4W9DC

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methyloxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 3)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 37
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9dC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9dC01
4W9CC 3ZTCC 3ZRFC 3ZUNC 4BKSC 4W9KC 4B95C 3ZRCC 5LLIC 4W9IC 4W9GC 4BKTC 4WQOA 3ZTDC 4W9FC 4AJYV 1VCBC 1LQBC 4W9EC 4W9LC 4W9DC 1LM8V 4AWJC 4B9KC 4W9JC 4W9HC
chains in the Genus database with same CATH superfamily
2GFBA 3KPSB 5LAPA 3FC8A 2PN5A 3FCTB 4FF9A 1BF5A 4QHKI 5M7QA 2R59A 4TNWF 4BFOA 2VMEA 1WWBX 3SY0A 3U0PB 2ZAHA 1FPTL 3VH8G 2NZ9C 1QUPA 2ZYIA 4TVPL 3WMQA 1D6VH 3CH8A 5AWNL 5IHLB 1RZJH 3FQRB 3BO8A 2OR9L 2PCPB 4HXBH 4LU5H 3G6JA 3QEQA 1V55B 3LH2H 1OGAE 2XNAB 3CDZB 3TH4T 1RIVH 3S88H 1A9VA 4KMTL 2JK5A 3K0YA 2WD0A 4KKLD 5KN5A 4QCIB 2G60H 1DDHB 1I85C 2NSMA 3KXFE 1SY6L 2AQNA 5C0AB 3ZIYA 5CCKH 2A0LC 3ARBC 3FQNA 3TTYA 1Z3GH 1OTUD 4PREB 3WFEH 4OF8A 5AW0B 2NY4D 1BX2A 3J07A 4J1UA 2WLJA 4V1DB 4BZ1A 5EIQA 3GDCA 4Y1AA 4HUMB 4PH8A 2XPGB 3QBTB 4WWNA 5I6NA 1NZRA 2PCFB 4ODBD 3MV9A 2QQKH 2IEPA 4TTDD 1B9KA 4S1QH 1SJHA 2BHUA 4K4KA 3SGJA 2OJZH 2BZDA 2XY2A 3QEQE 3SY0B 5DLLA 3FOMB 2FB4H 2VDQB 2AJUL 5C70A 3TCTA 4YL4A 1ET7A 1YPZA 1RP8A 3O9WA 2OMNA 4U05A 3BO8B 3HNTL 2X53A 1XCQA 2IDTA 5KVEH 4NJ9L 3G6JB 3AXLA 1RVFL 3QEQB 1KPUA 4ODWB 3Q05A 3LS4H 1MN4A 3BVXA 4L3EB 2PTTA 4XVUC 3W9DB 5E8DL 1AC0A 5KN5B 2VR5A 3LD8B 2X6UA 2FX9L 3AT0A 4MS8C 4AQAA 3QFGA 5MI0C 3UEZA 2EIEA 1BX2B 1EDHA 3FBQA 1LEKB 4HC1L 1WWWX 3KLHC 3NN8A 2YJLA 4Y1AB 2OCCB 3QO1A 4G7QB 2WVSA 1YPZE 3MV9B 3NIGF 4BINA 3VB8A 5DK0A 4ZTOL 3SGJC 1A9BB 1SJHB 5GGSA 1KTLA 5IJDC 1F6AB 2OW6A 2EADA 1TO5A 3DDGA 3IMSA 5HY9A 3AZUA 2PYFB 3O9WC 4WI3A 4WFED 3UAJD 5JR1L 3M07A 4E9SA 2X88A 1ZLUH 1SZNA 2ZKHL 3O9WB 1DQJB 4KKAC 3SYQA 1XCQB 2AJYH 5FUOH 4CVUA 3ELAT 5D55A 3AMKA 4CMHC 1KB9K 3B2MA 3E8VA 3EH5B 4P9ML 3ETSA 1RK0B 1P7BA 3QIUB 3ZQWA 4CMHB 1J5OL 1HHHA 3Q2WA 3EYUH 2VXSH 4AQAB 2YZ1A 2K7QA 3FN9A 4K5NA 2ZF8A 4ICXA 5C8JB 2D0FA 4P8QA 2ITFA 4F8TA 3TJHD 1F0LA 4PJDE 3W11D 1DCLA 3NN8B 3SKOA 2ADYA 1GC1L 4MMZA 2PPDA 4J3BA 4R7LA 4WW1B 5IB3A 2WXQA 2XFGB 5E0QA 2V0AA 5IESL 1ZHBA 5E94A 2EUXA 3BH8A 1QZNA 1GS7A 3QUZA 3VE0A 5FYJL 3DVNB 5HY9B 2QPFA 3DURA 4NWTL 2FATL 4X9BA 1ZHLA 1MHCA 3BUDA 1UTDA 2VC2B 1AGEA 4L1DA 4QWWD 2OL3B 3EZ8A 3LNEA 5T1LB 1KFAH 1ED3A 1MCRA 1SYVB 2EEDA 1E3XA 4NZRL 3APMA 3WEOA 3V0EA 3QORD 3FONA 1B2WH 2C9XA 1IFHH 2EDWA 2W0FA 4KO9A 2ZX6A 1HHHB 4CMMA 3WE1A 2YD4A 4IK7A 1JZ2A 3N85H 2ROYA 4PCTA 2BCKB 1U8NA 2M8XA 2KERA 3Q6GH 1A7OL 3WHXA 2XVBA 3DO3A 1BZ8A 1G43A 5J06A 2I9TA 4UTAA 3EH4B 4KJWD 1KENL 3CSBA 1T66D 4MMZC 3SKOB 1DVFA 4NCDA 1G6RL 4KKCC 3U79A 4K94H 4TN9A 4JZNA 5DRXA 3RWJA 1JRHL 8PAZA 1JHKH 2A3TA 5IB3B 3NZHL 3RWHA 3ASWA 3PAVA 1ZHBB 3DXAA 3CSGA 4ALAL 4HPYL 4AEFA 2VDRL 3QUZB 5DHMC 3O45A 1DQTA 3S0PA 2G4GA 1KACB 3DURB 4GW1B 2EZ0D 4OV5B 2ZUQC 3MJWA 1X5AA 1YEHL 1ZHLB 1R0AL 3WTUA 3A21A 4N5UA 5ADPH 2R4SH 2VLKA 2Z1KA 1AGEB 2YXVA 1XB8A 2OX5A 4Y9BA 1DEEA 3ZIMA 4A38A 5IOKA 3Q43A 3DV6B 1AQ8A 3ME0A 3FONB 2AK1L 1UB6A 4HWUA 4CMMB 3X14B 4DP6X 2R0ZL 4XPBH 1QI3A 1QLEB 1MCFA 1X4ZA 1U8NB 2O30A 4MTMA 4XWGL 1Z0MA 4M7JL 1JWMB 4KK8C 4XMKH 5HHMD 1YMHA 5LBSA 3VCLA 4OKDA 4QHLB 2O93L 1KLFA 3DXAE 1JZFA 2I9TB 1C5BL 1AOHA 1DVFC 3B7TA 4GRWB 3FKUS 4NN5B 2Z7YA 5IT2H 1UFUA 1XF3A 3H9HB 1MCEA 4PG2A 5EZLB 4R26H 4WIQA 5FM8A 4D9RD 4D8PA 4F57H 4KRNA 1RZKL 5DRXB 5IQLA 4C55A 5ALCH 4MQ7A 3ISYA 1DYZA 3RWHB 1X9QA 4ZI8A 2R2CA 3DXAB 1JNJA 2RTTA 1J1OL 3T5WA 3SE6A 3J27A 4EKJA 4D9QE 3F84A 4LASH 4Y2OA 2RMNA 5CXPA 1UG9A 4OI7A 4HCGA 3U7YH 2VLKB 4FFWC 3KWVA 3CE1A 4YSTA 1L9TA 5KSVB 4G1EA 1OK0A 2WUBH 1UENA 4AYBA 3TEYA 1DEEB 1CYGA 1LHZA 2CR6A 3LRLA 2BOCB 4BFGA 3X11A 3ME0B 1FGVL 1BJ8A 4OLZH 4JPKL 5DD5L 2YEZB 3TX4A 3FT9A 4FE9A 5E2WL 2A9NL 3RRQA 2XX1A 4N0UB 4QRSB 3M8OL 2FO8A 1L5GA 1J7VR 1MFVA 4PLOB 2VERA 5JIIA 4LPCA 1IGML 1A6AA 1YMHB 5FA3A 3VCLB 4IBTA 1KLFB 4JG0H 2J2ZA 3REWB 5FWQA 3CVBA 5AW7B 1EAOA 1ND0A 1U2HA 5F0PB 1N5AB 1DQML 3ZE1F 2L3BA 4LIQH 3GQFA 3ILQD 3HZMB 1D7CA 3OXSB 1S7VA 1YJDL 1ZLSL 5G5DB 4MQ7B 3DVIA 1UJ3B 4R84A 3VFUB 3UJTH 1PYWA 4JG1L 5ILTL 3RDTB 5JIMA 1G94A 1BYOA 4TSAL 3CQFA 4WO4C 3KDMA 2DYPD 3ZTNL 5C7XH 2KI6A 4O2CA 1EZVY 2GK2A 3DGGB 5E2TL 2P4AB 4AE1A 4G1EB 2CWRA 1TQCC 4B95C 3VU1A 4WGVB 1TQCB 3X11B 5IUSA 4NBXB 3QH3B 4GINA 4LRIA 5KVGE 2BVQA 1L5GB 2BRRL 4TVUA 4MDIA 4NQDD 4M1GH 1XIWB 5AZUA 