3ZTCC

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
141
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 141
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3ztcC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3ztcC01
3ZTCC 4W9EC 3ZRFC 4W9KC 4B9KC 5LLIC 4W9DC 4AJYV 4B95C 1VCBC 4WQOA 4W9HC 4W9FC 4BKSC 3ZRCC 4AWJC 4W9GC 4W9CC 4BKTC 4W9JC 1LQBC 4W9IC 3ZUNC 4W9LC 1LM8V 3ZTDC
chains in the Genus database with same CATH superfamily
1S7WA 3PIQA 1IT9L 1HVXA 5HYSB 2J5WA 5SV3A 3M88A 4IRSD 1KTLA 5FDWA 5L4MA 1M7XA 5IVNA 1CFSB 5I1EH 4AC4A 2HRPL 3LN9A 4K3JL 1E2WA 1ML0A 1II4E 4WSJA 1MZYA 2XN1A 3ES6B 3QDGB 4EDXA 4FFVD 4JN2A 4HIHA 3C8DA 4X6EA 5GZNC 1I9JL 2BSBA 2EILB 3RRQA 1MH5B 3KL5A 2NQ3A 4TVPE 2I60H 3WIHL 2VC2B 1P7QD 3GNMH 4Z1PA 2NY0C 4U3SA 4X5WA 3WS6A 1KGWA 1RJLA 4KJYA 2BOBB 3V4PL 2ZUSA 3SGJC 1MAML 1ZV5A 3WLWD 4U05A 4AV5A 1MFDH 3DUHA 3U1QA 4UQ2A 4NKOB 2JB6A 4JFVA 4GG8B 5ITBH 4LIQL 5IWLC 3NJMA 1BMZA 2UY6B 4EQ3A 4D9RE 5DVNA 3MGTB 1NEZB 3NJGA 5C07B 4KK6C 25C8L 4FHKA 4XBEL 4AQ8C 3M45A 3KPPA 3QG7L 2AJZB 3U4AA 4HIPA 3DBSA 4V1DA 2ENQA 2WUCH 2QV2A 3AGWA 3MNWA 4XMVA 5D7KE 5GGRY 3JZ7A 1I7TA 1AGCB 4W9EC 4Y1AE 1FNAA 4J27A 4FNUA 4GRLB 3L7EA 1TZIB 3UIZA 3PFQA 1JAEA 3MVSA 3MTRA 3NZHH 1BVLB 1YYLH 4H20L 3LVTA 4MA7H 3FOMB 2VR3A 1XCWA 2F8OA 3ARGC 2QQLH 5I17B 4BFNA 5CFAA 4Z7OE 2DEYX 3GLZA 3NCWA 2OMYB 2ZWSA 4ES8A 1MW1A 3Q2NA 2ZOKB 4AQAA 3C6LA 1UT9A 3UZVB 4N2BA 3LXUX 2BSSA 4M7JH 1AMYA 1U8MB 2EXWC 2OXHB 1KENL 5JW4N 1KFAH 4PRHD 1CL7L 1NA8A 3EH1A 2F58H 3GI9L 4OFDA 1H6TA 4TNFA 4ADJA 5L0QB 1MHHA 3SE3A 1NAKL 5EZPA 4HH9B 2EDXA 1BGXL 2Q6WA 1IC5H 1MCPL 1NM4A 3L3KA 1MCLA 4KPHL 3E1F1 4FNRA 1NANH 3S34H 2KDGA 4JKLA 2H32H 3SDCD 5ANMB 4G59C 4LRNL 4W9CC 2Y3AA 1JMZA 3VWJB 1BEYL 5FO7B 1X5XA 1H3UA 3UEZA 2XIIA 4OCXL 1UWFA 3T4YB 3W9EB 4WW2C 1AKJA 3WNMA 2AGJL 2DI9A 1A7PH 3O2DA 1M9WA 4G7SB 4PV9A 1EHAA 2AQ2A 3ALPA 1SJXA 1TITA 4I3SH 2FJGB 1BYPA 1D7BA 1EFXD 2BO0A 2WQAA 3S8GB 1NGZB 1DDHB 3OV6A 1NCWL 1U8OA 2R69L 3QI9A 1VFMA 2CA3A 1UD2A 3GSNB 2FWOA 4JFQB 3OLIA 3ZZLA 2VSCA 3HG1A 3ML8A 4O2EA 4L0YA 3WJJA 3TBYA 1DYZA 1OGTB 5L8KB 4YE0A 5JO5B 2BHFA 2XTSA 3LZFH 4HLZG 4DSYA 3GUFA 3H9SA 1S7TB 3GXUB 4MTMA 4FJ6A 2XIDA 5GS2H 1HEHC 3RZCD 1AHWA 3KWXA 1KJVA 4ODUA 3GUTA 1QA9A 4WUUA 1IJ9A 1FPTL 2VDNL 5KJRL 5HHQA 5DFAA 1JPEA 1WA0X 4KX8A 4R4ND 1DO5A 4NQCE 1F45A 1IARB 1J05B 4JPIA 3TA3C 1NDTA 3RA7H 2A74A 1VEOA 3IJSA 1JP5A 3G6AB 4XZUA 2XFXB 1WUZA 2CJ3A 5J56B 4RMWA 2GT9B 2L3BA 5TE7L 1QX1A 5FFLA 3H7LA 1LO3L 4KJQD 5ICYB 1IAOA 4CC1A 1FVDA 4LPWA 5CD3A 2PCYA 2W9DH 3DBXB 2Q1EA 2FBRA 2OQJA 5AW4B 5FO2A 1EUUA 2IANE 1OB1A 1YNLH 3OTTA 4I2XA 4AMWA 1CFQA 3KPNB 4DIXA 1SVBA 3FQNA 1J10A 1SN0A 2QVIA 3QJHB 3NG5A 5DU7A 1WAAA 4QO1A 4NWUH 1KTBA 2KH2B 1FN4B 1C8PA 2ICEA 3ZDZE 2CM6A 1HWHB 5LBSA 4QXGH 3N42F 1U8KB 1ETB1 2HT4C 4RQQA 4M5YH 5D2NB 5LNGA 5AVZB 2J6EL 5B8CB 5I0XA 2ESVD 2OMZB 1FORH 3DUSA 4EVNA 1VFBB 5DJAB 1ZLWK 4D9LL 4ODHL 3ATDA 2NCMA 4OTXL 1MCJA 3HG5A 5D1ZA 4DFIA 1AD0A 4PJCE 2X4NB 1U8NA 5IMLB 1CU4L 1QRNA 3ET9F 5C0FA 2NY7L 2UV3A 2FR4A 2BOCB 4FRWA 4OZHB 4Y1SA 5MP6L 2IQ9L 2F53B 3OB0K 3MJ9A 1TJIH 3KPLA 4BFEA 3BDXA 2BHUA 4YHPB 3IU4H 2VDKH 4AV4A 4X4XA 1JZGA 1UACL 4JO4L 1PPIA 2L8AA 4FI8A 4MB1A 2V4LA 3P3RA 1IQWH 2ZP0T 3MV11 2R56H 2YD3A 4KNTA 2F7IA 2VLKA 2AEWA 1NL0H 4P4KC 3VFUB 4M6ML 4J6IA 1PD6A 2E27L 2X70B 3CZFB 1MCWM 4NC0B 5HD8C 1LP9F 2MTPA 2FX8H 2AQQA 3SCMB 3EH3B 1NGQH 3GINA 4JANA 2YA2A 2I9TB 4OV6F 3NCJH 3MRMB 1NOFA 3IDGB 2MCMA 3CC5B 1CLZH 3QFDB 2ZF8A 3ZU8A 3K81A 3UBFA 1I3UA 5EEXA 2OMWB 4HCGA 3NSXA 4MQTB 3MYJB 4IQHA 4KXAA 2XXFA 3ULUD 4G6KL 5IBLD 1SF5A 4ODSH 4QGTA 1I4FB 4ELKB 1E7UA 5A2AA 4LSPL 1RURL 2VW6A 3ZHKA 5FO8B 5BUGA 1FE8H 1QI3A 2DQFB 3J07A 3CAFA 3RBSA 4CSPA 1JNHA 2EVJA 1J0JA 1I3RB 2LVEA 3GJFB 5EZJB 3U9WA 4UTBA 2RACA 1WCQA 1AHMA 3QPQC 1LP9A 3KYOB 4G5ZL 3UTSA 4X6BB 4QWWC 4XT1C 1KCUL 1RUQL 2WD0A 3BKYH 3NAAH 3M7FB 2V9TA 2QFRA 4OLZH 1GTNA 3GI8H 3G5WA 3BZEA 1WZ1L 2R1WB 2W59A 4E9TA 3GKWH 2XZCH 3TNNB 5D1QB 3BH8A 4PJAF 1WYJA 4MXWH 4CGUB 4DN3L 1Y0LA 5EDXA 3EFOA 5J3HD 3WJMB 2QGDA 3FO9B 3OZ9H 3S3BB 3F00A 4FQLL 3L3JA 2CQVA 3X3GL 4F27A 3IDNA 4XVSL 3E8UL 3VGGA 3ZLQC 5BV7C 1Q9WA 2CE6A 4HWZB 3K91A 4XNYH 2BC4B 2QKSA 4XNZB 4JLRB 1LGVA 1DANU 1WVZA 3RY6A 5E6ZA 5SWQA 2NR6A 3FB7A 5ID0A 3WE6B 5C86A 4KY1H 3WIIL 4JL2A 2NY6C 3N0AA 1S7SB 1N9PA 2D7NA 1YYML 4ZO8A 4LEXH 2IWFA 3OKNA 4F8LA 4V11A 3LRSB 1UYWH 5MENA 5C09A 3RQ3A 4PRIA 5E8OA 4BZ1A 5DA4A 1ZXQA 1KB5B 4ACTA 1G7HB 2FX7H 2VDLH 4PJAA 2MH4A 3EJRA 1DUYA 4MMYA 2FSEA 4F20A 2ZKMX 2Q2EB 3FT4A 1NGPL 4G42B 2GAZB 4NPJA 5AZ2L 1URLA 4L3EA 3EJPA 4ZX5A 4V1DD 5E2TH 4K3DL 4AMXA 1JTPA 3HOGA 1G6RL 1VENA 5EUOE 2O93L 1MLBA 5EU3B 2JCWA 5AYUH 2BH0A 4HK3J 3UTPD 1ET7A 1YLBB 4H0IA 3CFBB 4GSUA 4Q52A 5I0WA 2XPGA 1BREA 4XBPA 3RILA 2Y06H 2JJTC 1T6BX 3QG6B 4JZJB 4F9PA 1N0LB 3EDJA 5EU6E 1CLOL 4YHKL 4MB4A 3GXFA 4FXGC 3KWUA 3ZTEA 1OSPH 4GKSA 3VRLE 1JV5B 1XBRA 1ZT4B 4BQ8A 2HJFA 3LPGA 3O2DL 4KKBC 1EHXA 4WI3A 3SQRA 1FLTX 5FF6A 2NY4D 4GAJL 3BPOB 4YWGL 3TN0A 1M05A 4RGNB 3Q6GH 