 1MHCA 4AKOA 4RFEB 5D2NC 1UM5H 3U0PB 1HT6A 4NS0A 4IBTA 2YEZB 5FYKE 1RZKH 4PJDB 3BKJH 4ZMTA 2O5XL 4C4KT 4Z7OE 4ZMNA 4TVUA 4OZHE 3H9HA 3RKDC 4BZ2L 3MTXA 1RMFH 2W0LA 4WV1C 5FXCH 4R7NB 4XP5H 4Z7UB 3CHXA 3S37H 3S36H 1OLZA 3MRCA 1JYWA 5A16A 1G94A 3APMA 5AUMB 1BG9A 4Q9RL 2OMWA 3Q44A 3EO9L 5GRVL 1PFOA 2WBXA 5ETUA 1M7IA 3JV4B 3GHEL 5J9PB 1ZDSA 3G6JE 5GS1A 3VXPA 4ZXBD 1KFAL 3WHXB 1E67A 1XGRA 5ESQB 5DD3H 4I8DA 4ZX5A 3DXAB 3FQTB 5K39B 5J1AB 4RWHA 5AG8A 2MCPH 4FP8L 4PBWD 4YZFF 5D93C 3MXVL 4P9MH 4WWKB 4YHIB 2AQ1A 1CT8A 5D96B 4TRPH 2PO6B 4RMTA 3ZMEA 5BXFA 4YGVA 4FQIH 3VXOA 1ZVYA 4YHMH 4YBLC 3ULVH 3TNNA 4WHDA 3JT2A 2JF1A 2A99A 5BVPH 3CZNA 3BEWA 3OGCB 5GGVH 2Z1KA 3A3YB 3I74A 3DHMA 1J9SA 3L1OH 4TL4A 4UQAA 2DJUA 4G9FD 3H9SD 3WN5B 1MAML 1A2YB 3FFCA 1IEAB 3HHSA 3BEVB 3Q2LA 5T5FA 3GSQB 4QNPF 1JF1A 2HVJB 3O6ML 4K15A 4WFGE 1EV2E 4PG2C 1IGJB 5KZCB 2UY7B 3KGUA 5MEOA 3LH2H 4HCIA 5DRZA 1WGVA 2HP4A 4RGOL 5LXVA 5JUEH 4Z0BH 2R1WA 5DQ9B 1NC2A 2VL5A 2VDLB 3TC9A 3CN1A 2R9HD 2FVNA 3QORB 5FYKU 4Y8DC 5I9QC 4JDZB 5D1QD 1OP9A 4M1CD 4X6FA 2RD0A 3VFRA 5JW3L 5FGSA 2NY1C 4MMXC 4RDQF 1AQDB 3PE9A 2IAMC 4ELKB 3GINA 3BH8B 3FU3A 4GEJA 4HJ1A 4ZOAA 2ZF8A 5KVDE 4L37A 4F93B 3IDNA 2X5PA 4NPJA 4RBPH 5EMYA 3CH8A 3JT0A 3QK0A 4X6CB 5FYJD 5KVFH 4WI8A 4U1IA 3ZL4H 3PQYE 5J56B 1GIGH 3NUKA 4OLUL 5D4QA 1JZ4A 1OAKL 1P6WA 1TVBB 3P30L 3CFKA 4XWOD 5DK0B 3V0WL 2Y1YA 1IE4A 4P04A 1CCZA 4L0ZA 4ENZA 1RURH 3MDJA 4CDGC 3QO0A 1F13A 3FOLB 3EJRA 4G71B 4MQTB 5HYSG 2DBLH 3W9DA 3P4NB 4ACTA 4LIQL 1N2RB 2CDGA 1MLBA 1XR9A 4H20L 4OCYH 1EXUB 3K4ZA 2FJFA 4IRSB 4M8QA 5T5NG 1OKEA 4N2BA 4MS6A 1MCBA 3RDTC 5CP3H 1D2OA 2IQ9H 2YWYA 3K74B 4WI9A 1S5HA 4TUOB 5ID0B 2QMJA 4LZKA 4YEEA 3VFVA 1UXWA 4XBGB 3NIDE 2NW3A 2Y5QA 1UA3A 3ULVF 1RZFH 4X5WB 4GW1A 3ULUL 4OFYA 1T2XA 4KVCL 4Q6YA 4ODSL 3GSXA 2H0JA 4NOBA 2D3VA 1XH1A 3UTQB 3ZRFC 1AKJB 3NSYA 2Y1VA 4NKMB 1KBKA 3H0TA 5LLIC 4YFLI 1A3LL 3NJMA 2XFXB 3PQYA 5ABDE 3O45B 1R9FA 2B1AL 2NTFB 1YNTB 2OR9H 3OAZK 1OCWH 1ZT7B 2OLDA 1DQTA 4B53A 5BS0A 4I18B 2K6ZA 3CIAA 1E9PB 2F18A 4DNLA 2JKJA 2H3XC 1FFRA 2MKLC 3E80A 4WKXA 4X6EB 3E1ZA 5IMMB 3V6ZB 2K7PA 3LYRA 3O4OC 3O3EB 4HX1B 4X4ZA 4XVOA 2NSQA 3ILPB 4A2HA 1DVFC 4OVUA 2DS4A 3ETSA 4H1LA 2JWYA 2AJSH 2YR3A 3NTCH 3O4LD 1YEDB 2V9RA 4I0PA 3L4WA 1OAJA 3AU1B 3ZGHA 3FRPG 3QIUB 5FHBL 4NC1C 3D0LA 1SDDA 2P8LB 5KYUB 3QH3B 2ZOTA 3ZHLA 5BRZE 1CF8L 4WCYH 1BGXL 1Q4NX 3QIUA 4HIQA 4JM2A 3QR2A 2E6JA 1AIFA 3SDCC 1JZ6A 1KIRB 1RZKL 4FJZA 4ZUVB 3MLUL 1FNSL 2BY2A 4HD9A 3LRHA 1N4XL 2GTWB 4UWQB 4E41B 4NNYB 4Q2ZA 4S1RH 2A2QT 1P4LA 3O3EA 1DDHB 4LSDA 3BAKA 4FZ8L 5IMMA 4B9FA 3FU8A 3L5XH 1JXGA 4H8QA 5I5RA 5TK2A 3EYQD 