1ICTA 2Q86B 3RX7A 1TTBA 1A6AB 1INEL 5FA3B 5J6GA 5KBMA 3VFVA 4D8OA 2OSWA 5KSBA 1ZHKA 3QHZH 3S8WA 1T2QH 1ND0B 1TQBB 2WXHA 1D5XA 5AW6B 1J11A 2NNRA 1KLGA 3RX9A 2FEJA 2NY3D 1J0YA 1E65A 2HRHA 3AM8A 1IQWL 1LXMA 3EJPA 1HJBC 3TEUA 1DBJL 1MHPH 2GUOA 3PQYA 4J3OC 3CFBA 4EZLA 4HALA 1Q0YL 3T4AB 2DEWX 1YUHA 4Y4HA 4HLEA 2DQGH 4I2XB 5G4MA 1C1EH 3F6LA 4XC1L 4LF3B 4Y2LA 5HPOA 4P5MB 5GZOA 1LLAA 1SLXA 1WBYA 1MCPH 4Z7VF 1T5XA 1VCBC 5KSBE 2FGZA 2VLJD 4LRIC 1GPOH 1NMCC 4KX7A 4WHYG 2Z35A 4ODTL 4Y4FD 3CC1A 5D1XD 3UIYA 2BVQB 2QLYA 1CICA 2P49B 1V54B 3ARED 2J7LA 1P5VB 4Z3HA 3O2DL 5J6GB 3VFVB 2FAUA 2WVUA 3DUSA 3LMJL 1PY0A 2TAAA 1D5XB 4HIEA 3BT2H 4PS4H 3NQKA 2VIRA 5C0CD 2MPAL 3FHAA 1CBJA 4Q9QH 1TZGH 2GUOB 2DF3A 1S5HA 2R4RL 3PQYB 4K9EC 2GPZA 3CFBB 3HE7A 4Y4HC 5AYUH 3SE8H 3TEWA 2LAAA 1YUHB 4Y4HB 3KBFA 3ARFD 2R0WH 3IDMA 1HKLL 4A7UA 4X50A 2Q5BA 3OMNB 2RD0A 2CUMA 5KBNC 2BIPA 4WU7B 5GZOC 1NJ9A 3EADA 1TSHA 1L0QA 1MW2A 1K4CA 4TSBL 3WU1A 4NAQA 1ZLWH 2YJQA 1EO8L 3N42F 1TCMA 4ZMPA 3IJ8A 3IPBA 3L3IA 4P07A 2Z4QA 4GKLA 3T3MF 3HR5B 5C0NC 1DBBL 3N1FC 1LO2L 1CICC 4NS0A 2Z35B 2FX7L 3SN6N 5JOFA 1L6ZA 3OB0H 2LABA 2KQNA 2C9WA 4B50A 4DN4L 4LEEA 1E8ZA 3OZLA 4Z76A 4MQXD 2MKLC 4MXQC 1ZT4A 5DD3H 5E08H 4XVJL 4W9CC 3DUSB 4UT6A 5DYOA 4HIEB 2WQXA 4X6CA 2F5BL 2Y2TA 2VIRB 1KXQE 3VRLF 3QW9A 2DYRB 4ETQA 3HE7C 1OSPH 4OBSA 2WMPB 2W9EH 2HKFH 3V95A 3QNFA 2CR3A 1DCEA 2WQ8A 2YIHA 3LRGA 4JNXA 1OCWL 5HYSA 4G6AD 5E4AA 4HOMA 4WK4B 3IDMB 1FFQA 4AUUA 4ZS6D 1MJ7L 1AZRA 1WV7T 2NX5D 1F00I 5INCA 4JO2H 1F1AA 2WXOA 4M4PA 1V7ML 1NJ9B 1W6LA 1M42A 2I5YH 3BAEH 5IQNA 1CQYA 3JXAA 1MI5A 3X1FA 1VB9A 1EDYA 3CFKA 4YHML 1OLLA 2Z4QB 4HH9A 4J4PD 1UACH 5DDHA 5B3JF 1XH1A 2K4WA 3CN1A 1OZUA 1AHWA 2J73A 3EJYD 4EZJA 1B0GB 4ADGA 5DJAA 2KPNA 4X6CE 5C3IA 4NKOA 1I1FA 4YDKL 4Z76B 4LCIH 3EYVA 3MBED 5A6MA 4N2EA 2RIKA 2WXMA 4YDIH 4I9WD 3MPCA 1T83A 5IHZB 5EORL 5DUMH 4X6CB 3PL6D 3U30C 3ARVA 3RU8L 1E4KC 3LJ3A 4ETQB 4JLRB 2WANA 4WEUD 5D1QB 1EPFA 2NLJA 1TYRA 1ONQA 3BDBA 4PS3A 4OQTA 4L1LA 3QGVA 3OAYK 4NFDA 1Z0NA 4GRLB 4GPVA 3HG0A 3V9CA 1NFDA 3PDDA 1NAMA 3APNA 4D0DB 5BOPA 1E8XA 1F6FB 1MI5B 4G8IA 2AJZB 3CFKB 3ARYA 4MA7H 3UMTA 4GIAA 4HH9B 1AHWC 1FP5A 5DDHB 1RUQH 2CMRL 3MLYH 4G9FB 3GLAA 4I18A 1OV8A 4YHLL 3CFMA 5HBBA 3GFUA 5DJAB 5LGHH 2FQEA 5I8KL 1P1ZA 2VDKB 1RZQA 2C9PA 5IJKC 4NKOB 1DN0A 4MJ6B 1SXZA 3EYVB 5JIDA 4Y4KA 1J9CT 1GZHA 1T83C 4GLRI 4JG5A 3L2LA 2IWKA 4GG6A 5JHDD 1FL3A 1BFTA 3W56A 2IG2L 2ZOWA 4M7LL 2CDGA 1M6OA 2D4FA 2H3XC 3ZSSA 3QISA 1NFDE 1FBIL 3AT9A 2J21A 5FV1L 1ONQB 2QPEB 4GNKB 2HYMA 4ODVL 2YLKA 2KC0A 1YN7B 5ISZD 5BRPA 1IJNA 3QG7H 1F1GA 5KTEL 1U3NA 3PP3K 5JHMA 1EEZA 1H15A 4ZS7L 2IAAC 1NAMB 2E9BA 4YHKH 2VRAA 2ZPKL 1E4HA 4I18C 4BHUI 1KN4H 3O8XD 5F7MC 2RBLA 1I8AA 2MTPA 5AOJA 1QA9A 1T1YA 4GG6E 4XMLH 3L5XL 4XP4H 4YHOL 5GS0D 4JHBA 2X1WL 5L7XL 1BLNA 2P80A 1P1ZB 3RKPA 2NY1B 1DFXA 1DN0B 4Y4KC 1ET5A 2Y7NA 2ZCKH 4A7GF 1J5DA 2CDEA 1IEAA 4O02H 1PG7H 2LTQB 5AOIA 5GRYA 3SPCA 1IARB 4GUOA 4JFQA 12E8L 2DWDB 1UM5L 2OMXA 1F4XH 1FL3B 5H37H 4GI6A 1E6JL 5GS1A 1H3PH 1UQSA 2CDGB 1M6OB 3ABGA 4NQEA 2W07B 4KK5D 1F58L 2RH0A 3QIWA 3MGTB 2EIDA 1W72B 1SHWA 2BIQA 2QTEA 3TBYB 5DCCA 4XOCA 1G1OA 2NT0A 2PUQT 2EP6A 5JO5A 2IPUG 4W9DC 3CHPA 4HJ0D 3V0JA 1EEZB 4HUWA 4IRSA 3GI9H 4QRAA 4AYGA 3MOQA 4S1DD 3OJDB 2X9ZA 3ALXA 3FN0H 3B34A 4M8VA 3D0AA 2BSDA 2BH0A 5JHAA 1CUOA 1Q0EA 1LGVA 3JVFC 1QA9B 1T1YB 5JIQA 1PY9A 2BDNL 1KUMA 2N7SA 4OLVH 5T5FL 3IXAA 1U95B 3FT4A 5C0FB 4BKTC 5L9DH 4PTUA 4YBLB 3B5HA 4XHJC 4DEPB 4JFQB 3WOVA 4AIZB 1URLA 1DDTA 2OMXB 3AACA 4PB0L 3T0EA 1M05B 1MF2L 2M83A 5GS1B 3D7PA 4OZHE 3B2UD 4TUUA 4MCYA 3VGHA 3NJHA 1NDMA 2Q0ZX 1UQSB 4NQEB 2YC1B 5LG6A 1DQVA 1J5CA 3QIWB 4W68A 2YBRB 3FU3A 1HINL 5DZJA 4W4NA 4L2LA 3V9FA 5D1ZD 4F7CA 5B8CA 3CDYA 5DJ2A 4IRSC 3QUMH 2J5LC 4F93B 2J5LB 4JMNA 5TE7H 1JZ8A 2VQTA 4PRDA 2YPVL 2XWRA 1G9NH 2YXFA 1CO1A 3DGCR 3T71A 5LJYH 3WEAA 1CDUA 3ZE0B 3GBDA 1I8KA 3OV6A 4OLEA 4Y0GA 1BF8A 3FT4B 5DMKA 4MCNA 3ZT6A 4PTUB 2OULB 2X0UA 2NY2C 1EHXA 5CJOH 3DVGA 1N70A 5DFVC 3F7LA 4XNMA 3F7VA 3LXBA 1JFHA 4BZ2H 3V0FA 4EQ2A 3T0EB 5EBMA 2AAAA 2X3BA 5C09B 3HRZC 4U6VH 1NDMB 3LTVA 2NSXA 3PP4L 3SKNA 3WIIH 3X3FL 2HWZL 5E2VL 3AXHA 2XN9A 5K9OA 2VR4A 3M45A 1W2KT 3QZWG 5AL0A 1RUML 1CIDA 3HBZA 4EIZC 4DGIL 5B8CC 4Q0XL 3F7KA 2VMDA 1IAMA 1JPGB 3F58L 4JFFD 2IV9A 3MOAL 3G04A 3I84A 4FABH 4U1IA 1T7XA 1PY4A 1FNEB 4AIOA 1U4FA 3F12B 4OZIF 2Y7OA 3S35L 1JGUH 5DEFA 4P2CG 4PRDB 3I2CL 1A4JA 2FK9A 3HG3A 