5DURB 3BSZH 3UCRA 3UH8A 3AWEA 4N24A 2QHLA 1V7MH 2Z3FA 3O3AA 4X7DC 1EAPA 1Z32X 1Q4NX 3X12A 1AQ8A 2X4UA 1IGYA 3QR1A 2ZKHL 3FFCE 2P46B 4PP2B 4AMKL 1BV8A 1V27A 4OZGA 3LIZH 2YS4A 5GGRB 4D3CL 4LLUA 5GPRA 3TFKD 2ROYA 2EO7A 2CDGB 3JWNE 4XP6L 1A6WH 2OYKA 3BGMA 4FOMA 2YPKB 4MNHA 4EBQH 1NGWA 5AVTB 1WE5A 5KSUA 3IVKA 3RGVA 1MFCL 1AKJD 3MLXH 2GABA 1JZHA 2NX5B 3GMNB 3X11B 1OGAE 1OQXA 4WW1B 2V2TB 4D94A 2LHAA 3LTVA 4TUOA 4AIXA 2IBZX 4AW7A 4LIQE 1BVKB 4JREB 5MEPA 4BZYA 3D0VB 2Y1YA 3RUGF 3TO2A 2EYTA 3ZHFA 1AACA 1MCIA 3KPQB 4LQ1A 3MBWB 5AAWA 2PCPA 2K8QA 1MFBL 1DVFA 1MJ8H 4J39A 5IESH 3X17A 5KBKA 4IM8A 3VXTA 4L8BB 1F1DA 3JQOB 3HG1D 2K70A 4MAYD 4X98A 3GS0A 1A7RH 3BUYA 1T1WB 2DQUL 1T22B 3ARFA 3KBPA 3U0PA 2IPUK 5JPNB 3MO1B 1A1OB 1R75A 3O9WC 4LKCB 3JZYA 4HIXL 4OJDH 1JZ2A 2I5YH 4MWFB 1XBDA 4JPWL 3VTAA 4U1IA 4UI2A 3TIEB 1GXEA 1MQ8A 4WUUD 1GGIL 1XF5B 1DE4B 3QDHA 4QHLB 5HHMB 1WLHA 2XG4A 5ETUA 5A7EA 5IB4B 3HHRB 2CK0H 1UVQB 2CUHA 2ZAHA 3HC4L 4HXAL 4XVTL 2KPNA 4IW4C 4W9HC 3MXVL 2Z64C 3PWUA 1EEZB 2YLKA 3LY6A 4Z0BL 4A38A 1OARH 5D4QA 2MOGA 3JWNC 1SUHA 1DANT 1R3HA 7PAZA 3SODB 2OTUA 4L05A 4W9LC 3MSPA 4RBPK 1E9QB 4MD0A 5SWSA 2K6ZA 4G6AD 3UERA 4YHMH 3LPPA 4LLVB 3V6OE 3H6JA 4DOHB 1VADB 4HS3A 3NQKA 4ELMA 4ICWA 4QGYA 3UJIH 4ZD3L 1WBZA 2YPVH 1ED3B 3H7BB 3QNXB 3MLWL 4ODVH 4AEFA 3UBXI 1QPPA 2FCBA 3ZTNL 3OAZH 3TPUA 1BBDL 4NO3B 4NRYB 4B9JA 1AQKL 1P4IH 4BKTC 1VJSA 1WT5A 5J12B 4H44C 3U83A 1IGJB 1ILSA 2XV0A 5F3FA 4FHJA 4ZG1A 3O4LB 1NCJA 2A9BA 2EYRA 3HEIB 4QXVA 4OZHF 4PWEA 2QSCH 1OCCB 3ZN6A 5D1ZD 3MCLH 1NCNA 4JG0H 4DQAA 4OZFG 1OPGH 1JF1B 3NJJA 4U1HA 4PD4J 5KBNC 1QRND 1OP9A 1A3LH 3SDCC 3C5SA 4Z3JA 3T65A 4X7EC 5IUCA 5I1IH 5BVJB 2GJZA 1KXVC 5CGYD 3L5XL 1JOIA 1M6OA 5AOKA 3MFGB 1QEWA 1LL1A 3IJ9A 4H8WH 1P5UC 2IBZY 4H25A 4YHLL 3ZXAC 4P5MA 4OJYA 1HHHA 2A3TA 4KXBA 1G7PA 4JDVA 5GRXG 1S9YA 4HX1A 2WBJB 4ZUUA 2BNQA 5J0BA 3GBDA 3DK0A 4LQFL 4AYEC 4YFEA 3FQUA 4X9FA 3CQFA 2VLKD 3V6OC 2CM5A 1L7IH 2WQSA 3B37A 5MEQA 3LRHA 3ZDXB 1S8DA 3KBFA 5HDBE 3BI9X 5JOFB 1CR9L 4YDIH 1D9KA 1IL1A 1Z9MA 4NNYA 4OLVH 2FEEI 1HAUA 1KG0B 5CXPA 5AG9A 3FB6B 4IDJL 3RZCC 4POYA 2WQVA 4PI0A 3NRQA 3P4LA 5FCUL 3TF4A 1YAZA 1NBCA 1KCLA 2Y25A 2Y5EA 1KLFB 4FKHA 5IIEB 3CDZB 4K0OA 2Q3ZA 1H5BB 2QPDB 4R4NC 2WB7A 1B4RA 3ZTCC 5FECA 1AOZA 1D5XB 2WVUA 4JFPB 5FGRA 1OCOB 4QOKB 3PXHA 4P9HL 1T21A 2CUIA 3NEXA 5EIVA 2O61B 1I7RB 3I6SA 1U3HC 4JFFE 1VFAA 4KJQC 2QDWA 4HGKC 2VLJE 5I30H 3BP5B 2G30A 3U2IA 5GGSA 2F74A 3MAWA 3VFMA 4PRDA 5CN1A 5B21A 2HKAA 1F8TH 3FYIB 3CXDL 4FQQB 3S7GA 4GKLA 1T66D 2QGBA 4R4BB 1M7IA 2OL3A 3UTSD 1MQKL 3F7RA 1XFPA 3HAEB 3A22A 3BE1H 4Q56A 4KY2A 2G60L 3MCKA 4KK9D 4V2CB 1BQ5A 3EHBB 2GBAA 1YPZA 3LS4L 4UYPA 1N5YL 4L1LA 2FATH 2Q3XA 4OCWL 4RDQF 1QKZL 1C16A 3G04B 3K2UL 3LZRA 4KKLD 3CX5J 2HWZH 1A1MB 1P2CB 5IEKB 5DFTA 5TF1H 3VGFA 2VABA 4LXFA 1IC7H 5L7XL 5I1CH 2VC2L 2GTWB 2JI2A 1NGYA 1T2XA 2GFBB 2TRYA 2JKWA 4X7TA 4XPAH 2DIAA 1ZGLA 3OKMA 2YQGA 3QQNA 4JG9A 3JWDL 4QHUA 4BCZA 2BVQB 5B7FA 1E27B 4YFLF 2NR6D 2D7TL 2EP6A 4M43L 4AIEA 3F7VA 3AACA 2VN7A 1KN4L 3QAZB 1S5IH 3SPIA 4PGBA 4ZTPH 5JHAA 2BFVL 1J18A 5MEND 5C09D 3MRRA 4PRID 1BX2A 2X6CA 5HHPA 1B0IA 3HC3H 3H54A 5AUMA 4P5TB 3R4DA 2FH6A 3QR2A 2AXWA 2CALA 1BZ8A 2R0ZH 3NEEA 4L3ED 4HHAB 5E1AA 1K8DA 1T1ZA 3NSDA 5HI5D 3OKDB 4K7FB 2AJVH 4BELD 1W0VA 2F2HA 4IKJA 2F8VA 1RK0A 1U6AH 1HS6A 1XXFC 8CGTA 4L29A 1IILE 5CNHA 1OY3B 3I85A 5E6IA 3FU3A 2BZCA 3CX5K 5DS8B 5I16B 1YNKL 4WHCA 1UT2A 1JWMA 5CJOL 4JO2L 2C7FA 1BZEA 2EEBA 1CMOA 1EXHA 3NUKA 3PJSA 3ARBB 2O72A 5BO4A 4BXSV 2XICA 4F2MB 3P0GB 4PG2A 4FTVE 5HDQL 1R3KA 4X4KA 1NDGA 5JR1L 4PJ7E 2VDOL 4R96A 5DD5H 3P4MA 4HWBH 5D9SA 4TKWA 5B1KA 5MI0B 2GUOB 3QC5X 3TN0D 1VHPA 2WW8A 2CO6A 3RIFF 1Q1JL 3QIUB 4I9WD 1BLIA 2Z4TA 2KQMA 1INDL 3QPKA 5BZDB 1ZHNB 2WKLA 2OX5B 3KLSA 1E4WL 2J43A 3DA0A 2GHWB 2OFQA 4K7PL 1QW8A 1N64L 5GS0H 3WTXA 5G2NA 5T1MA 3POCA 3ULVD 2NSQA 1MWAH 3VVVA 1WK0A 3GGWB 1DL7H 2DQJH 4GQ9H 1KGCE 3RGVD 3GMOB 5E7BA 2RFXA 5EBMB 4G8EB 1CGXA 3NJVA 5J3HC 3MBXL 4JHZA 2D03L 3WLBB 3VFGH 2ZWZA 1HH9A 3ABLB 4P5KA 3MRGA 4GP5B 5F7BA 3NP3A 4KTEL 4S1SL 2ICWJ 2W0FB 1DVFD 4P2RA 3TNMB 2Z93B 1KXQE 4BRJA 1FAIH 4OCNC 1UM6H 3U0WL 3MNZB 1COBA 1SHWA 3QJSB 3ARFD 4FC3E 1J86A 4G71B 4OM0L 3ME0B 4YK4C 4CU8A 4JRLA 5FS5A 4TN9A 2CUAA 3W57A 2G2PA 4BK4A 1CYGA 1PZBA 5CCJA 3NIFF 5D70H 3EJZD 1TO5A 4HC1H 5JQ6L 5FYLD 1U42A 2W81C 2X12A 1WSST 3VW3H 2OMXB 2CDEA 3WEXA 1E65A 2GI7A 3T6WA 2N4IA 1BZ7B 4I7ZC 3QO1A 4LLWB 1YUHB 3CXHK 4HKJB 3MJ7A 2VAAB 4FXKA 1IBHA 6PCYA 3VA2C 4K9EC 5F97E 2AI0L 3HZKA 3P3YA 5TDOA 5I6XC 5DYOA 2H0EA 2X6AA 5SWSD 2C3HA 2VDMH 4JJ5B 2YWZA 4EE2A 2W0PA 5E1GA 1QBML 4UU9B 3R0NA 4XNUH 3S8WA 5DK0B 1FO0B 1SMDA 3M07A 2MCPL 2WNKA 4EMZA 1BJ8A 1DDTA 3SB3A 5J06A 3S37H 3MLSL 3NACL 2MIZA 1XB6A 1F4XL 2GJRA 4OLUH 2EKJA 2B39A 1UGNA 2PETA 3EFDH 5KYUB 2HFGH 1HSAB 2F5BH 2YMXH 3C9NB 5I73C 2Y07H 4X5RA 4NJ9H 3HUJB 1OCWL 2VDPL 2Z0UA 4YGVA 4IOFD 3IN0A 4M61A 1CICA 3BN9C 4ZFGL 3MRKB 4MQ7A 4N6QA 3SJVB 1I1FB 4MJ5B 3US1A 4TMPA 1XEUA 2A6IB 1OLZA 3QRGL 6CGTA 2ZICA 4Y1TA 2YXMA 4NT6A 