4W9DC

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methyloxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 3)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
140
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 37
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9dC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9dC01
4BKSC 3ZTCC 1VCBC 3ZUNC 3ZRCC 3ZRFC 4B9KC 1LM8V 4BKTC 3ZTDC 4W9FC 4AJYV 4W9DC 4W9GC 5LLIC 4WQOA 4W9JC 4W9HC 4W9EC 4W9IC 4W9KC 4B95C 4AWJC 4W9LC 4W9CC 1LQBC
chains in the Genus database with same CATH superfamily
2K6WA 3BPCA 4H0HB 1NJ9B 2QTEA 3LQAH 3VWKB 4IEFB 4JRYE 4UM9B 3BGFB 4XCCL 1ADWA 1Q38A 4OZFH 1DN2A 3VXSE 2VCOA 3L13A 2EDWA 1JPGB 2CXKA 4A04A 1YMME 4V11A 4PGJA 4Y4HA 1D5IL 3LS5L 3GHBL 4XVOA 4ZUVA 3STZA 4ZMPA 1WYJA 2J6EH 3NOIA 3P4MB 4JFED 4RQQA 5DZJA 4X50A 4DGUA 1JNLL 3Q9QA 4WHCA 5I30H 5JHMA 4BH7B 2OI9B 3ZKMD 4TUJB 2KZWA 1OF2B 1YDPB 1CF1A 1HQRA 3RWEB 4H1LA 4ZYKA 3K81A 5IMOB 5I6OA 1U92B 3WIHL 4XNYH 1KF9B 2H8PA 2GB2A 2VSMB 2ZOTA 1EGJA 5I6LA 3MFFA 1A21A 1KLUB 3HC0A 4JR9L 5L0QB 2PTUA 2WXGA 4OLEA 3K7UA 2XG5A 2WQXA 2LFGA 5KVDE 3RWDB 1CFTB 3NJVA 3M1BB 4FEIA 1OXYA 2OCFD 4OJCA 1I8LC 4AQEB 2MPAL 2UXGA 3HAEG 3OGCA 4LLUB 1T7XA 5DJXB 2YAEA 4Z95L 5J0BA 4CBPA 5L88L 1NBVH 4GQZA 4HIIA 2IAAC 2VQTA 3Q3GB 3CK0L 2NXZB 1JWSA 5JIDA 1F4HA 4F3FB 3CX5K 4UQCA 2OXHB 5D1ZB 4IBZA 4MJIB 4B60A 5J11C 4JHAH 2FD6H 2HPTA 2VWEC 2X1WL 1HCYA 4L8DB 3O8XA 5DLMH 3FT2A 1OAXH 4MCYB 5C07D 3VD9A 1D6VL 3WN6A 2BX5A 3NTCH 3UFIA 1J12A 1YEWA 1RD6A 3T6XA 5I71B 4UT6H 1I75A 3S5LA 2WBJA 5IWLC 2B1HL 2ZOKA 4KXZI 2OZNA 5DD0L 3KJ4B 4AM0B 2VXTH 2P44B 3ULSA 3BOVA 2ED9A 5GIRB 1FYTE 4HW6A 1A4KA 1FL5A 2KT6A 5HDQL 4CVXB 3U48A 4HDIA 3QEGL 5I8CA 1T7ZA 1W6LA 1WC7A 3WTXA 4URTB 4PEEA 1KCBA 4U1LA 1P0SE 3AS2A 4J6RL 4KTDH 5D5MF 1KOAA 3V4PL 1NLDL 5D7IF 5K5YA 5IHHA 4HWEH 1AGCA 2QKIC 5IW6A 3OZ9L 4Z7OF 4F7EA 4HWUA 2H1PH 4ZFOL 5B3JF 1N19A 1TETL 4QWWD 2NW2A 1QD0A 3H9YA 4HIQA 3AT9A 3ESVF 1EK3A 2WWMD 3HUJE 4WO0A 3VXRB 4ICWA 3G5WA 1BYOA 4PWHA 4S2SA 3AADB 4YFEA 1JZ4A 2OKMA 3NEXA 1IBYA 3ZPDA 4DSYA 3T2PA 2P7TB 1GYVA 1HSAA 4WNQA 4QHMB 5CFHA 4JREC 2YD8A 3IAPA 1C08B 5F9OH 2LTQC 1GC1L 1N59B 3H6JA 5IEHB 2LE9A 1CURA 4K9JA 5DZ9A 1KJMA 4G6FD 4KPHL 3ZDWA 5C0DB 5MERA 1SQMA 3ECBB 2K3TA 1X5LA 3LS4L 4YDKL 4Y1AE 4AGOA 5C0EB 1TZGL 3JWDL 4AYID 3FU0A 4D9LH 4E41E 5F0PB 3V5DA 5HDWA 3MRFA 1WWAX 1NSNH 4DNLA 1U58A 3GZKA 1AAJA 5HGBB 1C5CL 3SZKC 3ZSSA 4Y2DC 2A73B 4CKQA 3S2CA 2EIBA 5IUSA 4AGMA 1NICA 3RVVD 3DO7A 3LEYL 4AKOA 4P9HC 5C2BL 7PAZA 2X4UB 1BOYA 2WZAA 2AQQA 1KB5H 2GJ6A 4UB0H 5CGTA 5KTEH 2FYVA 4JG0H 3V6OE 1M71B 4XC3H 3UH8A 1LJMA 3G9AB 4GBXC 1N8ZB 2JELL 5TE7H 4OCWH 1GY1A 4LEXL 3W39B 1SYSB 1GZQB 2BPBA 3AXLA 1RKRA 1H6UA 1X9RA 1CS6A 1HL4A 1KLFB 1L9RA 3FQTB 5BXFB 4HKXB 2W60B 4G11A 3WENA 4EDXA 3IMRA 1RZGA 4N2IA 4ACPA 5L6YL 4IU3B 1FO0A 1SOSA 3HNSH 3PS6A 4FTVB 4K3EH 4HOZA 4H0LC 1AZBA 2AAVA 3KPQA 3VXUA 2AXJA 1NC4D 4LOFA 4QJ4B 4MJHA 4DOHE 4QXUH 5CP7B 2IADB 5ESAA 5D7SH 1JZ2A 2OSYA 3N5AA 3OG4B 2HTLC 4HIJB 4LF3A 4BK5A 3EYOB 3O3UN 3BP6B 4PJ8C 4TTDC 2W65A 2CKBA 4ANUA 1JAEA 1C16A 1C5DB 1ID5I 2DIAA 2BZCA 3AQDA 1FZJA 3FSVA 1BEXA 1BAFH 2XZQL 2NY0B 5HD8C 3CIQA 3U4AA 2NY4D 5DFWH 2YPLB 3P4OA 2ZX6A 5EZIH 5SX4I 3EGDB 4Y88A 4XO8A 1LDPH 4M43L 3WKPA 3APNA 1TQBB 1GAFH 3PQYB 4O2EA 2DQUH 2W38A 4WWNA 1JK9B 4IS6B 2NSQA 4BCYA 3KPPA 2OL3H 4WV1A 4XPBL 5I8KL 1D9KA 3V6FB 4U6HA 5F1SA 4HAKA 3MOAL 1JPFB 3LJ3A 1U8MA 3BUYA 2EYRA 1N26A 3BPOC 1I8IA 4JRFA 4Z5RA 4KI5D 3SKOA 5T1JA 3IFOB 3CZGA 3BDBA 1FORL 4ORZC 1Z5LB 4GO6B 1HWHB 3LCYA 4FABH 2XRAL 5ANMB 1T83A 1QSFA 2RFXB 4OM0H 1P6FA 4A2HA 3D12B 5CO1A 5JHLH 1XGUA 1C8PA 1O5DT 4HS6A 1QX1A 1YRKA 3QIWD 4FG6C 4IDLA 4QAWA 4AMWA 1H6TA 1WZ1L 2V5SA 1A7PL 1EBPA 3KH3A 4MQXD 1ZE3C 1WBYB 1TQCB 1XF5B 3MBEA 5ESVA 2NUPA 4ZAKC 2GTWA 3B8YA 5TPWL 4ZTEA 3TN0C 3A47A 4AQ1A 4PJAE 3EYUL 2PCYA 2ZNWA 3GBMH 5EV7A 1OCCB 1NFIA 2JJVA 5LWYL 1URLA 3R06B 1MWAL 4LRNL 4ZO6A 1LO5B 5EC2B 1NDMB 3H9HB 5I1DA 2YWZA 4Z7UE 4AIZB 5L7XH 3SO5A 4CMMB 2HFGL 3GSXA 2OP4L 4JFZH 1JPSL 3ZXAC 1M42A 4KRPC 1U3JA 4L8CA 4MMZC 3BVWA 4P9MH 4P9HH 4PJIE 1IL1B 1CFNB 1FV1B 4X7DC 2Z3FA 4LVNC 4M6NL 2ZG1A 4LMQE 2X3AA 4L4VD 1Q0XH 3DHMA 4KK5C 4Z7VE 4YQXH 4NI3A 3LXUX 4QXTB 5C6TL 1D3CA 2AS5M 1JIBA 2CGYA 2R2HB 2YXWA 1EEZA 5DHEA 5DEGA 3V95A 3V6OC 1RPQA 4TLTA 1FE8H 4KKLC 1XGZA 5D1XB 3OXRB 4YIQB 5FGRA 1BX2B 1NZRA 4BE5A 3I75A 4H5SA 2XQBH 4A7SA 2Z8SA 1BXVA 3MLVH 2HT4C 5E4OA 4Z9KB 3MGOA 3KYKL 3MRCB 1ND0B 4KTEL 5JOFA 1ZPLA 1PD6A 4HCRH 5KVDH 3BP4B 3HZVA 5F7YC 3VGEA 2YEVB 2AABL 1GIGH 1KENH 2V2XB 5SWZD 3L5JA 1UXSA 4RIRB 4BFNA 1JGVL 3KG5A 4FQXB 4M7KL 4B27A 5DUPH 3KVDD 2WKOF 3PDDA 5I0ZA 3S5YA 5EU6A 4LDLB 4APXA 5G5DA 1I1YA 2F9BT 3CHRA 1P7QB 3GXUB 3QUHA 3BCDA 4R3SB 1B4LA 3T1FA 3VI4A 4BHUA 3G5ZB 3BVNB 3VRJA 1YC7A 2DTMH 2WNWA 3NJMA 3VMOA 1DHKA 2R2BB 4MD0B 3GSNB 5C09A 1QR4A 1WIUA 2ERJC 4L1DA 5GGQL 3BKML 2HPOA 1FFPA 3M17B 3D3VE 4FP8H 4OZFG 3ZE2F 4Y1TA 4KRMB 4OM1H 1X4YA 5I5MA 15C8H 1TITA 3RGVB 5FGBC 2BC4B 4PJEA 3QXVA 2NPLX 2PYEB 3V7AG 4HWBL 