3ZTCC

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
141
Chain Sequence
LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 141
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 3ztcC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 3ztcC01
4W9DC 4W9KC 4AWJC 4W9LC 1LM8V 1LQBC 3ZRCC 3ZTCC 4W9GC 4W9FC 4W9EC 4BKSC 4W9JC 4W9HC 4W9IC 4B95C 3ZUNC 5LLIC 1VCBC 4B9KC 3ZTDC 4BKTC 4W9CC 4AJYV 3ZRFC 4WQOA
chains in the Genus database with same CATH superfamily
5ES4B 3P73A 4GRLA 3RDTC 1U92B 3KPNA 5E0QA 4XI5D 1U41A 4JFUA 1ZT7B 3RE0A 1W16A 1SZNA 1QZNA 4BKSC 1UZGA 4RNRA 4W4OA 4IBTA 5DRWA 3RWDA 1YY8A 2VLMD 1KF9B 5A16A 4JBSA 1PJ9A 1OW0A 1QHPA 3IDNB 3WEXB 1ODUA 3WHXA 1WH0A 3QQ4B 1HSBA 1KB5A 2HT3C 3K72B 1GS6X 3UPRB 1ZSHA 4FQHA 1NBQA 3GMPB 2WINA 4ELKB 1MG2C 4BDVB 4HLJA 2VC2B 2D3JA 1IC7L 3IFLH 1U3ZA 4P3DB 5D70H 1KACB 3CUPB 5AW4B 1JXKA 1XH3B 2LGNA 3QSKB 2Q8BH 2X6VA 3IF1A 2XZAL 4J4PA 3TEWA 1C5CH 2VDKL 3GT6A 1RZFH 2VCOA 5CCHE 1A1MB 3LD8B 1DVXA 4Y9GA 1EZVX 2GT9A 4JFDB 3UJJL 2N0MA 5DEGA 4IIQB 3NIDB 5T1DL 2FEEL 4WWNA 1G4RA 3DUSA 3KPSB 1NICA 1YNTF 2GBUA 3CLEH 1XCQA 4N2MA 3FO9A 3UZEA 1DBKH 5GGRB 1U8HB 3KPRA 2BSSB 3NA9L 3EH1A 2BZDA 4EUPB 1AKJA 1S78D 2QQLL 3VUAA 2OMTA 4HUVB 5A2LH 3SDCC 4X98B 1GGTA 5HYSB 4AJWA 4IBUA 3HNVL 2Z4QA 3X1EA 3ZT6A 2W1NA 3NSYA 3EGXB 1U8MA 3MBEC 4JRYB 1MCPH 2PO6B 4GXUN 3S48A 1UB5A 3WIIL 3QJZA 1SYVB 5HGHA 3NACL 4Y8AA 4KKBD 5FLVA 3QDMA 2VXQA 1GGIL 4NZTH 4XXCC 1S9XB 1ADQL 2ICCA 2JJWA 3D8MA 1HOCB 3I2CL 1F2QA 3MLWL 1BLNA 4HBQA 2DWTA 3FPYA 4TVPD 4EDXA 5HVHB 4UT7L 1CD1A 1DUZA 1FG2A 2DQUL 3TZVA 4EXPX 2ALWA 3JWDL 4XCNA 4KMTH 4LOUD 4MNGA 2G5BB 1EH9A 3OSVA 1WUNT 5J1SC 1QNIA 1F41A 1WSST 2NXZD 3PWUA 4FEIA 4GYBA 1BQHG 5BZDA 2A9CA 4DGWC 4J3OF 4E36A 4KTDH 2E27H 1GYWA 1C1EL 4YGAB 2AXHA 1IGIL 3GSQB 2VO5A 4TQHA 4ELMB 5EDSA 4ODVL 5GSVB 4BWUA 1QLRA 4ZTOH 1N59B 3R4RA 4PJ9C 2FD6H 1MOEA 3IJYA 5D2LA 3WOVA 4ZUTA 4H7VA 1Q72H 3RY4A 4UU9A 2EXWC 5DD1H 3QZWB 5IHBA 2D7QA 2M8XA 3L08A 1PZ2A 2B5IC 1S7TB 5B3SB 3K6DA 2FBRA 2EDXA 5EFIB 3B2MA 1S9YB 2DV6A 2VDLH 3EYQC 4I4WB 4R2GC 3EFOB 4M6ML 1HE8A 4YZFE 1S78C 4QF1B 2NUTA 2ZCHH 4JQIH 1BP3B 3Q3GB 4GIOA 4XGZB 5J11C 1FSKC 1N6VA 5TF0A 1O5PA 2ZCLL 3UERA 5BXFB 4PTUB 5E4AA 4OD3H 3MTRA 4YSQA 3AAZA 2RMNA 1D6VH 5I76B 2EE6A 3RUGE 3UZVA 1N9PA 1V55B 1OANA 4KKBC 4LCUA 3RKDC 3PU7A 4PGEA 1HVXA 1UYWH 2VDQL 3ARFB 3RIAF 3BFWA 4B9IA 3CN4A 5ISZA 3V0VB 1MQKL 4Q9CA 3LQMA 1AZRA 2D3LA 4HISA 4OQTH 5IQMA 1QZ1A 3BWUC 4L3FA 2NXZC 4PRIA 1HL5A 1A1NA 2X4OA 4NKQB 3ZDXE 5CIPB 1JGIA 3KGSA 1WC7A 4FQ2H 5BRZE 3MV8E 5DHVA 4BFBD 1NOAA 5ECJE 2OX5A 3G5ZA 3VXME 4DP8X 3F6LA 5MHSD 3UTQB 2P8MA 1PNDA 3B34A 3H56A 4N26A 1L6XA 1JP5A 4WV1C 1KCVL 1L6PA 2YMOA 2YC1A 3X3FL 4AK2A 3RWEB 4N5UA 1G6RL 2C4FT 1JF6A 1FG9C 2EDQA 4QOKD 1BBDH 3OR7A 3FQNB 3GSUA 2X9YA 2YMXL 4LKCB 2ZUTA 4A7UA 1UCTA 2CK0L 4ETQA 4HKBB 2CDFB 1WBYB 4F15C 1A21A 3N0PB 2OSWA 2BNQB 2ADIB 5JYMA 1WS7A 5DHMC 1UD8A 3RWIB 1UB6A 5E8NA 3RVTD 2UVEA 3V0WL 2XG5B 5EUKA 4Y2OA 2OMUA 2JIXB 3CPLB 2HJLB 1MI5E 3T8MA 1OM3H 4KZDL 3PJSB 4C55A 3S2CA 4ENEC 2CO7A 5MEPA 1AKPA 3D33A 4KQ3L 2EICA 3K46A 5GRVK 1BBJA 4ZS6D 2F74B 5E94A 4G9FE 4NNYA 3GMNB 4XN8A 3SD5A 4L8DB 3ES6A 4O2CB 4KK9D 2MKWA 3B2UC 3NCFB 3X11A 5LGKA 2BSCA 3ZKSD 3HRZA 2HA1A 3FCGA 1MVYA 4OCXL 5LAPA 5D7LD 2WAQA 4OR1A 1D3CA 3VQMA 5CLZA 3Q48A 5F7NC 4NFDA 4RMUA 2AJYH 5FHAH 3VXSD 2EIZB 1VFBA 3S3BB 1U8IB 1WZAA 4HUWA 2ESVD 3BAWA 3BJ91 4B97A 4BUHA 1PSKH 3WIHH 1ACXA 4LCIH 1HSAA 3KPOB 2HFGL 5F70A 5LGHH 1JERA 2Z31A 4LVOC 4Y5VC 2GJ6D 1CDIA 3WFBH 2C9QA 3ATDA 1T1XA 1KJ2H 3KEHA 2P46B 4GAAA 4YFEA 4G8GA 5SWQA 4GQ9L 1DN2A 5IW3A 1JRHH 1NGWB 3T5WA 1F58L 3SDAA 4ALAH 4D0DA 4AT6B 1JNNH 4MXVF 1QSEB 5MENA 2O6CA 3EDDA 2HLFD 3D69A 3IMWA 3SKMB 5C0CD 4LOEA 2L3BA 4UTAA 5KSUA 4MX7B 2AW2A 5GRWA 4YO0B 3BYYA 2X9WA 1N6UA 1HS6A 4MJ6B 4ZFGH 4ZMQA 1N6QH 3RVXC 4Z7OE 4PGCB 3M8OH 1ZIAA 4WU5B 3GSNB 2VLRA 3P9LA 3L3DB 4UZUA 5I1LA 1A65A 3MXWH 3BDYL 3ETBF 4Y19D 5KVGE 3ZZSA 4NO0B 1Q9OB 2BSTA 2FIKB 5DA0B 4K71B 3VI4A 1QWUA 5AKSA 4NHCL 3SDXB 2IANA 3R0NA 3MRMB 3HMXA 4WWID 1F1AA 1LP9A 2G2RA 1UHVA 1ASQA 4YPGB 1J5CA 4JG1L 4JHBA 4B9JA 1IBDA 4LP4A 1ANUA 1CG9A 3IJEA 4RIRA 4JX0A 5D7JC 3FTUA 1N64H 2LTQC 3CFUA 1A7BA 2WUBH 2FH6A 4U6XA 3L5WA 1AS7A 4GKOA 4I89A 4PJCB 1DBAL 3BUBA 1ZDQA 2QGBA 4Y4HC 5EORL 3PWPE 1MCRA 5JXED 1TJMA 1AGEA 4NN6C 3PHQA 4RAVA 1BF5A 3IJ9A 4AYFA 1XB8A 2P7TB 3B9VA 4DF9A 4XHQA 3V79C 4ILDA 1KBKA 4OFPA 5ALCH 3U7WH 2HLFC 3N1GC 5HDQH 2VC2H 4PRDA 5JA9A 4OI9A 5I30L 2C3GA 4PEEA 4IQHA 3D85A 1S7WA 1PIFA 5E5UB 3VCLA 3VSVA 1M7XA 3JTBA 5C07B 3KPLB 3G5XA 2HUEA 4CC4C 5KTEL 4M61B 4N8CL 3ZBMA 3MREB 1H6TA 1CD9B 1BYPA 4ABUA 4YC2C 1FCCA 5BS0B 4LLDB 4GW1B 2VTFA 4V1DE 3VXRD 4UOW0 5ADPH 1RZJL 3WY3A 3FFCE 4E0RB 4GUPA 5C2BH 1KB3A 1THAA 2BH0A 2C9UA 2VM9A 3ARQA 4HPOH 4P2RA 4NKIL 2UZYA 4ZUUA 3CSYB 4GAGL 1PYWB 2R0KH 3INUL 3N1FC 4JUTA 3MKKA 5EPMB 2LW3A 3SPJA 3UH8A 3EAKA 3G6DH 2XV0A 5LWYL 5ID1B 4HIXH 1U3HB 5TFSL 1F3DH 1MFBH 3OGCA 3VRJB 3V5KB 5GSRA 2VWEE 4JFZL 3O41B 4G3YL 2HP4A 5D7EA 1XDTT 4OKVB 3VWKA 