4OD3H 4UDTB 1RV6X 3DETC 5DDHA 1QFOA 5F7EH 3I6LE 5F9WC 2FTAA 3RFRA 3PREA 4FCAA 3PP3K 5INDB 1BSIA 1T4KB 3GF8A 1EHLL 5IHZA 1ONQB 5BCAA 5FO9B 4J28A 3LKPA 3BUQA 1BVNP 4BGDA 1AR1B 1NCBL 3KLDA 3MLRH 3UC0L 5ABAA 1JXFA 4JAMA 1AXTL 3PAVA 2BNQD 4QYOA 5D7JA 1UD3A 2W07A 4Y2LA 4QYAA 3GDCA 1KBPA 1PG7W 4F7PB 1FAKT 2EE9A 2ZTBA 2VIRA 1RJYA 4FG6D 4LB8A 2YO3A 5LG6A 2CKBH 1D9KD 2NYZA 1MKFA 3L6FA 4MAYC 1UM5L 5IHUL 1NCDH 5KYNA 5F3HA 2E6JA 5DHYB 2ORBH 2HJLB 1UH2A 3NN8B 4E9SA 4L1HA 4XAKD 4Q9RH 1E9PB 1JGIA 4WY7H 4MA3B 4DFHA 5E9DB 4QRRA 3L5WB 4CBZA 3D52A 1F90H 2PXYC 3FQRB 3IFNL 3P9MA 1QRNE 5K9OA 3GK8H 3DO7B 3FAXA 3T3MB 3IETA 3HFMH 2VXQH 3BJ91 1HHGB 4WGVB 1AQDB 5EF0A 4B9CA 4DEUA 2F7QA 4F57H 1HH6B 1A5FH 1SJEA 1Z3GL 2D7QA 1X6NA 2HVJB 4FD0A 2ZXBA 2DIJA 3EDEA 2X89A 2XY1A 2BP8B 4K71C 5T1LB 4ZUTB 2ITFA 1P53A 4IU2A 4M4RA 4ZFZB 4NQEE 5JLZB 2P49B 2PWFA 3EYUH 2PO6B 2DKUA 3MFFA 1AJ7H 2WNGA 2X44D 3RVWD 2B1AH 4WFEE 1KLUA 5I8EB 1PD1A 3CIAA 4X4MA 3UADA 1VACA 5TH2A 4ZMWA 4PBWD 5E2UL 4AYDC 4A68A 5JW3L 1UB6B 2R2BB 2EEXA 3VXPB 3VXUA 5BQDA 4E0RB 4AT6B 5E0FA 1KCSH 1T04B 1KEGH 4UANA 3HI5L 3DJTA 1L0PA 5CZKA 4A2DA 4ONFL 5F96L 3VWKD 1IB5A 3TLRA 3QCUH 1WBYB 5I19L 4UM8B 1HI6A 5KTEL 1RERA 4DKFL 5HJBA 5EBWA 3AAZA 1PG7H 3WD5H 3TBWB 1AIFB 1KCRL 2N01B 3F6JA 2AFNA 2WY3B 4JDTL 5ACZB 2E9WA 4JL1A 5I82A 5CEYA 1RY7B 2E86A 3CVBA 4BDVA 2VB5A 4QTIL 1F02I 3CSPA 4N2AA 5L2JA 3DIFB 4DZBA 5IW1B 5CGYC 3UXFA 2MJWA 4P2QE 4Y4KA 2R1XA 4UAOB 4BZ2H 4ZFOL 4ZMAT 3CFMA 1LP9E 2EDBA 2H8PB 1MRCH 1IC4L 2F54A 2C9AA 4YSSA 1R0AL 4QMEA 2IOMA 1EBPA 2ZX6A 5KOVC 3VI3A 4DK5A 5KANI 2VXSL 2BERA 3KR3H 3EXJA 4B9ZA 5L4JA 3MRQA 5AOJA 1MEXH 2J2ZB 2GB2A 4JQIA 4NENA 5LCVL 5GRUL 4S1QH 2XQYK 1B0GB 4UQBA 5JQHC 2LAGB 2LU4A 3VTMA 1JMXA 1DSFH 4PAZA 3ETTA 2PR9A 2WIIA 4G8IB 4NP9A 1KPUB 5E6ID 5TFSL 2X6MA 1DCLA 2IPTL 1AXSB 4AL8L 3B56A 4OLXH 3VFSB 2Y3NA 3DOSB 1N7ML 3STLA 2IPUG 2Y7MA 4OKVB 2C4FU 3K6FA 1FNSL 2X6VA 5BW7A 5FK9B 5I76A 3P69A 3CLEH 4GBXB 3CVHH 5AW6B 2OJZL 1DVQA 5EF1A 1TYJA 3PWLA 2IWGA 3D4ZA 4Y7MA 2VISB 1D5BA 2DLEA 4YJZL 1NCIA 5B1JC 4PJAE 3H2QA 4RGMC 4ETQA 3O4OB 3OXSB 1UC6A 5K1JA 3QQ4A 2HKFL 4QXTA 5FGCE 5A2CA 3T9WA 3WKQA 4FQ1H 5KSAA 4KK9C 2IALB 1UZ8B 2JLPA 3QDMA 3AADB 3BD5A 3L3GA 3Q5OA 4O9HH 3E2HC 5I1AA 1RUPL 2H0FA 2CXKA 3B34A 3GTNA 4P9HC 3ZGHA 3MRPB 1E9OB 4H1LA 5LLIC 4OAWA 4JDZB 2VDQH 3P0VL 4DESA 4Z3TA 4WTZA 3QUHA 3FH7A 2LLNA 3S5LA 4XNXH 5EZIL 2VL4A 2WJ5A 2IMNA 3NYKA 3UYPA 1S7XA 1KPRA 3PCYA 4P2RD 4FQXB 2VITB 1HXYA 5CIPA 3DJRA 3RWCA 4FQHB 1A7NH 1HHJB 2Y5TB 3RY6C 3RDTB 1Z0MA 3ISRA 4HWUA 4I9WE 4UV7L 2V5TA 2X9XA 3GBNL 4YIQA 2ALWA 1KIQA 3C8HA 1JPTL 4H26A 1XXDC 3KCPB 4M9PA 5IROC 1TQBB 5KBDA 2AEIT 1CBVL 1HZHL 5H35B 4LSTL 2G2RB 3IDUA 3T6QC 3WY3A 3F7QA 2ZKWA 3L7FB 4U33A 2O30A 4J3OH 3WAKA 3TBTA 4Z7VB 2ZAGA 4E5XG 3MRBB 4Z7NF 1AS7A 3BX7C 5D7SH 3JWDC 3LPFA 4WUKL 3LNGA 4WIQA 3ZMRA 1NFIA 4A6YH 1JXDA 3FMGH 4WNJA 5T3XL 4BWUA 2DH3A 2EXTA 2NUTA 1LYQA 3F85A 3NRPA 1LEKA 1TKWA 2QGEA 1MW2A 3FAWA 1GKEA 4GW4A 5ANME 3RIAF 4Q58C 1E5UI 2NXZB 3HUJF 5JPMB 2VLRA 4U1NA 3T3PB 3T77A 4F9PC 5E99H 3CJJA 4AQEB 5B39A 3D85A 3M1BB 4WU5A 4F9LA 4PJ5E 4WSKA 2DLGA 3DDFA 5FGBA 3FQXA 3OAUH 5L9DL 3VQ1C 4H2AA 2CLVB 1QUPA 4X5XB 3IFOA 3GBML 1RZGB 1CICD 2CO1A 4RAVB 2JXMA 3KAAA 2GJJA 4YHOH 5T3XD 1ACXA 4POUB 2IGLA 5DR5L 2G9HA 2YZ8A 2HMIC 1AGDB 3MLUH 2NYKA 4DPCX 4AYSA 4PJDF 4N1CA 2OS7A 4XCNA 1XVSA 2XUWA 3RUGE 3T0VA 1CIDA 3E8VA 1NC4B 4WAFA 1NCTA 4ZOAA 2VRKA 3QPXH 1IBGH 4BWWA 4AGLA 1J8HE 1KEML 3TH3T 2WBXA 3E6HA 3H3PL 1I8IB 2P28B 4HALA 3RTLA 3EOBB 5DS2A 5IT2L 2WAQA 4YDVB 1TCRA 2G4EA 5D7JD 2ZOLA 2VXVH 5AAWC 4LDLB 3RWHB 1BZ9A 2ITCA 3FCSA 1SLUA 3LVEA 3NK4A 3FF7A 3RKPA 3OG4B 1TU2B 4TUJB 5DD6B 4AH2B 4L4TE 2MQCA 3TASA 1Y7VA 4FERA 2W5PA 5DMGC 4QRRD 1ES0B 3HVNA 3SY0B 3ETSA 3CD4A 4CDGC 4KOCA 4RAUA 2BP0A 4X80H 4M8QA 2O5XL 3LQZB 5T3ZH 4GKNA 3RP1A 3EYFA 3GIZL 4M8RA 1FC1A 2EXSA 3QUMA 1ZLVH 2BSDA 3SDXF 2AP2A 3BW9A 5D2NE 3CFJA 1WHPA 2X89D 3JWOH 3OHXB 4XVJH 1B2WL 1NM9A 1MI5E 2KLSA 4RA0C 2DYRB 4EIBA 2BNQE 5GIRB 5DC4B 4HP5A 5DHVH 4MDIA 2CLZA 4CKVX 3R18A 1WEJH 2Y7QB 1MFMA 1MXGA 3BKJL 3Q9PA 5MEOA 4MQSB 2R8SH 3EFFB 4O5LH 3V5KA 1ANUA 1XV8A 4OZHE 4DAGH 1GGBL 5I71B 3UAJC 3T2LA 1NOAA 1QLEB 1UFUA 3NGBC 1B0WA 2CK2A 3EAKA 4GKZA 4PTTB 4F5CE 1P7HL 4LRIC 3SKMA 1DLFH 3SGDI 5F3BB 1W16A 3BMWA 5DQ9A 3VXUD 2HKHH 4XAKE 1LE5A 1J5CA 1BFSA 3QCVH 1HKLH 4DKDC 5IB3A 4YSOA 1GC1L 1K4DA 3LCYA 3M1CA 3QZPA 1EAQA 3HTLX 4J4PA 4UNUA 3HRZB 4ZS6C 2Q0ZX 1J8RA 4OQ1A 1BQRA 4APQA 2F8IA 3FTWA 4OCRH 3FCBA 2X4QA 5FYKD 5CINL 4RGOH 4JQIL 1KXTA 1D6EB 4DETA 2P9RA 3NJHA 4FLSA 3QSKB 3V52L 5F93C 2YSSA 4B0MM 1C08A 1LTXA 1YEGL 1ZVYA 5DLML 4F3FB 1AZBA 1SMAA 3Q1SL 5DVPA 1EJOL 1IGFH 4PJGB 4NC1E 5IQ7H 3HE6C 1J8SA 4YH6A 3GMQB 3WNLA 4I18B 4Y4KD 3WS3B 4YC2C 3BOVA 3SE9L 2R4SH 3OVUB 4LNRA 2X5PA 4FI7A 1J88A 5D2NC 3X1EA 4R7XA 4L8CB 2EUWA 1H3GA 4KZ0A 2F54D 3C08L 4WEBH 3G5ZA 2OZ4H 4OF5A 3II2A 2APFA 3P77A 1RMFL 2XV3A 2XU9A 4NBZB 4MASA 4OT1L 1HHKB 3H6AA 4K3HA 1UKTA 3DSNA 1K85A 1OAXL 2A99A 4PP1D 2B9AA 2ZYHA 5TDNA 5F2FA 3H9HB 5EO9B 