2H6PA 2R2EA 4F7CA 4ZTOL 4HGMA 1MFBH 3C8HA 3FO1A 1HH6A 5KVGL 3UAEA 3PCYA 1TVBA 4O4YL 1B0GA 4PJBA 3H2WA 4FZEH 5DQ9A 2CRYA 1IC7H 1U93B 1KGXA 2XA8H 4ZMWA 4E5XG 1S7TA 4HJJH 4Z7QB 1EA9C 1WCQA 3EJZD 5C6PB 1CGYA 5JORB 4YVNA 3WUWA 5F9JB 3DX1A 4KKPA 1QA9B 2QQLH 4QXGL 4C56E 3NIFE 4ZFQA 2OA9A 3RTQD 3WDIA 5IFHL 3UZQB 4F7MA 3BWZA 4LGPB 5GGUB 3QJQB 1F18A 1O9VA 4WW2C 2DEXX 3NH7H 4O02A 4ZO8A 4ZFGH 5D7JA 3QI9D 3DVIA 1YUKB 4RWHA 1PLCA 1URIA 5FUCE 2E74C 5GRUL 5EOQL 4R7XA 1Y0LB 4N90D 1QLEB 1ZE3H 1PBYA 4OCSH 4YK4C 2WO2B 2DM3A 2ZXQA 1MJUL 2VSDA 3ENEA 1CXLA 4NAMA 3TH3T 3HS9A 4POUB 3DURA 3A21A 2CA4A 2EDBA 5FECA 1HHGB 2ESVE 4BQCA 3BAEL 3BUQA 1U8JB 2R7EB 1R47A 3OXSA 1H8NA 5KYYA 1G0DA 2AF2A 3QQ9C 4OSUH 1JL8A 4XH2B 1A02N 1CT8B 3MRPB 3BZFB 4TLKA 1BF5A 1AXTH 1LMIA 4RVBA 4F20A 2C5DC 1ULVA 5C0GA 4PGCB 3W81A 2P5EE 3DX8B 2AQTA 1I1AB 4EN3D 5TDOB 3UC2A 5HJ3A 1JTTA 2J1YA 2QPDB 3II2A 4K4KA 2VRKA 2ZCZA 3O3EA 1EAQA 3HI1B 4NRYB 4FX5A 1AD0A 4A7GF 3RUGA 5KVFL 1QFWM 4KDTA 2K9UA 1UH2A 4GI6A 5DC4B 3ZO0A 1F42A 4PRDB 4PREB 3SDDB 2P52A 2QLVB 1TLKA 4PLOB 1KXTA 3UGXA 1XF2A 1YY8A 5IOPA 4I9WD 3QHZH 1JTOA 4MD5B 4PRHD 1WAEA 4EO5A 1G5GA 2WQSA 1L9QA 3VFNB 4BRVA 2NX5A 2VO8A 2N7SA 2EDHA 2DLEA 4L9DA 5HGDB 3HMWL 1QO3B 1DQQA 3O41B 4H88H 4P5TB 4Q2ZA 4FMVA 5CGYD 2QV2A 4CGTA 2UX7A 5LCVA 3OKLB 4HFUH 4B9GA 4C83B 4I89A 3BIBX 1SXNA 4WNJA 2XWTB 1ZLEA 4LEOA 2Z1KA 4TUKH 4PJXF 4K3GA 1MWOA 3G6JF 4MKTA 5C1MB 1QBLL 1XGPB 1CFVL 3TEYA 1LK3L 2KH2B 2XN9D 4JFQB 2NSXA 5GSVA 2OMXB 1XTLA 3BFOA 4I8DA 2NNAB 4BQ8A 3DV6B 3VI3A 3Q0HA 3DRQA 4YAQB 4GQPH 2Y72A 4X5WB 3WNIA 4NQXA 2ICEA 4PP1D 3FQ4A 2VXQL 3K8LA 2E75C 3ULAB 1KCSL 3E2HC 1E9PA 4XXWC 2DEWX 1U8NA 2VMCA 3N1QC 2ZXBA 3OZLA 3UO1H 2AV1B 3WUZA 3FU3A 4AQOA 2ROYA 4RESB 5BO1H 3WKNA 3C60A 4DEPC 2DPKA 3WMSA 2ZUQC 1X5AA 3MV9A 5D70H 4CRPA 2VZTA 3OG6B 5TE4L 1AY1L 4WEEA 5AW6B 3P11H 2B4CC 3QUXC 2LU3A 1GMIA 3QNXA 4CU7A 4WHTB 2I9TB 2ILLA 3GLAA 5F96H 4P2RE 2QSQA 1CIDA 1AXSA 4QNPF 4YSCA 1MXGA 1IAOA 4AYFA 2C26A 4FYTA 4YXKH 5J3HC 1HXMB 2JLLA 4BK8A 1EHKB 3PHQB 1I4FB 3GT6A 3K6IA 5E1HB 2VLMD 2EEAA 2O6DA 4R84A 1QI3A 2EKSB 1I9RL 4KROC 3S4SA 4JN1L 2ZWNA 3T77A 5EO0B 1KT2A 1BF2A 3K6FA 2ARJQ 4FJZA 8FABA 1ROWA 4K8RC 1MW3A 4ELMF 1E4KA 3LZQA 4ISVB 1ML0A 5SWSE 1I7UA 3K0YA 2HG5A 1GYWA 5CU5A 3DKHA 3PWNA 4JFHE 1T1YA 3T2LA 1QSEB 4R7VA 3N9GL 2H0EA 3LH8A 4IJ3C 3WS6A 1I85C 2PCPA 3L95B 3V0WH 3VXMA 3QFJB 5FO9A 4UIMB 5L4MA 3MRDB 4HWZA 2NY2B 5E8NB 1Q72L 4LPVA 1T6VN 4ELDA 5ABDE 2AEQH 1VESA 2Y7MA 5BZDA 1JS4A 2F8XC 3WXVL 3CXDL 2W0KA 2ADFL 1PYWB 3PXJA 2XT1B 2IFFH 3F7RA 1EAPB 4J4PC 3MA7B 3EO9L 3ASOB 3FOMB 2Z92B 1U8HA 4A38A 4JJ5A 2G4GA 1S9VA 2NXYC 1A6WH 3KPRA 5GGTL 1F6FB 4OGAC 4GMTL 3LYRA 3ZUNC 3RVWD 3SKJL 5KANI 1YQ2A 3C5JA 4NRXB 4QRRE 2R23A 1LO0L 2BHZA 3HMXH 2EXSA 4X6DF 2BSSA 5TQ0H 3L3DB 2B15A 1FNHA 3PG2A 4PGDB 3IXAB 3SGKA 3HHRB 2L7JA 5D2LF 2OTWA 5KN5A 3O4LE 5F93C 1L0YA 1D5BA 5DZAA 2CM6A 1SJEB 4IGBA 3GS4A 5KW9L 4NNXA 4XX5A 2VW6A 2Y36L 3IFPB 4H44C 3MODH 4HOXA 4JUSA 2DBLH 3WLWD 1RZFL 3LH2H 3T0EA 2YZ8A 3OMIB 3TNNB 4ONFH 2Y22A 4R0LC 4PBDA 2LU7A 2NT1A 3QBTB 3KNBA 4KVCL 4JM2B 4L4JA 3SOBH 4LVHB 2YQ3A 5F1KC 1CPUA 2WXIA 4HUKB 4JKLA 4CA4A 2CO1A 2UZPA 3QS2A 2A5UA 4F24A 4N5EC 5BOZG 4PJDE 3MYZA 1SOXA 1U8PB 1OTTC 2L0DA 3BZDA 1RZ7L 4FQHA 2C4FT 2C9RA 3BO8A 4OF6A 1CF8L 1DQMH 4OLYL 4I3RH 5LN4A 35C8H 4D7BA 4I48A 1AQDB 4Z8FH 5AYUH 5A16B 1R3HA 3TBVB 3IGAB 1RI8A 3WLBA 1NIBA 3AY4C 2R9HC 5FHBH 1C5BL 4PV9B 4Q6IA 2H6UA 3P2BA 5DTFB 4J3BA 3IFLH 4G8IB 5JXAL 1QOKA 4S1RH 1MCKA 2J1ZA 1FFNA 5IOKA 1BVZA 3ESMA 1N7MH 3QZLA 3VWJA 1NEZG 2EH7H 2YD6A 2EXYD 3QWRD 2QDWA 3GJEB 4ZW6A 1OGTA 1XT5A 4X5RA 5F70A 4J3OC 3MROB 3DDGA 4ZS7H 1CZ8H 2B4CH 4Z0BH 1V3LA 2ZXEB 2W1NA 2F1AA 5F72S 4ZW5A 4AQ8A 4XP9H 5JR1L 4UM8B 2D73A 4YSDA 1IM3A 4HQQL 5EOTB 4LO9A 2CPCA 5ADPL 1IGYA 4WEMB 3ROLA 3MGTB 3AVEA 1OARL 2CLZB 5FKPA 3PWPB 1JDDA 3BIKA 1B9KA 4FQIH 3F7YA 1IC4H 4NB7A 2CGRL 3LMJL 4Z3GA 4PRPA 2YK1H 1WEJL 1A9BB 5E5UB 4I1PA 1RAMA 4XMLH 4CJ0A 2K1MA 3MNVB 4F9PC 2DQJL 3COOA 4K8RH 3F2LA 3Q1SL 3BWAA 3CPUA 4CW1A 1YNKH 4YHLH 4M5SA 3D6GA 2FEDC 3LQZB 4JMNA 3DTXA 2UY6A 4XHJD 3D85A 3FQYA 4Y4HD 2BP3A 2GW5A 4ZUUB 2VSCA 5DRXB 4HVBA 2FX8L 3QG7H 1KMGA 4JFXA 4P59H 3V0IA 2VH5H 2DY2A 3T3MB 3A67H 2Y23A 3BESR 4BHUI 4DEUA 5E8EB 1KJVA 2I5YH 3RVUD 2RD0A 2CHZA 4PS4H 1J05B 3VACA 5HBBA 3GSUA 5INDB 4XB7A 5C07B 3GO1H 4K7PY 4U6TA 2UZIH 1ETZB 1QUNB 2WQ8A 3SDCC 1JV5B 4BKLA 5BVPH 1CFSB 3EHBC 3TYGH 3TXAA 2VLRB 4WWPA 5F7DB 3NA9H 5EZLB 5E6YA 4O2FB 3WSQL 1PLGH 4WTQA 5J1AB 4YHYC 1H6EA 1EJOL 2EDDA 1J0IA 3BIAX 5CKGA 1E28B 1YPZF 1KBGL 4M4RA 4TVPL 4LAJH 3HE6A 1T89C 1OW0A 4PG9A 1DUZA 1YC8A 3BD3A 4YDIH 3B9KA 3FBKA 5IF0B 2ZG3A 3EUDA 4AW7A 2VW7A 3ZRCC 4Z77A 1QW8A 5I1HL 4OZ4B 3O8XD 5I73C 3LV3A 2FJFA 5FAAA 4FG0A 4FYQA 5EUOB 4LQ1A 4PRIE 1DBJH 5IHUH 1QLRB 1K4DB 3HN8A 4I2XE 3QEUA 4JPWH 2RA1A 1HZLA 2WBJD 3WS3B 1IKFL 9CGTA 4EZMA 4N2CA 3BLKA 2CKBL 2Z34A 5D1QB 4M1DH 4NNYB 4DEWA 1JYNA 4U6YA 1G9ML 1K3ZA 2Y1YA 2YC1A 1TSRA 1HHIB 3CLWA 2WC7A 2I32A 2OMUB 4L1TA 1YLBB 5DGQA 4G6FB 4LNRB 4PRNB 1CLOL 4TQIA 1JGIA 