4MBRA 3GEWB 2R2EA 1GKEA 1I8KB 1MPAH 3WUWA 1F1DA 4F7TA 2ITCA 3IGFA 4MS6A 4FQ1H 3HAEA 1MW1A 4AT6B 3H2QA 4XB7A 3KPNB 1OWRM 2KQMA 4KTDH 1SF5A 3WFBL 2CJUL 4XNMB 1TIUA 1OAUH 3F7VB 3FSZA 3GSQA 2XA8L 4FNQA 1AIZA 5EBMB 3FU5A 5JQ6H 2CLRA 1LJMA 3DX6B 3L4UA 3MNZA 4L4VA 2DQJL 4TNEA 2YAHA 1MFDH 4L0PB 3FO9A 4FXTA 3SKNB 3GC3A 1TVHA 2XN9B 5I0VA 1ACZA 4JZJB 1J8HD 1ZT1A 2BNRA 5HYQB 1JPEA 2V2WA 1SM3L 4J6IA 1FAIL 4DKFH 3ISRA 4XNZB 3V4PL 3N04A 3ARPA 3G04B 1Q9LA 2R39A 3Q1EA 2CRZA 3NCJL 4S1SH 5CJQH 5CKAA 2Z8SA 2UUDH 1PZUB 2DLTA 3M1BB 5DEFB 4F9LA 1A4JB 2FVNA 1F02I 1W0YT 4QTIL 3VFNB 1WIUA 2R2EB 3DK2A 2FQDA 3WUWB 2ITCB 3N9GL 3K3QA 3DJ9A 1OSZA 4R4FH 4DKAA 1KCLA 1DVXA 5E5MB 3C5XA 1A65A 4GW5B 2BNRE 3BE1H 3HB3C 3GSQB 3V0WL 3D2TA 2CLRB 1AI1H 1UEMA 1QTPA 4U6HA 4L4VB 5FPIA 1S7XA 3FO9B 3M1OA 4GBXB 1WFIA 1TVHB 3U46B 3T04D 3LNGA 1ZT1B 2MCG1 2KT6A 2NXZC 1IFGA 2GBVA 2WW8A 4WK2B 5G2NA 4HCRL 1KIUA 2NXZB 4U1HA 2DL9A 1P84K 3G6JF 1NFIB 4KRMB 4X6BA 3DA0A 3GSNH 2CE6A 1P4IL 3ZKND 15C8L 2O5YH 1LK3L 4Y2DD 4PG9A 4F9LC 4PHZA 3QHFL 4IKKA 3S36H 1RK7A 2BS9A 2UXFA 2UXTA 3B9EA 4KVCH 1V10A 4PV9B 1AO7A 4PJIA 1ID5I 2GSIA 1IEBA 4LLYB 4AV0A 3AMLA 1X3DA 5DHYA 1GCFA 2DYSB 4R5VA 1LNUA 1SYSB 1CK0H 1UWXK 4NN6B 4CC1A 3WN5B 2NXYC 1U93A 3MLWL 2YD6A 3C6SB 3HMXA 4X4XA 4WCYH 3ECQA 4F7PB 4OLXH 2WYHA 4Q2ZB 3MUZ1 4XPGH 1RULL 3EFFA 1LEGA 2G9HA 2QL1A 5D7SH 1F18A 1UOLA 4Y1TA 4A63A 5IVOA 1GOFA 3APDA 1WEJH 3B8YA 3OC8A 4R5TA 5LAXA 2RAMA 3CVIL 4EIUA 1XD1A 5KYYA 4TPRH 4YHYC 1KIUB 5I6MA 4O4YH 1JDDA 4X6BB 1DSFL 1S5IH 4B0MM 3QDMA 4FQIH 5H8DA 3D1MC 4W9IC 1A6ZA 2AVFA 2AEIT 3QQ9C 2BY0A 1A7QL 2CHNA 4PG9B 3WJLA 4F91B 4YGVA 1GYCA 4RISH 1I7UB 2ZOUA 3HFMH 3KLAA 1F4WH 3C60C 3QQXA 1U58B 1KNOA 3EHBC 1JJUA 1AO7B 2Y5EA 2R56H 4PJIB 2FTAA 2FYYA 2W5PA 1QFWH 2CHWA 3F01A 2HRLA 1LNUB 5E9DA 3AGVA 4OJDH 1U6AH 1U93B 3QXWA 1I9EA 3SCMD 2W92A 5KJRL 4X4XB 3C5ZA 2EXWC 1R1CA 1LEIB 2R15A 2WAHA 4MX7B 4NZUL 1TVBA 3IJYB 3TBCA 2N1KA 2ZKYA 1LEGB 3WY2A 2UVFA 3D6GA 3VYPA 3JVGA 4NKDA 1WITA 1RKRA 2Y3AA 2CLZA 4ELMF 4QPEA 4B3VA 1ASOA 5LAXB 2I07B 4HBCL 2DQEH 4ODUB 2XLLA 3FQTA 1MIEH 3FXIC 3SDAA 5KYYB 1U91A 2OXGA 5JLZA 3FB8A 3ILPA 4P04A 3NVQA 1DBKH 4HZAA 2RR3A 3QDMB 4NUJA 1RZJC 3LRMA 3WJLC 1A6ZB 3CCHA 3ZO9A 5E9DE 3EJCA 4HJGA 4G59C 4C4BA 4D3CH 1NCDH 4GMSH 2XTJB 3FAXA 4QRPE 5EC1B 5AW3B 2FYYB 3UDWA 4OV6F 5JW5A 3L3OA 3C5ZC 1QOKA 4JEGB 1ZVNA 3FTYA 1N8OE 1P1VA 4ANWA 1FYTE 5IWLA 2IO5A 3ZT5A 1CGUA 2BXZA 2XOTA 1JZDC 1TVBB 3IVKA 1PLGL 3SDDA 1IC5H 5EZOL 4N2KA 4LLMA 4E41A 2BZ7A 2SEBA 4NKDB 1A3RH 3PNWA 4NKQB 4JG9A 2CLZB 4OZGB 4PJFB 5DR5H 1A4BA 4FOMA 3VQ2C 3FQTB 1JZIA 5KVEE 3SDAB 2KS0A 2OXGB 1A3LL 1D2PA 1U91B 3O4OB 5FKPB 5HJ3A 3SOTA 4HAFA 3K6OA 4JY5H 4NUJB 1HX0A 2ENJA 3ESMA 4IJTA 2PF6A 5EHFA 5FYKD 5EZJB 1SEBB 4X7SL 3TBWB 2NCMA 3NTCL 3UJJL 3VD4A 1S4IA 2JB5H 5LNEA 1WA1X 3UDWC 1AGFA 4RVBA 2Q76A 1QWUA 5C2UB 3L3OC 3O3DA 2BZCA 1NCUA 3TJEH 3WLWD 3RKDC 5JW5B 1JGVL 3L3OB 4E41E 1LE5B 5IWLC 3CXFA 1CGXA 1KTCA 1PU0A 3OLDA 2QKIA 1I9JH 2EYTB 4DFIA 3OLEA 2P24B 5IB2A 4Z7UE 5EOQL 4L8SA 4NYLA 3R7QA 3A4FA 4ZRGA 4FFYH 1I8IB 3SDDC 2C1PA 4UQCA 4PLNC 1K3IA 3SDDB 2IPKA 4LLMB 2F1EA 1C16B 1ZPLA 4UTCA 5KYWA 5DA0B 5DUBB 2XQBL 4LQFL 5KJ4A 5IM7A 1HWGB 2ODHA 2P5WA 4P9HL 5HVGB 2EDYA 1NCHA 5F9JA 1QG3A 3TA4D 1BAFL 3UPAA 2DTML 4MQSB 3RJOA 4G8GA 5JZ7D 2BP8A 5L2KA 3B2VL 1FDLH 2CXGA 5LDUA 1NCIA 4NRXA 5D72L 4KZEL 4IIQA 4PV8B 2NR6A 4CA4A 1SQ2N 1BPVA 3VYNA 4KJPC 1AGFB 2XY1A 1YEDB 2Q76B 3N0PB 3O3DB 3UADA 2VZSA 2F53D 2FWLB 1WAAE 5MEPB 2QKIC 4JGUA 4FXKA 3V6ZA 3BGFB 1IBDA 1GMIA 4XVTL 5IB2B 4M7KH 2Z8RA 4L8SB 4NYLB 4WY7H 2NY7H 4IGBD 4YDLB 1A1MA 5TDPB 2C1PB 3DHPA 5I19H 3APCA 3SGDH 3OL2A 2WIMA 2G0LA 2V33A 4J3XA 4G8GE 1GL4B 4K3DL 3HG1B 4C57C 4UDTB 3I50L 4F1SA 5IM7B 4HSCX 5JORB 2P5WB 3CN2A 3G5ZA 5AENA 4BUHA 4QEGA 4EN3A 4K7FB 2IQ9H 2HX9A 5F9JB 1SLWA 1I3GH 4AGLA 1REIA 2YD9A 2BP8B 5L2KB 1OD7A 2FHBA 3PGFH 4IIQC 5CCJA 2Z7UA 4IHBA 1AE6H 2OR7A 4FCAA 4NM4L 5EG6C 4GXUN 1QACA 1H3WM 4ZO8A 3MJ6A 4BM7A 3LQZA 1PQZA 4PVBA 4WJKB 2JIXB 4FXKB 3V6ZB 1FNGB 3LXAA 5HGHA 3GJEA 4K23H 1E5YA 5D7EA 4NQCB 3VMPA 2GTWA 2HRPH 3O3EA 3WD5L 4E9TA 2IPTL 5DT1H 2CM6A 1A1MB 1K4DA 1OZTG 4PJCE 1W91A 2EXSA 3KVDD 4K94C 2WLNA 1JTOA 3BN9C 3BJ91 1E9PB 1N10A 3EH3B 5MHSD 3GK8L 1BF2A 3QCUL 1C08A 3FTVA 4IDJH 1DQQA 1HHJB 3G5WA 5F70A 4BQBA 3VGAC 4TULL 4AEHH 3DPDA 2K78A 5DD0L 3OMZA 1NLBH 3L7EB 4EN3B 2QVMA 4LPVA 3US0A 2GIYA 4XN7A 3NEXA 5D8JH 4Q7DA 2ARJQ 3BPOC 4EUPG 3SO3C 