2J25A 3B7RL 3C8HA 3O9WA 1NCAH 2QGDA 4L3CB 5I2IA 4WKZA 1GHFH 4HZLB 2WYZA 3NEXA 4R9HA 1KN4L 2F7QA 5IBLD 2EINB 2EDTA 4XNQA 1NJ9A 1VZIA 2O6FA 4H0IA 3NJHA 3IDIA 1H3XA 1ETA1 2W60B 4JHUA 2FYYA 2XY2A 4Y2DD 1JYXA 1XR9A 1FDLH 3AG1B 1R24A 3FFDA 3B56A 4PLKD 1SJHA 3F83A 2C9SA 1Q1JH 3DV6B 3EYVA 4L1BA 3TO4A 4HIPA 1FCGA 3QI9A 4UQ3A 1FZJA 4U33A 4TUJA 1LEIB 2VJ8A 2FJGA 4ZBJA 3KS0J 2DLEA 2B9AA 3O8XA 4QRTA 2QT6A 2ADFH 2J43A 1UOVA 5FFOA 3DTXB 2BNRA 2XQYG 1AD0B 4EI5A 1BQKA 3DO3A 1U3JA 3K1KC 2MNWA 3PV6A 3U1QA 4FLOA 3SO5A 4NUGH 4XPHH 4PRHD 1V3LA 3MCKB 5T5FA 1YEIL 1ORSA 2NZ1A 2FQFA 2C7UB 5BUGA 2NMSA 4XCEB 4K7FA 2FL5A 4UDTA 3ARYA 3OGOE 2AEQH 2AZUA 1HH9A 5IKCA 4MVBC 1MJUL 3BUQA 5I15H 4NEHB 3QXDA 4Q6IB 4J3TA 1PPIA 4Q0XH 2ENQA 4FI8A 4ZXBC 2GAZB 4JG9A 1JF1A 2CLVA 4JY4B 4MS6A 5IW1A 1TJIH 2DWXA 1VGEL 1B0RB 4PY8I 4ODHL 1ZMYA 1ORQA 4LRIA 1JCVA 3L2NA 3DBXA 1I75A 4HX1A 2XJLA 1ZVYA 2IDUA 3VJ6B 5E5MB 4ABVA 3RURA 4PLKC 4RGOL 1IGCH 2CH8A 5AG9A 3ZDZB 4MAYC 5CIPH 2DL2A 4CSZA 3HE6A 4GKZA 1A7QL 4HYTB 3LKOB 3QUYA 1WT5A 4QYOA 3MGOB 3NJGA 3PGCA 4AQ1A 1RZIA 3BN9D 4XVTL 3GBNL 4LDEB 4W81A 4FG0A 4KNSA 2VQ1B 1OALA 4QI3A 2JELL 3M88A 4M1DL 5IG7B 2NY3D 4P9HH 4C83A 1A9BA 4MNQB 3ZZLA 3MLPA 1T20B 2VISA 4ZMPA 5GGUA 3V6FA 3UZQA 4XXWC 1KXTB 1TXKA 4OZGB 1OGAD 3KWXA 3HE7D 1BF8A 4LNVA 4MXWL 1EHAA 1MREL 1M6UA 4FLSA 3EFFA 3CFDB 2VQ4A 1C5DA 4JDEA 4N9OB 2APSA 2QHRH 3ZE2F 4EBQH 1E6OH 2APTA 1WQVT 3SE3C 4Z78A 1Y1UA 4GI9A 3QAZC 2ZOOA 4G6JH 4M00A 4NDMA 4QHUA 4HKJA 5JXAH 2QQNL 1YEEL 2UWEE 5FKPA 4AEIH 5KYXA 3WNJA 5AW1B 3R06A 1DFBL 1YNLH 2PTTB 5LCVA 1KYOJ 4UM9A 2P43B 1EDQA 3QRGL 4Y0GA 5GGQH 1TDQA 2J8UA 4DEPC 3ZTJG 1RIUH 3LEVH 3J8F7 1XGTA 4YXHL 4AUJA 4PJGB 3S34L 4GFTB 1WVZA 2NQDA 1OWRM 3H9SD 5EO9A 5CZRA 3L1OH 1T83A 3AVEA 4X6CE 2WZPA 1ZK5A 4RAUB 2H32B 2BP5M 2X12A 4M29A 2ARJA 4MDJA 1XF3B 4NN5B 1SDDA 5J13B 2JKXA 2W9LA 1H5BA 1C5BL 4QHLB 2X4UB 1UTDA 3RNQB 4DOHE 3BX7C 2P5WE 1KGXA 1CGSL 4MZ3A 2EEXA 4KTEL 1DJXA 4NP4H 4ZMTA 1J88A 2J2ZB 4ZPVB 2ENJA 4Z7WE 4HWZA 4YHMH 5D1XA 4DFIA 1KLUA 2XTSA 4WRLA 4EO5A 2J1KA 2PXYA 3JVGA 4FXKB 5F3HB 5E2TH 1VFAA 4KV5F 1MLCB 5CGYD 1I82A 3PWVA 2WLYA 3VRLE 2F5BL 4TV3A 1RJLB 4JG0H 2F1AA 1KYDA 1X6LA 2L8AA 4PJBE 3BVNA 1S7XA 4HQQL 2KLSA 2ZKXA 5E6ID 4J6RL 4FXLA 5I71B 4N6RA 1JK9A 3HB3D 1GGCH 4TQEH 2GC7C 2XYCA 1EHLL 1SN0A 4NWTL 3LV3B 1ZA3B 5IMOB 1YUHA 3RWFA 4DO4A 1HXYA 2F53E 5D7KD 2BMKA 5FO7B 3SCMB 4K15A 4QRRA 1SMAA 1CB4A 3U46A 5E6SB 4PYGA 1NCHA 2R0LL 3P3SA 1ZLWK 5AZ2L 1VHPA 1KLFA 3FO0H 4KJYB 5FOBA 5SWZA 1G7MB 3MLTB 4YHYB 2BNUA 3HN5A 4XWOC 3L4YA 1CGXA 5LG1A 2GK0B 1UWYA 2CHNA 4GSDL 4NO2A 4G80A 4M56A 3WFEH 4GNKB 1DVTA 2AQRA 4TULL 2UXVA 3M1BB 4TUUA 3DMMA 3WFZA 4AVJA 5IHUH 1FFPA 2GHWB 2V0AA 2BINA 2YGVA 3PAYA 4JY5L 4AM0Q 3UJTH 2R23B 4JO2H 3DSFH 1KIQA 4K3GA 4JK0D 2AAVA 5C08E 5LBGA 2K7PA 3CLFH 3GMMA 3QEQE 5T3ZH 5EO1B 3PJNA 1CGWA 2UUDK 3K6IA 3LKQB 3CHRA 3MYZA 3O4LD 4JGUA 1YY9D 2GUYA 5E6IC 4P2OD 2VN3A 2DPKA 5HHOA 5DGRA 3HG4A 4ADJA 3GMQA 3HB3C 5B8CB 1FWXA 1R3HA 5F96L 2W9DH 2K70A 4OQTA 4ZYKB 3U6RB 4PJHB 2DWDB 4CMHB 1DVYA 1IAIH 1X9LA 5ESVB 3ROLB 1M71B 4MYWB 4OJDH 2IPTH 1ZRUA 5DR5L 3WSQH 1WD8A 1KDIA 1F8TH 2PETA 3KCPA 4X5RA 2GSIB 3OPUA 1TFHA 2NCEA 1F2XK 3ESNA 4MDRA 5L2KD 2V9QA 3FQXA 2H5UA 1AGFB 3L7FB 3MO1A 3SYOA 4AMKH 4S1RL 1T3FB 3UTOA 4A63A 1WPCA 4NGHH 5EF0A 4O4YL 3E6HB 3P4MA 3LKSB 1G7HB 4NNPL 4D9RD 1HKFA 3V9FA 3WDJA 4HHAB 2Q3ZA 3V6OA 2UYLB 4HXBH 1KPUB 2YA2A 1JSYA 3MLSL 1XGQA 4F20A 1OGTB 1TVDA 1AO7D 3GSWA 6FABL 3NDZE 2LLGA 4A6YA 2J8HA 1NGQH 1V7MH 3L3OA 4DGYH 4BKTC 5IB1A 4DHLA 4WTZG 3GC3A 3S4SA 3T3ME 1MFAH 5L88H 1DL7H 1A7NL 1ET7A 3MROB 3QUMH 5H4ZA 3SJVA 2E9JA 4YX2H 2HMIC 3FONB 4UQIM 1YY9C 4FA6A 2QEJA 4P2OC 1RZGA 2VB5A 1HILA 3HEIB 1MCBA 5ESAA 3SYQA 5HYFA 5I1GH 4MA1B 2D7MA 2N7AA 4JQVA 1A6WH 1JZ3A 2OW7A 2QGCA 1WLHA 3CHQA 4Y5XC 1J9QA 3CVHB 2F19L 4PM1A 1YHPA 4LXFA 4RFNC 5AVRB 3AU0A 3UDWC 1TNMA 4R0LA 5KG9B 1AYOA 3TU6A 3GK8L 4XP1H 4PV8B 4EMZA 4WI5A 3T2NL 3UGUA 2AK1H 2IH3A 5CCKL 2WCPA 1C08B 2YXWA 2YLHA 5AOZA 1M1XB 4F7TA 4U2YA 1JPGA 2CO2A 4FQCL 2O93L 2R0ZH 5DMGD 1RZPA 5AYUL 3WIHA 4U6VH 2WBJD 1SPDA 3IS0X 4JJ5B 5KOVC 5J6GB 1RUQH 1GGBL 4N8PA 4OU3A 1SBSL 1A7OL 2UZIL 3TYFB 4YDVA 4P4RB 3QPXH 2JQZA 1KJ2A 2OMXA 3UO1L 4HS6B 4NRXA 4WUUA 2Y6SD 5D1QD 1RJZB 1XGUA 1MFEH 4EQ2A 2XRAH 1KFAL 3IDMA 4E41D 1KWGA 1WWWX 5KJRL 3MV7D 1LWRA 3AACA 3TYGH 3TCTA 4R97B 1AS8A 1I9JH 5TDPB 3BP7B 5DRXB 3D50A 4GO8A 3VE0A 4U7KA 3PJLA 4R96B 1CR9L 2WOYA 2PKDA 3D0LA 4BE5A 3HBZA 1A6UH 2XKNB 1JYNA 2J4WH 4H4NA 1M1SA 2XI9A 3FTZA 3KM2A 3VFTB 1KEGH 1B3IA 1OIOA 2BOLA 3VWJA 4FABL 2ZKYA 3D06A 4IDJH 5JW4N 3MCG1 3TOPA 2FO1A 3FT1A 4ERSH 2C9RA 4F7CA 4YBQD 4UNIA 1HH6A 3NZSA 5HJDA 1BQHB 1WAAA 3F5WB 2CXKA 2OR9H 1XFPA 3LEXA 4FXTA 2WYIA 2C8NA 3KLHD 3K5SA 4G1EA 3MNDA 5EC1A 3CC1A 1KUMA 4QRPE 3HS0A 2DBJA 3LXCA 4PS3A 2VXSH 4JPWH 4XN4A 1WBXB 4LSDA 5FFLA 4F27A 2D4FA 1XF4A 1M4KA 5FA4B 2C5DC 1E5BA 4J3OD 3IU3B 2CM6A 2J73A 4G8IB 4X4KA 2HTLD 2X05A 3RPBA 4RVBA 1Z5LA 2IIJA 1W0WB 8FABA 4S1QL 4F7EA 4GKNB 4KHTH 5D1ZD 4FJZA 5I6MA 1QR1A 4LRNH 5KS9F 