1RJYA 3AU1B 2C7UB 4ZPTA 1DCLA 1O6TA 1F86A 4ZDHB 3UCQA 3MX0A 5J1SC 1T2QL 3LOWA 3D18B 4E9WA 4OLWH 5JTWA 4KNQA 4YVUA 1OP5K 3BW9B 5AAWC 3GLDA 3MLZH 4J3OH 2OW6A 5INCA 4DP4X 2DQCH 5J13B 4WW1B 4HIEB 3L5HA 5IJCC 1JXFA 1T3FA 4J3WA 3KPOB 2C3VB 4O51A 4N9GB 4LRIA 3GF8A 4OW6A 4ZUTA 4PN6A 4GRWE 3OJVC 2W81C 4YHKH 4WCYL 1BSIA 3EF7A 5I1JL 1IAIM 1QYGH 3DMMB 4G7YL 4K7FA 3W2DL 2ZCHH 4MAYC 3AMLA 1M05B 2MKWA 1I1FA 1KTLA 4IW4C 4YE4H 1NCWH 2A9BA 4K5NA 2ZUVA 4ELKA 2WMPB 3BX7C 1KNOB 2DWEB 3DETD 2FQDA 2FT6A 4N8UA 1DQJB 1ZHLA 3UPCA 1MCJA 3BAKA 2YUVA 4PTUB 4YJZL 3SB3A 5JIIA 3C2AL 3WXWL 5KYXB 4JPKL 3CPLA 1NC4B 3JYCA 3R4DA 1ZLSH 5IVZB 2OSWA 2VXVL 4FKHA 3OR7B 2E27H 2DLHA 2EDNA 3KJ6H 2FEEI 4U1HB 2WB1A 1BP3B 2GJ6D 2B3RA 4MNHA 3BD5A 5C08B 4ZMQA 4KQ4L 1XX9C 4X6CB 1OM3H 5IUCA 3ULVL 5FA3A 4X42A 2ICCA 2PETA 1QVOB 2FX7H 5L2KB 3PWJA 1KGYE 2BNQE 1OWRM 1TKWB 2NY4B 4F57L 3LN9A 4BIKA 4JZJB 4N3TA 2WN2A 3L1EA 3GWJA 4LBEA 2BSTB 4MA8H 4EUPB 4N2MA 3PDOB 1WP6A 2F5BL 2H1XA 3H2PA 4PJAF 2RBLA 5IW3A 1NCNA 2VJXA 1CXIA 5I75C 4L8BB 1AR1C 1BFOB 3VXUD 1B88A 1UB6A 3LXAA 5HGAB 1EUUA 1E7UA 1ORQB 1XGTA 2ENPA 2Y2WA 1PJWA 5I82A 5JIKA 4RA3A 4Z7UF 4GQ9L 4N2EA 1IFHL 2WBWB 3HB3B 3VB8A 2JV6A 3LVTA 3SDYL 3TJEL 1M6OB 1FVDA 1SUHA 1QRNA 2BNRE 3C6LC 1EIBA 2VDNH 1U21A 1QZ1A 1K4CA 1SUJA 3NCEB 2HKFH 5EF3A 4PJIF 1KPUA 4KZ0A 1UXMA 3AACA 3ZMRA 3GSOB 1T1XB 2BRQA 4Z7VF 4KHXL 4L4TE 5E9AA 1XBDA 2EAEA 4N68A 1S2EA 5BW7C 5JZ7C 4JGHA 5BOPA 4QPEA 2WIMA 1DN0B 2UWEB 5GISH 3F6LA 5DCCA 2YPVH 3HFMH 3EKCA 2V2TA 1BD2E 4AEHH 4JG9A 3ZKXC 4A66A 1ZGLM 1D9KD 1DCEA 1Z3RA 4U1KA 5G4MA 3U9UB 1J8HE 1JSYA 4AEIH 3MTRA 3CSFA 5HTSA 1MNUH 2W80C 5T1KA 1Q94A 1UWEH 4KKQA 1XH1A 1U8LA 4HXBH 5TFSH 5C92A 1N8OE 2HJKB 2P24A 1SJHA 4JRWA 4PJGA 4M8QB 1TEGA 1QSFD 5FGCE 3RNQB 1NGPL 4XZUA 4LFHD 3QR2A 2IOMA 3B2XA 1K8DB 5IG7A 2A83A 3OGOE 4G9FE 3HKZA 3C5SA 5AVWB 1WFMA 3UBXA 1MFCH 4BSJA 1L0XA 1KJ2A 3CDCA 2XIDA 5I19H 3MBED 4YSRA 1CE6B 3HRZB 3VG9B 2XWJB 3D8MA 4O02L 3OHXA 5GGVL 4XI5C 5FHAL 1JHLL 3PFUA 1MCRA 3MV8A 5DQDH 4HKZA 5I0WA 2E7BA 1UKTA 3S3CB 3QUZC 1Z9MA 1M7DA 1UCBH 4GSQA 1P4BH 3V0JA 2ZCKL 1YYMH 4XCFL 4LPYA 3VUAA 3LDBB 2Z4QA 5CSBA 4DZ8A 3N44F 3NCYP 2AEPH 1UUSA 4PR5A 3VGAC 1SY6L 3F85A 3MACL 4NWUL 3S34H 1UJ3C 3TBYA 1XB8A 3OKNA 5DJZA 5SWZB 1R3JB 2R4SH 1CICA 2CBOA 4N8CL 1X9UA 1RFDL 4DGYL 1MH5A 4P2YA 5HDBE 4OJDH 4XCYA 3P0VH 3ELAT 4XBEL 2A4EA 3FSZA 1JHTB 4YBLB 5E6SB 5EO1A 5AW5B 1XIWC 3N42B 3QGVA 1AHWC 3HAEA 1TJIH 4JEGB 4LT7A 3KPSD 4AIOA 2ZE0A 3IJ9A 4M6ML 1OAZL 4P46C 4C8XA 2F19L 1L9NA 3UADA 3VFMA 2Q9OA 4X8JB 2GFBA 4H0IA 2PLTA 1DBKH 1DVTA 1QTSA 3WCYA 4Z23A 1VCBC 5J9PB 1G7IA 4YWGH 3ARDC 4EIBA 1JOIA 2DIEA 1XCTB 3HG1B 4MMYB 1WV7T 1W0YT 5AL8A 3DGGA 3IMWA 4PM1A 1BZ7A 4ZFZB 4QRTB 4KZEL 4I18A 4UZUA 5IV2A 1JGUH 2ZT9C 1ITBB 3BH9A 2V5TA 4JFVA 1NCJA 4IIQA 5EU6D 4HFWB 3FCSB 4J3TA 3ZDXF 4PV1C 5F1OB 1IFRA 2VDPL 2QGBA 3KLLA 5TQ2L 2W9EH 3KPLB 3W9DA 2BNUA 1JYVA 5AENA 5C09D 3RLSA 4QRPE 3PGCA 1CLYH 5CKAA 1NCCL 4KJQD 1AYRA 3QI9B 2YMTA 2VR5A 2NYYC 2QADB 3NZSA 4FLRA 2RH0A 2FEEL 5GGSB 1OK0A 3F00A 1S9XB 1MHCA 4ONHA 1MFUA 1FNGB 3SGEI 3IJSA 3TEXA 3V0VB 3GXTA 1DSFH 4KX7A 5C0BE 5CJBA 2KLSA 2R69H 4XMXA 3KZ8A 3E6FB 2XWXA 3FMGL 3QUKB 1AQKL 1F41A 3EFFB 3QORC 4FDWA 3Q8EA 2J4WH 4ZUSB 3ILQC 4UQ3B 3RX8A 3TBSA 1G1KA 4OV6F 1NH6A 4RWYL 3FB6A 5B1BB 1FLTX 3QULB 1CDHA 4QRSB 1U95A 3EGSA 4UUJA 1QFUH 1T0MB 2J57A 2DKUA 1AE6H 2P5WA 2WXPA 3BP5A 3CLFH 3LZOA 4RAVA 4TUOA 4X4XA 4LDCA 5AKTA 3BZEB 4L8SB 4EOWH 4Q58C 4YSTA 3T4YA 5DMKA 3KYOB 4RCAA 2ZAHA 1G5AA 2NY7L 2O5YH 2GT9B 2OR7A 3BWSA 4CSPA 4QT5A 2OJ1A 3THMH 5SV4A 7FABL 1ES0B 2CUIA 1NL0H 2CO2A 4PJ9C 3QXUA 2WGXA 4GRLA 4KKRA 4QO1B 4U1GB 4XCNA 3TASA 5IR1A 1G6RA 1HAUA 2X70A 3MJ9H 2JIXA 1TYJA 4GRWH 3UEQA 1OTUD 3QFDA 3NBNA 3DI3B 1WD9A 4J8QA 4B50A 4PRHB 1KIUA 5HYSA 4N22A 4PBWD 4G1EA 1E2WA 1BZOA 3F7LA 3D0AA 1G7PA 4BUQA 3PWLA 2AXFA 4GUOA 1BOGB 1DQLL 2AXGA 3N1MC 2A74A 3SYAA 4DKEH 3FB8B 1YEIL 2X1PA 1EMTH 2DQMA 3REWA 4N2LA 2YPKB 4NCC1 1YEFH 1DJYA 1CQKA 1J1OL 2OMTB 4FXGA 2CH8A 3CDYA 1GTFA 3QPQD 2EYTA 3F58L 1YEHH 4K23H 4JKPH 2CKNA 3MJ8A 1JGLH 4P23C 3T65A 4ES8A 2OJZH 3U2IA 1HHJA 4AZ8A 3D4GA 2IFGA 3N1PC 4YNYA 1NGXB 1LO4H 4K94L 4FXKA 1HYSD 3GKZA 1N5AB 2NY3C 3HHMA 1BZ8A 1EXUA 3L2MA 3ZYOA 3T0BA 1RPUA 2CO3A 3DRTA 3SPJA 4YFLF 4AV0A 2NX5D 3OMNB 4J3OG 2QHRH 3S96B 1Y18A 5B7FA 2OMVA 4KI1A 1WFUA 5LBSA 3DJ9A 1E2VA 3DDFA 3BWUC 3G04A 4JFDA 4UBDD 4JY4B 3PHOA 4EDWL 2Z65C 3AGWA 3SCMA 2G3ZA 3DC0A 4U1MA 2H9GB 2OYKA 3L3GB 2C1PB 4MAUH 1K85A 3VYPA 1OPGL 1HZHL 3QIBA 4NGHH 1T5WB 1I9EA 1OAYL 3MOQA 4MQ7B 1MCPL 1BFVH 2Z31A 5K9KB 1PSKH 4GXVH 3FCTB 4EI6B 1G7JA 2FL5B 4NP4H 2X9XA 3QH3B 4LLYA 1XH0A 2BWDA 5DI8B 4A6YH 5BJTB 1ZA6B 2X4RA 2ZWKA 2NQDA 4LU5H 1U8CA 4LLWA 5BV7B 2WVSA 4OLZH 1JUFA 2Y7QB 3L5XH 1TQUA 3CZJA 5IFAL 5F9DC 5FCSH 3C60D 5CEXB 1CL7H 3L54A 2ICWB 3B6SB 3BKJH 5CCKH 4UILL 2RTTA 3HKFA 4K0OA 1BJ8A 4LLDA 3MRIB 4UOQA 1GYAA 4FFVD 1KIRB 2EDRA 1GC1C 3MZTA 5HVWA 2NY6D 2Y2YA 1SOQA 2QELA 4NERA 3ARYA 4OQTH 3JV5A 4OGZA 2BK8A 5BMFH 4Y4FA 5CD3A 4M93C 5DMIH 3JWDC 3KXFE 2ODIA 5EIIB 1TJMA 