4OGYL 3TNNA 5IW3A 1CE1H 1WICA 1FIGH 3BQVA 2E7BA 1G9MH 1UVQB 2AQ3A 3SO3B 3WLBB 4LSVL 3NFSH 1MIML 2B0SH 1QQDA 2E56A 2K45A 4MA8H 2NW3A 1FZOA 1C5DA 4BCYA 1CGTA 2RJMA 4V33A 4ZFGH 2BLFA 4X5XA 4M48H 4QLRA 1AOZA 5HGHB 3GJEB 5BV7H 1DO5A 4JY6B 3HS9A 3O3EB 5JOPE 1BYNA 2KDGA 4DOHE 2ZNXA 4LHJB 5DJ8A 3RZCD 2I60L 1K4DB 4ODXA 4WI4A 5IROA 2K6WA 1LM8V 4ISVB 4O2FA 3GIZH 2NQDA 1L6PA 2JELL 4I0PD 4H8WC 3GSVA 1KXTA 5AZEL 2PPCA 1C08B 5TQ2L 3HS8A 4E9VA 1ETJA 1XCTA 5FO8A 5IQ7H 3CHQA 1NM9A 2CLVB 3ZLQC 4WK0B 3OJMB 2AHIA 1U3ZA 3I6LD 4H0IA 4P2OD 5FWRA 2NY6D 1L9RA 2IBBA 5T3ZD 4I88A 2VLMD 3CFUA 4QYAA 1E4JA 4XZUA 2Z8VC 5KVFH 3TNNB 4NHCL 3RFZA 1AD0A 3DYPA 4YJZL 2XX0A 4DQOL 5D7IE 3D0LA 3IDXH 1FZOB 1NKGA 4XODA 1L9NA 1C5DB 4Z78B 1NOLA 1XH2A 4K8RL 4OJCA 3PWLA 4X5XB 5DA4A 4J5VA 2F5AH 3IMVA 1BHGA 3QZOA 4AGNA 2QQLH 2BP5M 3SPHA 2H0FA 2L8AA 3OKMB 4ZMOA 4L1BA 5EO9A 3OHMB 5IROC 3HUJA 4IRJD 3ABZA 2D7TL 5DJ8B 1T04A 5IMLB 4ODXB 5G55A 2D7QA 4G6KH 4TRPH 4QRRB 4XGZA 5F7DA 3GKWL 1SMOA 4L48A 3ATEA 1ZHNA 1ZANL 4IJ3B 2IQAA 1QFUH 2MOVA 1A0QH 1IAOA 3GSVB 5PAZA 2Q20A 5CJBA 1XXFC 3RIFF 2DKSA 5FUZH 4EI6A 2ZSWA 1XCTB 5FO8B 4ODSL 1CPUA 1HI6A 1OE2A 3LCYA 5IQ9A 5CZVL 4U1JB 4PJ8D 4B60A 2AI0H 1J10A 3RFZC 3DV4A 4XZUB 2JMRA 3RFZB 5ESQB 2H32B 4WHTB 4TUKL 3P4OA 3V2AR 3FUIA 4Q52A 5AVZB 4KQ0A 3HUJE 2B1AH 1ZEAL 3HCVA 5ESAA 2NZ1A 2Y3NA 5HVHC 3MODH 4P5RA 3FH5A 3CHRA 2DMGA 2H0EA 3PWLB 4RAUA 5JUEL 4XBGB 4WVRA 2ZXQA 5AWNH 3QJSB 4N85A 5KVDH 2YPLA 5EO9B 1GGYA 4PMFA 1QBLL 2DI9A 4X8XA 1QW9A 4WHYH 4FQCL 1T04B 1DANT 3OPUA 3RNQB 1JCVA 4XGZB 1NBCA 5F7DB 1A1OA 3B2DC 2ZSVA 3FQYA 1ZHNB 4XMUA 2IQAB 5F9AC 1LMKA 4OB5H 1UEYA 5DO2C 3QZLA 5I5JA 3PNRB 2F54A 5CINL 1HI6B 4BFBD 5LDSA 5D71H 3TIDA 2H1XA 1WFUA 2ATKA 5IQ9B 3E9UA 2ZCZA 3ECWA 2UZXB 3NRPA 4WTZG 2CKBA 1GGTA 4G7VH 4OJFH 4BA0A 4G42A 1LE9A 1YMMA 1I1AA 5DC0A 1FFNB 1FNSL 4HS3A 3V4LA 5GHWH 3NJKA 1G9EA 2N0MA 3HS0B 2Z4TA 2XQYG 3UERA 2I7OA 4JFVA 5I0DA 2YPLE 3A67L 3KPOB 5IHBA 5J57B 4LL4A 1KC5L 1F41A 1IAKA 2AAVA 2JKXA 25C8L 5ESAB 1LO4H 1ZVYA 3SDXA 1KN2L 2F8VA 3EUDA 1JZ5A 4LVNC 3T6QC 1QSED 1ZSHA 3TFKD 3II3A 3HNTH 4OGZA 4X4MA 4W81A 1FVCA 4NOFA 4XT1C 4JHWL 5CZRA 5EPMA 4BIKA 4DUVA 4QAWA 3T6XA 1A1OB 2ZSVB 1U8KB 1YYCA 4FADA 4DPBX 4Y16D 3QK0A 3U36A 5EIIG 3PIQA 3TA3D 1YMME 2CK0H 3DSFH 5HYJE 2FX9H 5AUMA 3NEEA 4JDTH 4QKTA 3K80A 2F54B 2AC0A 4XCEA 4NC2B 5F1NA 2ATKB 3IKCA 3BUPA 2FGWH 1I1AC 4P46C 4XMPH 2CKBB 4HC1H 3PABA 4G42B 1LE9B 1I1AB 1ILUA 1KV3A 2XWXA 1F4YH 3FUJA 4HS3B 5AAPA 3SDXE 3OMAB 2IMMA 1QWNA 3QJRB 4M5YL 2WQWA 3UO8B 3MCKB 4H25A 1OPOA 3VXNA 5AZ2L 4Z1PA 4PVLA 4UV4H 1SLUA 5BVJA 4X4ME 4OLYH 3VI4A 2KKQA 5LN4A 1H3VA 3P11L 4MMXB 1E9QA 3B5TA 3B2XA 1FGNL 1MXGA 5JR1H 3O0RL 3TH2T 7FABH 5LWYL 5F0JB 1TVDA 1FVCB 5KANI 1A02N 3LQMA 3QJVB 4LCWD 3GRWL 4KU1A 3U36B 3M6DA 3PIQB 3FCBA 2IGFL 2IGTA 3VAEA 5AUMB 2EIMB 4ZUUB 3RWIA 4YFDB 4GFXA 4GAGH 3DC0A 3TT3L 4XCEB 1ZT7A 4I13B 4UM9A 1C5CL 5JXED 3W39A 4R7NB 2F1BA 3MVSA 1Z9SA 3VI4E 4FXGA 2F7OA 3IPEA 1BG9A 1L9PA 2I9LB 2D31B 1UD3A 2I27N 2IBZX 3KWWA 4DGVH 1F90H 3VXNB 4FLRA 4R4ND 5IBUB 2B2XH 2CGRL 2Z7ZA 3SE4A 1DSWA 3KEDA 1T0NA 3TFBA 5BVJB 5T1JA 4Z7OE 4FL4C 2ZUVA 5FYJH 3UTSD 1E9QB 3LS5H 5E6SB 1N12A 5GS3A 6FABH 5BRZE 5B39A 2ZKXA 2YAPA 1QR1B 1KIQA 5B3SB 3SQBB 3LKSB 3RGVA 2F08A 4UU9A 3GUFA 1JD7A 1O5PA 32C2B 1YEIL 2GHWB 2ZJSL 2ZWSA 3Q01A 4IOFD 4KMLB 2KDYA 4DUXA 4RQQA 1BXAA 1MWAH 1G7JA 3O6ML 2Q3AA 2APFA 3VI3E 2NZ9D 2CNYA 4TSCL 5I74C 3BEVA 3UABA 1A7OH 4FXGC 3I74A 4IMKA 5HGBA 4D2NA 2AJVL 3MJ9H 4FXGB 2OI9C 3X3GL 4M7LT 2OMVA 5C92A 5JW4R 4OCSL 3MRQB 3MGOA 2OI9B 3ZE0F 1RH8A 3FO0H 3UTZA 2OZNA 3KWWB 2APTA 3SE4C 1NGXB 1QLRB 4ZX6A 1WPCA 3BYYA 3K91A 5LQBL 1OAQL 4K71B 3N50A 1T0NB 1A7RL 3QUKB 5F6IB 1ML0A 2VDRH 4ZBJA 3WYRA 2A0LD 1OGAD 3GSOA 3BZFA 3ARBD 3LEYL 1L4IA 2QADC 1R33A 4KROB 4YEFA 1FE8L 1BG1A 5CEYB 4EOWH 4MB1A 3RGVC 4HIXH 3KXFD 3DBXA 3F7YA 2ZUWA 2GW5A 1O6SA 4UU9B 3DOSA 3OKDA 2QGDA 5J6SA 4O02A 2YRBA 4FX5A 1QBBA 4RGNE 4MDRA 3VRIA 1QRNA 4GAYA 5E0FA 5H37A 3VXSD 5BS0A 1GTFA 1WC7A 1FFPB 5GS0L 1NC4A 4PQXA 1HL9A 3ZX1A 2XXFA 4JO1L 4XWGH 5KW9L 3D9AH 1HNGA 3AS3A 4IMKC 1Q0XL 3IE9A 5HGBB 1C5BH 4NOBA 3QI9B 2OMVB 1VADA 4G9DB 4ZUTA 4QKXB 4OIAA 3UTZB 4XVUD 4K07A 2CO1A 3G6DL 4JR9H 3LXCA 1E6OL 5I5RA 1DQIA 4MS8D 3MO1A 1MCIA 3BZFB 3WIHH 5FO2A 3MTXA 4JJHA 2G75B 4WKXA 1JYWA 3G9VA 5IOPB 2WQVA 2WQAA 5BS0E 1MFUA 5I6LA 3OF6D 4L9LC 3F7YB 4BSVB 3IAGC 4H0LC 1O6SB 4PW9A 1G4RA 3OKDB 1BOGB 3ULUE 1JSYA 1PBYA 1A6WL 