1PD1A 2EIBA 2ZNWA 3LVEA 5FGBA 3IRZA 4OLYL 4HG4K 2RJMA 2WBKA 3IFOB 3H0TA 2VZSA 5CBAA 35C8H 3MNVB 4WW2B 3P30L 4X9FA 5IP4A 1CZ8H 3CN3A 4QTFA 3OKNB 5DJ6B 2XFGB 1P5UA 3NFSL 5KYWB 2X0VA 4HUNB 1KC5H 2BS8A 3GJEA 3M1OA 1F90H 4ONOA 1SJXA 2H32H 2R2HB 3T0WA 1FRGH 2RGSA 1TT6A 3HHSB 2HYMA 1WISA 4HS8H 2VERA 4NUJA 1GY1A 5E99H 2YKLL 5C6WH 1XH2A 2DB8A 4YBQC 3IT8D 1MHHA 1PDKA 2JXMA 2PMZA 3MCLL 5KN5B 5BV7L 4GQPH 3TPUA 1YYMH 4X99B 3VSQA 5H2BA 2YEVB 4POYA 4GMTH 3T08A 3UG5A 4D0BA 1QACA 2WSPA 4G1MA 1KT2B 2JCCF 4LIQL 2NTFB 3FU9A 4CJ0A 1DQTA 1AXSB 3MUGA 5MERB 1LQSR 2N56A 4IIQC 5BRPA 3NA4A 43CAA 2A9ML 2HTLC 1NPJA 3BN3B 4GBXA 5DUBA 2DKMA 3GIVA 2ZSWB 5CR1A 1ACZA 3JWDC 4A1RA 3KWTA 1YYCA 1X9UA 3II3A 3ULVF 4TL4A 5GGVH 2WWNA 5BNXD 2L7QA 5IWLA 4LFHG 1JMZA 2NY7L 2AEPH 5F1IB 4DPRA 5L4MA 1SN5A 5DRNB 3QIUA 1LO2L 3T2QA 4IBYA 2WN2A 4PJXE 5LN8A 2VLJD 5L2JB 3NESA 2PO6C 5HYJD 3OZ9H 3FAXA 5FYKD 2P5EE 5DQDL 1FN4A 4LPYA 2BXYA 2A6IB 3WN5A 3LKPB 5CXPA 2R29L 4IRZH 5HI3D 4G6KH 4YHZH 2Z7ZA 5HVHC 3CFJA 3MRPA 4WSKA 4B27A 4OZHF 3F04A 3KPRE 4RGND 1MCJA 3DJZA 5EIIB 1NFDF 5GZNC 3CPUA 3JTSB 3LMJL 4PW3A 4TVPH 4KXBA 4Y2DB 3U4EA 2FJFB 2VR7A 2CMRL 3QFJB 1OQOA 4NQEB 5H37G 2IPKA 1KELL 1S3KL 4Z7QB 2EH7H 1SLVA 2DQCL 3K8KA 3QQ9D 4IOSD 3HLAB 1J1XL 2ZWYA 4TVUA 3UAJA 3LCYA 4RZKA 1ZLDA 3RGVD 4Z8FH 4N2BA 3QJUB 4PCSA 4BK5C 1CICD 3RJQB 1ERNA 4AIZB 3HI6H 4R4FH 4Z7NB 1NEZA 1CJYA 2UY6A 5LN4A 3DXAA 4O2FB 4X50A 2PCYA 5I75C 1M2VA 3BE1H 4YE4H 3ARXA 2B1OA 2WIIA 2WLIA 1OTUD 1UASA 3CG8A 4HGKC 5FO8B 3QIWB 1RZ8A 2X4QA 3QFDA 1CFVH 3O6FD 4PV9A 1L0QA 1MJJA 2DMCA 2R51A 1JN6A 1NGZA 5I16B 3IGAB 3MRDB 4JJHA 1PG7L 5EZIH 4I1PA 1E42A 4JM0A 4NKDB 2VKXA 1R19A 5E24E 1DZ0A 2ICWA 2PR4H 4DVRH 3QUXA 4RFEB 3TN0A 1BZ7B 3WTSA 3LRGA 3VI3F 1G7IB 1U58B 4LAQL 4L23A 4B9FA 4U1MB 4PHZA 1QFUL 4HZ1A 1HNGA 4NT6B 5ITFA 1JV5B 3IVKB 15C8L 2DMBA 2MNUA 3CFIC 4C56D 4LDLB 3MNWB 1CXKA 1J05B 2EYSA 4X6EA 5TDOA 2CPUA 3BZDA 1Y18A 3IMRA 5DRZA 1A9VA 3QQ9C 3DTDA 4FQ1H 4C4KO 5D5ME 3RI5F 3FF8A 3RGVC 4QPEA 4IKLA 4ORZC 1MCNA 2YD7A 3KJ6H 4XHJC 1CICC 2E0PA 1E3XA 3CH1B 3ZQWA 5L4FA 4M5YL 5D6CB 4H1LG 5GZOA 2DJUA 2P5PA 2OSXA 1M7UA 4PWGA 3EO9H 2OS7A 1COBA 4Z9KB 4PP1D 4A2LA 3T77B 3MRBB 1KZYA 5I74B 4HEPG 3NQIA 5D55A 5I6XB 3ZZQA 3UAEA 4AL8H 1F0LA 3WMPA 3BWAB 1PKOA 2B08A 4HCIA 1RIHH 2YUZA 1OGAB 5HD8D 1A6TB 3MLXH 1NMBL 1BAGA 3M86A 4LP5A 1JXGA 1UJTA 2P8LA 4JO3H 5CCGE 4NRYB 3RAJH 2XWJB 1DQLL 3FQTA 1BM7A 1J87A 2NDFA 3BZ4B 4FLHA 3D39A 4Y4FB 3REWB 2HKFH 3OLGA 1A64A 1ID5I 4IOFC 3S5YA 1QO3A 4L1SA 3T65B 5TK4A 1K72A 2WIMA 3DKHA 1AHWA 4I3SL 4BCYA 3ZMRA 1KTJA 5CD3B 2FHCA 1YG9A 1YEFH 2B4CL 3QUZA 4U7MA 5J3HC 2QZQA 4HULB 1QBMH 4MMXA 1JFHA 3JWNC 3MR9A 4X5XB 3A67H 3U36A 3L4WA 4M6OH 3A47A 5CU9A 4ZS7H 5PCYA 1NC2A 2AKRB 4U1NB 1U91A 3OKLA 1KJMA 4K3DL 4H13C 3SBWA 4K0OA 5DYOB 5I6OA 2CUAA 1BFTA 1ZPUA 3GBLA 4KQ4H 2X6MA 5L7XH 1RZKH 4QXTB 1UM4L 4AWJC 4UDUB 3H6JA 2TRHA 4A2DA 3LQZB 3D2TA 1PF3A 5KBKA 4W9FC 4S1SL 4PP1C 5E1IA 5KW9L 1JD9A 3C9NA 2ZPKL 3UTTD 4NRZA 2NY2D 1NSNL 2XA8H 3MRRA 5C1MB 2A0LD 1F1DA 1VADA 1LNUB 2CLZA 2VJ0A 1OCCB 2N7BA 4DGVL 4FFZH 1PAZA 3O3AA 5JZ7C 2EVFA 5HD8C 1HZKA 5EZPA 2YJQA 4PS4H 8PAZA 3QIBB 1NAMA 1OQXA 3FCTB 4TKWA 2J6EH 3P77A 2HVKA 3TPKA 1UT2A 3CE1A 4P05A 1GMEA 1T2XA 2R1XB 2XFXA 1Q9WA 2BSRB 1UFGA 1XF2B 4OLUH 3VXPA 2XC8A 2AV1A 1DLHA 3QHZL 4K71C 3W5MA 1PZ5B 4GW4A 4AQAB 4FKKA 4MFHA 3SQBB 2AQSA 4JKLA 1BQUA 4ANWA 5I1CH 4RETB 1JV2B 4HIJA 3MODL 1S9WB 2QKSA 5HDLA 2ADYA 3RHWK 5F1NB 2JKSA 1HEZB 5MI0B 3PAUA 4AEHH 1XL6A 2YPLD 1MPAH 2ZJSH 2UY7B 1HDMB 3DRQB 3CZKA 1RZJC 4DT2A 4M8VA 4OFKA 1OVZA 2D31B 3BVXA 4QDGA 4U1KA 3I6KA 3CDZB 4WFEE 4ZUVA 2LFEA 1I8AA 2A6KA 3RIKA 4FNRA 2EVHA 1T0NB 3AG3B 5IB4B 2AJSL 4X4ME 5BPPA 3PXLA 3RWHA 1ET8A 1S7QB 1MHCA 3TBVA 2VW7A 4M6AA 3L6FB 1WFJA 1J8HD 5LBSH 4KDTA 3TH3T 4AGNA 3E6FB 2KS0A 2JFCA 4MAUL 3V4PB 1U8LB 1J9TA 3F7QA 3D48R 3GSXA 1XGPA 3TVMD 4MTMA 3ULUL 3Q8BA 4XBEH 2QR0A 4EN3A 1FYTA 4IS6A 2UV3A 3WKPA 4N2IA 3ZX1A 3NJXA 3HFFA 3O4LB 2BP0B 4JVWA 4LCWA 1ASOA 4O02L 3V0IA 4DP6X 3US9A 4CSSA 1E65A 3D2UD 3LNFA 4FNTA 2YXVA 3IKCB 3U0WL 3ULUF 3E9TA 5KVFL 1EEQA 2E6PA 4OSUL 2FATH 4DQOH 3APMA 2WLLA 1U3HC 4QCIA 4HJIA 2OZ4L 2R4RH 1DE4A 2F5AH 4W9LC 4PJ7B 4BWWA 3CNKA 2JJTA 4G8FB 1YEKH 3QUMA 5DYFA 1KPRB 5IJKA 1ZOXA 2EDOA 5L2KB 1CL7I 2VLKA 3BC9A 4HK3J 1O5DT 3TJEH 1XT5A 4HFUL 3VFMB 1ACCA 4MCYB 1I9IL 4TN9A 1SY6H 2NTSP 4JFFE 1ZGLB 2OP4L 3NCWA 5C0RH 1WITA 3RILA 3E0GA 4HIHA 1PKQE 2B9BA 1XCTA 1FH2A 1JGLH 1QX1A 3OAZH 1TO4A 2BRRL 2JJUA 1L3WA 3FAWA 4F7MB 5C71A 1NEPA 3EDKA 3MGAA 4ZTPH 4KDVA 4HOZA 3MYJA 3IDXH 2J88H 4R90L 2YSTA 5K9JH 3OG6B 2OV0A 4OZIA 5I5MA 2N0KA 2WNKA 1MFDH 2VZOA 4L8CA 2BW4A 3NP3A 3G08A 3VW3H 3ML9A 1RUPH 3Q2NA 4PY7B 4NPYB 5FF6A 4XMPH 3ZE1B 5GS1B 1ADWA 1J5DA 1K2DB 5D71L 2OZNA 4LSTL 1U8KB 5JYLA 2H2PD 4LK4A 3MACL 4RMWA 1KB9J 1AJ7H 3QJQB 5D6DA 3SPIA 1UACH 5L0QB 3GHBL 4X83A 2RR3A 3BQUA 3NEEA 2AXGA 4UZGA 3QR0A 1A2YA 5JQIB 5BJTB 1D5BA 3VXTA 1QSFD 1S2EA 2OK0L 2PYEE 1TJHH 5GIRA 3BW9B 2WC7A 4KH2A 2LVEA 1JGDA 5ILTL 4BGLA 4R6UA 5F9AC 2Q2LA 5D7IB 2GJJA 