4I7ZC 3TESA 1ONQA 1Z0NA 3DUUB 4JFOB 5D5MB 5FFLA 4XCCH 1NDGA 2X4TB 5D7IB 3ES6B 3DVGB 2F58L 5EZOL 1NGWB 4XN2A 1AZZC 3QQ3B 4FRWA 4I5BA 4ODTH 4I1NB 3EOTL 1NCDL 2HN7A 4HC1A 1FCCA 5EORH 5CEZD 3JQOB 3NJIA 2E6PA 1D5IH 1ED3A 3GHBH 3NPSB 5T3XL 5KYNA 3S35L 1GOFA 2DM2A 4H8UA 4NZ8A 2XFXA 1OK8A 2YHGA 5DK0B 3SGJC 1UT2A 5KSVB 4JHZA 4X5PA 1UM6L 3FQWB 5ID1A 5KS9A 4OUOA 1PD1A 1T66D 3E1F1 1GJIA 2VISA 4XGZB 3RDJA 5BZWA 4U0RB 1HCVA 3ZSTA 1FVCB 1XH2A 2L7QA 3GNMH 2WAHA 1MHEB 1M2OA 5CCHE 3SE6A 4DO5A 2YRBA 4L9LB 3WIHH 3GBDA 4YDMA 1GR7A 4NJAL 3UTZA 4ACTA 3VXMD 5BRZB 2PR9A 3MJGX 3DV4B 4JR9H 4M7ZC 3RJOA 3INUL 1P4LB 3VFPB 5B7EA 1YNTF 3VMNA 1NFDB 2GUOA 4PIRF 4HPOH 4XCEB 2IBZX 3DROA 4PHZA 2V7HB 4GUPA 4CVZB 4OU3A 4BZ1H 2L3BA 2J43A 3KPRD 3L3OC 4Z95H 2VR7A 1KLGB 2H47C 1P5VB 4KK8D 3FFCA 3DOSB 3GSVB 2XXCB 3LEVL 4DGVL 1MFMA 1S3KL 3G6DH 1O7VA 2QR0B 4AXWA 3QEQE 4QJ3B 3SE4C 3EO0B 1AGDA 3JVFC 1TEFA 4QTFA 3U1PA 4IIZA 4OAWA 1RLWA 1YEGH 4ZQKA 1KV3A 4IGBD 1A7QL 4WFHE 4IMLB 4PG2A 3N04A 3QNYA 3HZYB 1IGML 1X5ZA 3ZK0A 1I3UA 5GS1C 2WOYA 3T0ED 5ESQB 3RPBA 4LLVB 4DN3L 1S7QB 3B7YA 2DIBA 4MNGA 3SEPA 1AP2A 4ZXBA 1A3RL 3QR0A 1XAKA 2FEJA 4YDJA 4P5MA 4R6UA 2FVNA 4GT7A 3L81A 1MJ8L 2VQUA 1Q90A 3ZHLA 3FOLA 3LEXA 5T3ZL 1PTZA 4F27A 4J6RH 3UBXI 4LSUH 4ODVL 5MEPB 3V4PH 1BVNT 2DYRB 1HNYA 2E4FA 1Z5YD 5FF6B 1FL3A 2IAND 1QBAA 1WAPA 2PWHA 1JHKH 1JZDC 3O0RL 1GGIL 1Y6NR 2ZKWA 5D71L 1PDKB 1Z2KA 1XF2B 3BPCB 4M6OL 4G8FB 3LRMA 4N2HA 2UVFA 2EVJA 3OAUH 3WE6A 5H4ZA 4AENA 2UUDH 1KXQA 3AZUA 3LSOB 3RAJL 3IJEB 2Z93A 2GTZA 4KPHH 5AKVA 5E5LA 3G5YA 4LSVL 4ZUVB 2MQCA 4YDKH 4RQQB 3JWDH 4YFDB 5DHVH 3ZE1E 4GG6E 3QJXA 1IM3D 5DEFB 4L1SA 4PS7A 5E95B 3IGUA 1HQRB 3QZWB 4NPJA 1O7DC 1C5CH 2C8NA 4ZYKB 1RZ8A 2GHWB 3BZ4B 3CAFA 4K3JH 4BJLA 1CGTA 2GABA 3FUMA 3HC0B 1MEXL 2Q8AL 4PRPD 3TX4A 3LEYH 4PSRA 5I8OL 1IAMA 3CC5B 5DVLA 2XG5B 4OF0A 1FIEA 1H19A 2K0RA 4UT6A 1SBSH 4NJ9L 1QQDA 2Y06L 4B9FA 1XF1A 4FYSA 4IRSC 5AWNH 2A9ML 4ODHH 4JKKA 3VFRA 3CSBA 3MUHL 3IXTB 4AUYA 1PZ3A 3A24A 1A7BA 2JELH 5I15H 5ITFB 2M2DA 3D85D 4HIIB 1P84J 2YAOA 4MCZA 1X7TA 1CD9B 3Q2CA 1H5BC 1X5HA 3FNKA 1LE5A 1RHHA 3O6LH 3QO1A 1SHMA 4Y5XC 4M56A 3FN3A 5IQ7L 3CDGB 5KSAB 3O8XB 4RDQF 5C0ND 5ALCH 2DL2A 2NY5C 4I0PA 4PWIA 1EFXA 3S5LB 5F3BA 5KYUB 2YD0A 4BBWA 3C6SA 2HVKA 5HHNA 3QC5X 3AAZA 3ATFA 5D9SA 2XZQH 3CUPA 4NQTA 4PUBL 1MZZA 3H2QA 4Z3HA 3OKDB 4FA8A 4GY4A 1UB5A 3F8UB 1U8QA 1CDJA 4MJIE 3L17A 3NJGA 3VW3H 2NLJA 3HE6D 4HDIB 4M02A 4ZNEE 2X42A 2X1XR 3MSPA 4A7GA 3O11A 3BT2H 2HLAB 1IFGA 5C0CB 2E4TA 1FZOA 1WJ3A 1WUNT 3B9KD 2AJSL 5I8KH 1RUQL 1AGCB 2XTJE 5IW6B 4PB0L 3WI9A 4JO8A 3QUMB 5D4HA 2JJSC 4C57C 3FUNA 3QHFH 1HQ4B 2WCGA 4S2SB 3VD3A 4EF3A 4QLWA 1IEAA 2Y1VA 1KB5A 5GS2D 2WYZA 2Z7UA 2XRAH 4WNQB 1A8ZA 3RDTC 4NZJA 1JPTL 2AQSA 4BUGA 2YAHA 4JPVL 3KPNA 1HIML 1T7YA 4RGOL 1KJMB 2GEEA 3SQRA 1WZ1H 5I74C 1A7PH 3ATAA 4D7PA 2XZAH 3V5DB 4R96B 1FAIL 2E59A 3GGWB 4M7LL 1MAMH 5IB3B 3KYMA 5DVMA 1I8LA 1UURA 4CSTA 2Z91A 3VXRE 4G3YL 3TCLB 2N4IA 5HGGS 2NNRA 3L9RA 4JG1L 4WY7L 3EYUH 5AZ2L 2G75B 1LEIA 2HT2C 3FJTA 4DWHA 4ZW3A 4HEMA 2A77L 1IM9B 2ZONA 3X14B 4Z7NB 3AM8C 4LCWA 5IQMA 2FH8A 1ZVSA 1RV6X 4OCNC 5KAQF 4FNSA 2HFGH 2OMYA 4HMCA 1XSIA 4RA0C 3VE0A 1FJ1A 1JPSH 4X0NA 1YNLL 1N0LA 2ZYRA 1V3KA 4TSAH 1ADQH 2FSDA 3VU1A 3IPFA 1D5ZA 5FCUL 4EDXB 1NAMB 4LKXA 4G72B 1P7KA 1RZGB 2J88L 4S1SL 1KJ2L 3VWKC 3MTXA 3BGFC 4W4NA 1XR8A 2R1XB 4EMZA 5IWLA 2IALB 5IB2A 2BFVL 4NSKA 5EWIL 3FUEA 2OL3A 1P5UA 1PD0A 3P4LA 3VXUB 3T2NL 3Q44A 1I3RA 1T21B 3IS1X 4GRMA 1OAKL 4JO3L 4Q9BA 4WEUD 3GRBA 4G8EA 4HJ0C 5ESAB 1MFDH 3VFVA 6FABH 3FUHA 1TJGL 4B9JA 4BA8A 5L4FA 4Y4KD 2OI9C 3TEZA 4RMVA 3TCXA 4KTEH 1QPXA 2W65B 1TUPA 3HLAA 1C16B 4L29A 2CWRA 1FZJB 2GAZA 4PWGA 4R8WL 5AOZA 1VCAA 4QHNA 1AGFB 1G6VK 1QBMH 2W0PA 1JFQL 1NPJA 2GC4C 3PGFH 5L0QC 1JGVH 2QKIA 4XN9A 5LG6A 3P4OB 2M26A 1TF4A 4M7KH 1WE5A 4UINL 4CU8A 2C9QA 4DW2H 5JHLA 1ODUA 2ZX9A 5EIVA 2LT9A 4FLOA 2NY5H 3ECWA 1IT9L 4FTVE 4JFFD 1I8AA 4KUZL 4Q56A 4GI8A 1WIOA 2XQYG 4O2EB 2P1YA 3KVQA 5FS5A 3VNZA 4XWOD 4F33A 4P3WA 5I16A 3KPPB 5DC9B 4HAGA 1WG3A 4UF7C 3L4CA 1T03H 4JHWL 3RY5A 3U2JA 4RNRA 1MAKA 1EZSA 2FIRT 4Y5VB 3K3QA 3BKMH 4MB4A 1SXAA 3US0A 3ZQWA 1D9KB 5CXPA 1MFVA 4U6HB 2IXQB 3D5OF 2ENJA 2VERN 2NXZC 3DPDA 4X7SL 4WFGD 5E2WH 4KAQH 1U8MB 3BUYB 5D1ZC 4RDBA 5FM4A 1QRND 3WO3B 4TV3A 4Z5RB 1Z9SB 4BWUA 1N70A 4ZTOH 1SM3L 2B8OT 4HWBH 2AQPA 3OC5A 5D6DC 3PHSA 2NNCA 4EI5A 5ADOL 4O9HL 4PYHA 4IYKA 4E36A 4F2EA 5HDBF 1H3WM 1QSFB 1XVSA 1CK0L 3QT2A 3PQYE 1XAUA 3KLAA 1UZ6F 3ZHKA 4Y2DA 1XGUB 5I71C 3G6JB 4NHUA 2GJJA 3VXQA 3NAAH 3KJ4C 1YMMA 5FYKL 1JFHA 2R0LL 3Q2VA 1II4E 2NUPB 3D87B 1NEZA 2HA1A 4NENA 4M8UA 4X9HA 5DD6A 1U0QA 5C97A 4UQAA 1PZDA 3CBKB 4AQ1B 1ZDQA 3UC0L 3SYCA 5IHWA 2HT3D 3WFBL 1NFIB 2VQ1A 5T1KD 4X4YA 3I02A 3CFBB 5GHWL 5GRUH 2LV4A 5ANME 4UTBH 2ZYHA 4X4ME 2DTSA 4ZQTA 1DVFA 2CMRL 1MJUH 4BGLA 2I85A 2Q2LA 1G7HB 2XN0A 4N6RA 1V05A 4ABUA 1UD2A 2OQJB 3BAEH 3H4FA 3HNVH 4D3CL 1BLNB 4L8CB 3IBEA 2OMNA 4OLVH 5F44A 5HYIA 1OAUL 4TULL 2WXKA 1H15A 3KBHE 2CHDA 1R5WB 4G6JH 1XO8A 4RAUA 4DK6A 3FB7A 4JAMB 4HK0A 