4DO4A 2ZUQC 3BP4A 4RIRA 3G9AB 2JTDA 3ISRA 1HHKB 3MMEB 2C4FT 3E3QC 5K1NA 2NUPB 4F2MA 3ME0B 2FLMA 3PQYB 4R7LA 2C34A 2G2RB 3PV6A 1CGXA 4GLRH 4WEEA 4B27A 4K71C 4BKTC 4D7BA 4XC3L 5CP7B 4IEFA 5EA0H 1YQVH 3WFCL 3DETC 3L16A 3KJ4C 4ZDHB 1S7VB 1RU9H 4GBXD 4PGBB 3VGAC 4ZNEA 1MW0A 3BKML 3C6SA 5HHPB 4L0PB 1KB5B 4M03A 1OTTC 3IWVA 1ZV9A 3B5TA 1UWXK 2EECA 4MJID 3TN0A 3K72A 3ZOAA 3EFFB 2CHNA 1O5PA 1IAKB 4DVRL 5FYJE 1Y6KR 4MJ2A 1H9VA 4KROC 1OWRM 1KEGH 1BAWA 3DGDA 3L9BA 1S5HB 4TUOA 3TEXA 1Q90A 3HUJE 3II2A 1W15A 3U4EA 2H32B 4TNEA 2YLHA 3ABLB 1JP5A 2C1PA 1O9WA 4JY4A 3ECWA 2YUZA 2XG5A 3L95A 4HFUH 5A7EA 1ECYA 1KN4H 4EZMA 1BAFL 3CXFA 3IDIB 2AK1L 3Q8BA 1I8UA 1YC7A 4EN3A 4IGBA 4U7MA 4NNXB 4XPHL 3V4PA 1NFDA 4Z5RA 3UH8A 1T66C 4DP4X 1I7RA 5F71A 1HZHL 1TVBA 3KPSE 4HC1H 2NZ1A 2ZG3A 3WNMA 3ZE1B 3MRHB 5HVHB 3LRMA 4B41A 3NFNB 3QDMD 4G5ZL 3U30B 1E4WL 1ECZA 5LG1A 2L7JA 3F6JA 5EEYA 3RZWA 4ELKA 5I1HH 2J88H 1BIHA 1IFHL 2W88A 1J1OH 4B9GA 3AG1B 2NUTA 3HAEB 2YZ1A 2PW2B 1JRHI 3AJ7A 3VWJB 3QORA 3IGUA 2B20A 4W93A 5EN3A 5AKVA 4BK5A 32C2B 3TBBA 4HIHB 3DX8B 3IMVA 4NQVA 3STBA 2C1OA 4QRTA 3M1CA 2HTKD 4E9YA 4B9IA 2H0EA 4MASA 4A2FA 2ZXGA 5INCA 4MFHA 5DGQA 3KPRA 4FLSA 1KGWA 4YXKL 1U8QB 1WE5A 1KJ3H 2VLJB 3GBLA 3RTQD 2DOCA 3VFNA 4K71B 1KYAA 2H3NA 3JVGA 5FCUL 2WINB 1EH9A 4N3TA 1YVLA 3ABMB 4U1HB 4WRLA 3CDCA 4TUUA 1DJHA 3OGCA 3ABZA 1PIFA 5DMKB 2V5TA 1UOKA 3AACA 5DS8B 5EBLB 3L7FB 4D0DA 4ELME 3BVNB 4B3VA 3MROA 4NN6C 3VFGL 2ADFL 1RUPL 3VXOB 3SKOA 4YGVB 3RY6C 2CO4A 3BFOA 3ZL2A 2H47C 2OW7A 5E2TL 3BJLA 5G55A 3CFIC 4XB7A 5KVGL 3LZFL 4FDWA 3A0OA 4W9KC 1OP3K 2CR3A 1LD9B 1IL1A 3EYUH 1JI1A 2X44D 3BMVA 5C9JA 5DJZA 3RVWC 1HCFX 4FXGB 1R75A 4KHTL 2CRZA 2QSQA 1F02I 5D1XE 5J9PA 3LKQB 5IB1A 2O30A 3D25B 4QO1B 5DZAA 4GAJL 1NGXB 5JZ7C 1BDYA 2OMWB 4PRPD 4Y19D 3B9DA 1Q9KA 3QI9D 3WNPA 1MQKL 1UXSB 2GAZA 3VW3L 4HSAC 5TH2A 1WWCA 2W8CA 4JY6B 1HSBB 1LQBC 1PMYA 5HTSA 1BQHB 3ARFA 4LLVA 5I1AB 1C08A 2JJVA 4LEOA 5GS0C 2G3XA 1RUQH 5AZEL 4P2OD 2ZWZA 2CZNA 3GJEA 5AL0A 3FYIB 4YS4A 4R5XA 5AENA 1JPSH 2A9ML 3IBOA 3SBRA 3EO9H 1EFXA 4KMTL 5CZVH 4BFJA 3GSVA 4UQ2B 4F9PA 5A43C 3VTTA 4ADGA 5D71L 4G9DB 3RY4A 1DQLH 3QJFA 3QJUB 2QKIB 2CAKA 2XQYA 3ARUA 3V4PL 2F74B 1F4WL 2ZCKL 3IGKA 3V7AE 2XVKA 3VCLB 2VR8A 4PR5A 2VDPH 4GQPH 5IEKA 2W81C 4U1NB 5HI4C 1X6LA 1WK0A 4PCKA 2F5BH 4PRAA 2DRUA 4Y19B 2DYPB 2KPWA 3RBGA 3T3MF 1G0DA 1XF4B 1DVQA 4Y4FB 3SJVD 4X7SH 4ANKA 1I9IL 2H5UA 5HVHC 5L6YH 2WTOA 2DH2A 1Z0NA 2J73A 3RDTA 3IXAA 5CLZA 2LABA 1QI3A 3KBFA 2AVGA 3UAJD 3BZ5A 1ZHKA 3GRBA 1I7UB 5LBSA 1E8WA 5EZOH 5IJVB 3P11H 5ICYA 4P2QD 4ABUA 1J11A 1EZLA 2WTPA 1PQZA 4MD4A 3V0GA 1VZHA 1KB5H 