4FG6D 4Q6IC 3RDTA 1XX9C 3FB6B 5C0BB 2DJSA 2GFBB 3QHFH 5KBMA 1DVFB 4Z95L 4J3BA 4A2EA 4IRSD 4KI5F 4KKCC 4WNJA 5IHZA 1TUPA 5ICXA 5EEXA 2EAEA 3CXHK 4I0PD 4YHOL 2DQEH 3A24A 1XB6A 5HI5D 4KY1L 3L3IA 3DIVA 3MNZA 5JHDA 1W72H 4X6DF 2AVGA 5IJCC 5JORB 5D1QB 4ADGA 5C6PB 5I1IL 3G5VB 1ZWIB 4P8QA 3V0AC 3B9DA 2OCCB 1INQA 3OKDB 3BSHA 3EYFA 1UWXH 4Q7DA 5GRYA 2BFVL 1F86A 3MV7B 3NH7H 3O11B 2IALB 3OKKB 4W68A 3U7YL 3HZKA 3BAEH 5FYJU 3W57A 1W0VA 4DKTA 5JDSB 3IETB 1RUAH 4MD0B 4ESKA 3VG9C 2F0CA 3PQYD 4X6BA 4L0YA 3BSZH 4FP8H 2BHZA 5I17B 5I19L 1AC6A 2C4XA 3WD5L 3Q1EA 2YPKB 2E56A 4ABQA 4CMMB 4M5ZH 1FP5A 2M83A 4PWIA 5J12C 1J8KA 3FCSB 4Y1AB 2YLKA 3NJMA 3FO1B 5CR8A 2ZUYA 1MZZA 4XP9L 4ODSL 3BJLA 3IPEA 4CGTA 4HHGA 4F80A 4M8QA 2MCPL 1XD1A 3SDCA 2I7OA 2J71A 2HG0A 3QGVA 2GJPA 5DQ9B 1CLCA 2R7EA 2VLLA 2XBDA 3QJHA 4MWFA 4L1HA 3DETC 4NAJA 3OJVC 1EO8L 1A7PH 1J18A 1T66D 2H8PB 4HCGA 1SN2A 4P04A 1SXBA 2WWKO 4PR5A 2X4RB 1RSYA 3VFUA 4Z7VA 4JRXE 4XP6H 2EEDA 4WHCA 3NJLA 1M56B 5H8DA 1BM3L 4JM2D 1CLYH 5DD0H 5HHPB 2ZXGA 1LK3L 2NQ3A 1Z0MA 5J13C 1J1PH 1U33A 3K81A 4UI2A 3IFNL 1AGDA 5C3IA 5DI8A 3LNHA 2DQHL 2OMWB 4XBGB 1OP3H 2IDTA 1FL3A 1W8EA 4PJ9A 4AKPA 2Z91B 3LS4H 3RZCB 4Q4IA 1QI3A 1K4CB 3O6KH 3WY4A 3TWCL 4QT5A 2AGJL 2GC4C 2QSCL 3NOIA 2MCMA 2MNJB 2X41A 1GOHA 4LSQH 1DN0A 3PABA 4GT7A 3N85L 4I77L 5DVPA 2VAAA 1EMTL 1QI5A 3B7YA 4RA0C 2H3XC 3BHBB 3CCHB 1AGBB 2PW1A 4NJAL 1X5AA 4CJ1A 4W4NA 1R3IH 2V5MA 3JV4A 5HHQA 2RH0A 3UOAB 5E8OB 1WE5A 4MMYB 6PAZA 1WZ1L 4YXKL 3MU3A 5IK3A 4B5ZA 5IOPB 4GRWB 3ZVVA 5I71C 5TD4A 2CIIA 1OL0A 4AGPA 4NSKA 3PDOA 1T66C 1WJ3A 2H6PB 1ODAA 4ZG1A 1SLXA 4CW1B 1FO0L 5CILL 4BJLA 1KV7A 3SCMC 2EE3A 2Y7OA 5DJCA 4ZFZB 3MJ9H 3MOAL 1BJMA 1EHNA 3P2TA 4PB9H 3CHPA 1T5WB 3QWRA 2ZX6A 4NN7B 3HUJB 3KLDA 3FN0L 2ZKHH 5E2UH 1RUKL 3NCJH 3QYCA 3UYRH 4FNLH 1YPZA 1AQKH 1J0HA 4DQAA 4E9LA 4KOCA 4I1RA 2YK1H 2GIXA 4TUKL 4TM9A 3ILQC 5B1CA 2V5RA 4UT6A 1B0GB 3LRSA 1TEFA 4RGNB 2VL5B 4JZJC 4PJEE 2BCMA 1OE2A 3NK3A 4U31A 1DQML 5JQ6H 3GHEL 4A7GA 2V8LA 3IDUA 1BJ1H 4XWGL 4AK1A 3A6BH 4I5BA 4YBHA 3B83A 3EJUA 3HCVB 3AWFA 4R5VA 1A8JH 1UADC 1PAMA 1PQZA 3T1FA 4YHLL 43C9A 4Z3TA 1XSIA 1HN1A 4OD2B 4X4ZA 1NDGB 5TDNA 3NZ8A 1TU2B 5I1AB 1E7VA 4XVSH 4NYLA 1NCOA 4YBLC 3L16A 4WHTB 3DWTA 2ZYRA 2NW2A 1FLRL 2FWOA 4L8BA 3BKJL 1RULL 4LU5L 4IKNA 4LLQA 4QLRA 4Y8DC 1ZANL 2WGNB 1B2WH 1OAUH 4KUCD 4G11A 5GGSY 4CMHC 3C2AL 3RWCA 3S8FB 2DI9A 1RERA 5IVXB 3FT0A 1F4AA 3FOLA 1EAPA 3C5ZB 1FYHB 3S8GB 4R4BB 3B2DC 2O5YL 2NY6B 3O6FB 5IEKB 4XXDB 2HJFB 1G9NC 1H3PL 4YQXL 5TPWH 5J57B 5AOIA 1QRNE 3MV9E 1D7FA 3GLAA 1UJ3B 1HHHA 1QNZH 2NZ9D 4ZFFA 3K2UL 3MGTA 4PJFA 4TS6A 25C8H 5INCA 4Z5RB 4G6FB 4EI6B 4XTRC 4H25A 2ZXQA 1XZWA 4EVNB 2QDVA 4QOKA 3VD2A 3G04B 4Y5YB 1JPTL 5E2JA 4NM8H 1RMFL 1RK1B 2EADA 5AW5B 1ZD6A 5A6MA 2GUOA 2VXTH 3ZMEA 1UM5L 3CQPA 3CGTA 4NQCE 2EDMA 4QGYA 1LP9F 4XP5L 2F58H 4OM0H 5JLZB 4LCCC 1H9DA 4N8VA 5JDJA 2DMKA 2ICEB 2PWEA 5J5EA 4M03A 4K4KA 2PWGA 4G2AA 1UZ8B 4MA1C 3NN8A 3GUFA 4P9ML 2GB2A 4BFIA 3QYNA 4GAYA 2E59A 1QSVA 3F3HA 4KK6D 2P48B 5DVMA 3M46A 1FLTX 2R2CA 1E2ZA 4OCLC 1JTPA 2DYPB 1EWHA 3BCFA 5JA8B 2G75B 5E9NA 1TZHB 5I28A 1RH8A 4M3JA 3KPPA 4P5TD 3DI3B 2AK4E 1D5IL 4Q9BA 4Y9EA 4JO5A 3PP3H 3QJVB 3ZE0F 2EE0A 2XX0A 1WRFA 3FRPG 5D7LA 1ZT1B 4TNVK 4W1TA 5IV2A 2CPCA 2EACA 2FO4B 3EG9A 4L1TA 4L3ED 3VXSA 2YXFA 3HPLB 3TM6A 1KYFA 5LO7A 2X4PB 3EO1B 2BIOA 3Q6FB 5BO1L 2KZKA 1O7DE 3OMZA 3PL6C 3VFRA 2ESVA 1MNUH 5D7JA 1I9RH 1U8PB 5DZ9A 2G3XA 2Z35A 4NZRL 2CG9X 4MNHA 4PU2A 4UILL 3W11C 1JZ6A 2GJ6A 3DRTA 5F7HA 1NCTA 3RA7L 2MHAB 4E42B 4RWYL 1IC7H 1JHTA 3FTXA 3QORD 4PJ8D 3CV5A 4Y4HA 1F02I 1NCDL 5IGXH 4FFZA 5DC0A 3U82B 1HXMA 1YDPA 4LPXA 4MJ5B 4F1SA 3UTSE 3DX0A 3ULVD 3IFPB 1V3MA 3VFGL 2XZAH 4CVZA 3GRGA 5C0CA 1E9QA 2J6EA 2VDKH 1ZKAA 1XZ0A 3QE5A 2AQ3A 5LNDA 1FVDA 4BCXA 3UJJH 2C9VA 1KBBA 3GDBA 4NQUA 5CGBA 4WEBL 5T1DH 4PGZA 4CC4A 3S36L 3RWJA 2MOVA 3H7BB 3WDIA 1RXLA 2IPUK 3QNXA 1IJNA 3UTTB 5K9KB 4OCRH 4QY8A 1Z9MA 1IE5A 4Y19A 2JK5B 1BAFL 3NA9H 4H8VA 4XMLL 4JNXA 3HG1D 4L5FL 2JV6A 5IF0B 1NCCH 3S5ZA 1XF5A 2PCPA 4OT1L 1Q4NX 2JB5L 4PMEA 1KTDB 3O2DH 1WFTA 4OLVL 4XNXH 3F7LA 3HNVH 4GW5A 2I69A 4K3JL 5CM1A 2QV4A 5DUML 2QTEA 1IC4L 3DYOA 1ZVHA 3WIIH 1SLWA 2BY3A 4F2MB 1B4TA 3NACH 3F84A 3EH5B 3V4VB 4XRCA 5GRVL 1AY1H 5AAPA 1ND0A 5D2NC 4ZAKB 4J3OH 3MLWH 5BV7C 5CEXB 4YZWA 3B7SA 4FNQA 4NKMA 2DQUH 1IKNC 4LSSL 4PJ8C 5JXEA 1BQLL 2CUHA 2RALA 3G6JE 3JWDH 3WV0A 5HTSA 2YGOA 3E80A 5HDBF 4L0PB 1RP9A 4WW2C 5LBSA 4MMZC 1GYAA 4Z3IA 2XN9D 3IDGA 1WD9A 2YPLB 5C0IB 1C1EH 3O6LL 2IQ9L 1ZS8B 3DK0A 4Q9QL 1U9KA 4ODVH 4E9XA 3ARWA 4IRJC 2AI0L 3L3GA 1DSFL 1NKOA 4TF4A 4GG6A 1M57B 4KK5C 1DBBL 1CFQB 4UMSA 2Q10A 5DCCA 3FKUS 3I75A 4OCMC 3V4VL 4YS4A 2MQ0A 5I1DA 4MD4B 1GZQB 3A4DA 2WTRB 4NBZB 1C8PA 3NTCL 1UWFA 4NO3B 3U6XS 1F6FB 1T22B 3VXRA 2F68X 2W91A 2XPGA 4YIQB 4AQZA 4M6MH 3ZL4H 4NWUL 1J9SA 2C4FU 5C0FA 3MRFB 4AW7A 1J8HB 3STZB 3BPNC 2EO9A 2FR4B 2ZCLH 3ETTA 2IAAC 5DZLA 1YRKA 4U6HA 1IT9L 3S37X 3TVMB 3GSRA 2IGLA 1MRCL 1R3LA 4H1LB 3HZMA 2L0DA 3VFSB 2BDNL 4JFDE 1SY6A 2IAMB 4LOVA 3NIDE 4HKZB 