1CF8H 1EUTA 1I82A 3SBRA 1QFPA 3VRIB 5I75C 1UB5B 1JYVA 1QRNB 3HE6D 1QHQA 3OR6A 4GAYB 3MYZA 2XXGA 1IM3A 4JZOB 4ZAKA 3ZTJG 5I75B 1DLFH 5DD5H 2JH2A 5E2WH 3ULUC 2A9NH 3SPGA 4FD0A 3I3BA 5FCUL 3F7RA 2QGBA 3ARWA 3BXNB 4BQ6A 1OPGH 3QYNA 2WUCH 4BCZA 5ANME 3BUYA 4KKAD 2A77H 4XVOA 1T6WA 3JZYA 1CG9A 1DQMH 1X5JA 3NH7H 5C0EA 1DQDH 2WOYA 4TUJA 3T65A 2O61B 3QUMA 1IM9B 3S34L 1ZLSH 4IHOA 1QRKA 4IK6A 1NA8A 3U7WH 4GQRA 4KBPA 4AL8H 1N8ZB 2BS71 3MO1B 3FNKA 4BSWB 1SN5A 4IKIA 4ONFL 2P8PA 5TH2A 5CD5C 3I85A 1RHFA 1ADQH 3KNBB 4FQLL 1IKNA 5IY5B 4NJAL 4BKSC 3R1GL 3HFFA 4H26A 1MFNA 1HSAA 2FD6H 3QG6B 3VG9B 5LVEA 3GTVA 3ZVVA 1QP1A 3R19A 4WF7A 2FLBT 1UOWA 4OCXH 1M53A 1N6UA 4BZ2A 1CXIA 4UI2A 4ZAKB 5MP6L 1EGJL 1QUNB 5DF0A 3QIBD 3VXRA 1EAJA 3HG2A 5I26A 2O5XL 1IBYA 1L7IL 4Z5RA 4AG4H 5FGRA 2R9HC 2NDGA 1CIUA 1INEH 1H8NA 1S7WA 4M6AA 3B3IB 2ICES 4L8DB 4LDOB 2Z9TA 1A14H 1TJIH 3BUYB 2R7EA 4N0CD 3L3JA 3UEQA 1M7IB 2PWHA 1CG9B 4P3CL 5EU5A 5C0EB 2EEAA 1DZ0A 4B5EA 4TUJB 4WNQA 2WZ5A 4GUCA 3C75A 3T65B 1CLCA 4HWNA 4KNSA 5JXAL 3F6JA 3ZKMC 1DBJH 2DD8L 1NBZB 3CLEH 3NA9L 5FYLL 1G9NC 1JVOA 4ZX5A 4FP8H 2FH6A 2L7EA 1WQVT 1KYDA 4WWKC 3T4YA 3TBTA 3O6FA 1IKNC 1YEWA 2P8PB 5TH2B 3KGUA 2CKNA 5JIKA 3LB6C 3VXRE 1ZD6A 4H26B 4MNGA 4QOKA 4XC1H 1HSAB 3CVDA 4KKCD 1RZ8A 3DTXB 3VFGL 4Z77B 4C56A 3UC0H 4JFOB 4WSGA 3HIZA 1JNLL 2FSEB 2MQGA 2B1OA 3FK3A 5EF1A 4X6EA 1P5UA 3NEOA 1S7WB 2R8SH 4L2YA 1QW8A 3KPRB 2H41A 2R7EB 2CCWA 2XWDA 3UXFA 1MFCH 3CDFA 3QUXA 5EU5B 1J88A 4PJIF 3H7BB 3MR9A 2NW2A 1NGZB 4WNQB 5DJZA 4ZOAA 4L4TA 5L8LB 2ZOLB 4ECNA 4W4OA 4QOKE 3PUUA 3EYFB 4ENEC 4KOCA 3ZYJA 4AJWA 2BHYA 1GCYA 3T4YB 2JJVA 2FLRT 3O6FB 5EOCL 2BO0A 4YPJA 4C56E 4XN4A 1KIRA 3Q8AA 2DI7A 1DVFD 4I77L 3L1OH 4MNGB 1TQVA 3GRBA 1CXKA 2KZBA 3SGEH 4AYMC 3IYLW 3QPQC 5KZCB 5BRQA 5TJWK 3FFOA 1UM4H 4G2AA 3KD4A 3SOBL 1DJIA 1TFHA 1TNNA 1X5GA 3IS0X 2BW5A 3ZNGA 5HI4D 4PJBA 3WS3B 1YDPA 2DQIL 5LXVA 1GTNA 1ZV9A 5GSVA 5SWZD 4Y19B 4KI5F 3BSZA 2MMXA 2LW3A 3MLXL 3D2UD 4G43A 2RGSA 2YGPA 1F6LL 1P5UC 3OPZL 1KB3A 4L4TE 4YFLF 2AQRA 4X6EB 4MYWB 2XWJA 5ID1A 3GEFA 3V52H 1MLCA 2YAOA 3QUXC 3FU7A 4KXZI 5A16A 4OCLC 5GGTL 3EGDB 4XP1L 2BJMH 3JBG7 3GSNA 2IH9A 2XV6B 4JUTA 2NW2B 4ZFOA 4R96B 2HVBA 4D9QD 5I71C 4ZFZA 1F8TL 3D4CA 1QX1A 3Q3GA 3L9RB 3MLVL 2QPUA 5M95B 3VFRB 5LUMA 1NAKL 5D5MB 4OIFA 1U3HC 3M7OA 3ZW3A 4J28A 3ROOB 1ECYA 2YXWA 3GXNA 1F3DH 3BYTA 4PHXA 1PX3A 4PJBE 5CM1A 4PRAA 4KUZH 4KXAA 2EE2A 2BFVL 3REVB 4LHUA 1DSYA 1T03H 3PGDA 4OZGF 4PJFF 1L9OA 1FZMA 3L1EA 3EXLA 1AS6A 2MQCA 4YHMH 3LEVH 5LG1A 4PJBB 4KQ4L 3RTQD 4CJ1A 4HXAL 1LO5B 2DKUA 1LYQA 4GP4B 4KDTA 4G80A 3MNDA 4G43B 5I6PA 3LRSB 1DBML 3SJVA 3S5LA 1EIBA 1MLCB 2UWEB 4WO4D 2V2TA 5A16B 4OSUL 1F2XK 4PJ6A 4G7YH 2A9DA 4ZFOB 4PRPE 5KUMA 4IBSA 4I3GA 3CZFB 2MCPL 3Q3GB 4XHQA 1IILE 1G1YA 1VGKA 5IG7B 4WQOA 5MERA 2Y1VA 3H9SD 5IVXA 1T80A 4LVEA 1EFQA 2G2RB 4G5ZH 3P77B 3WELA 5I1DA 1MREL 1K6QL 2VN6A 3N6YA 4PS8A 3SJVE 1FZMB 4CVXA 2R1YB 4LARL 4J3OG 2A38A 3CFQA 2ZT9C 5GIRA 2J4WL 4KDTC 1VEMA 3DSNB 4JRLA 1AVAA 4YHLH 5L6YL 4G80B 4HIPA 4CADA 5KYXA 2YA0A 1GGBL 4F7EA 2GIMA 3PWPE 4AX3A 1LP9E 4Q56A 5F7WC 3ZZLA 1IIIA 4ORZC 3L54A 5ALBH 1I9RH 1JHTA 1M57B 3FT3B 1G7QB 4K7PY 3LIZL 4GMTH 4U3CA 2Y1ZA 1CGSH 1TFPA 1VGKB 4JO4L 3SDCA 3VH8B 4BXSV 2R69L 3VTMA 2PR4H 5MERB 1U92A 1TU2A 5IVXB 5FO7A 5CWSA 2AVGA 2UX6A 5I1DB 5KTEH 2BSBA 2DJMA 2XACC 3ZYOA 1DJGA 4R83A 4ESKA 3DJTA 4FFZH 1IBGL 1WH0A 1DFBL 4CVXB 3MTRA 1PZAA 5HGAA 2VZVA 5ICXA 1FFTB 4NWUH 1CVRA 4ZODA 5GIRB 4AM0Q 2NY4B 1NBVL 2XFXB 2DM7A 1ZS2A 4EZMA 1SOQA 3GHEH 4KH9A 1B4JL 1RLBA 4ZD3L 5JDJA 3GRGA 4A6YH 5KYXB 4HQQH 4E9RA 4JRXB 5L7XH 3C2AL 1WTGT 4I3SL 4TTDC 3TBBA 1XF1A 2FEEL 5HYEA 3QJFA 1JG9A 3QJHA 4R90L 4WEEA 5E24E 3FBKA 4DN3L 1INQB 4POYA 5F1OB 2C9AA 3FH7A 3PXLA 5DFAA 4TV3A 2Y24A 2Y0SA 1JHTB 3KYOB 3UAJA 3PFQA 3SDCC 3MLPA 4ZPVA 1SUJA 1H3UA 5K39A 4HU2A 4N9GB 4OZFH 3OKLA 3NZUA 1HXYA 5I73C 3EYOA 5CZXC 3FQ1A 2WIIB 5CWSB 5FO7B 5F7KC 5I73B 4Y5YA 3DETD 1TSRA 1T7YA 1KG0A 2WNXA 3Q8CA 3LKOB 1EWHA 1WAEA 3QO0A 3TYGH 5HGAB 4GKSA 2P7TB 1D5ZA 5EBLA 4FFYA 4UIKH 3ARUA 3L1GA 1TT6A 1NCJA 3ASOB 3L5WA 4QT5A 2VM4A 3TOPA 3JV4A 5I1JL 1X4YA 4KMQA 2OTUA 1K8IB 5IEHA 4WFEE 4MGXA 2VDOH 3IMRA 4KAQH 3QJFB 2X7LA 2X1XR 5HHXH 1CDHA 4NI3A 1GR7A 1UM6H 3UGEA 1R5IA 4C59B 2EDRA 3VD7A 4PB0H 3UAJC 3OGCA 3CGTA 1MF2H 2EDMA 3FTWA 4BE5A 2B3RA 5J11C 5JW4Q 1OL0A 3HBGA 2LLNA 4I1NB 5J11B 5EDXA 5K39B 1CDGA 3MNWA 4WTQA 1AKJD 5T1DH 4YDMA 4OH2A 3MV7E 4BK8A 