1RU9H 4UM9B 4CMHB 2Z34A 3B9KA 3SYAA 4LAQL 3PWVB 1L7TH 3PHOB 2PPCA 4X7CC 4IRJA 2WMPB 3O0RH 2RTTA 3UABA 4EN3C 1U93B 2F61A 4PJBA 5KS9F 1SEBB 2B1HH 3BT2L 1IRAY 2WXPA 3KL0A 3O45A 4HIIA 3JV6B 3GS7A 1DVSA 3N1PC 4QXUL 1L3WA 4ZOBA 5ESAB 3TC9A 3RLSA 2DBLH 3IS1X 1BIIA 1UZ6F 3NVQA 3PV6B 4KTGA 3ZTDC 5HYJB 3CHSA 3SCMC 2OXGA 4LHJB 4UBDD 4NC1C 5EV7A 2A9ML 1JZ4A 2YEVB 3D4CA 3BP4A 4DQOL 1WIPA 4IJTA 5HYQB 2GK2A 4PTUA 2WWKT 3APCA 3KYMA 5ICUA 1RJCA 1TVHA 1N12A 1N19A 3QH3B 1AI1H 2J88L 3FHEA 1UWGH 4JUTA 3L3IB 3S36X 2NY2B 5KSAD 4HG4J 3FOLA 1JZ3A 3QDMD 2DWTA 3MV7B 5C7XH 4KI1A 4WNSA 3FKUS 2CHNA 2B8OT 4OF0A 1NLBL 4F7MA 1QLRA 3PWJB 4N2GA 4UILL 1E0OB 2Q5BA 4QRAA 1YEFH 4KO9A 3OC8A 4WDIB 4Z0XA 2ISDA 1K3IA 2PYEB 1I8KA 2N56A 1V55B 3VWKC 1JI2A 4AV0A 2LQRA 2AJSL 4FQ2L 3S37X 3CMOH 3T08A 4FNQA 3L48A 3VFRB 2CBMA 5D96C 5D1ZI 1E4KA 5I26A 2AJUL 5HTSA 3BZFB 2DYPA 2VDLB 1SFHA 3APNA 3B3IA 4W4NA 4HBCH 3DPBB 2IH3B 3L3HB 1AY1L 4UUJB 2AV7B 4AKPA 1XGUA 2Z35A 4ODXA 3GSVA 3C60A 1YY8A 3BGFB 3EDFA 1L9TA 3VFNA 2OK0L 1T5WB 5J6GB 1I9RL 3QIBB 5EDSA 3COOA 4PJ9B 3UTQA 1M7DB 4UOJA 1I7ZB 3LZLA 2ENYA 3MA7A 4U1MA 1XB3A 1BAFL 4XNZC 2OMUB 3K6SB 4FP8H 4HOWA 4G43B 4HG4K 3FRPA 5DJDA 3PE9A 2YKLH 4JO3L 4RGNE 5DHXB 2XQBH 2FYVA 3L9EA 4XI5D 5TQ2H 1IGCL 2AXHA 2PTTA 4OGQC 4WRLA 3T3PF 1OP5H 3HS8A 5IB1B 1FVEA 5GJSL 4U0RB 2WVSA 1A21A 1MNUH 3DVGA 3ISWA 4YPGA 2X4SB 1JTTA 2XKNA 1W72H 4Y16B 2X0WA 2HA1A 4OZ4B 1YMMA 2APTA 4P2RE 3ERXA 4Y4FB 4EDWH 2VLRD 1QBBA 2BW5A 4NZRL 4DP9X 1Q9OA 3QUZA 5ILTH 1Z5LA 3D85D 3MV9E 3QW9A 1PCSA 4PGEA 1A9EB 4MLIA 4AGQA 2UZXA 2DICA 2OR7A 1OWRM 1SJVA 3TT3H 5LGYA 2Y23A 5HDRA 1MREL 4UTAA 1NC2B 4FN0A 4GEJA 1PZ2A 4UQ3B 3RYMA 3KM1A 3N0PB 4WWNA 4A37A 4ZXBA 5KJ4A 4A39A 5IOPA 4OBSA 1MDAA 2WLIB 1FV1B 5LN8A 1IAKB 4G8GA 2R51A 1AIZA 3N41F 4OLWH 4YXKL 3NCMA 3FQTA 2IPKA 4D0BB 2MEJB 1V3MA 3MRDA 3TEXA 1HSBA 4P9ML 4WI9A 3PGFL 5CGTA 5J1AA 4YHNB 2J8UA 4Y8DC 1NCAL 3Q8AA 4UV4H 2AJYL 3BXNB 4JR9H 3QDAA 4W9GC 2H32A 4HIEA 4LU5H 4QIRA 4JPVH 5A2IH 1FIEA 4RMQA 4RGNC 3IMSA 1THCA 2D7OA 2RIKA 1R9FA 2VR6A 4N26A 3L54A 4G1MB 3PPSA 1G84A 1GYVA 3HCVB 2PR4L 4HUNB 4ZNCD 2XWXA 5EFIA 1OT1A 5BNXD 1JZFA 4ZMTA 3NIFE 3BRDA 3OMIB 1HTYA 5EA0H 1A6VH 3QUML 2G0KA 1VGKB 4HZLB 4TNVF 3IAGC 1QO3A 5DJXA 1NFDF 4KZDL 3LKQA 4XWOC 4WEMB 1HDMA 1AGFB 1JHLH 2H1LM 1AYOA 3MTXA 5T33H 4BQBA 1OOAA 1MUJA 2MMXA 5DD3L 5T3XE 3GRWH 1I82A 2DWEB 3BGAA 2F9BT 3EGXB 3DX6A 4JREC 4KAQH 3VE0A 2EJ1A 3IGAB 2PWDA 4PJ8A 3C2AH 1HHIA 1JIBA 3CFUA 3TCTA 1PG7X 2K6WA 4ADIA 5F1NA 2EYSB 1DBML 4L9LC 5IHWA 5HHXL 1EQWA 1ZSDA 5DO2C 3SDAC 1A4AA 4L4VB 1H8NA 3QUXA 1ID2A 1G7MB 3SYCA 4JRXB 4WQOA 2YXFA 3I9IA 4DHLA 1B4TA 4LSQL 4ODBD 4BHUA 2AAVA 5K69A 5KYYA 4W4OA 1IJNA 2NNFA 4XCEA 5HJDA 1WWAX 3V4VA 1EZVX 4NWTH 4YDZA 4JGJA 4XC3L 4XPGL 3KDMA 1YC8A 3ROOB 5EH1A 1GAFL 3KW7A 2XQYG 3ORJA 1FGVL 2XZQL 3NOIA 2WSPA 1D2PA 3EO9L 1UJ3C 4EUPH 5I1GL 3T0EB 3GHBH 4KK5D 1MFEH 4GSDL 5BRPA 1J5OL 2DJ4A 4N1EA 3T8VA 2YBRB 2BWQA 3BAEL 4OGXH 4BK5C 3O8XA 2GSIA 1JGVH 3IPEA 5EOTA 1MCOL 5G4OA 5BRZA 1T1YB 3SD5A 2Y6SD 4NQVB 2XV6B 4Z7UF 5L6YH 5A6LA 1OAKL 4LOFA 1PKQE 5C6WH 1WFNA 3UP6A 1MVUB 3D0LA 3BYYA 5GGVH 3CVCA 4IMKC 2PF6A 4AGOA 2NZ1A 3DX7A 1S9VA 1CTOA 4HSAC 3HB3B 4RAHA 4APQD 5TF0A 1KJMB 3J8F7 4WNQA 5FKPA 4NPYB 3F12B 3ZE2B 5CMAA 4N5UA 2NY1D 4XPHL 3CCHB 4PRNB 1FSKB 4FFYL 1OK8A 5DC2A 3CVIH 2Q7AA 5AB0A 4JVPA 4M7ZC 1KGIA 4U7MA 4YBLC 4POZD 4G8AC 4Z76B 2IXQB 3VFTB 1DEEA 1DQMH 1FBIL 1TTAA 1JWUA 3WG7B 1RJZA 1A1NA 1P6FA 5TE4L 3CN0A 5DJ2B 2YEQA 1XWVA 5TDPB 1XSIA 3QDJA 3FT3A 3DRTB 2V33A 1UKSA 4LMQI 4NO5A 4DP4X 1U58A 1PVHA 3ILPB 2XTJB 2QQQA 1J1PL 5DJ8A 3PQYB 1RZQA 3K71B 2FO1A 1DQLH 2E9IA 1DBJH 3VXUE 1QUNA 2A6JB 2BVPB 4K94L 1OE2A 2P8LB 3B6SB 3P4NB 4KKAD 3WXWL 5D4HA 1E4HA 1RFDH 3B9KD 1XGRA 4JY4B 1R5IA 3OQRA 2NW3B 5E5MA 3JWNG 2UWEF 3GZOA 1NBVH 4NKQB 3AGVA 1TZHA 2DQHL 4IRJD 4X0KB 5GSVA 3IJ8A 2MRYA 3W3BA 3DXAA 2P5WB 4MX7A 3SKOB 3ARDB 4Y19B 3F6LA 2VXTH 3ARPA 2BP5M 2FBJL 1AKPA 1X5ZA 3S5LG 4G9DB 2X40A 3WXVL 4NSKA 1OT2A 1RSYA 4DN4L 5KAQF 1BVNT 3B8SA 3CLFH 3KPSB 4JE4B 2XBZA 5HYSA 3E1ZA 1SDYA 4M7LT 3AT8A 1OP3K 1EZVY 3GJEB 3S35H 1DZBA 5I1EL 1NAMB 3ELQA 1FFTB 3ES6A 3O2WH 3V8OA 1MHPH 4Z8FH 3S9DB 3P3UA 1OV8A 3OKLB 4R84A 2BIOA 2UWEA 1MH5A 2WLLB 5BZWB 4JZNB 3RL1A 2XNAA 3CZLA 2ZX5A 3GNML 3NJIA 4C47A 1XH3B 1AGEA 3L95B 4CSZA 1S7QA 5IFAH 5GS1B 1MFDL 5H94A 4NKOA 3W0WA 2V7HB 4GG8A 5E94B 5ITBL 5E4EB 1NEZA 3MV8A 2FX9H 2BP3A 5C07A 1UXSA 2NLJA 1TLMA 4GMSL 1EEUA 1Q90A 4KO7A 4YHYC 3QXVA 2Y0SA 3VB8A 1HXKA 3F7YB 3IJHB 4MA8H 2DYPD 4P57A 5BVPH 1U91A 4EI0A 1JWSB 2WUCL 1AGCA 1MAMH 3LHPH 1P4LA 4N0FA 1T20B 1U30A 3QARA 3C60D 4BFKA 2ZX9A 3O6FC 4C56E 4I3GA 2HYMA 2R23B 3NZHL 1YYLL 2O5NA 4F2ME 5C0BB 1GC1C 4JB9H 4MA7L 2GSGA 4G6FB 5I17A 4P3WA 2QQLL 4J1UB 4M8UA 2OMYA 3SPCA 3MJGX 5LXGH 3KPRB 1A25A 2GW5A 2ZOKA 3ZSTA 4CADB 3GZPA 2CNZA 5EC1B 4LZKA 1EHKB 2EXYC 4M7JL 3N85H 3QAZC 4AM0Q 4U0QB 4PSPA 2H6PB 4HCFA 3KXFA 4ZAKC 1KFAL 4B7LA 3G6JF 2F58L 2AF2A 1ASQA 2EVHA 1O6SB 2D0HA 4YZFF 4E9WA 1FI8C 2MKWA 2NSMA 2ZUQB 1UCTA 4KDTA 3VU2A 4L1SA 2H2PC 