3WJJA 5AKSA 1RCYA 2B39A 4E9LA 3V9EA 5IFJA 3MODH 3HS8A 3WFCH 5CGYC 4P23D 5CGBA 3X1FA 4ANWA 2EICA 4W68A 1MAJA 3RWDB 5IIEB 2A6JB 5IHWA 5B1BB 2MQ3A 2LV4A 2NW2A 2V5RA 4HULB 1TZHB 5KVFE 1JERA 2I27N 4PV8B 2XWTB 4WU5B 2BIIA 1GGYA 4LPTA 3LDBC 2OMNA 3D4CA 4TLUA 1MCCA 3RHWK 3BD5A 2IPTL 4KDWA 1YEFL 1G43A 5DD0L 3HI1A 2Z35B 3T0XA 4JKPH 4CMHC 1WV7T 4JZJB 3CDGA 4W9EC 1ESOA 4MD4B 1G7QB 3IN2A 3FUNA 3NGBB 3W1ZA 3VUAA 4TNVK 2XQBH 3SY6A 3WKMH 1XR8B 1KCVL 3FB8B 3MRLB 5GJTL 5IB3A 2ILLA 3BXNA 4UNVA 1TPXB 1MFBH 3L2LA 4MNGE 4OGYL 2ERJC 4UTBH 3HUJB 5I0WA 1G9NL 4UM8B 3WFDL 1I1AC 4XMPH 1TETL 4H8PA 2MOQA 1RHFA 3EYOB 1M4KA 3QDMB 3HAEH 4N20A 1ZRUA 4RCAA 1D7CA 3MRQA 1NMCB 5DWUL 2P80D 3HG0A 1FYTA 4MA8H 1F58L 3WBDA 3DJTA 1A6TA 2GT9A 1E6OL 1CO1A 4JGHA 4G9DA 1KFAH 5I17B 2IH1B 3QUZC 3P2DA 2CLRB 2YGQA 2HT4C 4LF3A 3T8XA 3H6AA 4JCWA 1N0LA 4XO9A 1F45A 2L0DA 4ESKA 5C0DB 2EDRA 3QQ9C 4XHJC 3W2DL 5LAPA 4PJIA 3F12A 3PQYD 2XN2A 2ZOKB 4MAUH 4OSUL 1DJXA 1KBPA 3CK0H 4RGMC 3UYRH 3IVKA 1C08B 4OI9A 2Z4TA 2XTJD 5EOCL 2WLLB 5D7IE 2IADB 1S9KC 5IG7B 2Y72A 3KVQA 2GAZB 1NMAL 5F96L 4HXBH 1OP4A 1KG0A 3EBAA 3RVUC 3BWUC 3N9GL 1HNGA 2VDRL 4FFVD 4LFHG 2IO5A 4BSJA 2VDQH 3ARDD 2YSTA 2WSDA 2XX0A 1WUZA 1I1YB 4E36A 3QJXA 4ICWA 3D25A 5TE7H 3LKQA 4WZ9A 1MCPH 3QAZC 5K69A 4OGAC 4XGZB 2VITA 1M57B 3QPQC 1RUPH 3RNQA 4M61A 5DJZB 1DVYA 3NABH 2RFXA 4H8WC 4EDWL 2W9DL 1B0RA 3SPIA 3ULSB 3KYOB 1YEHH 2RH0A 4HFWA 4BBWA 2WP3O 4RAVA 2NLJB 5MEPB 4A37A 2AMUA 4OB5L 4MNQD 4HGWB 5FUCE 4CSZA 3C9NB 5CZRA 2BW5A 2VZVA 2X6CA 5F7LB 3QHTC 1YDPA 1DUZB 3IK2A 3IPBA 4K94L 2WXJA 4P48A 4MZ2A 3Q06A 2OAAA 3ASNB 3EAKA 2WINA 1EZVY 3TO4D 3V0VB 1WT5A 1SDAB 2VL4A 1C5BL 4OW6A 2MQCA 1ACZA 3QXTA 4LPUA 5KVDL 1KTKE 4BELD 2JK5B 3KNBB 5J6GB 1KZYA 1AD9A 4QIRA 4ZMWA 3DRTA 2B1HL 4WJG3 3S34H 2JKWA 5EZLB 4NZTL 1U93A 4FI6A 1ORSB 1HCYA 1A21A 3LKNB 3P9MA 1U3HD 3GTNA 4O4YH 3V6FB 1BLIA 3DX8A 3TFKD 2VLKA 2F6AA 4P3CL 1I9EA 1YUKB 1OAYH 3ELQA 5CKAA 5D71H 1TSRA 1U8IA 1L9OA 2QVIA 3LMJL 1QSFA 5GRXG 2G9KA 4QT5A 5ISZB 1IM9B 1UJ3A 2WWNA 3UZVA 3PL6D 4UT6H 2OULB 1P7QA 1IBGH 1UC6A 3LZNA 4AYSA 3GMPB 5CN2A 5D2LE 4OLWH 2BJMH 3IGLA 2ITCA 2ED8A 4PYHA 2Q8BH 4DN4L 2YHGA 1O75A 3VYOA 4F8LA 1AS8A 2BSTA 2DPKA 5IWLC 5DT1L 5I1JH 4L4TB 1R3IL 4KJYA 4MJJA 5J6SA 4XN8A 3K80A 5D7JA 3DSNB 1ZE3H 4OLXH 1LNUB 1HYSD 1R47A 1GL4B 3KWXA 2YPLD 5EF1A 4MMXB 1NFDB 2IXQB 4IGBB 1GIGL 4OLUH 3V4PB 5E9NA 1F1AA 2B4CL 2AXWA 3MX0A 4WDIA 1VEPA 4LOVA 3ZLQC 1UZ8B 2M83A 4OZ4B 2EACA 3WFZA 3L95B 2P5ED 4K5OA 3A4EA 4U6TA 4X0NA 4XC1L 3B2XA 2DTMH 1UH2A 4TNFA 4YE0A 4WSGA 4JN2B 1OT2A 1LMIA 2H32A 2YPVA 1WT5C 3UMTA 3DSFH 1OGAD 5BNXD 5KS9A 3CZFB 2VR4A 3WEXB 