3CK0H 2VT0A 1U42A 4LSPH 3MSPA 4Y5YB 3QORA 1X6NA 1A2YB 2X6BA 1YYLL 3OKOA 5ETUB 1BWMA 3WI9A 3HNSL 3KYKL 4NNYB 4GKSB 2V9QA 1D5ZB 3QZMA 4MRBA 5HYSG 1HCFX 2P8MB 3TJHC 1DEDA 4G7RB 4LPXA 4ZO7A 3L5WB 2C5DC 3JV4B 2OTUB 4ZT1A 5GQBA 2HT4D 1N68A 5B7MA 5L4IA 3QEGL 1U30A 4OD2A 5HI5C 3BSHA 3KM2A 3BEWA 1TZHA 4FMKA 5CCGE 2X7LB 2AXJA 2JCCA 3LZFL 4F8QA 4L37A 4B9CA 2APSA 1HJCA 1PGRB 3II2A 4GP8B 2A6IA 2V17H 3OGCB 5IB1A 2WQSA 1UT9A 1GJWA 1YEKL 4AEIH 4YNYB 3AQYA 5L2JA 2AGJL 3JWDH 1KTKE 2OR8A 5FC9A 3MNWB 5KS9A 1MSPA 1U36A 2BY2A 3HN5A 5F7EH 5D9SA 1MG3C 4I8DA 1AGCA 1EQWA 2ATPA 1OO2A 2FZ3A 2ZYHA 3JT0A 3QORC 4K15A 4U1SB 1OAZH 1SQMA 2BX5A 1FI8C 5T33H 1P6AB 2WTOA 2ZUYA 1MFMA 3MOAH 2G5UA 2E76C 3OKOB 3NJGA 2XUWA 3LNDA 1AY1H 2VN3A 3BGMB 4LRNL 4QRTA 3HKZA 2DY2A 4D9LL 2JCCE 4KJWC 3VW3H 2BMKB 5BMFH 1SBSH 4O9HL 4AW4A 1MUJA 1ZJBA 1NC2D 1ERNA 2ICEB 4KO7A 3ZGIA 1S9VA 2BOBA 4OD2B 1Q72H 1ITBB 1ZGLA 1TZHB 4BQCA 2UY7A 2WLMA 5KS9E 3U48A 5D2NA 4D0BA 1TUPA 3WHE0 1BQLH 2ZONA 2OZ4H 1PKQB 3GMMA 2VXUL 2A6IB 2AJSH 1AD9A 3P9LA 4HIIA 4RMVA 1MOEA 3BKYH 3O4LB 5AVWB 1OWWA 1A6UL 5D9SB 4IEFA 4JO3L 2JSFA 4BELD 1SM3H 1AGCB 2ATPB 4U3SA 2D3VA 4UM8B 4EUPH 1ZTXL 4Y4KD 2ED8A 2WO4A 1FIEA 4AJVA 2FHFA 1KTDB 3FB7B 2VDMH 3V4VH 1T7WA 3UJIL 1P7QD 4XPAH 1OGTA 4GI9A 3I9GH 4QRTB 1IBFA 2E6JA 2VDLL 2VXQH 4TXVB 3ZDXE 5IW1B 4HV8B 5HHMB 1TYEB 3L5HA 2A6KA 2UZIH 2R0LL 4EBQH 2J8UA 2WVTA 1B2YA 4ZNCD 1S9VB 1XZ0A 1S7UA 1MCBA 3WE6A 1ZGLB 4D0CA 1H3TA 1KGXA 1NLDH 1JHLH 2VR8A 4M6OL 2CU9A 3UTTD 5MEOA 4LSSL 5D2NB 4D0BB 1YEJL 2XWTA 4UQIM 1N18A 4QJ4B 3HG5A 1AKPA 1YY8B 3WXVH 2HJKA 3MV8E 3FQXB 3ARDD 1JGEA 4MKTA 1CE6A 5T3XL 2X05A 3D3VE 1AD9B 1R3JA 1SJVA 4HIIB 2B7DT 3QCTL 4RDQG 1UWFA 4W70A 3U9UA 4NKIH 5T3ZH 1YEFH 1G9MC 3NCEB 1VF5C 4QXUH 3W2DH 1Q94B 1ASPA 1BXXA 4BK5A 4OCRL 5LCVH 1JV2B 4LO9A 3MXVL 3UBXI 1MHEB 4JRWA 2WBJB 4JRYE 2D8KA 4XPHH 1O5DT 5BV7C 4XHJD 1BFVH 4K5PA 4DSYA 1LK3H 1T0OA 1D5IL 2IH1A 4RAVB 3C5SA 1L9MA 4NQDA 3DRTB 5DJ6A 1HL5A 1UD8A 1OAKL 3KG5A 4GOSA 4GB9A 5BJTA 5B1KA 2WZ0A 2J8UB 2WZ6A 3ILQC 1NMAL 3GXTA 4U1GB 2VKWA 4MKMA 3WE6B 4D0CB 4XXCA 5MEOB 3NIDE 1JXDA 2XWTB 2A83A 2XN1A 4F9PC 4KNQA 1NGWA 1TPXB 2HJKB 1ITCA 2VKXA 1MQKL 2IFGA 3L3DB 4QHNB 2Y7QA 1R3JB 1XZWA 1TJGH 3U9UB 1H8LA 2J6EL 1DJSA 3WNKA 2DYPB 2ZCLH 3CVHL 4BK5C 1Z9LA 3FQ4A 4K5LA 2J6WA 1LWHA 4Q6IB 1QKZH 5EEUA 1E4WL 3CXDH 4NQDE 4OF0A 3ATAA 4JQIH 3BKJL 1KTBA 3JWNH 35C8L 2NY2D 1DSFH 4PJ7B 5I30L 2Z31C 5DFVD 4CU7A 3TBSA 4JAMA 1Y6NR 2ALWA 4Y4FA 5D1XA 2QZ5A 5E9NA 3BSGA 1WZMA 2IH1B 3LZNA 2B77A 4OUUA 2F74A 1EAQA 4NQDB 5IFAL 2Y36L 3AREA 1G5AA 2PKDA 4YUEL 5DJ6B 4YXHL 5DS2A 5FW7A 5BJTB 3OKNA 4S11A 2VSKB 5E2JA 4LLDA 1K85A 5I17A 2YRZA 4KI1A 2NY3B 3FCUB 3GXFA 3HRPA 1GRWA 2BP0A 3UGXA 4JCLA 2IADB 3HJ0A 1NGWB 3MRIB 2MOQA 1IC7L 1WWCA 4MDJA 3BLKA 5AD0A 2DLFH 4WJ5A 4YDNA 3ARFA 3RA7H 3WEMA 2AABH 3OB8A 4JHUA 4YWGL 3KAAA 4UYQA 3E0GA 1DVSA 1H0DA 4LCUB 3WUZA 1N26A 6CGTA 5FAAA 1WS8A 3VXUE 1N67A 4PCSA 1DJXA 1HXKA 1HHIB 1QWHA 2GJRA 2XJLA 4Y4FC 5D1XC 2VLJB 3U1PA 1NANH 1OAXL 4NB7A 4JAMB 5B38A 5D1XB 3ZU8A 1ZRUA 3C6EA 3E2HC 2F74B 2EUVA 2CO6A 1JI2A 3AREB 3ZZQA 2PYEE 4AWJC 1IT9H 3NPZB 3TYFA 4G6ML 4EKXA 3OKNB 4XI5D 1WIPA 1CT8A 2LFGA 4LKXB 3LQAL 3H42L 5I17B 4IBUA 4G8EA 2SODB 4UINL 1OGSA 4ZMYA 2F8XC 2BP0B 3CX5J 5C0CB 3K6SA 2AQSA 4XCFL 2YFNA 3OQ3B 1CJYA 3J2PA 5FO9A 4JCMA 3SE9L 3T0AA 5E6IB 5IMKA 4MDJB 5C0RH 5AD0B 2F2HA 4WJ5B 4OKVB 2HFGL 3ARFB 2NNAA 1AZNA 2TSBA 1UOKA 3HAEG 3DJRA 2YRPA 1H0DB 1EFXB 3VFWA 1H5BA 4XB3A 4B9YA 5ID0A 3G5VA 2QSTA 5MENA 3JT2A 4UMSA 2AF2A 1T89A 5KANG 4J4PA 3ULVH 5FHBL 1HIMH 3HLAA 1AP2A 3HB3D 4JFTA 2XDHA 4YBQD 4G5AA 3ZL4L 4MQXC 1X9LA 4P4KC 4YSEA 4OFIA 2ZOTA 3GHBL 3VNZA 1JZ4A 4WKZB 5JDSA 1CT8B 4H1LH 1GW0A 4ILDA 3RUGA 3VXOA 1JGVH 4G8EB 1PD6A 3E8UL 3F7PC 4K2UL 3W38A 2XBZA 3PL6A 2VDNL 4PGEB 3FO1B 3SBQA 4KX8A 3SYOA 4NIKB 3MBXH 1SLVA 2W88A 5IMKB 1GYUA 3WBDA 5MENE 4ZS6C 1MFAH 3SPVB 4C8XA 1OARH 4ABQA 2JTYA 1VFBA 2NX5B 5GISL 4HFUH 3VFWB 3PHAA 4YSCA 1H5BB 5ID0B 5JTWA 2YKLH 3NYKA 1T89C 2NXYD 1IE4A 2YO3A 3D06A 5GPRA 1BZDA 5E7FA 1TCRB 1GHFH 1GGCL 4PWKA 3B9DA 3RUGE 1EBPA 3NK4A 4YBHA 4XPFL 2YGNA 4WSKA 4YK4B 4NRZB 2V3DA 3OKEA 4AK1A 2CIIA 4L5FL 2MRYA 1PZDA 4BFKA 3MBEB 4F2MA 2ZKWA 1BBJA 5JDSB 5JHDA 1YC7A 2FQGA 1RMFL 1MWAA 3U82B 1GAFL 2J1WA 4KGJA 3ATDA 4WDIA 1YG9A 4TLKA 4PJEA 1BZ7B 5I15H 2APXA 3PL6B 4NP9A 1VERA 3CWGA 3HKFA 2QTVA 2EDBA 4N0YH 1INDL 3VXPA 4M1CC 2XPYA 4XWOD 3MJ9A 4NGHH 3NSCA 1OXYA 4HJJH 5FYJE 