1IC5L 5DJ6B 1BQHG 3D34A 1LO0H 5CLZA 4YO0B 2YQ2A 3QUZD 5C0AA 3S34L 3EJUA 2EKSB 4I5BA 4JJHA 4FHBD 4CN1A 3VWJA 1QSVA 5H37G 1I1AB 3QUYC 4HKXA 1LQBC 5IHLB 3GI9H 3TJEH 2VH5H 4JM2F 2W88A 1JZ6A 4Z7QB 5KVDH 4MVBD 3NCXA 1A7PL 4XO5A 1Z0NA 1NAKH 4I3SL 1NGZA 5CWSB 5I5JA 4G8GD 3SKUD 1GOGA 1DDHA 3D39A 3ARBC 3ARXA 4YBHA 1DQVA 3G6JA 3WDJA 4MA1B 2EDDA 3GSNA 4BSVA 3BRGC 5E9NA 3QEHA 4N1HB 3BWAB 1M3IA 1XCTB 1GJWA 4NOBA 4YDMA 5JO5A 4LOEA 2MNJB 5DMYA 1PMYA 4PMEA 2JSFA 4TSAH 3HG4A 1CN4A 3BWSA 1S7TA 3LZFL 5IVZB 5IQLA 4MJ2A 4LPYA 2WXJA 4KX9A 4PCTA 1NCHA 2ATKB 2VLRE 4OH2A 3TVMC 3DGGA 3SKJH 2CA4A 2EADA 3VGAB 4OZIF 4WZ9A 1ZHKA 3FJTA 1ASOA 3RA7L 3G6AA 3FUJA 1TYRA 4UQDA 3F7LA 4NAMA 2HVBA 3PXLA 2ETWA 4WFGD 5A2JH 4Z7NE 7PCYA 4K07A 5AD0A 1DQKA 3DBXA 1OAYH 3ASWA 2GTZB 3EYVB 1PZSA 2PP7A 1ESOA 1J9SA 1LK3H 1RXLA 4PJ8D 4CSTA 1DJZA 4N68A 1YNLL 4PRBB 4IBLT 2Z31D 3OSKA 3RBGA 2DB8A 1ZANH 4N3TA 3KPNA 4PWKA 4WWKC 4Y2DB 1QHPA 4LDCA 3QJHA 4YSPA 2ILLA 2EC9U 2FECI 1KCBA 3HUJE 3GBEA 1T0NB 4NWUL 4OZIA 4A66A 2P8PB 1C5DB 5AOMA 3DX2A 4QXGL 1U8KA 5KVFH 2E7BA 3V55A 2IH1B 4KVCH 4OIIH 1IBZA 1CB4A 3FULA 5B8CA 3REVB 2NY3C 4G83A 1AAJA 2WQRA 4N8PA 1AO7B 3F8UB 4KVPA 2H6UA 1VFBA 1FORL 1P7BA 4N28A 2JMRA 3CU7A 2EDYA 4MMXB 5IMLA 2IDCA 3O8XD 4Z3IA 4PJDE 5B3JF 3MREB 5BRZD 2HT2C 1IM9B 1RZ7L 1VAHA 3ZE2F 5CZXD 2F53A 4R97B 1R1CA 3LRMA 1GZHC 1RLBA 4X7FC 4YHPA 5DHEA 3I3BA 3HG0A 4PB9H 3IU4L 2VDKL 4D9LH 1SVCP 3BT0A 3SD2A 5CEXB 3VI4F 1SLVA 5DQDH 1IQWL 4A1RA 3ZW3A 2EVFA 3VFUA 1VFOA 2R56L 4DCQA 3FFDA 4NQXA 5E00B 1NL0L 3VRJB 3HMXH 3BUIA 3CZFA 5IQNA 5ADPH 3V7MA 3FS9A 4OFQA 3PGCA 3DMMB 3QGVA 2FX8L 3GMMB 1GCFA 3AITA 2MOVA 3MRMA 4BH8B 2ZX8A 1A47A 2CKBB 2HXAA 1E50A 1WBXB 3IDGA 2C3WA 3ULUH 1K5NB 3QDJD 1CLZL 4FE9A 3VQ2C 3D3VB 2ADJB 3MYJA 4NO0B 3AXHA 1DLHB 1BYNA 1JNLH 2BSRB 3ZDYB 3N3EA 1I4FA 4ELKA 4ODSL 2E27H 4I3RH 4QRQA 3O2VH 5FO8A 3ZRFC 3T0WA 3VD4A 3LKOA 3SDDC 1KYDA 1FE8L 3O6LH 2QSVA 2DQFA 5C9KA 5F0JB 5IMKB 2CGRH 3QQ3B 4JY6A 4MD4A 3SDXE 4EPSA 4LCYA 4P46A 2D31B 3DPDA 2G3XA 3GJFA 1PGRB 2UXFA 2VXUL 3DXAD 5F7DA 2C9QA 4JFSA 2IQAA 1CPUA 1K8IB 1ZA6B 4X6BA 3TESA 4QCIA 4U3HA 3IKKA 3NZ8B 3BKYL 3NAAL 3LB6D 4OLZL 2OYLA 5C2BH 5I5MA 3GI8L 2R1WA 5CJ8A 3TNNA 1HXMA 2B3IA 2XZCL 3GKWL 5D1QA 4MHHI 4PW3A 1U36A 2IFGA 3PABB 4TQHA 1NIDA 4E9YA 3KLKA 3WJMA 3FO9A 3L3OC 4M7LL 3V8CA 2VKXA 2CXGA 3OZ9L 1AD9B 3SN6N 4Y2NA 1YJDL 2DQEL 3CH1A 5BMFH 2I69A 4N85A 4OCYH 4TQEH 2CKNA 4KK5C 4NZUL 1OCRB 1QSFE 2F1AA 4JLRA 1X7SA 4XNYL 1SYVB 3OPZH 5FHBH 1W0WA 1OSYA 3FRPG 3V4LA 2JNZA 1KNOB 3WE6A 1A3ZA 4EI5A 1RP9A 4KY1L 2EC9T 1S7SA 1G0DA 1I1CA 1SEQH 4LEXL 4G7YH 4I77H 3T4AA 3W0WD 5CLWA 5GISH 2HTKD 2PO6C 4QHMB 1UYWL 1T7XA 3W11D 1KB5A 3PHQB 2DL9A 3MV8D 2FX7L 2NQCA 2VDLL 4HFUH 1LWHA 4U6XA 3O0LA 5C07D 5CJ5A 2X1QA 2ZAIA 3NSYA 2NY5H 3CFIC 2W95A 2X4RB 3DRQB 4U6TA 5E2TL 5SX5H 1U3YA 5IP4A 3I75B 1XT5A 2RHEA 2XJLA 2ZCHL 1CD9B 5EU3A 4XHQA 2LFGA 1CGVA 1RIHH 4TM9A 5AYUL 2YFOA 1KTCA 1CDGA 2ZWYA 1CXEA 1D5MB 3SGDH 2Y06L 1ZTXL 1N0LA 4I0CC 4WTXA 5AZ2H 4AYGA 9PCYA 3A6CH 5KS9E 2C7UB 1KF9B 1JV5A 1OSPL 1ZT4A 5DK3A 1GJIA 5L8LB 5DRXA 4KKAC 3KXFD 1UZ6E 3B9KC 3VXMA 5AOIA 4MNQB 1UXWB 5I24A 4IBQA 2AKRB 3BSZL 3PYCA 2VM3A 4PS8A 1KULA 1V7ML 2GJ6B 1V3KA 2LTQB 4WJKB 1YEJH 4Z7AA 5DZAA 2X88A 3I2CH 1NSNH 3BSGA 4PP2A 5GGRA 5FA3B 5C0AD 4QRPB 2ZXCA 3LIZL 1VIWA 1GL4B 4LCWA 2P5PA 4XMXA 1CDUA 4M56A 1ZVNA 1T1XA 4HZ1A 3VWJD 4FABH 4N2IA 2YPKA 3WGVB 5IM7B 4EBQL 4UOW1 4YWGH 4DP1X 3WUWG 3SO3B 4K94C 3X11A 3MLXL 2P52A 1XH1A 1R34A 4WW1A 2V2TA 4Q74A 3MRCB 3RIFK 1BVKA 3D0VA 5AVXB 1ZLDA 2AQNA 4G70B 4GW5B 3D39D 1CVRA 3ZOAA 3KPQA 4XOEA 3D06A 4AQZA 4BFBD 3AY4C 1YEEL 5E5RB 1FL6A 3SDYL 5FUZH 3VYPA 5IESL 4WO4A 3QXTA 3S3JA 1PQZB 1L9MA 4JUSA 4LCUA 5JHLH 1IIIA 2QVKA 1J9RA 1XSJA 1T22A 3A4DA 1A7RL 1S7UB 5JORB 3JVGA 5JPNA 4ZDHB 1VKXA 3P73B 3MO1A 1A1OA 4G80B 4PBVC 4XN1A 2VZVA 1YN6B 2VJ0A 1M2VA 3TIEA 4Z7WB 3QZNA 5J9PA 3IXAB 4Q4EA 5IB4A 4WKZA 2O1AA 2CK0L 4EN2A 2CO4A 1WTLA 3L1GA 2JQZA 1I85A 2FJFA 4BQCA 5IV2B 3KWWB 3LEXA 1OARL 3OMZA 5ESQA 2GK0B 4HSQA 4RWYH 5GSRB 5A3ID 5GZOA 3HNVH 5IJCC 3WY2A 2MOQA 2K3HA 4A7QA 5AW0B 2AZAA 1E9QA 4JPWH 5E6SB 4ZX6A 4GS7B 4ZYKB 3T3PE 2OLDA 1GGIH 4A6YB 1JGUH 2GBVA 4YHML 1GR7A 3CFKA 1VADA 4DVBA 1R3IH 4JQVC 4HXAH 4XVTH 5BOJA 4FQXC 3OWEA 4PY7A 1JUFA 2R29A 4R26H 5JDSB 5JUEL 3UJIL 2OJEA 4ZMQA 3H7BA 2YPVL 2XWBB 5LBSH 4CA4A 2H3NB 4N9GB 4ODVL 4E41B 1LEIA 1UWXH 1FYTA 4GOSA 1FF5A 2JIXB 4NO3A 5DRNB 3V0WH 2GCYA 5HXMA 3HLKA 1P4IL 1G5GA 1IGJA 3C75A 4O2FB 6TAAA 1C5BH 3O4LA 3HI6H 3NFPA 4NC2B 1E28B 4FULA 4ZT1A 4LVHC 4XWGL 2JFCA 4F1SA 3GBLA 4GUOA 2ZE0A 1JF1A 3MCLL 4G6MH 1ZCRA 4I48B 4JG0L 1OPGL 5T1KA 3AS2A 3MLWH 3POHA 2IDQA 1A3LL 3MJ9H 3ZTNH 3LPOA 4LDEB 4G5AA 5KYWB 3MRJA 2HFFB 4LEBA 1BBDH 5I1IL 1HIMH 1ZVSB 3VYNA 4LCCB 1IE5A 4NKMB 3SE4A 5TQ0H 4H8WL 4NRZB 1JPFB 2WBJA 2QKIB 4LVEA 2NXZC 5IB5B 1VZIA 2XN9E 3IDYB 3MLZH 1NIAA 2FO4A 2CIIA 2BSTA 4D0CB 5AKSA 1CDCA 2CJUH 3UO1L 1ID5I 2AK1H 1DJXA 4PR5A 3QJOA 5JOFA 1EJFA 3S2AA 2D2OA 4GB9A 2VO5A 1X9QA 3L5XH 1XF3A 3OJDB 4YDIL 3S35X 3NEOA 1U3NA 4OLVL 