3PABA 3CLFH 3BVTA 5EU6A 3WFBL 2FATL 4XC3H 1OGAB 2N7BA 2AJ3A 1IAKA 1AGBB 1MWAH 4P57B 2QKSA 1JV2A 1S7UA 1FQ9C 1QO3B 5KWYC 1MY7A 5IHUL 4LHUG 1NM4A 1T0MB 2N7SA 4G82A 1K5NB 3DOHA 3C6SB 1U9KA 2NT0A 2OMUB 3S8WA 3S37L 3OKMB 4YAQB 2XLLA 3EOTL 3VG0L 2EYRB 4BDVA 2C9QA 5BCAA 4UNIA 3WIIL 3ZTDC 1QHOA 4I3SL 2I25N 3CGTA 4NJ9H 4ERSL 2EEXA 4DVBB 3HPLA 2NY4D 1RJLA 3GO1L 4B6ZA 5KSVB 4O5LL 3DUUA 1AY1L 4YSDA 4BD4A 3MMEA 1U6AH 2IOMA 1T83A 1XMWA 4UDUA 4Z3TA 3FUHA 3QWRD 1M71B 4JFED 2ADIB 4GMTH 3OKOA 1E6JH 5BQ7B 2EDLA 3FBKA 5IKCB 1GW6A 2DQDH 4F3FA 3F7VB 4JO2H 4EI0A 3U46B 5AAMC 2GJ6B 4AKQA 2BNUB 1OTTD 3T4AC 3K5SA 4Q2ZB 1OW0C 1CGTA 1QFOA 4N0RA 5EZPA 3U6XS 4CC4C 1XIWA 1YC8A 4TMPA 4YLBA 1AJ7L 3LEVH 4YVNA 4DH2A 2NY4C 3N04A 3MUHL 2IF7A 5JW5B 1GC1L 4GRMB 4OIIL 4BA0A 3RUGA 2N1KA 4JQIL 1BQKA 4O2FB 1MF2L 3VFWA 6PCYA 5JPMB 2BCKB 3QH3A 1SDDB 2X40A 1CLOH 3C08L 4JPIA 3M88A 3MYJA 4P5TC 1VFMA 4JO3L 2Z1PA 5GISL 5DHYB 3TIDB 4AGQA 4ZUUB 4NP9A 1PKQE 4LOUC 1YEDA 1KLUA 2ICEB 4N8PA 3P40A 2RTTA 3QEGL 1II4E 3HZVA 5AW2B 3L9RB 2APTA 1NCJA 3OAUH 3WSQH 2DF3A 4GT7A 3RNKA 2VDQB 5IFAH 1RZ7H 3GSUB 4FX5A 4N2DA 5JHLL 4B9KC 1KV3A 3I50L 3O6LH 1H3PH 2ZCLH 1NMAH 2VR3A 3QXWA 3KJ6L 2FHFA 4NDMB 4PVBA 1NIAA 5IQOA 2HLFD 4P05A 2R4SH 5FHAL 3K2KA 1JZHA 3U83A 4NO2A 4JM4H 1CDIA 1E9PA 1QSEA 2DY2A 4ZUSA 4XBEH 3ZZLA 3AS0A 1VEOA 4FZEH 1MCSA 1F3JB 1JTTA 2NY5L 5DJCA 2WZPD 4ZTOL 1CB4A 4O2EB 2HG5A 1KXQA 5E0QA 2MOVA 1XGUB 2CXGA 3QYCA 2WSKA 5AQ0A 5EC1A 3QDHA 3US9A 3UTOA 1XV8A 2VW4A 2CRMA 3DMMA 3IBEA 1BX2B 5C92A 1HHHB 3RUGE 3VFGH 1LO2L 3CK0L 4HKJB 2KUTA 3RE0A 1HS6A 1RULH 2YUWA 1MCWW 3EJYD 3RJQB 4ZO6A 4EUPH 1GY2A 5DCCA 1RV6X 4XBGA 4U2YA 3VFVB 3QS2A 1YEGH 3T2NL 3QRFM 2G2NA 3FCTA 3O2WL 2GY5A 4QRRD 1WH0A 4R7VA 1OXYA 1ZEAH 4JKNA 4KQ4H 1JBJA 4G42A 3M1OA 1LL1A 2J25A 2NY2C 1BZDA 4TTDD 4WHTB 4FTVD 3VRIA 1Z9OA 3B1UA 1NCNA 2HWZH 1A9EB 4RISH 3H7LA 3ISWA 1N2RA 2CDGB 4N9GB 1OZTG 2VDLH 4W70A 4J3UA 3BLKA 3NCBB 3MNMA 5DK2B 1PY4A 4ZODA 3EJYC 4A7GF 2X6BA 2BS71 3SZKC 3I75A 2BY3A 3QG6A 4LCCB 5I8KH 4HIIA 2IGTA 3DK0A 5JDSA 2KDGA 5I28A 5IFHH 5EO9A 5F3FA 4KV5E 1JGDA 2FEEL 2EH7L 3ILDA 3ZXAC 1UASA 2ZUUA 1HI6A 4L37B 4N3UA 4KTGA 4TLTA 3BH8A 2VLRB 4GMSH 1FFNA 1H15B 5FCUH 3OV6A 3NP3A 2DWDA 5IF0A 4DOHE 3OL2A 3UIYA 2EIKB 4KWUA 1NCGA 1MFEH 4UQ9A 3VE0A 1AAJA 4MRCA 3PHOB 5KOVC 3BP5A 1IAII 2DN7A 3BWAA 5FK9B 3ZDYE 5ITFB 2BOBA 5F6IB 3HLKA 2GJJA 3X11A 5ITBH 4NQEB 3PJLA 3C5XA 2PF6A 1I9IH 3P3YA 5I18L 1LWHA 3SQBA 3EYUL 2FWOA 4FXTA 2VM9A 3OKLA 3BPOC 2AV7A 4GAAA 3BEVA 1MN4A 2HMID 2VXSL 5HDBE 1CICA 4H25B 3T5WA 1AQMA 3MLZH 3O9WB 1Z9PA 2NNRA 3B56A 3BPNB 4HT1H 1KXQE 4WCYL 2BHUA 4LHJB 3HJ0A 4I4WB 