3D2UB 4M1GL 3KPSE 2I5YL 2WXLA 2A4CA 5IB2B 1OOWA 1VACB 3QW9A 2R9HC 3ORJA 3UC2A 4YLCA 5CO1A 2HN7B 2NSMA 1HCYA 2MRYA 1F11B 1WEJH 5DK2B 1AZBA 1O9VA 1T1WB 4CVXA 4JRYE 3X3FH 3K6SB 1NFKA 3BPOC 5FYKH 3ABGA 2RIKA 4PRPB 1G6RH 2R2BA 3KNBA 4PV1C 4LSUH 4D7BA 5LQBH 3MBWB 1K8DA 4MQ7B 2E7HA 1T0PB 4OLWL 2YMXH 2WPGA 5I0ZA 1AMYA 1IEAA 4YDJA 1I1CA 3QA3B 3MX0A 5CN3A 3V0WH 4AJ0A 4PRHA 4QHMA 3DX7A 4J3WA 2SEBB 3CBJB 1CQKA 4XXWA 8CGTA 3P0VL 2N1TE 3E8UL 4KQ3H 4WF7A 1CWVA 3Q7JA 4ELME 5IMMA 2D73A 3BVTA 5G4OA 3FU8A 1N0XL 3LSOB 4HS3B 4KXAA 3MA7A 4N0UA 2O5XL 1KLGA 1DSWA 1TG8A 1PLGL 1AANA 1KXVA 5EZOL 2YSSA 1NGPL 2QHLA 3FB5B 2IADB 5FECA 1W72A 1VAHA 2CKBA 3KJ4C 5DEJA 4H8WL 1NIFA 5FS5A 5GRJH 2X2YA 5E2VL 5EO0B 1RJYA 3RB5A 2JF1A 2DF3A 4I2XA 4U6YB 3AB0C 5FCUH 1CFSA 3CIAA 2P80D 4LLVB 2AMUA 1P7KB 4J3XA 1IFGA 1NM9A 4POZC 4YDZA 5BUPA 1I9EA 1L9PA 1G7QA 1RQ5A 5A2IH 4C4BA 4IBSA 1G84A 5I8CB 1SFHA 2FEDC 4LMQE 4FTVA 3B2VL 4IRSB 3OAWA 1AIFB 5J9PB 2CR6A 2K9FB 4I0PB 2IOOA 2YD1A 3GMOA 5E23A 3SE4C 1DR9A 3C08L 3RUGF 3OWEA 1R3JB 3ARBD 4Y1TA 2Q7YA 3DSNA 3RLSA 2NT1A 1VCAA 2X6AA 1MI5B 4JFTA 3F05A 5CSBA 1OV8A 5F7WC 2IDSA 2VDNB 3T4AB 3X1NA 5JIHA 2EKSA 4HKXA 2VKWA 3NEOA 3STLA 3T8XA 2AANA 1NMCB 3KYOA 4KROD 5E8EA 1N0LA 2CRMA 2HX7A 2UX6A 4G9FB 4N0YL 5CKAA 3RKPA 1PEZA 1L6ZA 3ZDXF 1YQVL 2B4CC 1IJ9A 3PQYB 2Q76B 1JZFA 2WVVA 1CLVA 4HJ0D 3T0ED 2FQDA 3BDYH 5I74C 4BZ1L 4AIEA 5E03A 3T0XA 4LBEA 5CZKA 2YGPA 1JHLL 4JFPA 4P2QD 1IZKA 3WCYA 3CVBA 4JG1H 2BNQE 2I60L 2VDNL 3BEVA 4PSRA 4MS8D 2IBGA 2XIIA 1AGCB 4Y4FC 4NXKA 4OCNC 1BD2D 3M6DA 3H9SA 3B6SA 5IVZA 3VFNA 2B59B 3UIYA 3GNML 4D8PA 1EXUA 1CXHA 4WK4B 1QFHA 1DBAH 2D7PA 2Y7LA 5EORH 3RX8A 3D12B 5D9SB 3SKNB 1WF5A 3BVVA 4OH2A 3QARA 1ILSA 1QFWH 1RCYA 3O4OC 4OIIL 3NJKA 5E9AA 5BOZG 3M7OA 2Z8RA 5AYTA 3H7LA 3HZVA 3NIGE 2GW5A 3PGDA 4KXDA 4Y9FA 5GS0D 5I30H 5T5NF 1UA7A 1UQSB 2X7LB 4OF0A 4JM2B 1BMZA 4JDVA 4TSAH 1N5AA 3P4NA 2WLNA 3FPXA 3T0EC 4I7ZC 4N1EA 4I0KA 1DFXA 2AEIT 2CLRB 3IXTB 1TTGA 3LAFA 4R7LA 3CJJA 1SXAA 4J3SA 4QHPA 5E6IA 3EYOA 4GAGH 2CDEB 4WU7B 2AJVL 1VA9A 4MCNA 3SE6A 4PBDA 3SPVB 1OE3A 1QSEE 3IJ8A 4MS8C 5TFSH 3DVGA 3I84A 1AAJA 4CBZA 1QKZL 4GI6A 1TVBB 4JFZH 2CQVA 2JB6B 2G2NA 4G3YH 3QXUA 3DV4A 4G7SB 5C0AD 3ARGC 1TZ8A 3PY9A 4X2UA 3IN2A 2GI0A 5KVGL 1F3DJ 5EC2A 1VSCA 5CEYB 4K9EL 2L7EA 4U1IA 5SX4I 5IFJA 4LLMB 1OTTD 2QELA 5DJZB 1KN4H 3IXAA 4O51A 4AMXA 4Z7OF 2XU9A 1XR8A 3O2WL 4V2BA 3BKYH 2EDRA 2WMPB 2W0LA 4MZRA 3SDXE 1AD9A 4M7ZC 3ZKMD 1HHGA 1I3RB 3MOBL 4KFMA 2XPZA 3ULUC 1FORL 4OZFB 3P0YL 3VTAA 2HVBA 2NXYD 2F1BA 1NCBL 4ACPA 4FQXB 5IROC 3S96B 1UD6A 4NLAA 4X4YB 4P5KB 4WKXA 1OAQL 1IAKA 3NIFB 2GIYA 3FT3B 1S9KC 3KLLA 2R0WH 4NXSA 5DT1L 1INDL 4BFNA 5DS2A 4PJCE 4YGVA 3PG2A 1TZIA 4RRPM 4P5RA 2BO0A 4P2OA 3TWYA 3RFZC 4A37A 3RIAK 5EBMA 4J4PD 1EHKB 5FDWA 4JFYB 5KSBA 2ERJC 1YEIH 4JLRB 1EEZA 3F7KA 2EIEA 3N1PC 2D0FA 1PY4A 3CZUB 3OWRA 3UDWA 5L6YL 2K3TA 4DKFH 1RZ7L 1UXSA 3EGDB 2ZXBA 4X8JA 2BSDA 4XO5A 5C07E 1FL5A 2K7QA 3KPMA 4QRSB 1SHSA 1IQWL 5CD5D 4LEXL 2DQTH 1OTTC 2FX7H 1X5JA 5BS0E 1G9MH 4HPYL 5C0JB 1KNOB 2GSGB 1E40A 4XH2A 4H8UA 5SWSD 2CO3A 2Y36L 3JVFC 1S7RA 5HGDB 4EOWL 3FQRA 3TA3C 3MJ8B 2F54B 4GAJH 4JPSA 4X5WA 2X2UA 1OAKH 1RPKA 1WWAX 4UIKL 4RGOH 5T1MB 2NXYC 3H53A 4A04A 1JOIA 1MCQA 1OF2B 3D3VB 4PTTA 3D0VA 3DGGB 3DPBA 4QD2E 5LXGL 5DVKA 3VNZA 1A0QL 5AKTA 5EUOA 5A7BA 12E8H 1KJVB 4JANA 5K39A 2W9EL 2JJSC 4H88H 2WQRA 3TZVD 3BGMA 1QEWA 4DKDC 4M1DH 3ZTEA 1MWAB 1MUJB 1N2RB 4KI5C 4BH8A 4M7KH 1HE7A 5FA3B 1YMHA 1BEYH 2IG2L 1A6VL 1I8LC 5I6KA 4JO4L 4YR6B 1OSZB 4N9GB 3VG0H 4M1CD 1AYRA 2DQ6A 2V3FA 4TNFA 4MXWH 1MREH 2FBOJ 4JFVA 4KJWC 3RX9A 1VZHA 3L7EB 4ZUSB 3F7VA 3FU0A 4Z3GA 3Q2LA 3OMAB 4XOCA 2I9LA 1A4AA 1P84J 2HG5A 4I48B 2CRZA 1A47A 4EQ3A 1O6SA 1E3ZA 1RU9L 1I8UA 3EO0A 3C2SA 5J6SA 5IVNA 2Q3XA 4G42B 2MQ3A 2FGZA 4MBOA 5E8DL 3BFQG 3UFIA 2QQNH 1YEEH 4XO9A 1U8OA 2WBJA 3HVNA 3BZEB 4U3SA 1ZY9A 1DFBH 5DMIL 2Y5QA 3FHAA 3QRGH 3ELQA 3ME0A 1EZVY 1IGTB 3FOMA 3WUWB 4YXHH 2NNXA 5AZEL 4ZMNA 5JNYA 3PF2A 1YNTA 4OD1L 4E41A 2APBA 2DQDL 1DVFC 3WO3B 2EJ1A 2CHDA 4Y2NA 1ZTXH 3VXQB 1RK0B 4L9LC 1KTCA 3JWOL 1B88A 3OB8A 3KLKA 3QDJA 1KGUA 5AENA 4TLTA 3QO0A 5J11B 1EO5A 2P24B 1MCIA 1HU8A 1CL7L 1X7TA 3FT2B 5B39A 3QORB 1KGWA 2VOTA 4QHNB 3CUPA 4Q52A 1Y0LA 3GRWL 1MCWM 1BVNT 3JZ7A 4LARL 1D2OA 1EEUA 2A9BA 3TIDA 3ZDZE 3KXFA 3AY4C 3LQAL 3VMNA 5J6HB 1J5IA 1LYQA 3RGHA 2YHGA 4ZNCD 3QNYB 3VGAC 5BZZA 1WBZB 3H9HB 3LKNB 5E9DB 4XNDA 1KCWA 2EYRA 5CINL 1UEYA 1ADQA 1R3KA 3W9DA 1AE6L 2WCSA 4O58L 1K6QL 4MNQE 4K7PX 1NKRA 2DWSA 3WKML 5D1ZA 5IJVB 4ATWA 2ATKB 4KQ0A 1OP9A 1U2YA 4OZGE 4P46B 4FA8A 2WZ6A 2COVD 2DICA 4CSTA 2R0LH 5AZ2H 5D7SL 1SHWA 1S8DB 2FCBA 4PJ5D 3EGXA 1QFPA 4AZ8A 4DOHB 5IREA 3DX8B 5ICZA 1CVSC 2EECA 2I07A 5BUAA 4GSDH 5C9JB 2X4SA 4Z0BH 4M5TA 5I8KL 4HH9A 4RX4D 1HQRB 5D96B 1LXMA 5DLMH 3RTQB 4TULH 1DDHB 4YEEA 3V7AE 2EVGA 2Q6WB 2UWEF 5E6RB 1FNEB 2FJHB 3OV6A 4JY5H 4BFKA 1KN2L 2K6ZA 3ARDD 1LWHA 5H94A 4EE2A 3HNSH 1MXDA 4WI6A 3OHXC 5GZNA 3ESPA 5F72S 4PJBB 1DHKA 1KBPA 5IQ7H 4AX3A 4LLUB 2VYRE 3PWJB 1UC6A 1JZ8A 4G8GD 