2X7LB 1XD1A 4Y5XB 4RDBA 1NFDE 2ADYA 3DVIA 1WZKA 4JFDB 3ZRSA 1URIA 1RZKH 2IGFH 3FB6A 4AQ1C 4FFWD 1AVAA 1EGJH 5C3IA 2XJKA 5BJTA 4P5RA 4F7TA 1YEDB 1H9DA 1N59B 4LQFH 1KLFA 1OSEA 3QIWB 3IDIA 2AS5M 2W65B 2DD8H 5GGVY 3ABGA 2EICA 1I7RA 3SGKC 4NXKA 3I6GB 5EOQH 5FYJD 5TK2A 3O3BA 4UTBH 3KD4A 1G0XA 3BP5A 5I30L 5CP3A 1MY5A 4P46D 4GAAA 1UFGA 1F8TL 2YLHA 5T8IA 1FZMB 2VDRB 3FB5A 4R4BA 1IGIH 2P24B 3VRIB 2Z31C 2PCXA 4Y4HA 1DJHA 1T5XB 2EEAA 3BE1L 3QJFB 3VXNB 1HZLA 3WFEH 1JL8A 2NY0B 2VXQA 5D1QD 1B9KA 5JW5B 4W4OC 5ISZB 1G7IB 4CC0A 1H19A 2FATL 2R2CA 1D2OA 2E8YA 3G04A 2RGSA 4KU1A 2KHAA 4Z7UE 1T5KA 4TTDC 1SXZA 1A1MA 1P2CA 5AAMC 5IEKA 2HWZL 3FN0H 4EZJA 2MNUA 3KYNA 3K2KA 3DYOA 1IC7L 2O6PA 2VLLB 4O2CA 5I6LA 1I9IL 3E9UA 1U8QB 2F0CA 2CO7A 3G3LA 3C2SA 4WO0A 4Z77B 2BVQA 4NO2B 2V7NB 3N43B 3HJEA 4EKJA 4YVNA 4AUYA 4EI5D 1N5YH 3OHXC 3PHSA 4CILA 1GCYA 3KPOB 4X8JB 4PCKA 1S5IL 1KACB 2WZ6A 4BZ1H 4ZTPL 4UZGA 3WIFA 5IJKC 1T89A 2X4OB 4C4KT 2VNCA 4J3BA 1AP2B 5DEJA 4NRXB 1P5VB 1S7VB 3T2NH 1CDHA 3HC3L 3ARGB 4P5TA 5IY5B 5E4OA 4IHBA 1K72A 3KS0H 2R0ZL 2BVEA 4HHAA 4OF8A 4JKPH 3OKDA 2QPEB 2WJ7A 2YD1A 1KN4H 2DJSA 3UMTA 2AJVL 3VJ6A 1U6AL 5CCKH 4OFYA 4IIQA 4KRLB 3ZKMC 4ZODA 3FU5A 3HS9A 4LSSH 3FO0H 3FRUB 3VCLB 5LUMA 1QR1A 5FCSH 2UWEE 1E5CA 4N8VB 5FUOL 1XIWC 4NN5C 4XH2B 3UTTA 4FADA 2H3XC 3DC0A 1PLCA 1IKNC 1S2EA 2X87A 5D93B 3LKRB 5J13B 4AG4H 5BQ7B 1PD0A 1KGUA 3T8MA 4I18C 3HZYB 5DD5L 2GUOA 4HWBL 3CHXA 2QLVB 1PTZA 4N5ED 4WW2B 5DURD 3VXMD 3QIUA 1J0IA 5B38B 4EEEA 3MV8E 3M8OH 4Y1AB 1E3FA 4Q6IC 5AW9B 3U9UA 2OULB 4NM8H 5IJVA 1NMAH 3ULVH 1YY9D 2F1BA 1ZOXA 4FKKA 4LCWD 5GS0L 4N90E 4Z7OB 4YX2H 3GGWA 3VNZA 1MWAL 4LHUD 4JO1H 1DL7L 2DQJL 3KYKH 2WLYA 4GQ9L 1B4LA 5EBMA 4G8EA 3M46A 4UAHA 1MCSA 1MCWW 1NZRA 1EPFA 3VFGL 3VSUA 2PW2B 2BCMA 5FUCE 3D6GA 1DQTA 5AL8A 2W0FA 2ZP8A 3WBDA 2EDEA 2Z93A 5DXWA 3TA3B 1GS7A 1X4XA 5E1HB 4DK3A 4WO4D 3P4OA 2DKSA 3EO0B 5F71A 2WLHA 1FAIL 3MRNB 3W56A 1UM6L 3MNZA 2AXGB 2WQWA 1PDKB 4KROB 5GS0D 1U8LB 4L5FH 1BJ1H 5DFVD 3ME0A 2BPBA 2BSCA 1JPGB 5FYLH 2D03H 4UMSA 4XGZB 2HTKC 3KLLA 3MRHB 4J3OF 3OHMB 5D70L 1TVBB 4ANVA 4HC1L 4RNRB 2H41A 2R29L 4KTEH 4S1SH 5C0AE 2OMXA 1PCXA 1ORQA 2X3AA 1NGXB 3OKEA 5IFJB 1YUHA 1SPDA 4HKJA 3QYNA 2MCG1 3BZ4B 4JPSA 3AU1A 5F7AA 2VAAA 4MDRA 5IW6A 3O11B 5JOPE 3L4WA 2D9CA 5GZOD 1TQWA 1KSRA 1TETH 3PNWA 3WGUB 1GTFA 3O41B 3PJNA 4JGHA 2AXFB 2X41A 4H40A 5EMYA 3ENEA 1KGYE 3D39E 5D1XD 3VFPB 4YHZH 3MQIA 5E2WH 3G6JE 3H9ZA 3MNMA 2QADD 4JJ5A 4MD5B 5D55A 2VDML 4JFEA 4UU9A 2WZPA 1O5DT 3P30H 1CTNA 4YZFE 4XNUL 3EJQA 5INCB 5FM4A 3UZQB 3AQYA 3IDXH 5FUCC 4PJEF 3N50A 1UOLA 4NQCB 5DJCB 2CBTA 2ICWB 2NNCA 4OLUL 5KYUA 1FYTD 1LLAA 3C9NA 3EFDL 2HFGL 2YMXL 3V0JA 4NUPA 2E7LC 2Y07L 2OR9H 4NJ9L 4LPVA 2CMRH 1BM3L 3QIBC 4KO6A 4KHXH 4ORGA 4MJ5A 3GM0A 2A6IA 5H2BB 4W70A 5C8JB 1ODAA 3RIAK 4OD3L 5I2IB 3G9AB 4WHDA 5T1KD 3IMUA 5F7EL 2IANB 5C2UB 4P4KB 3GSUB 6FABH 4CC4C 5T1JA 1W9XA 3VXOB 3RTQA 4NBXB 4FFZA 2J1WA 1T4KA 2IG2H 5LB1A 1UOKA 1LWRA 3L4XA 3BPLC 4LDOB 1X4ZA 5FO9A 3QNZB 4WI8A 5JIMA 2EDHA 4P23C 2EO1A 4PJEA 3V0EA 1FFRA 1X5YA 4WHTB 1IAMA 4IOIA 3ZDZB 3MLRL 2WBJD 3DDGA 2CCVA 2HT3C 3X3FH 4XHJD 1WH0A 4L0ZA 4PBDA 1G7LA 2EIZA 2IAAC 5LAXB 2J1YA 1YQVH 4JK0D 1LXMA 4GFTB 4OZIE 1KJ2B 1IEBA 4PJCB 3EG9B 3D18B 4LOUD 3KLAB 5K39B 3TO4C 3S3SA 1NCDL 4WSGA 1UA7A 5DHYA 1BBJB 2ORBL 3GO1H 3IXTB 3PUUA 5C0CB 1E9PA 3PAZA 4KUZH 4MA3A 4AQOA 3RI5F 4F93B 4WY7L 3L5WA 3UMNA 3FQRA 4L4VE 3MMEB 1V3LA 4JM2C 5E08H 5KYXB 3GK8L 3SBRA 3ARWA 3HFML 1HHGA 2VXQL 1AQDA 2WXGA 3JBG7 4NBYB 3MYZA 1HH6A 3O3EB 2Y7SA 1EA9C 4XNMB 4F57L 4F37F 2OW6A 43C9B 3HHMA 2R7EB 5A3IC 3QRFM 2OMVB 4C8XA 5FR3A 2OL3H 4ZFZA 3QWRA 1I75A 1ZSHA 4DGUA 2Z65C 1BF2A 1ZS8B 2ZJSL 2GITA 3KPMA 3EYUL 4AJWA 5HPOA 4XXWA 1AJ7L 1TPXC 4XN2A 4Y4HD 5BV7B 2B1AL 3RIKA 4HIJA 5I8EA 4IEFB 1HFUA 1FHNA 2JH2A 2P3YA 1S46A 2D3LA 4EUPB 5IEHA 4ABUA 1KBBA 5I1DB 1UB6A 4Y9EA 1XSKA 3VXPA 3VM5A 3DVNB 4FQIH 4LBEB 5B3JE 2NY6B 3B7YA 5FEBA 2N7BA 3BQUC 3HMWH 1T04A 3QQ9C 1TVDA 1KCSL 3ZE2E 1CG9B 1Z66A 5TE6H 4ZMYA 1KEGL 1HK6A 5HVWA 1E43A 4UM8A 4GUPA 3QCUL 3Q8BA 1CDJA 4YAQB 1DSYA 4IKLA 5CN3A 4JQXC 4UDUA 3WD5L 5HVGB 3VI4E 4UNIA 3U36A 2H1XA 2ITDB 3DJ9A 4GUCA 3DIFA 5IW1A 1KPVB 3JUZA 3NCYP 3QFJA 1KTJA 2NNAA 1FFQA 4BZ2L 2X2HA 2ZXWB 3QQDB 2H8PA 2KC0A 4AM0A 3BYTA 1MRCL 4FFTA 5KUMA 1WIOA 3PQYE 4Z95H 2ODIA 1YECH 4ODWB 3KR3L 5CCGE 4W9IC 2O26U 1MEXL 2J2ZA 4FXGB 2XWZA 2C3GA 1KB3A 4OI9A 1DQDL 4S1QL 3FNKA 1PEZA 2GEEA 4DJMA 4MJIE 4G8IA 4FQCH 4CMMB 2XVGA 1KPUA 4OFYD 3WO4C 2P5WE 5E8PB 4NZTH 2XXMB 4G3YH 1UWEL 5JHBA 4FFWC 1AXSA 1I8LC 3LSOA 4F15B 2VXSH 4H8WC 3UTTD 4HS6A 3DOSA 2VW7A 4OLXL 3WFBH 1NLDH 3KPSE 1RUAL 2UYLA 2XSKA 4YDLC 4AI7A 3HS0B 3ARQA 3CLEL 1U8IA 2HRHA 5G4MA 5HHOA 5TGBB 4GBXA 2AHIA 1X5AA 3D30A 3OAYK 3CVHL 5K5YA 1ZHLB 2VISA 2VN5A 4IRSB 3QS2A 5TFSH 1QI5A 5CBEB 4D7BA 2E56A 4AL8H 3CZUB 5TJWK 4A67A 3MOBH 3HA0A 4D8PB 4GAYB 2V2XB 4O02A 5EUOB 3OXSA 1H3PH 4TSCH 1NCCH 4PWIA 2G5RA 3V0VA 3Q44A 1N8OE 2WZ0A 3REWB 4FQ1L 2IALA 1UZ8A 1W15A 2BDNH 1YMHB 1AQHA 1ZT1B 3FTGA 5EU6B 4PYHA 5F1SA 4R2GC 