2E7CA 3PWPA 4LDLB 4WI4A 7CGTA 5CIPH 2JKLA 4G1MA 5F1OB 5K9KB 1CI5A 3TNNB 4TULL 4Z7WA 1MIEL 1B0GB 1LP9E 4HBCH 4U1GC 3U2SB 4LAQL 2TAAA 1BXAA 2HTLD 5IB4A 3GEWB 2PO6A 3FQWA 1J0KA 1CT8B 4YHIA 2UZPA 3UPRA 3D05A 1BVLB 3DVGA 4Y5YA 4TVPL 5C0RH 3KLHC 2P5WE 5EU3B 1XF2A 5J1AA 5K39A 3UG5A 4QY8A 4NO5B 3HI5H 4F15B 2F0CA 2DI8A 3NP4A 5B22A 4AENB 1M7IB 5ETUB 2ZCHL 4XPGL 3MGOA 3C6LD 4AC4A 2R69L 4OZIF 3U9WA 3SDYH 2QQKH 4P23C 3UCQA 1WICA 2VXQL 3O6FD 2A83A 2X87A 4NNPH 2BSCA 2OXHA 4MB3A 5L6YL 2IALA 4PIBA 1RPQA 4UF7C 2OMVB 2EC8A 3FONB 2ZG2A 5AW6B 2W95A 5IROA 4CW1A 2OS7A 3BUTA 4PPTA 1MHCB 3TBCA 4TM9A 1A1NA 4IOSD 3BT2L 4EXPX 2VO8A 4FNQA 4YXLH 5KYYA 1TZIB 1ZT4A 1FFOB 4UT9L 2NNFA 2AQ2A 4LHUA 2EIEA 4AXWB 1J1XL 2D7QA 2HVBA 4R83A 2V17L 4MX7B 1ZWIA 4OCXH 1YMME 4NZ8A 5IGXH 1WA1X 1JGEA 1JPFA 2Y6SC 5IUSA 1QYGL 1P2CB 1UM4H 1IFRA 3RDJA 3ULVD 3CHPA 2IPUK 4AQ1A 3HC0A 3ZYJA 2SEBA 2JCCF 3FW6A 3W2DH 3LV3A 4Y4HB 4GRLD 1QLRA 4S1QH 4KKLD 5BRQA 1KPRA 4OZHA 3CLEH 3D9AH 4J3OD 5EHFA 4YK4B 5C08D 3WJJC 4D8PB 4WUUD 1KWGA 2ZXAA 3ARBB 3MLTB 4JEGB 2CBPA 3QULB 1IIIA 1ZY9A 3QPXH 5C0AE 5E7BA 1I4FB 3FCUB 1XAUA 1ZANL 1ZGLP 5CUSL 1NPUA 2OL3A 5GRUH 2EINB 3SGDI 3AT9A 5AVYB 4OFQA 1U8PB 3EYSL 3RU8H 5F9JB 3GRWA 2ZE0A 1M7XA 1DVFD 4NSKB 5C8JA 5B39A 3E1F1 1LO0L 4BQ6A 1KIUB 4N87A 3T9WA 3OAUL 4C55A 3CX5K 3O11B 3F7YA 3VYNA 1ZXQA 1KIQB 4N5EC 4MBRA 1J5DA 2R4SL 5FHAH 1TVHB 4AGPA 4JL2A 4IK6A 2E76C 1A9BA 1T20B 3HMXA 1I9RL 4E9VA 4UMGA 4IRJD 4G80B 5I82A 4OLEA 3E8UL 1L9QA 3I6GB 2LU4A 1BZ9A 4X4XB 3QW9A 3R06B 4XBPA 2ZX9A 4Y9BA 5E8OB 5JW4N 2APVA 5GRYA 2ENQA 3RIFK 1RZ8A 4LLYA 2Q86B 4ODTL 5D4IA 2YD1A 4QRUA 3JV6A 3GXNA 1DL7H 1S7SA 2IFGA 2Y2TA 5AVSB 3IFOB 2JI1A 3VA2C 2X9WA 4FFYA 4XN1A 4MSWB 3G5YB 5CD5D 1ES0B 3V4VA 2CXKA 3QNXA 1PZ5A 3MFFA 2YLKA 3T0VA 3BKYL 3HPJB 2CQVA 3DURB 3MTRA 1X5AA 1RZFL 3OJDB 4N5ED 4EBQL 2OK0L 1CD1B 2HN7B 5F8QC 3K71B 1M7DA 2E6QA 1TENA 4LVNC 2NY0B 5HHVH 4WHCA 1GPOH 3SGDH 3U1QA 1OAZH 5H2BA 1S5IH 2QGCA 2NT1A 5E2WH 5G5DB 2P52A 2LOEA 2MSPA 5I0XA 1SQMA 3LY6A 2G9HA 3QG7H 2G75B 4UT6L 3AY2A 1YUHB 2AQSA 4YDVA 3T09A 3KPOA 1MWAL 5IW1A 1AR2A 1JPST 2DBJA 4XP1H 1AZVA 1G6RB 5E4EC 3JYBA 3SKUD 2N01B 2YD7A 4G7YH 3BISA 2UVEA 5KOMC 5J6HB 2DM4A 2BNQB 2X4OB 1WIOA 4K7FB 5BV7C 2YAFA 5EIVA 3VSUA 4WTQA 5CJ8A 5HPMB 1T1ZA 3C5ZC 2NMSA 1DCEA 3FFOA 1WFUA 1FNGA 5I76A 5C6TH 1SN2A 3ZDXF 2W91A 4J8RA 5KBNC 2YGVA 1FO0B 3K7UA 2R2HB 5T5NF 2A9NH 4AQAA 1HESA 2H2PC 3QEUA 2BSSA 2Y1ZA 4PJEA 2HH0L 4X9BA 4BA8A 4CC0A 1PPIA 2XICA 3U1SH 4G7SB 1XIWD 5M7QA 2EDYA 2C9SA 3WY2A 4ZMPA 2BZDA 2HFEB 2W38A 4KI1A 1LJMA 3DGGA 3WAKA 4BK4A 5HYSB 3EO1B 3JWNE 3OHMB 3WKNA 4JFYA 2EYSA 4RFNC 4IBYA 