1GC1C 2A99A 3C60D 5ISZA 3N43B 5I1LA 5A43C 1UASA 2EVFA 3EHBD 3P30L 3S9DB 3NESA 1DBAH 2GK0A 1UT1A 3RAJL 2V7HB 1JMZA 1FNLA 1XR9A 1YQVH 1E3FA 1BZQK 3KCPA 3SEPA 5HJGA 4F2ME 3O8XA 1NCAH 4HIHB 1JUFA 1KPRA 2HAZA 3IPFA 1FNAA 5AVTB 2JNZA 3TCLA 3MLZL 4PJEE 3WNOA 2F1AA 2FWUA 1KYOJ 3GXMA 3DKHA 1HXMB 4U6YA 3WFCH 3BP5B 3NFNA 3VGFA 2ZF9A 2VZ3A 5EB9A 4X7FC 5JHDB 5DQDH 4NEHB 1MRFH 3DECA 4XCCL 1MWAB 3QQDA 4TQEH 5ISZE 2DQDH 2RQ8A 4PJEB 3MBWB 1MCNA 5HHVL 3ZOAA 4DNLA 1OOAA 4G70B 3A5VA 1J1PL 8CGTA 4HF5H 4QLWA 2LQRA 4JPWH 3N55A 2D7PA 3VXPB 3GB7B 2R29H 1U0QA 3LVTA 5I1LB 4HX1A 3GK8H 3DX0A 2X42A 1WZLA 2WB7A 4XAWL 2P8LA 4A1RA 1QFWI 2X89D 4UYPA 3V6OA 4KJQC 5IV2A 4HEME 3C5ZD 2F0CA 5C0GA 3VSTA 3O8XC 5J7CC 3ML8A 4I48B 3DMMD 2VMJA 1I8LC 4QRPD 1HOCA 3WIHA 1QHPA 1G7IB 3O8XB 4K73A 3U9WA 1A5FL 4ORGA 1JUFB 1KPRB 3KWTA 3UL4A 4ES9A 2WKOA 4NENA 3UO1H 1R24A 1FYTD 1PG7W 2ZXDA 3B4NA 5E8NA 2YR3A 4XVSL 1RU9L 4LLAA 5C2BH 1PDKB 3QQDB 3EJRA 4KK5C 3GM0A 4OZ4B 3OZ9L 3HLKA 4BZ1L 2EH7H 4URKA 1PD0A 1HZHL 3FQUA 3QNXA 2TRHA 3V6OE 3SKUD 1TTGA 4ZTPH 3RVVD 1XDTT 4IDLA 4XMVA 2EDFA 1S7RA 4PJXE 3KVPA 4HJ0C 1R6VA 4HX1B 4X5WA 5D1ZA 5IMOA 5JW3L 3OQRA 5HHOE 3V6OC 5TQ2H 4G1MA 2P8LB 4S1DC 3RKDD 1ZS8A 2BCMA 1NCCH 5IV2B 5F44A 2WXRA 3INOA 4M61B 3T8MA 1AZZC 1HOCB 3IJHA 4F20A 3P0GB 1M3JA 4ORGB 4X80L 2OMZB 4RFOH 3STLB 1ADQA 1I7RA 4E41D 4ZMTA 4HJSA 1V8HA 4NHCH 3L95B 4NENB 4ZUVA 5A2JH 2VTFA 1ZVSA 2XWBB 2AXFB 4MBOA 5E8NB 4YHPB 3WIFA 2F9BT 3IU3A 2X4RA 3TNMB 4OAWA 3GPSA 5BCAA 4A55A 4RSYA 5E5UB 3O2VL 4E9WA 4LAQH 4WAFA 1D9KB 2E0PA 1NBQA 2H47C 1YZZA 4WI7A 4F92B 5I6XC 5IJCC 5F88A 2EUZA 2QELA 3IAPA 2D7TH 3A6CL 5IW6A 3FT0A 4GUPA 5D1ZC 4N3TA 5D5MF 2CHDA 1UXSA 2NPLX 1S7RB 5D1ZB 4FTVD 2YEVB 4X5WB 1ORQA 9CGTA 2A9MH 5JYMA 1CXLA 4GQ9L 4KJPD 4JFFA 5F96H 5EUKB 4GIOA 3RI5F 1PW3A 4AL8C 3AWFA 5BO0D 4X0KB 3LHPH 3HZVB 2XVKA 3VA2C 4YX2L 3TESA 2BK8A 3DDFA 3ZY7A 1U4EA 5TPWL 4KUCD 1XD0A 1A7NL 5ECJE 4G6JH 3IJHB 4JVPA 2VC2L 2FE0A 1NEZG 3FU0A 3CH1B 3L7FA 3FSWA 2R83A 1TQTA 1I7RB 1OCOB 4DAGL 4GS7C 1AXTH 3GD1C 1MCQA 1ZVSB 4GS7B 3VM5A 2AXHA 3M46A 3O3AA 1E5AA 2LV4A 3LN4A 2UWEF 4Z0BL 4ONHA 3GINA 3SPJA 3IU3B 2X4RB 2J88H 3IU4H 4OAWB 3OXRA 2D9QB 3B7YA 3ZDZE 2BVYA 4G8GD 3MA9H 1JD9A 1IL1A 4JFFE 3UYRL 1G7MB 1LQSR 2BSRA 2ZUSA 3AS1A 1QBLH 3KPPB 4WNJA 5E1QA 1J8HA 2DM4A 5IW6B 4GUPB 1UXSB 3WSQH 3PWJA 3QZWB 1ORQB 4FHJA 5A7EA 3WDJA 1QD0A 1IAIH 4HYTB 5JNYB 4PRNA 1CB4A 5CINH 1KF9B 3LZPA 2CDFA 4PJGE 5DFWH 2Y1YA 3K2MC 1SPDA 5HI3D 3OAZH 2WWKO 4YQXH 2C3GA 2QQNH 3I9PA 4MHHI 4BKLB 3L7FB 3B43A 1Z66A 4E9XA 1FNSH 3NGBC 2XG5B 2VJ8A 3V5DA 1FH5L 5ICUA 3SGDI 3MFFB 4LSQH 3UPRA 1UXWB 2GAZA 3FUEA 3ESPA 3RQ3A 2FT8A 2YFOA 3QUYD 5I16A 3HC2A 25C8H 1I3VA 3T3PB 4M43L 4E5XA 2IFFL 4UTAL 3ZRFC 4NQTA 4WLCA 3VG0H 3B9AA 1XGPA 2BSRB 4YMPA 4TLSA 4L1SA 4GT0A 2X4UB 2W65A 3PLYA 1J8HB 5L88L 1KJMA 1SVZA 4QXGL 3WO4C 4JFYA 3V0AC 3GSXA 3OAUH 2ZXWB 2WXKA 5IVXF 2HKHH 2VWEE 1YNLH 4YR6A 1EXGA 3ZKJA 3SDYL 1F13A 4NUGH 5F3BB 2C3XA 1FL5B 2D73A 4GEIA 5DURD 2ED6A 1HDMB 1DJZA 1MJUL 4PRNB 2VWEC 2FBRA 2CDFB 5TE6H 3L4YA 4XNUL 5D70L 5FF6B 5C71A 8FABA 5IZ7A 1LO3L 5F3HB 4R4BB 4UT7L 3RWDB 4ZNEE 1CR9L 5FEBA 4LOUD 3NJLA 1CBVH 3UPRB 5GGRA 5JOPD 1N0LB 5E6RB 2B9BA 2YOCA 4WO0A 5FDYA 1QNZL 3ESVF 2Y2WA 5I16B 4OQ1A 3V7AE 1COBA 5E6YA 5CEZL 5LBSL 5GJTL 1JXFA 3COOA 4KK9C 4BDVA 4DO4A 4N8CL 2B15A 5I1IH 1AGBA 3RL1A 4YHZL 2W65B 3QDHA 2GB2A 1JGLL 1BVZA 1CFSB 4OM1L 1MCKA 1N64H 5CGMA 1ES0A 4O5LH 5AALA 3ZKNC 4YR6B 3AUWB 5I1HH 3GS7A 4P2QE 5KSUA 2A5UA 4Y2DB 2GJZB 4OD1L 3FMGL 3K6DA 2GT9A 5EMYA 3Q1SH 1IGFH 1PSKH 3SO5A 2EINB 3FOLB 5IIEA 8FABB 1U8LB 1CLYL 2NTFA 3LZOA 5SX4H 2YSTA 4NDMA 4Q74A 3QA3A 4GW4A 3S3CB 1Y07A 1KJ3L 1IX2A 1G4MA 5KVGH 3SCMA 2KLSA 4X83A 4X9FA 3R8QA 3H0TA 5GXBB 4H8HA 1TZAA 4JVWA 5DRWA 4LEBA 3IMBA 1DVQA 5I66A 1I7TA 1TKWA 3INUL 3CQPA 5LGJA 2PP8A 1DTUA 1VJSA 1BLIA 1WHPA 5BVPL 1AH1A 2DQ6A 4Q4IA 3MRPB 4ZXBB 3RLSA 2XTLA 2CG9X 2CO3A 2DDQH 3HPJA 4DP4X 2PPAA 1HN1A 5I1EL 1ES0B 4JM2A 4UNTA 4E0RA 3F00A 2OP4H 3ZKXC 4NSKA 4WTWA 4WW2B 4EPSA 5KSUB 1CFMA 2X4QA 3BH9B 3WAKA 4Y5XA 3H4FA 1OT4A 1BW8A 5IB4B 1QSFE 1XAUA 5IIEB 2VCOA 1CFVH 5DUPL 2AJVH 3X1EA 4RGMC 4NDMB 1GSKA 1M4KA 1J1XL 3SCMC 1CLOH 4JDEB 3L3KA 1T5WA 3MJGX 3GBNL 1GY2A 2JKTM 4FFZA 1FUNA 4LVOB 5DS1A 3SCMB 1OAQH 5DO2D 3QULB 1A7RH 4XN8A 3D4ZA 1W16A 1DO6A 2O5NA 4LP8A 5A2AA 1G87A 5I66B 1I7TB 1TKWB 2CJTA 3VFOB 3NACL 4A6YA 3ZYZA 1AZVA 3S4SG 5LGJB 4KVNL 4MA1C 4KKZA 2QJDA 1TJXA 4ZYKA 3MLSH 