2VE6B 5DRWA 3NA4A 1L9RA 3MRPA 1E9OA 3AWGA 4BHUI 3MX0A 4JDZA 1N8ZA 2CGZA 4Y9CA 4PV8A 3V95A 2VDQL 4PY8J 3W9DB 3LKNB 3I6KA 5GGTH 3WN5A 3ARDC 3I84A 5HYIA 4F7EA 3RWIB 1K2DA 4XNXL 5T1DH 3MLVH 1XCQB 3MJ8A 2DWDA 3FFCB 2Y5TA 7TAAA 3RDTA 4IU3A 1A7NL 5JXAH 1JI1A 1FDLH 1L0XA 4LLDB 2J1ZA 3MLYH 3TZVA 3QE5A 4XR8C 5HGBB 3V4PB 4CVZA 1RK1B 4GRWH 5H35A 5EIIB 1BD2E 4F7CB 3L7FA 2VERA 2W38A 3ESPA 4Z7VA 5F21B 4IBVA 3U6RB 3MRBA 2WP3O 1FFOB 3IFPA 5AENA 5MHSE 5D7SL 1F58H 3TCLA 1XF4B 8FABB 2VT0A 2FQFA 2Y1ZA 3FMGL 2WV3A 5EU5A 1TTFA 3MLTA 1J8KA 3WNPA 2ZG3A 1AOHA 4JFED 1BZQK 4U6YB 4YR6B 4QJ5B 1AYRA 5JPMA 4JRYE 4AQEA 5GXBB 3KHQA 5E99L 5C08E 3JT2A 2XWTA 3SDCB 4J3OD 1F6AA 2LU5A 4UF7C 3C6SA 3MROA 4KXZH 4MMZA 2JCCF 3DHJA 3QNYB 3G6DL 1ND0A 4YDKH 3OAUL 2CLVA 4X5XA 4N5EC 4RAVA 2P7TB 1P5UB 4YHOL 2X1OA 4HISA 2X1XR 3HG3A 1EFXB 3CSTA 3U4EB 4QF1A 5I1HH 3NFNB 3RVVD 2B7DT 43CAB 4AEIH 1E5BA 1FNFA 2HFEB 1Z7JA 3RTQD 3RX7A 5EEVA 3ESMA 3OKKB 3UP1A 5ITFB 3QPXL 1IBGL 3UCQA 3AB0C 5D1XE 4NQUA 1I8IA 2CSPA 1WHOA 3K7UA 1FFPB 1T4WA 3PF2A 1T83C 2WAHA 3S2CA 4YDVA 5DEFB 3RZCB 5I0DA 2FO8A 2PYFB 1AS6A 1BOGB 3RWHA 5IVXA 2VXVL 4IGBC 1ZJAA 2NZ9C 4NYLA 5KSBF 3HAEG 4FGMA 4EZKA 3VDCA 1TU2A 1RPKA 2AERT 1I1AC 3FPXA 4WO4C 1UXLA 5C9JA 5ICZA 2M2DA 5GS0C 1F18A 1TMQA 1U3HB 2K9UA 2ZZUT 3FL7A 3JVGC 1FNEB 1YNTB 3T2QA 4HEPG 5JA9A 1U8JB 5ENWB 1XL4A 4HK0A 2FIKA 4LL4A 2HPOA 1ES0A 4JHWH 4P59H 4CKQA 4RRPM 3SE8H 4MXQD 4WWID 1BECA 1BQHB 4MA1C 3ETBF 2VMEA 2WXNA 5CD5D 3OXRB 2IJ0C 1N4XH 1GH7A 2ERJC 2YD5A 1MCCA 4X80L 4WI4A 1MVYA 1UKQA 2VZOA 4GMTH 4JFYA 5GJTH 5T3ZL 1BAGA 3IAPA 4TNVK 1Z3RA 4G1EB 4TVSa 4HU2A 4WEEA 4HJ0D 4X5QA 4XVJL 5HDBB 1C7SA 3V0DA 4JM4H 4ZO9A 4P2AA 4EF3A 3QWRD 4OJFH 5D1XC 4A2LA 5C0IA 2YEZB 1R6VA 3GPEA 3CN1A 3ZT5A 1G7JB 2UZYA 3KH4A 4LEOB 2Y7QA 4U1GC 3HE7A 2HAZA 1AANA 1WEJL 2IEPA 3IDMA 4LSRH 4AXWB 3BUBA 3EFFA 1FGNH 4UQAA 4MBOA 4NUGL 2R8SL 4O5LL 1NJ9B 4WU7B 1MFUA 2DEWX 4DAGL 3QULB 4APXA 3VH8B 5I0VA 4PTTA 1U4FA 2J21A 4GXUM 2H3KA 1R3JB 1JD7A 3QZLA 1OB0A 2JWYA 5F3BA 4X8GA 1DLFL 2BS9A 3JT0A 4WI0B 4XPBH 5T3ZD 2CUMA 2D3NA 3QCVL 4YSUA 5FYKH 3RU8H 1HKLL 1X44A 5FOBB 4JFFB 3HRZA 2ZSWA 3OR7B 2VLJB 3RX5A 3BKJH 4OCRL 5EHFA 1D6EA 4GXVH 4RGOL 5F6IC 9CGTA 2BY3A 3IU3B 3CHPA 3NJXA 1B9ZA 1HQRA 4H0LC 3S0PA 4OF6A 4F3FA 3ILQD 4UIKH 5AVVB 3IMRA 5IMOB 2F7RA 3ECBB 4HKZB 2VOTA 4PJGA 1IGFL 1E5AA 5IQ7L 3GMQA 2F6AA 3QFJD 5HGAA 3KZ8A 1H3VA 1ZEAH 3C6EA 2R4SL 5EU7E 3FCGA 3V6BR 3VD9A 4PG9B 2H2SD 3HPJB 1E4XI 2R2EB 1WZMA 4JQIH 3L9RB 1PFOA 2RA1A 4PGCA 2SEBB 2WM0A 2YGNA 2JJUA 3FT0A 4LLAA 4OUUB 2K4WA 5J8OA 2Z1KA 4BK8A 4MB3A 4BE6A 5BS0E 5AKVA 2AQ1A 5K1NA 2AITA 5EO9A 4PH8A 4WF7A 1RU9L 4R97C 1AG0A 1RZFH 2WNWA 1CDIA 4JCMA 4PW4A 4CJ0A 3KLHC 2D0FA 1L7TL 2VR7A 4RH4A 2CLRB 2WMPA 3DSFH 2J44A 3O0RL 1HYSD 1TTUA 1K3ZA 1RMFH 4K7PX 2FUTA 3GSXB 2LR4A 5HPMA 1ZDQA 4XBMA 3CTTA 3GSRB 1NQBA 2B1HL 1NPUA 4XNBA 3PV6A 5D72L 2DBLL 2G9KA 4GG6A 5HHOD 1JPSH 2DTMH 2E74C 4GBXD 1ORSB 4LEEA 4I9XA 2AK4E 4XN9A 1S7WB 3PIQB 4R6UA 4X6FB 1M9SA 3IRCA 1KN2H 3IJEB 3E0GA 1KTLB 1ODUA 4NNXB 1BQSA 2YRPA 3G5XA 4HQQH 2R59A 4ZFFB 3HNTH 3OGCA 5EU7C 4YHZL 4EDXB 3QHZH 3NJNA 4JN2B 4HIHB 5E4AA 3KGTA 3MRFB 2FEDD 2FEEL 1AI1L 3AROA 2AZUA 1UWGL 3KJ4C 2C9XA 2DQMA 2LABA 2IAMA 3P9LA 4LPCA 3ZMEA 3MV7A 4XMUA 5C7XL 4U3SB 3HJ0A 2CBOA 4H1LH 4X5WB 4OIAA 1LNUB 1RHHA 4HUXB 1YAIA 3PWJA 4M48H 4PWHA 3UX9B 1OAJA 2Q76A 4FTVB 5JNYA 4WDIA 4PJ7B 1QQDA 3L1OH 1YEFL 1XGZA 4QJ3B 2OMTB 4HWNA 1N10A 2PYEA 2WTOA 4GRMA 4UQ2B 1NBYB 2JB6B 4R7NB 4IIZA 5CIPH 4L8SC 4MS8C 4PJHA 1HOEA 3CMOL 4HPOH 1EO8H 1YO4A 4RSYA 2WBWB 3BKCL 3BZFA 4NEHB 3RDTD 3KPPB 4L8DB 1G1YA 3TFBA 4V1DB 1IFRA 3L3HA 2VSDA 2Z7YA 3F58H 2AV7A 4BFJA 3OL2A 3TZVD 1CF1A 2MKLC 4L2YA 4YNYB 1I7TB 4HFWB 5KBPA 3AWFA 4HGMA 3OKOA 3VTTA 5I6XB 2GHZA 4NUJB 2OZNA 3EZJB 2RB8A 5J6GA 5D4IA 4AW4A 1ICTA 1VEMA 3KVPA 4PGZA 1M7DA 4FQ2H 4PJ9A 3ZTJG 3FU8A 1MELA 4F33A 1HJBC 4YPJA 4CVWA 4U7KA 1JFHA 2ZSVB 1KV7A 4FP8L 4TOYH 4NKIH 2YKLL 4MNQE 2BSSB 1X5LA 2XQBL 1CURA 3WMPA 3FO2B 1RPQA 2ED8A 4XNQB 7FABH 4KFZC 5I73B 2YIHA 4AITA 4F1ZA 2DKMA 2NY4B 3T0DA 3NFSL 2HTLD 2WANA 1PNDA 1MNUL 2WWKO 4K7PY 3LDBC 2DAVA 3CX2A 1KBKA 1I9RH 4Y16A 1HILA 1W72L 4OZ4A 1XR8B 1SNRA 2WXLA 4QRPE 1G87A 3Q6FA 4YSTA 1VGEH 1XH0A 4D7PA 2Q6WB 4EDWL 2DMHA 3L3KB 5ILTL 3FU9A 4JO3H 2EQDA 3A6BH 5E7FA 1P9MC 3EYQD 3TT3L 1NUNB 1VRSA 2H6OA 2Z0BA 4XB3A 1SXCA 4BFFA 4PV9B 4JJOA 2AC0A 2F7PA 5AVYB 1FV1A 2WLIA 3TP4A 1A6TB 1IAKA 3UG4A 4DGVH 4A2FA 3LNFA 2KUTA 4Q97A 5BXFB 4D0BA 4NZRH 1ZJBA 1OZUA 2EDKA 3VMOA 5DUBB 3I9GH 2FWOB 4YHNA 3GZQA 3BXNA 3HG1B 2VLMD 2HFTA 4UV4L 4JR9L 4LU5L 1CLYH 4JX0A 5AFAA 4MAYB 3TBYB 4JPVL 5FXCH 2WWMC 1NH6A 2A9AA 2V17H 4JFEE 2BXZA 1R33A 2BNRE 1QWHA 2VERN 3EJYD 2LTQC 1AHWB 2NUPA 2GIYA 1CYWA 3QB7C 1QA9B 4WUUB 5D2LF 1NEPA 1PLBA 5HHQB 1ZGLP 3Q2VA 1YNTF 1PLAA 1FH2A 2DPKA 3MBEA 5EO0B 1OIOA 4CVUA 4HZLA 4JPIB 1A6VL 4PJXF 1X9LA 5EA0L 4BFOA 2A74B 1KT2A 3H3KA 1GY1A 1NCAH 3IJSB 4XZUB 1H3XA 1F2XK 4KVNH 5HSFA 3TT1L 4E9QA 4ZMZA 3SO3C 3ZZ1A 5T33L 1JHLL 4H8QA 2DM7A 3PL6C 2WC7A 3GRWL 3ZSSA 2FWSA 3JTTB 