1XSKA 4WDIA 4EIGB 5F8QC 3GEWB 2YEZA 4UQAA 5I1KH 2Q7AA 4XPBL 2HVJA 2Y2YA 4X6CF 3VX1A 5MEND 2FTAA 1XEDA 4L4JA 3PHOB 3QCTL 2NX5D 2DW5A 4WFFD 1YLBB 3ZDYB 2P49B 5F96H 4XNAA 2OYLA 4BK5A 1IQDA 3SEPA 2AXJA 3B5TA 4NQXA 5GGTL 5C0DA 1FIEA 1M3JA 1YN7B 4JQXA 4UV4L 5HGAA 3TESA 2FX9L 1TCRB 4XE0A 3S3CB 4M3HA 2VLRD 4Z7WF 3CSFA 4O00A 2VLJA 1E3FA 3GBDA 4I0CC 4WI8A 4K9JA 1YECL 3U79A 1QTYT 3ABMB 4QJ3B 4KKAD 5HYJA 4RQQA 5IFAL 4S1RH 3TV3L 4B0MM 1G6RA 3VRLF 5TH2A 4M7LT 2BVTA 5AUMA 1RAMA 1DJGA 2XWBB 1JNLH 2JLPA 4QRQB 4NUQA 3LN9A 1OK8A 5ID0A 3EJZC 2BZCA 3ARDC 3K1DA 3QR2A 3FRPB 5C08B 4MJID 1JHKL 3OXSB 1JL8A 1UCBH 4OJCA 3LB6D 4FYTA 3GI9H 1BOYA 5I73B 2COQA 1YEGL 2LHAA 3FRUA 4L4VD 4WENB 4DKEH 3RB7A 1ZHNB 3ABZA 2X1WL 4GEIA 2YPVL 2ZG2A 1GPOL 4IKJA 4KRPC 3TNNB 3DOSA 5E1HB 2A2QT 1THCA 1U36A 1JK8A 4PJDB 4HFWA 1BYOA 4U05A 3RGVA 4ANXA 4I3RH 1CICA 5G55A 1I7UB 2F19H 4KVCL 3W0WB 5C0GB 3KYAA 3BPCB 3FUEA 4JO8A 2VDRL 1DEEA 3VNYA 2EQDA 4JKPH 1XTMA 5KYUA 2GBTA 4OTXL 4WI2A 4J39A 3QZMA 5CCKH 1TJXA 2QL1A 3WG7B 2HT4D 3I50L 3FU7A 3OJDB 2XVKA 3LH9A 5F0JB 3S5LB 5F0PB 3FT4A 4FQCH 2X1XR 3PYCA 5DD6B 2H4EA 4KUZH 5AYUH 3DBSA 4JZNA 3WNOA 4P2RD 4AKQA 2DBLL 3WS3B 1QABA 3TBTA 2VITB 3F6JA 4YDKL 3UO1H 2IOMA 3NSFA 1QLEB 1AQMA 1IO4C 2WD0A 5DGQA 1FJ1A 3C5ZC 5KAQG 3IMUA 1I1AD 5FK9B 1T2JA 2NY6C 1KFAH 5DFTA 2LV4A 3FO2B 1B4JL 3KLAA 4HIEB 1WDAA 4AV4A 2VERN 3CFTA 5I8OH 4XPGL 2CDGA 2WUCH 4OCSH 1UVQA 4F2EA 3UP1A 1H3GA 4JKKA 4C56A 4ZDHB 2BP8A 3KHQA 1UJ3C 3AWGA 4M4RB 1JPFB 1CR9H 5KVEE 2ED8A 2EYTB 4DP5X 4GUOA 4J23A 3QJSB 4Z0XB 5LNEA 3MRJA 4Q9RH 3AM8A 3VSTA 2WLKA 3ZTNL 3KG5A 4FABH 5CU5A 1MWAH 1VERA 4Y5YC 3ARBB 5DZNA 5L8LB 3HBQA 3X3GL 4WI9A 1PZBA 4KPHL 3VXUD 2ZWNA 3QI9D 1KGCD 2KDYA 4OGAD 5E0FA 2HT4C 5I5RA 4YLBA 1JRHI 4DERA 2K4WA 4P3CL 4LCYB 3O8XD 3D18A 3WNKA 3LH2H 2BNRD 2AEWA 5MHSE 2GJZB 4YHPB 4EI5D 1S3RA 1UA6L 4M7JL 3SQOL 4ACTA 1NCIA 2R2EB 3MRCB 4PJFE 3T3MF 4MXQC 2LAAA 3B9AA 3CC5A 3VFOA 5MEOA 5J1AA 1Z3GH 4S1QH 5AKRA 1NBVH 1MCWW 4PJIF 1I1AC 1CE6A 4QOKE 4TYUA 4QRUB 3CBRA 3ZNGA 4OLYH 2YOAA 3K0YA 2ODIA 1JZIA 2ED6A 3KYKL 3T3PF 1R5WA 2NY5H 3Q2VA 4JFEA 5CWSA 5JW3L 5AVQB 1ZHKB 4LLYB 3HC3H 3WTVA 5L8JB 3JT2A 2X88A 5I0WA 3MLZH 1QG3A 1GSMA 4Z7UB 3DHJA 3KYMB 5A2KH 4IJ3C 5JO5A 5EOQL 3QEUA 3ZSTA 3U2SA 1PCSA 4OLZL 3FYEB 1ZLUK 4QR7A 2XQBL 4ANUA 3TF7C 2YKLH 4XZUB 5F9JA 2XNAB 1H8NA 3PPSA 3P1VA 4IU3A 5BZWB 2ZOLB 4GOSA 2LE9A 2VH5L 1A9EB 4E5XG 2RFXB 2AQ1A 1J0KA 1DQQA 1NDMB 3N42B 1O75A 3TONA 2C3VA 3QUYD 5CN2A 5F9DC 1WWCA 1D7DA 3VFPA 5BV7H 5JQ6L 4GINA 3V5HB 1SLUA 1XAUA 2EABA 2LQRA 4LGRB 4S2SB 1SMDA 1H3UA 2AJ3B 3WO4B 4Y7MA 3ULVH 3VXSE 5I66B 3N1QC 4RBPK 2C9XA 2W65A 5FYJD 3OR6B 3U6XA 3NJVA 3ZO9A 2A9MH 5CJXC 4R7NB 3V52L 5EEVA 1FVCA 4LF3B 4LEBA 3LN5B 2Z0UA 3MRKB 5DS1A 3HZYA 1FNLA 1UD4A 3EOBB 3BIKA 3K5RA 4HK0B 4QHKI 1JZ4A 3SHSA 3VFWA 3OAYK 4HUXB 5DHYA 4FGMA 1T4KB 4P4KC 5K9OB 5F88B 5GS2D 5IB5A 5EBLB 1PS3A 5LVEA 1LO2H 2FHFA 2CIKA 4PGDA 3W3BA 1T80A 1WYJA 2OJZL 2E7LC 3V5DB 3K71B 1G87A 5DQDH 4PBWD 1CFTA 2Y22A 2X38A 2GJRA 2R29H 4GXVL 1I31A 1KCSL 2QKIC 1NLBL 1U8QB 1VFMA 4HZLA 4WK2B 3TGXA 4R5TA 3P73B 4GRLB 1GZPA 1OSPL 1HJBC 3KPNB 1FZMA 1KPVB 3LMJH 4M6NH 3UTPE 1T0MA 3IKKA 4B53A 1KG0A 3CQQA 5BVPL 4RNRB 2CMRH 5DRWB 3S4SG 4EXKA 3RWDB 3KPQA 3N40P 4YSRA 4MA8L 1S3KH 1O7SA 1WIUA 3QWOA 5A16B 3TA4D 4YJZL 3Q1SH 3IDYB 1CURA 5DFAA 2VDOB 2DQCH 4FXGC 3WHXB 1WS8A 2DLFL 1HSBB 1KB5B 4XAKD 4GPVA 3SGDI 3SBPA 3KGTA 2P8PA 4FQHB 1ED3A 1A02N 1YCSA 2G3NA 4LVHB 4XBMA 4BINA 5ITBH 1Q9LA 2ITDA 1O7VA 5D1XD 4RMQA 1HT6A 2WWOA 2DQJL 3A3YB 2PXYD 1F4HA 2DTML 1K9TA 1IM9A 2XKSA 3IF1B 3D9AL 5DMKA 5B4MD 1JNHA 1BQRA 4FCAA 2H1PL 4JAMA 4KJQD 2CNYA 1IX2A 2GT9B 2X1OA 3BO8A 5JOFA 5DEGB 4UIMA 2CHXA 3M45A 5A3ID 3DUSB 4Q6YA 1CF8L 2VDOL 1XCQB 3FO9B 4RSVA 4QTIL 1BVKA 1KB5L 4GMSL 3KPRB 4KZEL 3BCDA 4PAZA 3EHBB 4ZW7A 1AKJB 1VEOA 4NERA 4DAGL 5DJXA 1D6EA 2OMTB 5BRZD 5AD0A 4QRRD 3QRBA 4IBZA 4L8SA 1JJUA 4KVNL 3VXMD 1QFUH 2Z4QB 1KBGL 1U8MB 5EOCH 2H9GA 2H2SD 2NSXA 4APQD 4ZZFA 3BGFB 1UB5B 3ZT5A 3CXHJ 2HFTA 1L9SA 1OLLA 2NY4D 5HGHB 4UQ9A 1JFQH 1LO0L 4ZZKA 3QDMB 5FV2A 3N44F 5T33L 1F3JA 1P69B 4W70A 4PJXF 1BLNB 1PG7X 1TYEB 3K6FA 1CD1B 1DUZB 1FG2B 2ISDA 3RHWF 2B2XL 3FUMA 3TZVB 4YXLL 3UMNA 3GBML 1VFOA 4XCNB 1P4LA 2FUQA 2HWZL 4H8WC 4MNGB 1CU4L 4E9WA 3HIZA 3LRHA 3MJ7A 3SKJH 3PWUB 5CN1A 3AXLA 3RL2A 4L0ZA 4EF3A 2MJWA 5BZDB 1OOAA 5DURB 1ILUA 2B7DT 1YMMA 3OJMB 2M26A 3ZL2A 3U9PL 1QLRB 2EUXA 4PG2A 3WUZA 3IJYB 5D2LB 5CJ8A 4ZUTB 3QFJE 3MPCA 4NQEE 4UU9B 1QSFA 4DKAA 5A3IC 3RFRA 4Z7QE 1TCMA 3P2DA 3RVUC 9CGTA 3EJJX 3Q2WA 3GD1C 2XTJB 3X13A 4F9PC 2FLRT 1NPNA 3IYLW 2NUTB 4HEMA 2W81C 3APNA 3SODB 1CLZL 2B4CH 5C09D 4Z7NE 1W15A 5DTFA 4RDQG 1QLEH 1DBML 2H2SC 3QHTC 4APQC 3BKCL 3AAZB 4U1HA 5KSAD 3ABKB 1TQCB 2NY4C 2VMFA 3UZVB 2OJEA 5MEQA 4LCUB 3QJXA 1F4WH 4K3DH 1IBGL 2WO4A 4PGEB 1IKFL 1N12A 1RUML 1ACYL 5ISZB 3D34A 1RKRA 1HINL 2JE8A 1UM4H 1ETZA 2K4AA 1VPOL 2ZUUA 3CXFA 1MCLA 1FH5L 4S1SH 1A7RH 4PRIB 1A1NB 2X4OB 5KW9H 4EIZC 4YDNA 1MHPL 2H3KA 2ZF9A 2ZPKH 1WC7B 5HI4D 1NSNH 2EDNA 2VN7A 4QKXB 5DHVB 