3LEVL 4X98A 1LO4L 3PRZA 4LCVA 1L5GB 1U4EA 4B9JA 1CDBA 4M48H 4JR9L 3L3KA 4P5TD 1UCBL 4Y5VC 1RURL 2J57A 4X7EC 5GJSL 1EAJA 1BBJB 2V7HA 4RMQA 5DHMC 2HKFL 1DQQB 5CSZB 4XWGL 3NOIA 1HHIA 3CVHB 3SCMB 4Z7OB 4E9SA 3AXHA 5IOKA 2BNRD 1UCTA 4FYQA 4YC2B 1A8JH 3MA9H 3RILA 3BKJL 2XBTA 5B38B 2NX5B 4Z9KB 1Q9LA 2OMXA 5A7BA 3EOBA 1FLRL 4MXVF 5BO1H 3P02A 3OG4B 1EAOA 5F88B 3ZQXA 3GUTB 1E4JA 4Z7NE 3ULUH 2F7PA 3NJGA 2HJFB 3RJDA 1M2OA 4IRZH 4RQQA 4X83A 1CFMA 1ETZA 4NUQA 4X6DB 4NRXA 4Z77B 1RZPA 4AQ1C 3GHEH 2DKSA 2FBJH 2PR9A 4M5ZL 5BRZD 4JQIH 1MFAH 1A3QA 1R3JB 1ND0A 4QXGH 5DUBA 1LP9B 5I71C 4PJCF 4G8EB 2E59A 4L1TA 4NQSA 4KNSA 1FRGL 3GHBH 4PP2A 5KSUB 2R1YB 4LSUH 3D48R 5KW9L 1EMTL 3FO9A 1DCLA 2BNQE 3HG1A 1R6VA 2FAUA 3J8F7 4MJ5A 1CGSL 1AZNA 4TLKA 3NA9L 4NLHA 5K9OB 3CQQA 2ZCLL 1YO4A 5DUJA 2XACC 4QRAA 1CFNA 4PRIA 5BUGA 3O3DA 1NSNL 3RB5A 3FT3B 4OJEH 5GRJH 3WY3A 1FZOB 3KLAA 4MJ6A 4KXBA 4QHLA 1F58H 3B43A 2CKNA 5BZWB 5JOFB 3GMNA 1U6AL 4PJ7B 1I9JL 1OD9A 3WLWC 2H1PH 2AS5M 4HZ1A 3L7EB 1AZCA 1UKQA 1P6AB 4U6YB 2WQ8A 4GB9A 3FB6B 1HXYA 1P7KA 3CDFA 4WNQB 5FEBA 5MEQB 1JF6A 2P80A 4GLRI 2FE0A 4LP5A 5EFIA 5JORA 4LPXA 2R15A 2VZSA 5IQ9B 3SDCA 3GLEA 1XGQB 3SE3A 1JGIA 4FCAA 2Q9OA 5FWQA 1SXCA 4RGOH 4XCEB 1JPTH 1KB9K 1LO5A 2SODB 4EZKA 1CBVL 5IHUH 3DVIA 1F6FB 2Y5TB 4A6YA 4ZUWB 2VIRB 2VQ4A 3WGUB 2B5IB 5LB1A 1AD0A 3GMRA 4LHQB 2DLEA 1CVSC 1MCKA 3T6WA 1KJ3L 1QI4A 2IDQA 4LGPB 1LP9F 3ETBF 4LLWA 4GP4B 5E9DA 5I8OH 3R8BB 5CZXC 5DTFA 4DSYA 2Z0UA 1RK7A 1FFPB 3OKDB 4WJ5B 3IAGC 3JBG7 4MB5A 4ZQKB 1T5WA 4L4TD 2DI9A 2MQ0A 3DC0A 1S9XA 1NAML 3BHBB 1EO7A 3T6QC 1JGLH 3FB5A 3U36A 1FUNA 3S5LB 1UATA 3NCJL 3NPSC 1QMUA 3NFSL 1MNNA 5EA0L 4K7PX 3OR7A 3EGSA 1TFPA 3P4OA 4QHMA 5L2JA 2DH3A 4A6YH 3DKHA 1YSOA 4D94A 3VGHA 5FV2A 3SE4A 2C7FA 3WMQA 1FGNH 1WFIA 5B3JF 3CBKB 4YBQC 3OKKA 3TEZA 4JRLA 3PDGA 3SD2A 5CWSA 4H8UA 4ZFOL 4I85A 4OAWB 1N19A 5IHZB 4J6IA 4X7CC 1I1RA 5I1CH 3VDBA 1M05A 5J13B 5FGCE 4NCDA 4R8WL 4MMZB 4R3SA 3EH2A 4NHCH 2RA1A 3ISYA 1KXVA 3DUSB 2DQTH 3CFCH 4BXSV 5TQ2L 2R56H 2KZBA 1JD7A 1FO0H 1BAFH 2BXZA 4CVZA 1OALA 5I8CA 5JQIB 1ZHBB 3A67L 4OZGB 1VGKA 4LSVH 1BA9A 1L9TA 1YPZF 4YSCA 1YMMB 3L8QA 3LRLA 4GI9A 2FRGP 1QG3A 3HAEG 3LNIA 2HH0H 4XCYA 1T1YA 4HXAH 5FO9A 1F56A 1MH5A 2ZYRA 4M6AA 3QHFH 2HUEA 4Y4FD 1SZNA 3QXVA 3X1BA 2VDKH 1QI5A 1F00I 1WC7B 5HPOA 1LE9A 1EUTA 4BFNA 2NY5H 3A23A 2ARWA 4HUUA 4TSAH 4XOBA 4PB0L 3MHZA 3I02B 4IOSA 4MAZA 5T1JA 1L7IL 4WWID 5FV1L 4A04A 2WLHA 3FRPB 1YQ2A 2IQ9L 1LO4H 1AZRA 2Z64C 5IWLA 3DX7B 5CJBA 3ARDB 3IN0A 1L0PA 3OKNB 2O72A 2F58H 3CVHH 2IDFA 4O51B 3WJLA 4HSCX 1CIDA 3M45A 1N5YH 2AW2A 2IAMA 2P5WA 3V55A 4DESA 1C5CL 4F7MA 