5CD3B 1EUTA 3IGAA 4KAQL 1P6AB 4MCYB 4QY8B 3C2AL 1JCKA 4I2XB 1TT6A 2GJPA 4HETA 4P49A 4PVLA 5AWNH 1CFQB 1OXYA 3QUMH 2OR8A 4KMLB 3GHEH 4P0DA 5I5IA 1G4RA 4KZDH 1F4YH 4UT7H 2VMFA 4BV1A 5HHNA 4CW1A 4PJEE 5DT1H 2ICEB 3BPNB 4ETYA 1SQ2N 3J27A 4PGDB 4NWTL 3U9PL 1NINA 3U25A 1CWVA 3V0IA 4RZCB 5I1JH 1RH8A 3FU7B 3WY4A 1J5HA 1VB9A 1I7UB 4Y89A 2NQDA 5SWZA 3HE7D 2M8XA 3SE6A 4C4UA 1Q0YH 3DV6A 3CN2A 2VQUA 2Z8WC 3GHBL 5D1ZB 2YBRA 3QHFH 5CHNB 4PJFF 2Z7ZA 2BIIA 3C5ZC 4OGXL 2HVKA 1JGVL 1QRNB 1T1YA 5C0FB 4J3OC 3OAZK 3CPUA 4KRPC 3K6OA 5L6YL 1G6VK 1ET8A 2COQA 4G6JH 1MWOA 1MVUA 1LJMA 2IADB 2UZPA 4HD9A 4NCDA 2OSWA 1OKEA 4DH2A 3TJHD 4GS7C 3KPLB 4NLAA 1HINH 2B59B 4M9OA 1KJMA 4X4XB 1ZLSH 1QPKA 1XR9B 2P42B 1KJ3H 4FYSA 2RQEA 3F12A 1J5OH 5GGSY 3CCHA 4PRNA 1W0YT 1EXGA 3M6DA 3N42B 4FX5A 3CVIL 1W6LA 2EDNA 4YSAA 5EO1B 3QWQB 2FNWA 1JGDB 3QJTB 5CGBA 3RTQC 2AQSA 2CHDA 2IXQA 4ANKA 5D7LE 2PLTA 3QJQB 4M5ZH 1DQML 3ULUF 1CGWA 4WFHD 4JANB 4IRZA 4PJFA 1X7TA 1IC1A 5AAPA 5DJ2A 3ZL4H 4UB0H 5A6MA 1OK0A 1YCSA 4XXCC 2A0LC 3GXIA 3DRTA 3FUEA 4ZQKA 3RWDB 4QI3A 1OW0C 3ILPA 1F3DH 3BIBX 1NMCC 1GGCH 1RQ5A 5A1AA 5T3ZE 1DQLL 2BVPA 1DBJL 2A6JA 5EN3A 2CJSA 3P4NA 4OFVA 3B4NA 4GPVA 3LZOA 1BWMA 4P07A 1RFDL 1JNHB 1NBVL 1OVZA 4X0KA 5TPWL 1EHNA 4HKBB 2QFPA 1BMGA 3AREA 4GQRA 4P2QB 2QKIC 4ZS7H 4X7SL 4RGMB 4GT0A 2HSIA 3SKOA 2LOEA 3QISA 3AS1A 1LP9B 3E3QE 4NFCA 4OZFA 35C8H 2DDQH 2VXTL 3UTSB 2NYYC 1S7RB 5A2LH 4G2AA 3QFJE 3CLFL 2P80A 3BZEB 1OT4A 2IIJA 4PRAB 1SDDB 3WXWH 4M6OH 1L6XA 3BH8B 4HJ0C 4X99A 1E6JH 2PCFA 2HH0H 1Y0LB 3MNDA 3EFOB 3RGBA 4ZUSA 4EXKA 3O2WL 1TEFA 3L3JB 1MHPL 5FKAB 1I8MB 3N9GH 1BMWA 2WGXA 2DW5A 3MZGB 1CQKA 2WLLA 1Q9WB 4JZNA 2ZT9C 2NY2D 4DN4H 3K0YA 3B7RL 4IMLB 5FV2A 5EEWA 2IAMD 2ZG1A 4ZNEE 2WOBA 5HBBA 5SWQB 3FB7B 5BO1L 2DEXX 2WTRB 1JK9B 2JQMA 2QPFA 2XI9A 1LO2H 3T0BA 5IFAL 3OKNB 4M3JA 2PYED 3JWOC 3OKYA 3P11H 5E94A 3ZQXA 1KCKA 3TX4A 4PRIB 3UEQA 3DECA 3HBZA 3D48R 5EBLA 2ROXA 4PJAB 2FX9L 3C12A 4P2OA 1DUYB 1XH2A 3PWPD 2FSEB 5E24E 5HHOE 3FT4B 3E3QC 2FJHA 2OJ1A 3F7YA 3IJHA 3ZE0F 4MA8L 1QR4A 3BFWA 1MG2C 3B2XA 5BVPL 2BVUA 4K8RD 4LKXB 5FGCB 4G9FA 1XB8A 2XG5B 2XPZA 3LHPL 1T20A 4XTRC 1MLBB 1VCBC 3IEAA 1R17A 2WKOA 3B1UA 5C0BA 4JB9L 1S3KH 1T0OA 3U82B 3KEDA 2R0KH 1TENA 4GMSH 3KPRA 5LXGL 4AWJC 4RX4A 4CADA 3T71A 3Q7JA 5EC1A 3V5DA 1EBAA 2KDYA 4PRPA 4HUWA 2HJKB 3NH7H 2VMJA 3N85L 1VPOH 5DTFB 1MW3A 1A2YB 5FF6B 1LE9A 2B0SH 3DIDA 3TN0B 4YLQT 4LFHG 4F2FA 1DJGA 4Y16D 1ZPUA 1A9BB 5HI4D 1MHEB 1NPNA 3QXDB 3X12B 5CEZD 1CCZA 1IGYB 2D7PA 3ATFA 4YO0A 5DJ6A 4S1DC 2LW3A 1LO0L 4IBUA 4Y7OC 1ZRUA 1M1XA 4LLUB 1OWWA 2Q86A 2A7BA 3BMVA 4UTAH 5HDWA 2JJSC 3L08A 5KSVB 4GQZA 4UOW0 2WXOA 1HCVA 3BGMB 4MNHB 1NGWB 3TJEL 2VH5L 4UZUA 2X05A 3IVKB 3RGVB 3QJXA 1L5GB 2VDOB 5KVDL 3UAEA 5LDUA 3IMBA 4AIZB 1BFTA 3M17A 5FWQA 1E2VA 2C9UA 4HEME 5CWSA 5FFOA 5MEPB 3S3DB 4HV8A 4M03A 4YVUA 3EGDA 1NIEA 4R9HA 5JXEA 4Q9BA 2PCPB 5D93C 1UOWA 1PF3A 1C5CH 3RL2B 5IBTL 5J13C 1DVFB 5ACLA 4ZSOE 1XCTA 3AMLA 2CWRA 3ZL1A 5J6SA 5JW4Q 5DQJA 1FHGA 4WGWB 4X98B 4C57C 3THMH 5ICXA 1KYOJ 5IVZA 3U0PB 4GKOA 4TSAL 4PJ5B 4Y9BA 3G5VA 1RUMH 4GI6A 1P84J 2QR0B 3LOWA 4AK2A 2OTPA 3ZT7A 1RIUL 1GRWA 4Y2OA 3SKJL 3FCTB 3OBAA 2FZ3B 3QORD 3MBED 1SUJA 1ERNA 1XGTA 3KBHE 3N1QC 1D7CA 5DZLA 4N0UA 1REIA 4WFFD 3D12B 3RUGB 4P06A 3SOBH 3R0MA 1UOVA 2HZHA 4N0YH 3U46A 4Y5YC 1PZ3A 5JIHA 3DYMA 4C4BA 5CAYB 1TCMA 3ASNB 5JHLA 3E7JA 2GTZA 4JG1L 1OAYL 2BHZA 2COVD 1J8HB 2WYTA 1HE8A 1WAAF 4MD0B 5SWSB 4WV1A 1LK3L 1WD9A 4KTYA 3WFCL 1J1OL 4PS4H 3CK0H 2A73A 3LD8C 4FNLH 1ZANL 4HS3B 4X9HA 1ECYA 4F2EA 4ELMB 1VZGA 2HN7B 3D7PA 4KDWA 4PB0H 4MJ6B 2VLME 3L3DA 1WBZB 2EEFA 5ES4B 2HP4A 1F6FB 3NGBB 3V4VH 5AB9A 1HCFX 1T0NA 2W60A 2VL5A 4KROC 5G5DA 2WGNB 2HB0A 5I66A 2NZIA 3FSOA 2P8PA 1C5DA 2JKTM 4MNGE 1TMCB 4X83A 1KWKA 4L4TB 4ORZC 4Z78A 2IH1A 3LH8A 5KVFL 2HTLC 4PVMA 3UYRH 4U4IA 2YAPA 2JCCE 4KVCL 4OIIL 3UTOA 4PREA 1AO7A 2FLMA 1ZE3H 5SWZD 2MFNA 4PLJC 4CRPA 4MMXA 1A6ZB 1A4KB 5EWIH 4AYFA 2I24N 3MREA 1CYXA 1W8EA 1Y6MR 3C5SB 3U0TB 3TS8A 4TPRL 4X5PA 3T65B 5IMMA 1MIEH 4N0CD 5IFHH 3HE6B 4XPFH 1A02N 5GGQH 4LLYB 2Z8RA 1IE4A 5IK3B 3QJRB 3KGRA 4IDLA 4YC2B 3GTTA 1QEWB 1KYAA 3CZGA 3U30C 5ESVB 3GMLA 3NCYS 4PB9L 1MI5B 1HHHB 2VDPB 1SY6A 2HCZX 2IWEA 2ZXAA 4JDVB 1F3JA 1BAWA 1S9YB 5A16B 5CEXA 2XN2A 2BNQB 4X8CA 2O5YL 5DQDL 3FQUB 5T5NF 1TJXA 3P3SA 3BVVA 1YDPB 4BH7B 1GOHA 3TYFB 5KSBE 3HMXL 1RZ7H 1S8DB 5ADPL 5C0CE 3WNIA 3OAWA 2C34A 4NNYB 1L9QA 2B77A 5HI3C 2IFFL 5SX4H 4BH8A 5K9QI 3T5WA 2FHCA 1WBXA 4GXUN 2Z9TA 4W9JC 3EJYC 4IK7A 3ULUL 4YQXH 3PG2A 2XWJB 5KAQG 4EN3B 1OAQL 3FQ1A 2ADJA 3X1BA 4LPUA 1DLHA 2XTJD 4FQJH 2ADIB 2BSRA 3CLWA 2FEJA 1JNLL 5IGXL 1N67A 3ZKJA 1QFWI 3BIKB 4NHCH 1U95B 4I3RL 3O2VL 2WYZA 1SBSH 1O9WA 2M1KA 4X2UA 4DP0X 1T21B 1VF5C 3EOTH 3O6LL 3RVUD 1NCOA 5DJ0B 3WJLA 1HL4A 1VFAB 2CGRL 2ZOTA 4I0KA 3IKCB 5GGSB 2F74B 5AW8B 4PRDB 3ARED 3CFCH 4MYPA 4A7TA 2ATAA 3Q3GB 1N70A 2ZXDA 5HHVL 4JW3A 1ZA6A 1EGJA 1M7IB 2OL3B 1PIFA 3ROLA 4ONHA 1HX0A 5C2BL 1NWPA 4X5LA 2P80D 2P5EA 1UCBH 3NDZE 4HMDA 4ZTEA 2LLGA 3WFHA 3PABA 1QTPA