5CJXC 3W9EA 3NABL 3T8MA 1NCAH 1CLZL 2Y07L 4FFWD 4PJ8A 3UTSA 4ATWA 5F71A 4DK3A 3OB8A 4EXKA 5C0RL 3KPSB 2GVYA 4PJCA 2JK5B 1VIWA 1EEZB 1X6NA 3WFZA 1LILA 5DEGB 4IOIA 1QEWB 2AAAA 5E03A 3BVTA 4HV8B 3I75B 4H5SB 4S11A 2JTDA 3MRKA 4BFOA 4BDVA 1N6QL 3SOTA 1IEHA 4GH7B 5KVFH 3TBTA 3EJRA 2DH3A 4ELMB 1JPST 4GXUM 4GAYB 4NQCD 5FV1L 2EIZA 1CICD 4AYBA 2JNZA 4IOFC 4PV8A 1BG9A 4L1BA 3MBXH 1NKRA 3NP3A 1FYTA 4APXB 2ZOUA 4ICXA 5G5DB 3VMPA 2R8SL 3EOAA 1L5GB 5CGMA 3UAAA 1PG7H 3VRJB 2WINA 5D1XE 1M3JA 5TGBB 5TH2B 1TU2B 4F15B 3KBEA 3ZYIA 4NWTL 2A6JB 1J5IA 4R7LA 1FFPB 1P6WA 2HZHA 3MLTB 4OD2A 3QRFM 1NBQA 4NC1C 4X9GA 1QBLH 1RUPH 3IDYB 1RZKL 3L4UA 3D9AL 1LK3H 4UYPA 4L1HA 3ZN6A 4BH8B 4K07A 5G4NA 2H3NB 4BKSC 3OKMA 1DQDL 2ENYA 2R2EB 1AZVA 4QRUA 3HUJA 4BRJA 4TNEA 1WBZA 1OOWA 4X6DB 1TVBB 5AQ0A 3VSQA 4TTGA 5DQ9B 3TN0A 1DQVA 4UV4L 1CTNA 4LHQB 3RY6C 1S7TB 1F56A 2HWZL 1J88A 4A68A 5KVEL 5DJ2A 4KY2A 4NDMB 2AFNA 3WUWB 1FBIL 3RWFA 5LBSL 2WB7A 3ILPA 4IBWA 3FUKA 4F92B 1F4YL 5TE6L 4F7MB 4E0RA 4Y1AA 1C9SA 1GTNA 2AP2A 3HI5H 1HL9A 3DIFA 5J57B 1KDJA 5DR5L 3EYFB 3H42H 4P4RA 1SF3A 4MMZA 1CLVA 5BUAA 2VAAA 3CVBA 1MHPL 5H2BA 5IBLD 2J5WA 4H40A 3TF7C 5CBAB 3O9WB 4Z7QE 3DURB 3N1FC 1IKOP 5FECB 3IDMA 5JW4N 2E9JA 2ZSWA 1B3JA 1TQWA 1Q9WB 4MB5A 4OI8A 3OXSB 3V6OA 4L3EA 4EAEA 2WUCH 5KYYB 3NMEA 1UUNA 2HXAA 4WFEE 5T1MA 1F4AA 2J8HA 1TTGA 2CCWA 5IBTH 1JF1A 5ERWA 2X88A 3KPMB 5C0GB 2JQAA 2P5WD 4LHUB 5HJ3B 5JIPA 3FQXA 5CLTA 3N9GH 3L9YA 3NIDB 2E8ZA 5FKAB 1QWNA 1ZANL 5DO8A 4YPJA 3O3EB 3P9WB 4L5FL 4YBQC 3NK4A 3STLB 2XBTA 1Q72H 2BS8A 1TQCC 1AD0B 1ETB1 4M8VA 2ZQKA 4R5VA 4LPWA 3CXDH 5DLLA 4IDJL 1WF5A 2HKAA 4GRLD 1LP9F 1NCHA 4X0KA 2JIXD 3VXNA 3PABA 2YBGA 1EZVX 3BRDA 4OD3L 2NX5B 5IREA 3E38A 3SKJH 5GGRY 43CAA 2J20A 3U4BL 4FXLA 1E5AA 1BQKA 1DP0A 1LO0H 2RGSA 2WP3O 1DQQB 5FGBA 4Q2ZB 2IH3A 3K46A 2IGLA 1DE4B 3K4AA 4KJPC 2HFTA 2LABA 4RFOL 2OK0L 3B3IA 1DFXA 2AVFA 5F7HA 4ZPVB 2JFCA 1WGVA 4Q14A 1OHZA 3EJTA 4HH9A 5DUMH 3I85A 4JLRB 2YXFA 1RIHL 4E9YA 1KTKE 2H6OA 3TFKC 5ABZA 4ZX5A 1MDAA 3OTTA 5FOBA 1MCBA 1RZFH 3OQRA 3O2DL 1RULL 2FYYB 3VI3B 3DRQB 4MDRA 3IVKA 4NM4L 4WW2A 2IDTA 2ICEB 1KB9J 2W9LA 4W81A 5D1XC 1J1PH 2C9VA 1Y7VA 3ULUD 4LIQE 4YDLC 2G3NA 3FDWA 3OLIA 4HMDA 5AW8B 2FECI 4XBGA 1T1WA 3CZSA 4WHYG 2R4RH 1EZLA 3FF8A 1J7VR 3C60B 1CFBA 2KERA 3JV6B 1MCIA 3NCBB 4JFDD 4OLUL 2VDLL 4HK3N 3UYPA 3SCMD 1G9MC 2UXFA 5F1NA 4OLYH 1TOXA 1UA3A 4Q9CA 3FFDA 1WTLA 2NY6B 3QQNA 5LGKA 2YGVA 1SZNA 1NFKA 2YAMA 1VFBA 1YPZB 2WLKA 3QIBD 3CN0A 2YBRB 1GCFA 4NQQA 2Z31D 4KKAC 4W6YB 5I1GL 3NSDA 2TRHA 1IAOB 2APWA 2DWSA 3RPKA 3LQAL 4AYFB 1YEEL 2N0KA 3Q05A 4L05A 3DECA 3QS3A 1E9QB 1UACL 5C0AE 1LE9B 5C3LD 2EEBA 4GFTB 3QEHA 3US1A 3H8NA 4NT6A 1R3KB 1P1ZB 3RGVC 1E6OL 3S4SB 1T0OA 4KDVA 2D3VA 3N1GC 3PV7A 2J6EL 1KT2B 1CD0A 1EJ6A 1AI1L 2IQAB 2YUXA 5KG9A 1XFPA 4M5YL 5I0XA 5I30L 1IU1A 1O5PA 2RQ8A 4FQPA 2CO7A 1CFQB 2VN5A 3MFGB 3U7WH 1I82A 5IGXH 1T1YB 1B90A 3VXPA 4YHPB 2X44D 4X6FA 2EP6A 3PNWB 2Y3NA 3IDXH 5JOPE 2PCPB 4XVSH 1EDQA 1PCXA 2CGRH 3LMJH 3VXMB 3T2QA 5FO9B 2V8MA 4HWZB 1WEJH 2WTRB 2ZUTA 1A25A 1RIUH 3P54A 2JQMA 3PWVB 5CSZA 5BZDB 5AOIA 3V55A 2PWDA 2XZZA 2D7PA 2I69A 2WK2A 3Q1SH 4XNXH 3GS0A 1WA1X 1VKXB 1KCWA 2ZAGA 1U8HB 2A6IB 2BVOA 2UZYA 3CV5A 1LEKB 4GNKB 4P2QE 4R26H 2KQMA 1XR9A 3P3YA 4ZNCD 1KGWA 4NO3A 1EEYA 4AKPA 4F80A 1LEGA 4DUWA 2FX8H 3C5JB 2EUZA 1AOZA 2CXGA 2R23B 3V4UH 5AVSB 5BRQA 1IBZA 4IBLT 4DUVA 2VR4A 3LVEA 1PY0A 3ULVC 4JHAL 1TYRA 2FD6L 3QFJE 5FYLE 4FZ8L 1MRFH 3DA0A 5MHSE 2CBPA 3K1DA 3SPHA 4N85A 4GS7B 4HJEA 2OTWB 2X4SB 5KN5B 4AV4A 3OB0H 1OAXL 1LM8V 1D5BB 1L4IA 1UYWH 2GIMA 3LKNB 1OSYA 4RMBA 4AJYV 5LGJA 4NNXB 3ZDZE 4XXWA 4UT6L 2FJGA 3RGBA 1FG9C 2NOYA 3L3KA 3U0PB 2YSSB 2EABA 4WI0B 4DF9A 1I1AC 3T0EB 2OYMA 2VDKB 4HIPA 3I6LE 3VD5A 3Q06A 5LXVA 3U0WH 4IRZH 3ZE1F 5FDWB 1EJOH 3ZT5A 5ICXB 1V3JA 1ZLWH 4GG6F 2X41A 5LHDA 3FFCD 2E7HA 2MEJB 4FI7A 3QUXA 4NKDA 4Q89A 4KK9C 3UG4A 5E9DB 4KTDL 4F7TA 3I50H 4TS6A 2PF6A 2YRLA 3BO8B 5JHDB 1HL8A 1AHMA 1OTSD 3GZPA 4I48B 5B1KA 3WLBB 2LU5A 4GAGH 4PGEA 2IANB 2F1EA 1D7FA 1MI5B 1IV8A 2ARJA 5KYWB 1XGRA 1W8OA 4P5TC 2FR4B 4R7DA 1IKFH 4G7RB 1W8NA 1A6PA 4M62H 2YFNA 3L4TA 3RB5A 3PXLA 3LNGA 1H0DB 1G9MH 4ZXBD 5L8KB 2ZPKL 3W11D 5CN3A 4X2UA 2VXSL 1I9JH 1U36A 1VACB 1BJ1H 1I85A 1SLUA 2G0KA 4QEGA 4UQ9A 1VGKA 1ZWIB 3GBEA 4D9LL 2WNKA 3U46B 3PXHA 3ZW3A 1U9KA 4IU2A 5FYJD 3GSNH 2C3XA 3WNNA 3ZKND 1T2QH 3QE5A 3D0LA 3O6KL 3FQ1A 4HEPG 1EWHA 1IGYB 4J4PA 3TJHC 4BFRA 1E8XA 5FKPB 4K9EC 3E8UL 5T5FH 3F7YB 3GMMB 12E8L 3JUZA 3QDJA 1B0RA 4Z7VB 4TNWF 3CZUB 3KLQA 2IPTH 3ABLB 3CHQA 4G7SB 3KDPB 1ZGLP 3L3JB 1BPVA 2ZCLL 1QP1A 4GO8A 4J3XA 5E5MA 1ICTA 4DTGL 4UB0L 3BWAB 3DPBA 3U6XS 4CW1B 3WFDH 4XC3L 5E70A 5ILTH 4WLCA 5IMLB 2VUYA 3GMPA 4L3AA 4WCYH 2EDXA 2UY6B 5TE7L 3EJQA 4OCWL 2YR3A 3X12A 3II3A 3D85B 2FECL 4DAGH 2D3JA 4YL9A 2EXTA 2XWBA 4AVJA 2H3KA 3UOAB 1ERNA 3S3DB 4W6XB 1H8LA 4S0HA 3PWPE 1SRDA 1V55B 4G82A 5CHNB 1KJVB 1JI2A 3N40P 4J1UB 1LD9B 2J2ZB 1NM9A 3DX2A 4JPKH 3C6EA 4P2OC 4R0LA 5FLVA 4AMXA 2COVD 3FU7A 2LHAA 2WTPA 5D7SL 1P2CA 1QLEH 3BE1H 4I1RA 4F9LC 