2OX5B 2WLZA 3G5ZB 4JS7A 5T1LD 2P8MB 1UGNA 1MN4A 3RNKA 3OVUB 5FWRA 3SJVD 2YC1B 2YD3A 3SPHA 4GG8A 2DMHA 1QTPA 3MA9L 4NJ9L 3U9WA 3ZKXC 1JPEA 3F58L 2Z9TA 3LIUA 3OR7B 1MVUA 3EKCA 3QUHA 4AOFA 3GSUB 4ZJ9A 3BWUF 3HN3A 4K2UH 4ETQB 5JTWA 1MIML 1ZXKA 5D5MF 4TOYL 5K1JA 2XIBA 1UB6B 3FUKA 5E8NB 1EUTA 3LYRA 4U6TA 4WWKC 2YD8A 2OMUB 4H20L 4Y2OB 3MODH 5EUKB 4ZUWA 3PRZA 4X42A 1TLKA 5FW7A 1PLCA 1W0YT 2F18A 3HVDA 3IJSA 1TQVA 4HJJL 4JFHD 4LLWA 4X9YA 5TE6H 1CVRA 2CO7B 1FIGL 2XQ0A 3ESVF 5MEPB 4S0SD 1C8QA 1BBJB 2QADD 1GYCA 5E94B 2D7OA 3R19A 2QVKA 2OR7A 4NNYB 1OGAE 3BLBA 2CKNA 4R26H 2Q86A 4R7XA 3ES6B 3PWPD 2C7FA 3X11B 3HRZB 4WUUD 2OJ1A 1G7MA 3X14A 1NMAH 4URTB 5HHMD 4OJAA 3ZYJA 1LK2A 4C59B 2DQFA 2KZ1B 2QVIA 3MLVL 2W07A 4O5LH 2AJSH 3B43A 4DZBA 3UCRA 3SZKC 1VFBB 3N50A 3V8CA 1H6UA 2OXGA 4HUWB 4UTBH 4LE8A 5BVJA 1IVTA 4FKEA 2NNAA 2X1PA 2VRAA 4JZJA 1VDGA 1HSAB 4MAUH 5GS0H 2Z31B 1H3VA 3I74A 3KGRA 4K9EC 1T1XB 3H9SE 3LDBB 3QDGA 1JGEA 4G8GB 1F13A 1U21A 5SWQB 2GI7A 3HC0A 1QOKA 2ALAA 4JGJA 4UMGA 4F93B 4PG9B 1NEZG 4JRWA 3SDAB 4D0DB 5MENB 2Y07L 4JPQA 2E46A 4PWJA 2VDPB 3D69B 5F6IC 1GTFA 4XVUC 4HSQA 3LH8A 2KZBA 4HGWA 5E5RB 4QGTA 4M62L 2AJZA 5KSUB 1K8IA 3IJHA 1AQDA 3LXUX 1K3ZA 3WMQA 1G1KA 1OCWL 5I1LB 2P44B 1IAII 2BSTB 4ODTL 3VI4B 4HFUH 3TASA 2XETA 2WKGA 2IANB 4NOFA 1I9IH 1T03H 1T3FA 2G2RB 2YFNA 1LO5A 2Y25A 4RCAA 1I3UA 4ECNA 3SO3B 1CG9B 3ILPA 3IJEB 4RIRB 4P48A 3F64A 4GKSA 4JM4H 2XOTA 4E9RA 1MSPA 5D7KE 5ESQA 5G5DB 4U6XB 3T6VA 3L5WB 4Y2LA 2FYVA 3R7RA 5AWNL 4Z6AT 1AGEB 4UNUA 1RPQA 3PHQB 4RAVB 3HNTL 2BSEA 4LSTH 3CVCA 4AYFB 3C6LD 3ZXAC 2QVMA 4LCCA 3VDAA 2X40A 3MACH 4YOKA 4PRDB 2R1WA 4B7IA 1UT1A 2VUYA 3GHBH 2WGXA 2X6CA 3D85B 4N0CC 2DJMA 4PJAF 5GRUL 2VWEC 3A0OA 1S7WB 3UACA 3VCLB 2DDQL 1NC4D 2NY0D 4WY7L 1PFCA 1V5JA 3RGBA 3ZTJH 2F08A 1EBAA 3LZRA 3QULB 3G5XB 4N2EA 4C4KT 2H6UA 3J07A 5ILTH 1EFQA 2EXTA 2J5LB 4UAOC 5DO2C 3RBSA 4UQ2A 3N9GL 2HKHH 3PP4L 3FQ4A 1C08A 3ZU8A 5EEUA 1CS6A 2XIDA 1JGUL 2BY0A 3CMOH 3MLUH 4ICWA 3OL2A 4GUPB 2R69L 5JPMC 4WWOA 1PG7W 2UZYB 2HRPL 2K45A 4ZUUB 4YHOH 3FHQA 1ZHBA 4NKOA 3O4LE 4OGQC 3VYNA 1EFXA 3QIUD 4KY1H 4WAFA 1KJ3L 3UBHA 3U0PA 3FU5A 3AQDA 3PL6A 3QNZA 1QASA 3QEGL 3OGCB 2DMGA 5GSRB 3WXWL 5I1HL 1MF2L 1UH2A 2YUWA 3LZLA 4DEWA 2VW4A 3VWKB 2BFVH 4BH7A 5FUOL 3O9WB 5I2IB 1CFBA 1U6AL 2R27A 1OKEA 3GGWA 4FFVC 4WKZB 5FOJA 3U7YH 4BM7A 3DI2B 3GXTA 2MH4A 3H42H 4PJ7E 5I8EA 1ZGLM 2JKRM 1VIWA 3G5WA 1XGYL 5JPNC 2ZXAA 5KS9A 3C8DA 4XNQB 1NJ9B 3NSDA 1QVOB 3EZJB 5C0ND 5ABZA 5L2KE 3IDIB 3MLYL 5I19H 2FYYB 4FL4C 1XR9B 1R24B 2YOCA 4GH7B 3FFDB 2O5ZL 2ZOUA 2V17L 3SDDD 2Q1EA 1SJHB 4AQEA 3ZL1A 2DWYA 3EYVB 3TO4B 1X5LA 4UQ3B 3QI9B 3MBXL 1FZJB 4TUJB 1T7VA 2FJGB 4XP9H 2YFOA 1AO7E 1H0DA 3F5WA 4P5TA 3RU8H 3QZBA 3LRLA 4XMXA 4QRTB 3O8XB 3FQUB 3JWOC 3OB0H 3SYPA 5FO9A 4ZX4A 2A74C 2BNRB 4K3EL 3Q2CA 2WLMA 4YK4B 3BIBX 2MQGA 4EI5B 2YN3A 2EXSA 4NNXA 3EOTL 3PV6B 3ZE1E 1A14L 3LHPL 1GAFH 4AGMA 2FGWH 1YAIA 1ORSB 2JCCA 4N68A 4R4ND 3CIQA 1EO8H 5L9DH 4KXZH 4K7FB 5JHBA 2FL5B 1MIEL 2BCKA 4UDTB 1CMOA 5D2NA 2UXFA 1HH9B 5IKCB 4CRPA 4DETA 3QXDB 3LQAC 1IKNA 4EZMA 4PJ8A 2H0PA 4Q74A 4NHUA 1KY6A 3L5JA 2F8VA 2FX8L 5IW1B 1JF1B 2CLVB 4HOWA 1P6WA 4IMLA 3G6AA 3GXNA 5D7IE 5DC4B 4MMZA 1F6AA 3G9AB 3QUXD 3ASNB 4B9KC 1J5HA 5C0BE 1ORQB 2DQHH 4NZFA 5CS7A 3DBXB 1E9PA 2QFPA 3Q6GH 4HX1B 4IRJA 1DQKA 2A6JA 2LFGA 3P3YA 2AXFA 4W6WB 5FHBL 3GS0A 5AW6B 3SDDC 2IMMA 2QSCH 1LTXA 2Y5TA 3HE6B 2H3NA 4GKZB 4KITB 3QUYB 5D1QE 4LCVA 4QYOB 2G0KA 2KQNA 4I77H 3PGCB 3CFNA 3VFVA 4AQ1B 1RZIB 1Q8MA 1OE1A 1CDJA 1NANH 5HY9A 3O3BA 4BFOA 5G4NA 3HG1A 1OD9A 5A2FA 2J5WA 3FW6A 3MV7E 4OZHA 1JNJA 1EZSA 4NJAH 5GZOD 5C0EA 4C83B 1NFDA 1A9BB 1WZ1H 4YXKH 5JOEA 1HAWA 2VISB 2R29A 2AABL 3OXRA 5GGUB 3V6FB 3UZQB 1B9ZA 4R4NC 4WI3A 2F53D 4CN1A 1USZA 2CBPA 1UATA 3TV8A 1FO0H 4KMQA 1GKEA 3EFFB 2GG1A 3SKOA 3ZQ9A 2JKLA 3ZHLA 1C5DB 5DJYA 4JDEB 4Y1AE 5F89A 4Z78B 3H2WA 2D7TH 4QHUB 4NDMB 4HKJB 2EUWA 1JZGA 4L4TD 2XN9A 3L5XL 5FKPB 4ZNEE 5KYXB 3QUZD 2VR3A 2TRYA 2XQYK 4IEFA 3R06B 4NPJA 1NLDH 2Z7WA 5D96C 4UM9B 4ODXA 2DZEA 3C60C 3RTQC 2VO8A 4EIBA 4TUKH 2J8UB 2PCFA 1XGTB 4XMUA 5MP6L 1K3IA 1EEYA 2VDML 4X80L 3EF4A 2GBAA 4J5VA 1DQMH 3GHEH 4FJYA 4LHUD 5EO9B 4FCHA 4XWGH 3NGBC 3OLDA 4HUUA 3QEQD 3QZOA 2MIZA 2O6PA 2DY2A 2V3DA 4MDJB 2ARJB 3T4YA 1SDDB 5KBPA 1QSZA 1H5BB 3W39A 1OM9A 4YHLH 4S0TD 1BJ1J 4H5SA 3VI3A 1H9VA 5IQOA 5BRQA 5LKNA 1D5XA 1JDCA 2FQGA 1RHHA 4I9WD 4R7DA 1JUFA 1CN4A 2YZ1A 1Z6JT 2RQEA 4HWZB 3BKJH 1RULH 1YEDA 4LU5H 5D1XB 3WIFA 1KLUB 3NPSB 2PXYB 3JYBA 1ZANH 3P2BA 1TVHA 1VFAB 2VDPH 2ZG3A 3M07A 3O0RH 3PWVB 4MQSB 4Y16C 1K85A 2Q8BL 1LO4H 1BIIA 4UTAH 3MXVL 1C5CL 3A6OA 4CN4A 4ZX3A 3R18A 3N43F 1OSYA 3BVNB 3LS5H 1H3PH 3NP4A 3WAKA 1S7XB 3R0MA 4YQXH 4DESA 1Q0YH 4OI7A 1DJSA 4N6RB 1HWWA 1JK9B 3HPJB 3TX4A 2HFEA 2W80C 4AVKA 3QG7L 4LNRA 4LGPB 1DBKL 2GY5A 5GXBB 1YUHB 3RWFB 4GRWE 5KZCD 4AIOA 2MTAA 3UPCA 5LGYA 1HXYB 5DVLA 1HNFA 2BMKB 3X1BA 3HMXH 4QRRB 5J0BA 5DJ8A 3U46B 3SE4A 4GUCA 4BXSV 1JPTH 3BOVA 3MVSA 5I73C 1RMFH 3OPZH 1KLFB 3F00A 5H4YA 3BD5A 5SWZB 5FOBB 2BNUB 3OJ2C 1PCXA 