2Z7ZA 4B9PA 2A77L 4L5FH 5FC9A 4Z7QB 3R0MA 1UWXH 8CGTA 1BGXH 5DQJB 4I77H 1EAPB 1SJXA 3HKZA 4UILL 2RR3A 4JPKL 2AC0A 4QI3A 1DE4B 1QBMH 5EOTB 4QAWA 2OX5A 5DYFA 1JTOA 1TTRA 3HFMH 1IGCL 2YEQA 4JQVA 2FTAA 1QZ1A 1H3UA 2NPLX 2DQFA 5DS2A 5DU7A 5E6YA 5HHQA 1QD0A 3CZUB 4OUUA 3T6VA 5EOCJ 5AVQB 5KJ7E 4JL1A 1MRDL 2AQTA 3FRPA 5LNGA 1NC4B 4XVUD 3ZVVA 4W9FC 1Z0MA 4Y1AB 4XXWA 4Y2DC 1VGEL 4ZW6A 4ZOEA 3NZUA 3U6RB 1H3WM 4W9ZA 4OFPA 2FYYA 4ANXA 1KBGH 4G8GB 3ROLB 3UERA 1NDMB 4XPTH 1BOGA 3TL5A 1AZBA 5BMFL 2O61A 4FABL 1ZHLA 4AT6B 3PGFL 4EI5A 3M46A 4KFZC 4AMWA 2ZD0A 2XQYK 4PI2A 3ARGB 2HJLA 3UZQB 5I9QB 5JPNA 3B3IB 1VDGA 4OCMC 2CGZA 3CVBA 4Z3EA 5FPIA 4DEPC 3GRGA 3HE7A 1JMXA 3D39B 5GRVK 4I5BA 4CVZB 4XVJH 3TPUB 5HHOE 5LGHH 3WE6A 3D4GA 3VM5A 5EEVA 3ZTCC 1F6LL 3UBXB 1NDGA 3KPNB 1GKEA 3DV6A 4NWUL 2CG9X 4R3SB 2Y36L 4DGIL 4TVPE 1MZYA 5HJ3B 1HYSC 2XT1B 4RRPM 5F7KC 1ILUA 3L08A 3TBSA 4ZMOA 2EIDA 5CD3B 3T04D 2XA8H 4HKZB 4LGRB 1AGDB 3ZIYA 2APBA 2K8QA 2DTSA 2IBZX 2ZAIA 3D39D 1XCWA 1HXMB 3IMBA 3AROA 3OM3B 4ZQTA 5DJ8A 1MAKA 3I9PA 2O1AA 4R4BA 1LILA 3T4YB 2YJQA 2BHZA 5H37A 1MUJB 2V4LA 4OFIA 3BIAX 5E6IB 5KBMA 4Z7OF 1L6ZA 5CCKH 3T0EA 2P5PA 2X38A 1T1WB 2XN1A 3R18A 1KDIA 4M9PA 4GRLC 3QSKB 1EGJL 4KKCC 1HTYA 2DL2A 2IQAB 1PDKA 4CRPA 4BSWA 1D5XA 1SDYA 3MRRB 2C9UA 3BPLB 3LPGA 5JXEC 1YYLL 1CE6A 1U8NA 1G1CA 2QQQA 4P2QB 5IESH 4BRVA 3VXNB 1HU8A 2O5YH 4GXUM 2E7DA 4CC1A 4CNIB 5F3HA 3EGDA 5E9DB 4X7TB 3HB3C 1LXMA 1Z5LB 4LLWB 5I75C 3B9AA 4JHWH 4F8NA 4YDLB 3V4VH 3GLDA 4EVNB 3MREA 1A7QL 4HLEA 1FIGL 3CN3A 1USZA 4S2SB 5CFAA 1KT2A 2XETA 4L8DA 4DKFL 3NZHH 1OSYA 4A6YB 5IJKA 4UDTB 2OYMA 2HT2D 2VDML 3POCA 2XHNA 1MCOH 1PD0A 2R69H 1BW8A 3U7YH 2AGJH 1F0LA 4FTVB 3ESMA 3Q8FA 2GUYA 2WCGA 3R19A 4PTUB 1AKPA 1G7LB 3FF8A 4G8GD 3MUGB 5H35A 3S0PA 3E8VA 5EC2B 2QZ5A 4OGXH 3RX5A 3C2AL 3GBEA 3TIEA 2ZX8A 4U6YA 5FB8B 4OZFB 5DGRA 3AC0A 1VRSA 4MYWB 4FKEA 3RZCA 1F4XH 3HB3D 4RMWA 3AXIA 4WW2B 2R0LL 2VLME 1MJ7L 4L2YA 4F9LC 3IKCA 4Z7WE 3GMNB 3KYNA 2CKBA 4BFIB 5CJXC 5JOFA 5JA9A 3JWOH 1ODAA 1T0OA 3NN8A 4U3CA 3RA7H 3QUMB 4GBXB 4XMLL 2IBBA 4PRIB 3VX1A 1CFNB 3ASWA 3F8UB 3PUUA 3MV7D 3HNVL 1LK3H 1QVOB 5L88H 3KLKA 3RLSA 3FQYA 1CXLA 2ZOLA 4UTAL 2R39A 4PRPB 5GJTH 2ADYA 1ED3B 4FYSA 3FSAA 5CO1A 3TJHD 1IRAY 3EJSA 4OZIE 2FJHB 2JQZA 4KO5A 2TSBA 3FO9B 4Y2DB 3ZQWA 5BOZG 4GKOA 2X4UA 4MB4A 1CYWA 3DPBB 5T1LA 5D7IA 3KWWB 2Q7YB 5FO7A 2DQEH 3ESNA 4M7JL 1A4KB 3KGRA 3IKKA 5I1DB 1N3NA 3ETBJ 3MNWA 1QFUH 3KVDD 3DX9A 4AG4L 3S5LG 3AB0C 5E1AB 3NSFA 4XZUB 1XB6A 4X6DA 3RX7A 1WWAX 2UZYB 3I9IA 2KMWA 1FA4A 2YBGA 2ZKYA 3DXAE 2B9AA 2CO6A 3I6SA 4M29A 1TTBA 2NXYB 4GRWF 3CCHA 5HI3D 3SHSA 1ZTXE 3MN8A 