1WGOA 2EIJB 1AANA 1A7RH 3CH1A 2LR4A 4UV7L 3P30H 4HJGA 2NQCA 4X98B 3BXNA 3ULVH 1JDAA 4UANA 3UAJC 2G60L 4BK4A 4JG5A 1FRGL 2WZ5A 4XNUL 4OF7A 1BAFL 3HZ3A 3U36B 3BGAA 2NY2C 3A4EA 1G1YA 2I7OA 1LDPL 3MV01 3T3ME 4AGQA 4DP7X 3AY4A 3UEZA 1GAFL 2DQUL 2F5BH 4ONGH 1DUZB 3T3PE 5FM5M 2DF3A 2EDTA 3N44B 5C07E 4PMFA 4N24A 4MX7A 1I8MA 2OL3L 1IZJA 3H7LA 3DUSA 2PCFB 2ZF9A 4L48A 4YSAA 1Z1WA 3UPRA 1UH3A 5I6XB 2PMZA 2DOCA 4C56B 2O61B 1T4WA 1W0VA 5DMJB 4I3GA 2X4QA 1V7NH 1IFHH 4DFIA 1VFUA 1FN4A 4L37A 4I0PD 1HAWA 3SDYH 1EFXD 1X4XA 2VNCA 4GYBA 5IQ9A 5J12B 3ISYA 3ZT7A 4B9KC 1FLRH 2ATPA 1UWFA 2X9ZA 5B1AB 4FABL 3O4OB 3T6VA 2PW1A 3ZTJH 4U6YB 5MEOA 3MRJA 3CIAA 1GGCH 5CZRA 2QTVA 5JHLL 4KHXH 1VZGA 3UYOD 4M1CC 4DP5X 3BRFA 5FK9A 4NZFA 2A6DB 3FN0L 1J0YA 1FG2B 1OP3H 2EC9U 2PP8A 2X0WA 4F9PA 3MX0B 2KDYA 4KHTH 2Q86A 3FAXA 2YXMA 1PS3A 2F61A 3PFQA 3L45A 4JM2C 3FB5B 5HYJB 4LVHC 4U3HA 3UDWC 5K1VA 4TNVF 2XQYK 3VA6A 2AI0H 3BRGC 2O5XL 1KTRL 1T3FB 3IU3A 3ZDXB 1D5MB 2YLHA 4E9XA 3OAZK 4OZHB 3V7MA 4FHKA 4HXAH 3MC0A 1NGPH 3ROOA 3L4ZA 2BVPB 3DGCR 5JQHC 5HXMA 2CD0A 4K9EH 1I7RB 4K7FB 5B38B 4MSWB 4P9ML 3RVXC 3U1SH 3SDCA 1J8RA 4HKBB 4ELKB 1MHHA 3BI9X 1BMGA 1Q0XL 1ZHLB 3PIQB 5D4JA 3L9BA 4G8GD 2BCKA 4K73A 4Y9EA 2Q76B 4X9BA 1MELA 1P69B 2WP3T 2OM5A 4W9IC 4QRQA 1KB9K 1I1RA 1NTDA 2B9AA 1A6TA 2XQBL 3MN8A 3MQIA 1T89A 4WU5A 2CAKA 1DL7L 4Y4KB 5IROD 2IBBA 4MNHB 4B0MM 2DMGA 5I76A 4HCRL 1YEDA 5FA3B 5KVDL 1BFTA 2MRYA 1YYCA 2IPUG 3MACH 5E2UH 3PWJB 5PCYA 4P4KB 2J21A 3MNZA 3IS0X 3K6OA 4N8CH 4A2LA 5DUPL 5D6CA 4JFFB 4PBVC 4LBEB 2MQGA 4XNAA 5E94A 3P3SA 2B59B 4LEBA 1G7QB 1UOKA 4LCIL 2YPVA 1U6AL 3UROR 2DTML 3P9LB 3WTSA 3OPUA 4K94C 1U8OA 3HTLX 4M6MH 3O6FC 4PJDA 2Z7ZA 1V5JA 3KEHA 2O1AA 5ISZA 5FYLH 3WNJA 5I1CL 3FHEA 4FP8L 3PAVA 5HHQA 4OM1L 4WDIA 3QJOA 5EDXA 4X6CE 1FVDB 4EKXA 4Y5YB 5L2KE 1X4ZA 4OVUA 2VZVA 1K4CB 3FO2A 4BSVB 2XNAA 1MFBL 5GGRA 3KW8A 1N4XL 4PJHE 2WXFA 3CBRA 1KPUB 3J27A 4FZEL 1CTMA 3D52A 1IC7L 3H0TA 5AAWA 2DJ4A 2XA8L 4XOBA 4FQ2L 4KZEH 4MA1C 1W9XA 3MRLB 4CC4C 5DJAA 3TBWB 4BZ2H 1YN6B 1S9YA 2H2PD 4HX1A 4PVNA 2AHIA 3EJSA 1ZVHA 2V0AA 2B2XH 3R0MA 2DB8A 3OKEB 5TQ2H 5FA4B 3QZOA 2X38A 3D50A 4U1KB 4ZFGL 4EEEA 5EZJB 3Q6FA 1ECZA 4KI5E 1WQVT 4HLZH 4F5CA 3SJVA 2MNUA 2IH9A 3SBRA 1Q94B 3ML8A 4MAYA 4MJ4A 2HFFA 5CJ8A 3FSAA 3RWGA 5EFIA 2P24B 1SJHB 4OCSL 4EI5D 1FI8C 1JWUA 3LRKA 3UTPD 3H9SB 4GW1A 2Y4SA 1B4RA 1PNCA 1IEBA 4XZUB 5BNXD 2UUDK 3F7PC 4QWWC 1F3DH 4WIQA 3Q1EA 4EE2A 4CADA 2UWEE 3FMGH 3CFDB 4ZSOA 4G83A 2VMDA 5ITBH 3TV3H 4OSUL 5IM7A 3MRRB 3MYJA 4UT9L 4QRAA 5EBWA 1J10A 1YMMD 3C2SA 4LHJB 4P5RA 5D1QC 4XRCA 1AXTL 2NYKA 1AOHA 1BJMA 1KJ3H 1P53A 1FVEB 4K5MA 5D2NA 1M1SA 1X5GA 1BAWA 1BF8A 4QRRB 4G6AC 4TL4A 5EU4A 4P5KB 5JNYB 1MW0A 2R83A 3WEBA 2EVFA 3JTTB 1SLVA 1M7DB 2H0PA 3ZHFA 4IKKA 5H37H 1ZVYA 1TPXB 1DVFD 2Z4QB 3BUIA 4YHNA 3FRUB 4JGMA 1M53A 4FXTA 1BVKB 3MLYL 2GQHA 2YRPA 3U7YH 2JI2A 4NQCB 5IQOA 4U7SA 4F2ME 5DJZB 3QHZL 4AJWA 4N0YH 1MRCH 3T04D 5E2VH 4PBXA 1MH5B 2HTLD 1G7LB 4XCYB 2WSDA 3LZLA 3IGLA 3C6LA 3FUDA 5EO1B 4QJ5B 2JMRA 4PJ8D 3UTSD 5I5RA 4H88L 4TTDD 4H7VA 4HZLA 4LNVA 2NW3A 3ZKSD 4J8RB 2GHZA 3DIVA 2DYPA 4JKWA 5HD8D 3V9CA 4WFFD 1UA7A 2J44A 3DMMC 2FK9A 4X6EA 1J1OH 5B3NA 3HPJA 4D0CA 4Z7QF 1BREA 5BW7A 3MJ7A 3C8KB 3SQBA 1KPVA 5SWZE 3K6DA 4U7KA 4I2XA 2VUOA 2JE8A 2C9UA 1Z9NA 2G2PA 4K94H 5HI4C 2B1AH 1NIDA 2R69A 1TVHA 4UWQB 4YS4A 4GJTB 5FEBA 4XBPA 5IKCA 5CNHA 2GITB 5EEUA 4L3FA 4JCLA 3BH9B 4XO5A 4JBSA 4HUUB 1FYTD 4IIQB 1B4JL 1ZJBA 3LTVA 4HF5H 2MIZA 3U9WA 1DVYA 5BO1L 5C9JB 2FO1A 1X5XA 1FNAA 1WZLA 3HPLB 1XH3A 5EB9A 3KDMA 4AJ0A 5D70L 3PGCB 2R59A 4I9XA 4NXKA 1A4AA 4LCCB 2CK0H 2YUZA 3WFHA 1LWRA 2Q10A 3MOBH 4JZJC 5CUSH 3U0TA 3P11L 3TCTA 3HG1E 1OAYH 4FG6D 5JUEL 5DT1H 1MHCB 1CD1A 3IMSA 2ATAA 2YAQA 3L4WA 4PWKA 5F96L 2QT6A 1LYQA 2F5AL 1GJUA 3QIUB 4XO9A 3V4VB 1TFHA 2BW5A 4I87A 1RXLA 2L4OA 4YXKL 4ZX4A 3E6HA 1ZLUK 3Q48A 3S3BB 2RHEA 5CIPB 3HB3C 4PB9L 1JWMA 1SXZA 3GTTA 4QOKA 4Y8AA 4GW5A 3RL2B 3VRLF 5C9KA 1M1XA 5IFAH 2XVLA 4KI5C 3V5KA 4TL5A 3QUZA 3Q01A 2DM4A 1T5XB 3TBSB 3LKQB 3LRLA 3FB6B 4GOSA 1AO7A 4Y1AD 2G9KA 1PKQB 1U95B 3EGSB 4UUJB 4GB9A 5HHOA 4RAVB 3BP5B 1A7NL 2FBOJ 1AG0A 1UJ3A 4N90E 3CGTA 4KRPD 3V0WL 5FO8A 1GYUA 4QT5B 4DQOH 2VUKA 1FA4A 3EZ8A 2AEQL 5KBLA 4G80A 4N2NA 1ZT7A 4OIAA 1B9ZA 4Q9RH 1XIWA 1TSHA 4AEFA 1AHWA 1HKFA 2IFFL 2F58H 4ORGB 4MDJA 5EZOH 2WXLA 1G6RB 5IR1B 1SQ2N 2X70B 1YZZA 2FBJH 4Q9QH 3LKSB 4LPCA 5KOMC 2O6PA 1A6WL 4L3ED 4P46A 3TNMB 4KKLD 4U49A 4YSUA 5HYSB 3S35H 5I6KA 5AW2B 4OVVA 3L6FA 1QTPA 3PWLB 2AXFB 5JPNC 2J8UA 3HMXL 1XV8A 3IETB 1BZ9A 2A74B 2BVEA 3ARDA 3KLDA 2IGTA 2AJZB 3IJHB 2C1OA 2BVUA 1FL6A 3NJJA 3DK2A 3CFEA 2CCVA 5CZVL 1A6ZA 32C2A 1UQSA 3U4KA 5I1AB 4NJAH 3ZTJG 5FO2A 2KPWA 2MHAB 4NUJB 1A3QA 3Q2WA 2EYTB 3K74B 2HJFA 5ECGA 4CVUA 2NT0A 1JZ8A 3VG9C 3HRZC 4AZ8B 4I9WE 2O26U 2DBLL 4OIBA 4PRIB 3ZUCA 1QNZH 4PRHE 3GJFK 4FNRA 3GMLB 2F53D 4TOYL 3LH2L 2BNRA 2HRPH 4GKZB 5AVTB 4GKSA 4Z7WE 5ABAA 4DHLA 4DZBB 4MNQA 4G1MA 3K6SA 1PZ5B 3ZTDC 1BM3L 3LEVH 4GKNB 4KKCD 4B3EA 1S3KH 4FERA 2OSXA 3QDGA 3LDBC 2DLFL 4JZOB 3LH9A 3U83A 