5H35A 2XPYA 5CBEA 4ZOAA 3TH4T 2GIMA 1HI6A 4NO2B 4G80B 4Q8BA 2X1QA 3QWNA 2W94A 3HUJE 4NZTL 4U4BA 5FYKE 1YJDC 3DMMB 2X10A 2NYYC 2VDLB 1T1ZA 1WHPA 2CNZA 4HJ1A 3ARVA 2QPEB 4XE5B 4Y9CA 1FFPB 1RHFA 3N2JA 2NY1C 3V7AG 4KMTL 5F9OL 1DANU 3TCLA 4RGNE 3Q44A 1KIQB 4QXUL 4U4IA 3QEHA 3QPQD 2E27L 2BY1A 3GMMB 3DUHA 4EN3D 3JV5A 3RY5A 4PJEF 3WTTA 2G3ZA 3TF4A 3MRIA 1NBZA 2HX8A 1UOWA 3U4KA 5T1KA 5HHOB 2IXQA 2ZCKL 3GMQB 5DZJA 5IMLA 5BO1H 3HHRB 1CT8A 1R3HB 1O6TA 3NMEA 3RL1A 4F3FA 1I1FA 1FZKA 2VDLL 4P23D 3EUUA 4ZPTA 3UADA 4F8QA 5BO0D 2ZCHL 2VSMB 1U93A 1D5MA 3BDXA 4JQIL 1CXLA 4G8EA 2CUMA 1NCDH 4LHQB 1HQ4A 3O45A 1JXDA 3KCPB 5IVXE 1BVNP 2WWMC 3U30B 3FQXB 3VFGH 3GMRA 3MO1B 2J3SA 2R15A 3B5GA 4OFYA 5D93C 1AR2A 4WIQA 3P4MB 1KEMH 3SOTA 4ORGA 4CL7A 2WP3O 2W0FA 3LIZL 3IGFA 4OCYL 4WJ5A 1AQHA 4HCRL 4XP4H 4WEBH 2J6WA 4M9OA 4Y4KD 3S36H 2W0KA 1LMIA 1XGQB 3LQZA 2ORBL 3GSWB 4NCDA 4OQTL 3WFCL 4BELD 4A6YB 3PXJA 1CI5A 3T0EA 4TLSA 3L3OB 4G9DA 1NIDA 5IB1B 1BAFH 2IQAA 4QRPD 3QPQC 3S4SB 3P4OA 4HMDA 4MBRA 4OT1H 3SJVB 2YUXA 4B9GA 3BUYA 3BT2L 4P2QA 3P40A 1RZGB 1HILB 3RYMA 5ESAB 1XF1A 3B9KD 2BIHA 3TXAA 1IC4H 5DFWH 2LU4A 4U3XA 4N25A 3TBYA 3AUWB 3BQUD 3DVNA 1BBDL 3SGJA 1XF2A 1BD2A 3K80A 2V7NA 5HHXH 3VD7A 4R0LB 3ARGA 2OLDA 3EDFA 5A6LA 1N26A 4F7PA 2IH3B 3SQBA 3NJNA 5T5FH 3ZHNA 3QFGA 7PAZA 5EDXA 4F7TB 1JPGB 4HF5H 4HVBA 3KD4A 4YVNA 2QADB 2OAAA 5BO4A 1NKGA 1KIUB 4FI7A 2IQ9H 3DIFA 2ZWKA 4Q9QH 1C16A 3CDCA 1N18A 4YDVB 3SBQA 1KJ2B 2OMXB 2H47C 5CP7A 1DBBH 4NRXB 2OMYA 4WUUB 3L3JA 3ZYIA 3MMEA 4Y4KC 1XGUB 3CX5J 5IROA 3TEZA 3CDZA 5HHMB 4PS8A 4O02A 4HU8A 3IDMB 2QJDA 5CEZE 3NTCH 3FTYA 2OCFD 3I9AA 2QZ5A 4GT0A 4L29A 4WGVB 2O61A 1G0DA 2AJYL 5FHAL 2QPUA 3AROA 4ELDA 1PZDA 2FBJL 3G5YA 3VU1A 2B8OT 3RFZA 2OZ4A 3ZDWA 4UCFA 3D0LB 4U0QB 3WNPA 1TPXB 4OB5L 5TE4L 2Y1YA 1N7ML 5IUSA 1IT9H 5LGHL 4PD4K 4IOIA 3VWJB 1A4KA 3ZZ1A 2XWXA 4F7CB 1NCWL 4ZRGA 2B20A 4U2ZA 3LNEA 5DJAA 5C0AA 5FYJH 3ARED 1HH6B 1UOLA 1JRHL 3WN6A 1TNNA 1IC5H 4M1GH 1BAWA 2I5YH 1CDUA 3LEXB 4NUMA 2ITFA 3BKMH 2NSQA 4G1EB 5EC1B 2IFGA 3UTTE 2NUPA 4QTHA 3HS0B 4A38A 4P57A 5LXVA 4MDIA 3NPZB 1Y6NR 3SDCD 3JUZA 1XF4B 5GS2H 1A66A 2KZWA 3TA3A 3MBED 1XIWD 4ZFGL 5JIKA 1NCGA 1I8IA 1Z5LB 1N3NA 4P59H 1N5YL 3BZFA 3CD4A 8FABB 2NOYA 3MXWL 4F7EB 5JW4Q 1NCJA 4WW1A 4B60A 4F2ME 3P54A 4DCQA 1QR1B 3MZGB 5HGBB 5LCVH 2O4EA 2W5PA 3ZYZA 2HAZA 2JJSA 4OLWH 1OP4A 3H0TB 5ALBL 5CBAB 1QLFA 2QSTA 1OD7A 4OF5A 4QNPE 4OLXL 5EZLA 2VIRA 1P5UB 1NBYA 5ANHA 4N8VG 3GJEB 1I8LA 1N64L 5C8JA 3G6JF 3L45A 2Z8SA 1U8JB 2Y3AA 2YPLE 4PJ9D 4NUJB 3E8UH 5CSGA 4X6DA 1AVAA 4JB9H 2OYMA 4MQXD 2EXWD 3CU7A 2J57A 1TIUA 2WXOA 3ULSA 1MHHB 1PDKB 1BWWA 3AREC 4JVUA 5IHLB 4WI0A 3A5VA 5EZOH 4YHKH 3TPUB 2EUZA 5ALCL 2XZCL 5H2BB 3U7WL 1EBPA 3EYQD 4R2GD 1T7XA 5HDQL 2VC2L 5E56A 2IGFL 4G1MB 1E9OA 5SWSA 1QUPA 5E2VH 3MUGB 3NT0A 4KZCA 2MPVA 1KXQE 5HVFB 1J8HE 1XIWC 43CAB 3QVAA 1P1ZA 4HWEH 4GBXB 3I6GA 3C09C 5DUBB 3GIVB 1HTYA 3HC4H 3UZEC 2HRLA 1SGKA 2XV2A 3JXAA 4JPKH 2CJUL 2RB8A 3RKDD 2XHNA 1IIKA 3B2VH 4KRNA 5EU6A 5C2BL 1L7TL 3IPBA 2VXVL 1EAQA 3C08H 3FJTA 1AP2A 2WNGA 3QIUB 4L9LA 3VD0A 2WM0A 4OBSA 4MHHI 1FPTL 3QWRD 3S37L 1C7SA 2BVOA 3NIDF 1MFBL 1FN4B 2OTUA 5IHWA 3WN5B 2BVPA 4PUBH 4LB8A 4XO3A 4N0YH 3N40F 1S6NA 4XC1L 3LRKA 4IGBD 1DQVA 4JKMA 3EF7A 3CFJB 4MQXC 3MRPB 5LGJA 3WNLA 2LT9A 2FZ3A 3RG1C 3Q13A 1AS6A 3ETBJ 4FI6A 4DK6A 3QC6X 3AY4A 5EN2A 2EC9T 4PRPE 1UKSA 3U4EB 1WCBA 4BZ1H 1TQUA 2A3TA 2VMCA 3AXIA 4FKHA 3L4TA 3DDFA 4B7LA 2IPKB 3Q06A 1ECZA 1JHLH 3CU1A 4X8CA 3ZW3A 3GIZH 3VXNA 1P0SE 1BVLA 2DH3A 2X4TA 2AQPA 1Q1JL 4AH2A 4JFOA 2BLFA 1TQBC 1RI8A 5E7BA 2OM5A 4AC2A 3QH3A 4ENED 3GSVA 2KLTA 1F56A 4HIIA 4TL5A 4YNYA 1HX0A 4IKIA 1UD3A 2PW2A 1NEZB 1IKOP 2ADFL 2DEWX 2UY6B 3DXAB 3GNMH 1M2VB 4MRBA 2WIIB 5LHDA 2WLIB 3B2UD 3TO2A 1RZ8B 2X4QB 3QFDB 5CZXC 4ZO7A 4ELMF 4XPHL 4PV9B 1MJJB 5KYYA 3GSOA 4OIIH 1FBIL 1NGZB 4NPKA 2X4NA 1SXSA 4XOAA 5D8JL 3I6SA 4B9CA 2AEQL 3RVWC 5I18H 2Y24A 5ECGA 2G9HA 1V3KA 5HBBA 5I15L 4IGBC 3UG3A 4WWPA 3EOAA 5HHPA 1RVFL 3EFDL 2ICWB 1ZTXE 3QUXB 2CBTA 3OHXA 3TN0B 4JR9H 3QS3A 1V3JA 5ITFB 2P3YA 2DN7A 2PNDA 1NGXA 1CBJA 4G7RB 1X6NA 2CRIA 2QVFB 2X9ZA 3BAKA 4AJVA 1FO0A 3NCXA 2EYSB 4X6EB 1T1YA 2PP8A 1BXXA 5TDOB 5DRZB 1Y18B 4A6YH 2AJVH 1IGCL 4KO7A 3RIFK 1LDSA 5E51A 4ZMLA 3G9VA 4J3VA 3PAVA 2OYPA 3R7QA 1MW1A 1PY9A 5J06A 3KDPB 3ZIYA 4BUGA 5ICZB 3RVXD 4P9HL 5KVGH 4N90D 4PJ5A 4K9EH 2ITCA 2BIMA 3PQYE 4KX7A 4DTGL 1E4JA 3DVFA 4OF8A 4TSCL 3NIGB 3EBIA 2NQCA 5EIIG 2R59A 3GLDA 4FZEH 3O2WH 4W9ZA 1GKOA 4RX4A 5KBLA 3FQTB 2A83A 3D39B 2CSPA 1Q90A 4NQDA 7TAAA 4JMXA 4U7SA 5C6TL 2QHRL 4WFED 3GWJA 4BGDA 5D7JD 1QO3B 3ARDA 1NCBH 3OAUH 1AHWB 1EAJA 2Z7YA 1EXHA 1CPUA 3P11L 3QUZB 4AGQA 3WIAA 1OAQH 4AEIL 1L5GA 3FU3A 4MMXB 1VKXA 1KOAA 3IPFA 1JZ2A 4H40A 1INDH 2YBRA 3MR9B 4Y4HD 1ZA6A 1EANA 1L9QA 3U36B 4A2MA 1P2CA 2ODHA 4BKLA 4J8QA 2O5NA 1NC2B 3T6ZA 1J8RA 3LEVL 1C9SA 1U91B 3OKLB 1KJMB 2Z93B 2NX5A 5F7YC 4LSPL 1NINA 5TE7H 3US0A 1ESOA 4TNGA 2BC4A 1XAKA 4PRAA 4RGMC 1BX2A 1RZ7H 5AVXB 3MFFA 1Q9KB 3T0DA 3HMWL 4MHHG 5HHVL 4BFJA 5AZUA 3C9NB