3DIVA 3K8MA 5EG6C 1ZS2A 2MFNA 4F8OA 4OF3A 5HD8D 5HI4D 2FB4L 4YIQA 3Q5TA 3GIZH 2R56L 4GIAA 5DYOB 2FDBP 4DERA 4PRBA 4WW2F 1TZGL 1NBYA 2ARJB 3CSYB 3H9YA 4WAFA 4CVXB 3CFBB 3FUJA 4DTGH 1S5IL 4JO4L 3UGXA 2BVTA 4NQXA 4MCZA 2BS8A 2DWEB 5AYUH 2V7HB 4MTMA 3QQXA 4OTXH 3BOVA 1J8RA 2V0AA 2WQAA 3RX8A 3T1FB 4FA6A 4AMKL 2CDEB 3L3KB 4K07A 4YO0A 5L4MA 1UGKA 2EXSA 3L3GB 4X98B 4B60A 3CHRA 2MQGA 3D09A 3DUHA 4J12A 1LE5B 3K1DA 1JWMA 4ZS6C 1YY8A 3QORC 4BK5C 1G7HA 1CICD 1NCUA 2Q0ZX 5CGMA 1W72H 5IMOB 3EZJB 3DJSA 4M8VA 4ONHA 1U58B 2WAHA 3SGEH 4DKDC 4M7LH 2ZYSA 3GUFA 4NCC2 3CVIL 4BKLA 5I73C 4UV7H 5TPWH 4F5CE 1OM9A 2LLGA 3EH4B 4GW5B 4B97A 3FO2A 1J9RA 3VXRE 4C56E 4HQQH 3KYMA 5FKAB 3QUZA 2V9QA 5CIPA 1FHNA 4ZD3H 4Q8BA 2XKNA 4ZMXA 4QXTB 1MHEA 1JNJA 3X3GH 1DQDH 2DV6A 4XP6H 5EUOF 1MRCL 3H2PA 3ATFA 1AHMA 1KNOB 2Y07L 4OV5B 3NZ8B 2GCYB 2ZNWA 4BEIA 2BZ7A 1T6BX 1UB6A 1FZMA 1NCWL 5ABZA 3QQ4A 5IQNA 2B08A 4AM0B 5A6LA 1EA9C 3EUDA 5CF3A 4X6BB 3SYQA 2YMOA 5KVMC 4YXLL 4X4YB 5KYNA 4YQXL 2X53A 4Z78B 2V2XA 3HMWH 2IPTH 3MCLH 3HE6D 3OPZH 6FABL 5CJQL 3CBJB 3AY4C 3BMWA 1T0PB 4N85A 1SOXA 3IE9A 2RAMA 5A3ID 2XQBL 2BWQA 4P3WA 2V5YA 4P2AA 2WXRA 4TRPL 4PJ5B 3DURA 2EC9U 3KPRD 1NIFA 5FYKL 2I9LA 1YY8B 3AVEA 5CEYB 4XVJL 3FHAA 1Q94B 3RTQA 5IFAL 1LE5A 4PUBH 4L4VB 3IFOA 2KYIA 2I26N 2WCPA 1S7SB 1PZUB 3N44F 3JV6B 2H1XA 4QRUB 3Q8CA 2VC2B 5D1ZA 3KGTA 2VTFA 4FNPA 4AITA 3RVTC 4YHKH 2A4EA 3GJFK 1T20A 2QVKA 2G3ZA 3FQUB 1TVHA 5B39G 3ECBB 4NCC1 2YRZA 1IE5A 3CFBA 1XCXA 1NBYB 1B6UA 5E6SB 3V79C 3FT4A 2PCPB 2VOTA 3OTTA 4QOKA 3QEQE 3MRIB 4JS7A 1BAGA 4K3DL 3SGJA 3D85D 4HUWA 4AM0Q 4MAUL 5FOBB 5I73B 2Q1EA 5DJ6B 3WEMA 1ZLDA 3UROR 1JXJA 4PJEE 4AE0A 1MFNA 4Y4FC 1DANT 3MRMA 4JFOB 3VTAA 5JXEA 5FCSH 4WO4B 1FLRH 5D1QC 2N7AA 1NSNH 4DPAX 2CO6B 3O4LB 2V3FA 1B3JA 1GZPB 1WDAA 2QDWA 1YMHA 1QOKA 5E1AA 3DJRA 3DX9B 2F19H 3QULA 4FXKA 4LFHD 4IU3A 4L29A 2X2YA 2EXYD 3ARBA 3MLTA 3P3TA 5FO7B 4D3CL 3VFOA 1TQVA 1IKFL 3DPBA 4PMFA 3MVSA 4UQBA 3OR6A 4QXGL 1KPRB 4LOFA 2VXVL 2XWEA 3WCYA 1N26A 3K6FA 1ED3A 3EF4A 4EMZA 4IYKA 4KHXH 2WXPA 2KI6A 1TQTA 1PX3A 3HE6B 4AQ1B 5KEZA 1ZK9A 1U8CA 1SJEA 2E4FA 2ZCZA 1JGEB 1UWEL 2D7NA 4FFZL 4R97B 3RL2A 3ZHKA 4DOHB 1ZWIB 4GKSB 1AXTH 2ZX6A 3MGTB 1NGQL 1YECH 4KZCA 4QLRA 1WTLA 2YRBA 1AMYA 3IJEB 3K91A 2IDTA 1FFOA 1O7VA 4OCLC 3V5DA 1TZIA 1ZT4B 2J72A 5E1QA 1ID2A 1IC4L 5KN5A 3MJ7A 1USQA 3UEQA 3BW9A 4MVBC 2QLYA 2OCJA 1Y18B 5AAWC 5AL8A 2OMVA 3R1GL 4U1LA 4XAKD 7PCYA 2I7OA 2OL3L 3QJOA 4PTUA 5LQBH 3HNTH 3NFSH 4G7YL 2KQMA 4OD3L 3ZL4L 4JHBA 2A83B 1NOAA 4H26A 2PPAA 3OMNB 4FFTA 2PO6C 2FECL 5KYWA 3GM0A 5DZLA 2EJ1A 4AJVA 4YK4C 1LQSR 3DROA 3L13A 5DJ0A 2BNQD 5JOPD