4HD9A 3KH4A 3GC3A 1A2YA 4JFPA 4JFDB 3HE7C 1XF4B 3PHOB 4LPTA 5EEYA 5C0IA 3SCMB 4PI2A 4U1MB 1BD2A 1DQML 4I3RL 3QISA 35C8L 4EIUA 1Q0YH 1A7QH 4Z8FL 1OB1A 2ZXDA 1LWHA 2VR6A 2XFGB 5DJ0B 5FHBL 4YBLC 2EECA 3QORA 2D31A 1J8HA 2Z31B 2DN7A 3KD4A 4Z7AA 1AIFA 1HWGB 3IFLL 4S1RL 3NRPA 1GZPA 2B7DT 4TVUA 5F7FA 4DCQA 5I6MA 1S7UA 2J8OA 1N7ML 3UABA 3X1NA 1DANT 3IDIA 3SPIA 5EG6C 2EH7L 4KV5E 1A3RH 3GXMA 3HRPA 2WW8A 3GXPA 3B5HA 1JUFB 1KG0A 2B4CL 3LX9A 4Z0BL 2VRQA 4JZNB 3GUTB 3PP3K 1SXCA 4ODVH 5IK3A 4XP9L 1JNHB 3ZDZF 4LLDB 5DSCA 4PJ9A 3ZDYB 2Q6WA 1G4MA 4XC1L 4B41A 3RQ3A 1J0JA 3WIHA 2FB4H 2TSBA 4FQIL 5D7LA 3DXAA 1IC4L 3O3DA 1TTFA 1LHZA 2ZUWA 3QQ9D 4R7NA 5GZOC 3O0RH 1ZGLA 1GGIH 2YK1L 5D71H 4NLHA 3WY4A 4E42A 3I2CH 4M6OH 4F7KA 4HISA 4K8RL 2R56L 3KMDA 1CG9A 3B1UA 1NDGB 3LIZL 2VLME 3MNDA 5LAXB 4YHLL 2XKNB 2QADC 4BZ1A 1HOCA 1PY4A 2CK2A 1VZIA 2HN7B 3RAJH 1G7MA 1YECL 4NKMA 5TDNA 3FTYA 1J5CA 3GMOB 2XFXB 4ECNA 1AKJA 3QC6X 4P23A 1V7MH 5HSFA 5IESL 1ACYL 5E00A 4P59L 2VISB 5E6IB 4MA3A 4WUUA 4F58H 3CC1A 4TNFA 5GSRA 3VFOA 4AJVA 3ZNGA 4LP5A 4GP8B 2PTTB 3GO1L 2ZWYA 1KZQA 5I8OH 5D5ME 3TIEA 1JI1A 5D7IE 1HEZB 1YUHA 2GUOB 1CCZA 4NJ9H 2Y06H 5BVPL 4LCUA 5B3JE 3NSCA 4XOAA 1PX3A 3LKOA 2P49B 4IHOA 4UDTA 2BRRL 5CN2A 4MCNA 2YD5A 1UGKA 2D3LA 1C1EH 2YD4A 1HCFX 2G2RB 4IOSA 5E0QA 4H8VA 3NCXA 2YJQA 3GSRB 4QHLB 1SMAA 4L4TB 2MPVA 5BRZE 3P4NB 2WHVA 5IQ7H 3V4PA 1E43A 1UGNA 5ICZA 2QFRA 3DX7A 1XQ4A 1J8SA 4OAWB 1LGVA 1KIQB 1NFDE 2BW4A 4ZQKB 2Q20A 1LK2B 1XSOA 4ZFOA 3F04A 1ETJA 4PVLA 1DBJL 4K2UH 3LZPA 4XPFH 1E9OB 5IHUL 4BE6A 4JPWL 1FGNH 4ZUWB 5CGYC 5DHYB 3TC9A 4UAOC 3B9VA 5E4EB 3WYRA 2J25A 1NGQH 1TZIB 4M1DL 4E9QA 1JGEB 2QGCA 3R0NA 3CU1A 4MNGB 4HT1L 4P49A 4U1JA 1BBDH 4ZXBB 1ZPUA 3MMEA 4JO2L 1MW1A 4TRPL 2IWEA 4GUQA 3GRWH 4LPXA 1SYVA 4TNWK 1H8OA 3B3BA 3SPCA 1OIOA 3C75A 3QUXD 3QCVH 4RZCB 1O9WA 1WBXB 2I27N 3GEWB 5SV3A 4OGXL 4HGKC 1KTJA 3II1A 4MYWB 2EZ0C 1HSBB 3QJHA 1NGZA 1R3LA 1UASA 4X8CA 5I66B 5DHVA 5DYOB 5H37G 2AJSH 1HXYB 2KZBA 3PV6A 1RUQH 2FSEA 3FT4A 3H54A 3MLZL 3AWGA 4XPTH 5IFJA 4M8RA 2C3GA 2Q3ZA 2J12B 4KROD 1KY6A 4A67A 3SGJA 3FO9B 1D7DA 4WK2B 4K8RD 3T3MF 4HGWA 3DJZA 5TDPA 1QKZH 2D0GA 2YXVA 1N6UA 4M03A 5G55A 3WE6B 2RR3A 3T3PF 1MF2L 3C5ZD 3MUGA 4I13B 2ZUUA 1HIMH 2GTZB 2MCMA 3ZQ9A 3FO0H 2YQBA 3B7TA 3X3FH 4CL7A 3AITA 2ZCHL 3DGDA 3NJNA 4QHKJ 2V3DA 4OBRA 1F97A 2RQEA 4WTZG 5I24A 2BMKB 4YE4L 5A2CA 1FAIH 1NCWL 2QQQA 2VSKB 4GP5B 4R9HA 5I17B 3S35X 4DFHA 4J4PD 3WD5L 1JK8B 1USQA 4WY7H 2JCCA 5AZ2H 3KW7A 2GBAA 3QDJD 5J6SA 3L3OA 5F3HB 4OGAD 2A77H 3OAYH 4AG4L 5B7MA 4DIXA 5EU7E 2XY2A 3F12B 1QQDB 1R24A 3ZE0B 4WI4A 4DPCX 4RRPM 3P73A 4K55A 1OM3L 5FM8A 3VFRB 2EIEA 4QR7A 2FX7L 4Z0XB 1YNLH 2APXA 3ESOA 4MJ5A 4OKDA 2EIDA 2H0FA 2HG0A 2IBGA 4YMPA 2X2YA 5I18L 1QR1A 3LB6C 1KBVA 1FFOA 3GBLA 3MZGB 4KJYB 1DQTA 1ZAGA 5FCUH 4FG2A 2QMKA 3OKOA 1F45A 4O58L 4H8HA 1F58H 1IAKA 2DKMA 3F5WB 3HZMA 1WUZA 5GS1A 3KL3A 4N8VB 4G42B 5EWIH 1KXVC 5EO9A 2Y7NA 4WWID 3T2NH 2R1WA 3O3BA 5F7AA 2LAAA 3D69B 3EXJA 3AGVA 2D03H 5DO2C 4A2MA 1OAKH 4JO3H 3NPSC 3SYOA 3RVWC 4Y16B 3UBFA 1SGKA 1V3MA 4I0PB 1W8EA 5BRPA 3MBWA 5F3BB 5JDSA 4OJYA 2PO6B 4R5XA 2VDNL 4IHBA 5GS0D 2HVKB 2ZOOA 2B1OA 5F8RC 4V1DA 1OTTD 2HKFL 4Q74A 3LKPB 3KLHC 2ZSVA 2NZIA 4HUXB 3CUPB 3DO3A 5DQJA 1JYWA 4UINH 1YEKH 4TNVK 1U8QB 4JRXB 4PGZA 1AGBA 4KNSA 1RZKC 5C0BB 3ARTA 4B3VA 4KUZH 2CJUL 3P69A 2EDLA 2A1WL 3O11B 4EXPX 4HHAA 5HVHB 4ZMVA 4FULA 5DVKA 2EUWA 3WEXB 5I6PA 5TF0A 4JHWH 4XR8C 1A0QH 4AEHL 4U1SB 5DZOA 1I53A 2VXUL 3L7FA 4XOCA 1XZ0B 4HOMA 1H8SA 4NM8H 3P3TA 4J3OD 3BKCL 4X7SH 2ZNXA 4J39A 5K9JH 2XN1A 1AFVH 1MNUL 1MLBB 1A4JA 3WO4B 1F11A 2BOBA 1DDHA 2VN7A 1UTDA 5ACMA 1B3IA 4AK1A 4O9HH 4KQ3H 5HHPB 4AL8C 4W68A 1ZS8A 3TA3C 1A6VL 1E3FA 1KEGH 5C0CE 4DUXA 3L1FA 4JQXC 1YG9A 1WO2A 3L5WA 2OTUA 3KPNB 4O2CA 4YZFE 3W0WB 5A3IC 3GM0A 1VADB 3LRSA 4YOKA 2CNZA 4XHQA 5MENA 1MFCL 1I8UA 1T22A 3ASWA 2R0LH 2QSCL 2P46B 4GG8A 5I19L 1DJIA 1UKQA 2EXYC 2ZTBA 4UAHA 3UX9B 3SE3A 2AKRB 4G8GB 2DWDA 3L9RB 3UC0H 2FEDD 2DWXA 5DQDL 1QABA 2J1KA 4N0UB 4PFEA 4PJHF 3OLEA 3L3HA 4NO0A 3CN4A 5GHWH 3RG1C 3OR6B 3A22A 4YDVA 3WMPA 4B6ZA 5HVFB 1H5BA 4UDUA 1UCBL 1P4BL 4OCLC 4AITA 1UD3A 5DUJA 1YYML 2GC7C 3L08A 3V4VL 4Y5XA 2CMRH 3IF1A 4ALAL 1FJ1B 1X7QA 3D25B 3GSWA 4NUPA 4UQEA 5BV7H 1EHLL 1CDBA 4B5EA 3DX3A 5D72L 5KZCB 2JB6B 2AC0A 4UU9B 1PEZA 5KJ4A 1D5ZB 4UOW0 4M7LT 1ZIAA 1WITA 1XSKA 4LKXB 5KSBA 3SDCD 1UZ8A 1I8KB 1XR8B 2Y2TA 1KYOJ 1YVLA 3EHBD 4QHPA 4ANWA 4NQEA 4NSKB 2GY5A 3HHSA 1CL7I 1P5UB 4Z7NE 3QEQA 4H8PA 2V5RA 1NBYB 1VB9A 4GRMB 4U1IA 4XMPL 5DURD 3QNZB 4JHVA 4MAZA 1N6QH 1SPDA 1DBKL 3VFVB 2DYSB 3QR1A 5EUKA 1UG9A 2AJVL 2CHXA 4YWGL 4BQ6A 3WEAA 2QFPA 4HWBA 4UOJA 5D96B 4Z76B 1HK6A 1I1CA 3H6AA 1PZSA 4PGBB 4NAQA 3VSVA 2WWKT 5BO0D 3QZPA 5CSGA 3VO0A 3Q8BA 1YAIA 2XWDA 3VXUE 4NKOB 4GEIA 2JJSA 4F33B 3P0GB 5F7BA 3OM3B 4ETQA 2FIKA 1H9VA 1ZXKA 2X6MA 3CSYB 3L2LA 2W9EL 2VABA 3V5HA 5BS0A 1TNNA 1P1VA 4KZDL 1LP9B 3FQRA 2WVTA 5CEYA 1MJJB 2SODB 1CLYL 3DWTA 5ISZD 5DRNA 2LTQB 3RDTA 4YPGA 4FFZL 2UY7A 1KGUA 5JYMA 1RZKH 3D9AH 4Q52A 2WLNA 4S10A 3HG0A 4UTBA 2GPZA 1S7WA 2VC2B 4EI5B 5KSAC 1MUJB 4XPAH 1S7RB 1INEL 4XN8A 4PJ7A 1NUGA 5DRWA 2QVIA 4QXVA 2QPEB 1JP5A 1PL3A 2A38A 2DQFA 5DDHA 4L18A 1CMOA 5H35A 3PLYA 3D0VB 4QF1A 4F8OA 5AVVB 1FBIH 2J4WL 2PN5A 3GSQB 3CFNA 4HA1A 2VL5A 5CILH 2R1YA 1F4YH 5TE6H 1INQA 1IGJB 5ACLA 4CMHC 5DD6B 4AL8H 1OP5H 4FD0A 5DR5H 1SFHA 4EOWL 3SJVD 3S8FB 5JQIB 3I02B 4D94A 2NZ1A 4MAYD 5JLZB 4FQQB 3T4AC 1QSFE 4W9HC 4R2GB 4JZNA 1GOGA 3RGHA 1MHPH 1NJ9A 1DVFB 4UM9A 4IEFA 3VWKA 2VDRB 1NL0L 1W2KT 3G6JE 4HEPA 3UYRH 3GJFB 4N6RB 2X3BA 3KCPA 5FW7A 4OZIF 2BP8B 1T2XA 2GSGB 3MJ9L 4DK5A 1JPEA 4X9FA 3QWQB 3SDXA 3A6CL 3P4MA 5SWQA 1S8DA 5GQBA 3FB7B 3SKMB 4HK0B 1J0ZA 2YGNA 2C9WA 4NZDA 4KKBC 1XF3B 4PJ8B 3UTSB 1SEQH 3LD8B 1YDPA 3RWEA 1I3GH 2IAMA 4PJCB 3UTTB 3ZMEA 4UTAL 2DICA 2MCAA 4CC0A 4LSDA 3FN9A 2W95A 3OWEA 3TH2T 4AQAB 3RJDA 1X7SA 1YEFL 3FRPB 1KLUA 5AKSA 1D7BA 3AU0A 3OD3A 4X7FC 5DFVC 4LXFA 3NFPB 3H3PL 1YEHL 4K23L 3D2UA 3WNKA 1CFTA 2WLLA 3HS0B 3DETC 5AAMC 2MOQA 3TBTB 3D51A 1N0XH 2OJZL 4LGSB 4LLUA 2D2OA 1LO4L 3LY6A 4HJIA 4OJAA 5DJXA 1AR1D 1P7HL 3H3BC 2EIZB 4RMTA 1M7IB 2FJHB 4AT6A 2D9CA 3Q3GA 4FOMA 4OD3H 3ZKQD 2D0FA 3G6AB 4PV8B 3NRQA 3O2VH 3KPSE 4F3FA 3SZ6A 5L4JA 2QHRL 1GXEA 1TO5A 4M48L 2KPNA 5D1ZA 4H4NA 3C6LD 3BPOB 4P0DA 4PJ5A 2C7FA 2YD1A 3PWUA 2OK0H 5CJQH 3QYCA 2JJTC 2WINB 4OCYL 4RFOH 3EDJA 5D6DA 3QPKA 4PHXA 3WIIL 3AT0A 5KSUB 4L8DA 2EVHA 2DYPD 3QA3B 3FS9A 5F7EH 4OD2B 4LLAA 1LO2H 2FUQA 5EF1A 2P8PB 4MAUL 4BKTC 1A1OA 4ZT1A 4ELME 5FV2A 5DD3L 2NY1B 5JZ7D 2X3CA 3GMQB 1M7XA 3NFSH 5GGVY 1GGBL 4ADIA 4PI0A 2I9LB 1HTYA 4GXVL 4CBZA 3O2DH 1NMAH 4KFZC 4NP4L 3V9EA 5A2LH 4NM4H 1WHPA 5EU6E 2FJSA 4A6YL 5IMMA 1QLFA 3TA4D 3I9GL 4LU5L 5KBPA 4OLZL 5DRZA 5HPMB 1IMHC 1O75A 5C09E 3ILPB 1OP3K 2NR6A 4KZCA 1CL7L 2Z0BA 1LNUB 3I84A 4E0RB 4WJ5B 1OALA 3E3QE 3BKJL 1MW2A 2VDLH 2D4FA 2E7LC 3DIFB 1E40A 3ZE1B 4GG6B 4ZO9A 4PJEE 1NBCA 3DVNA 4XE5B 1T2JA 5AAPA 2AJXL 3VXRA 2E0PA 4X6DE 3AQZA 4Z7WF 4OQTL 4G2AA 4PJBE 7CGTA 5L9DH 1U3HC 2VAAB 3UBGA 5DMIL 5IVXF 2ICES 2QPFA 3BSGA 4BA0A 4Y5VC 3VXTB 1BQUA 1YEEH 3AREA 1I31A 3GIVA 3JV4B 2AJ3B 4MASA 4R90L 4RMRA 1D9KC 3NN8B 1C08A 1BQLL 1UACH 3IDMB 4XI5D 1N59A 3FTZA 3FQUB 4ODTL 4QOKD 5C0FB 2I07B 4YLBA 2K6YA 3LZFH 2QEJA 5GGTA 4XVJH 5EORL 2OYPA 5I1KH 5C0EA 1E6OH 1UM4H 2F7PA 3QUZD 3CSPA 1FPTL 4U6VL 2XXMB 1AI1H 5E1AB 4M5YH 1JF1B 1AO7D 4GI9A 1QFOA 2HUHA 5HHOD 5CU9A 3N43B 4R4NC 2IMMA 2E86A 2A73A 3NACL 3GNML 4BFJA 4HUMB 3QUMH 1VA9A 2VM4A 1Q9OB 2HJLA 3WFEL 1MCCA 4CGUB 4CU6A 2IF7A 2X4UA 3ABMB 4MJ6A 3RWCB 1DYZA 1NMBL 4KV5F 4LASH 2CIIB 4HPOL 3O2WL 5B1JC 1P4IL 1UWGH 1XIWD 1MREH 3L1OL 1EH9A 2F53B 2B39A 4X0KB 1VFOA 3IRPX 1IUZA 3L4VA 2ERJB 4BZ1L 4P46D 4LP8A 3W39A 1SYSA 1GZQA 3VFSB 2JI3A 2YA2A 4HKXA 43CAB 5BXFA 4V2BA 3G6DL 4HPYH 1MCEA 4RMSA 1YA5A 4IU3A 3S88H 1TENA 3ZIYA 1B6DA 2BOLA 2E7MA 2V8LA 1HILB 3GI8L 3NIDE 3ARDD 4HSCX 4KFMA 4KRLB 4X5LA 4MWFB 3B3IB 1TTCA 4ZMZA 5IIEB 2PUQT 2WXRA 4FZ8H 3MUUA 4LSPL 1YEGL 4HH9B 4IRJC 5CP7A 4J23A 3RY6A 4CUCA 2A0LD 2QPSA 3CQQA 3EDEA 3CLEL 3EYOA 1R5IA 2XTJB 1L7TL 3QPXH 4G9DB 1EV2E 3BP6A 1EHNA 1SN0A 2R0KH 2AXHA 4PQXA 4E9TA 7TAAA 2BNRD 4X7TB 5DD1H 4RGNC 2NX5E 3IVKB 2PPDA 2F8IA 3M86A 2QHLA 4ZMNA 1RP9A 2YKLL 4I4WA 4MNQD 3JZYA 2YPLA 4JM4H 4K3DH 1F4WH 3L3IA 3MKKA 4H8WL 1NAMH 2W94A 3PQYA 3QDGD 4I88A 4XBGB 1T1WB 1JK9A 1Z5HA 4PY8J 1CI3M 2QSTA 3D07A 4YK4B 4LSUL 3DJRA 4LBAA 2DMHA 4Y2NA 3WIFA 5CWSB 5K39A 5F1NB 1BD2D 1OD9A 1PQZA 5DVOA 3ATBA 4HCIA 1JPFA 3RPIB 3TU6A 3HJEA 2SEBB 1WAAA 1JHKL 3QORD 4PD4K 3EDFA 1J8HD 3VI3E 4XNQA 4JE4B 4XNBA 3ILQD 1MPAH 2HLFC 2EEXA 1Z5LA 1EHXA 4R97B 4F15C 2OXGB 2W59A 4NHCH 5ANMA 1VAHA 1KYOK 1XCQB 3OAUL 4J28A 3D30A 4GMSH 4KJQC 1NCIA 3HBQA 3IDYC 3E3QC 2ZPKH 3QHTC 3ZYJA 3QEHB 2VXSH 2P8LB 4YSEA 2V9UA 1FSKC 3DX9A 4RBPH 4P99A 4RMUA 3VX0A 1WBYA 1NFDF 5KG9B 1XF5A 3BH4A 5E4IA 1S6NA 2IWFA 2CO7B 1EXGA 1E3XA 3WTVA 1YPZE 4I77L 4PJ9D 3O45B 1RIVH 3O6KH 4MTMA 3VXPB 1FFRA 3WGVB 3CDFA 2AQRA 2Q1EA 3E8UH 3S36H 5D7LD 4K3JL 12E8H 3DXAD 5CCJA 4ZOBA 1T6BX 3QYMA 1BGXL 4N1EA 3DK0A 2BY2A 3C12A 1XCWA 3R06A 4LLMB 1LO5A 5EC2A 2AITA 2ZCLH 1SBSL 5CSZB 3H9HA 3SKNB 4DTGH 3FUFA 4AIZA 5I1EH 4DN4H 2AJUH 5AWNL 4NC0B 5CEZE 4ODHL 3QXTA 3U9PL 1BYPA 3ETBF 2BVOB 2UZYB 4MJJA 5E1IA 3UTQB 3ARBB 4IRZA 2X40A 5I15L 4XP1H 3UPAA 1MJ7H 1UFGA 3V6ZB 1J0HA 4NO3B 1IL1A 1FV1A 1THAA 1ZCRA 3O6ML 3UZVA 4CAGA 1AKJD 4U3SA 1Z32X 2VDMB 3O6LL 2HVBA 1SF5A 3G5VA 3O9WC 2G5RA 4HKJB 1PX8A 4LVEA 4P23D 4A2DA 3CTTA 4QXTA 4WUUD 3VXME 2Q7YB 4WGVB 4Y7MA 3X3GH 5DJCA 3CMGA 1MKFA 3GLEA 4YX2L 2NY3D 3Q7JA 2YLKA 5D1XA 4JCWA 5ALCL 5GS3A 1HKLL 2KDGA 1PVHA 3ESPA 3L2NA 5LGJB 3K71B 4DKFL 2VLLA 2FJGB 3MRCA 4OZGA 3UMTA 3CCHB 4UV7H 2X7LB 4JFYB 2G60H 3DLQR 4DETA 1NKOA 3I3EA 1FRGH 2V2XA 4XNUH 4RIRA 1C7TA 3GKWL 4KXBA 4IQHA 2X6UA 3VW3L 3CQFA 3QUXB 4NKDB 3SY6A 1RVFH 1HE8A 3CE1A 4IOSD 2F7QA 3BT2L 2HH0L 1M4KA 3BPLB 2FGWL 3BVNA 3G5ZA 3OQ3B 4EQ2A 2DJUA 4JO4L 1PLBA 5F7UA 3GSNA 1MIEH 1L9OA 3U4EA 3H7BB 2FZ3B 2PP9A 3M17A 3P3UA 2VN3A 4HJUA 3SE8H 3T0EE 2UVEA 4FQ1L 4PLJD 5F7LB 4CN1A 1R9FA 3EO1A 3RGVA 3INOA 3OLGA 2BC4A 2PYEA 3QHFL