1X7QA 4K3GA 5BW7A 5C0AD 2ZWKA 5K59E 4JM2C 4YAQA 1T0MA 3BX7C 4XP6L 5I0ZA 1BIIA 1KPVA 4E0RB 3RPIA 3CZLA 1UKQA 2QSQA 3GMLA 5FB8A 3K71B 1SF3A 4BD4A 4FJ6A 3K8MA 4K9EL 3WIAA 4A7VA 2CHZA 1NQBA 4HS8H 4QXTA 2X4QB 4Y5XC 5ACMA 4Z7WF 1SJMA 4OZFA 1ZOXA 3BAXA 4JFZL 5JMOC 2GSGA 2DMCA 3JTTA 3O2WL 1UWEL 1AQDA 3ZQ9A 1X6LA 4GSDH 2VRQA 4PD4K 1F5WA 1VCAA 2Q6WB 3GLZA 1KBGH 2A1WL 1U8HA 2N7AA 4MASA 2CQVA 2VB5A 3GIVA 3GBMH 2DM2A 2BPBA 1MAML 1XCWA 3K46A 4M3HA 3UAEA 2WBWB 5F2FA 4OCWL 4QAMB 1IMHC 1SDDB 5IFJA 2E6QA 2RALA 3P9MB 2XG4A 4UAOB 1HE7A 1RUPL 4P46D 4YHNB 3NJIA 5HYJD 2YMOA 4ZYKB 5BW7C 4F7MA 1ZDSA 5I76A 2ZAIA 2Q87A 4F3FA 3OR7A 5BUGA 1PZ2A 1TXKA 4JHZA 3TZVC 4JM4H 4KVPA 1XGYL 5AOKA 1T0MB 1F11A 3TN0B 3PPSA 3STZB 3ZMRA 1ZLUK 2OFQA 4DK6A 1KPVB 3B9KC 3GMLB 4MSWB 1RZ7L 5GS2D 1JS4A 1P2CA 5DLML 1M2OA 3EOYG 2QVKA 1OANA 4QXTB 3TC9A 2OYPA 4GSQA 3VFTA 1BVKA 1CGVA 3TIEA 4FFVD 4PBVC 4G8AC 1MVYA 4NN7B 2F18A 2YQGA 3WLWC 4A2EA 2F53A 1TTRA 1W80A 1U8HB 3GSUA 5IEKB 1U9KA 2VL4A 5FLUA 5L0QC 1IEHA 4L8CA 4IGBA 4BH8B 3IDIA 3QAZB 5IFJB 3NBNA 1HEZA 4HOZA 4ZUWA 4ZJ9A 2A6JA 1JPTH 3LH9A 4UT6L 1IO4C 3I02A 3QIUD 4F7MB 5I76B 2VDOB 1PCXA 4POUB 4F3FB 3OR7B 1P6WA 5DJCA 2O4EA 4ZMQA 4N2HA 4H2AA 4X4YA 3QYMA 5DS8A 1F11B 5HDBE 2Y1AA 4JM0A 2F15A 3MJ8A 2Y9RT 1XGRA 3G5XA 3QXUA 2D2CC 5LBGA 5TTRA 1GJUA 2F53E 1PZ5A 2B9AA 3FCGA 5IGXH 1IGYA 1OP4A 4PJ5B 4AVHA 2WWMD 2O5XH 4P59L 3GZOA 2ZE0A 3TIEB 3L17A 4WFFE 4HPHA 5AKSA 4LOFA 1BQRA 3CDGA 4X6DF 3EO9L 1ULVA 2F53B 3H6AA 3GHPA 5CUSL 4XNAA 5BRZD 5C08B 1HSBA 2J8UF 1N4XH 3FRUA 4JGHA 2EILB 4KHXH 4POZD 5CSGA 1VACA 1Z1WA 2H2SC 5FYLH 4IGBC 3QVAA 2IAND 5KSAB 2PABA 3UG5A 4UM9D 2VDKL 3NSJA 4XC3L 4EE2A 1QPXA 1Y18B 2GUYA 4J3TA 5T1LD 4X0NA 4YXLH 2IVFC 2AW2A 2TRYA 2A6JB 5EZPA 3I02B 3TJPA 5HD8D 3GLEA 4AJ0A 3EJJX 4KKPA 5J9PA 4AOFA 2I25N 4X4YB 5DWUH 2PCXA 5DS8B 1EHLL 4PWIA 2OZ4A 5B39G 3HN8A 4GG8A 5K9QI 1GIGH 1BCIA 2COQA 3KJ4C 4G3YH 3CD4A 4P0DA 4PJ7F 1OSYA 4LVHC 1PZ5B 3KJ4B 4OQTL 5GGQL 2ZXAA 5EWIL 1RZFL 1D3CA 4X4KA 4Q4EA 4L8BA 4EUPA 5F7YC 1OM3L 1NAML 4AMKH 3CFTA 4G11A 3BKCL 2DM3A 4DIXA 3J7HA 1XVSA 2AZUA 4F15B 3FRUB 5A2CA 3V4VA 1U8PA 1VACB 2BVEA 5E1HB 3S8GB 4QYOA 4XBEL 3RTLA 2VXQA 1PD1A 1EK3A 3AQDA 3VQ1C 3RZCA 4RGND 1EEYA 4P57B 1CLVA 1UA6L 1HTYA 4BZYA 3AJ7A 5J89A 4LSUH 5E5RB 4I0PA 5B4MC 4I77H 2OMYA 5DVPA 1RFDL 3HOGA 2G3MA 4HA1A 3QPKA 5C9JA 3RURA 1A4KB 2ZP9A 2MKWA 2YQ3A 1JRHI 4HAKA 1XSKA 4IMLB 4YL9A 4M9PA 3IJEA 4LSDA 4P2OA 4GG8B 4J6RH 4W9GC 4QNPF 1OTSD 1WTLA 2DN7A 2APWA 3WMPA 5EEYA 1LO0L 3MLXH 3ES6A 3UBXG 5I8OH 1TETL 4UOZA 3OPZH 4PJHB 1QFHA 4J3UA 2VDLB 3HC0A 3SYPA 3UYPB 1H6TA 5D93B 4EUPB 4MJHA 4PBXA 5LCVA 1ZJAA 2Y7MA 3P4LA 3APFA 4UNUA 1A6VL 1GGIH 4PRHA 2EC9U 5FK9A 5BS0D 4ADIA 1F8TH 3V4VB 4YDJA 4DPCX 2ZCHL 4EJ1C 4QYOB 1X5IA 3ULUD 4DF9A 1VZGA 3BZEA 1NEUA 3MCLL 5H35A 2XU9A 1CFQA 3RZCB 5HHQA 4N26A 1EEYB 4H0GA 2PWEA 4NPKA 2YPKB 3I6LE 4XH2A 3AU1A 4NERA 2OQJA 4I0PB 5SWSE 5IB5A 4EF3A 3IFPA 3KYNB 2Z8WC 5T3ZE 3OX8B 1P4BH 3LKRA 4AIEA 5C9JB 2NCEA 1A3ZA 3VFPA 2JJSC 4ZMWA 3U2SB 4P2OC 2NY6C 2QDWA 3QPXL 2HLFC 4FQJL 4DKEL 3GDBA 1E5CA 4Z7NE 4MB3A 4P2OB 4XMTA 1E8YA 2NY6B 1WWAX 3AG1B 4NNXA 3QJQB 4HXAH 4PJ8A 2DMBA 4PRHE 2FIKA 1BGXL 2JTDA 2L7QA 2E4FA 4AQ8A 3DX3A 2B59A 1UXMA 1CL7H 1L0PA 1Y1DA 5EF2A 3U1SH 1TMCB 1PVHA 3EBIA 3TPUB 4X7TA 4JQIA 5GSRB 3VWKB 4PB9L 4PCYA 4UILL 5AG9A 2DBLH 5FK9B 1FC2D 2WNGA 3RDTD 1RK1B 4C58B 3FTUA 5C0BA 3GXPA 2VW4A 2KZ1B 2NRDA 4UOJA 4S0HA 2QGCA 1BM3H 4IRJB 3BZEB 1VEPA 5H35B 1CFQB 5TFSH 5HHQB 1VENA 5JA9A 1BZEA 1VEOA 4QIRA 5EUOA 3QRGH 4IBWA 3OMIB 2R9HD 4XH2B 1FLRH 3AU1B 2ZD0A 2OQJB 3IFPB 3CVHB 3LKRB 4MNQE 4G8FB 2AEOA 2XRAL 4JKWA 3ZKMD 1DN2A 1HYRC 1EZVX 4PJ8B 3JWNE 1GMEA 4K5OA 3PDGA 5KBKA 5L6YH 3D48R 3WKML 2EJ1A 4M03A 4WWKD 4YIQA 2YAEA 4AQ8C 5IHUL 3GO1H 4WTZA 3VTAA 2LVEA 3OHXA 3QQ4B 1ZXKA 1BJMA 3MROA 5C0BE 3LB6D 3JWNC 5D2LF 5DHVH 4ANVA 5JHLH 5F1IA 4PRBB 3WXWL 3NCMA 5JPNA 3O81A 2C7FA 5DXWA 2XQYA 4JN1H 2NTSP 5EUOE 1USQA 2UV3A 2CCLA 3VXRD 4Z0XA 1BBDL 3S3SA 1EZSA 1QSEA 1B90A 5GZNC 1N0XL 1UWYA 3BUQA 3Q9PA 1XF5B 5M94B 1QBML 1U2YA 1FH2A 3L8QA 3E80A 4OGXH 3SHSA 3WTXA 2FDBP 1VHPA 3W0WD 3N43F 3DK0A 5AOMA 2P44B 3GNMH 1QTYT 3L2NA 4JFDB 1S3KL 2E8YA 2UXGA 1IBGH 5EIIA 4KGLA 3C6LB 2A74C 1J9RA 3O6LH 3OAWA 2Q8AL 3VSVA 3SD5A 1R46A 1UJTA 4M8QA 3SBPA 2E7DA 5F7NC 4YSQA 2LHAA 1BQKA 4P3WA 3OHXC 1ZLWK 3MX0A 1KJVB 4FMFA 4M5ZL 3QS3A 3OHXB 1IV8A 3VO0A 5DGRA 5A2LH 3V0GA 1BEYH 4LCCA 4P5TC 4WHCA 5JPNC 1TZIB 3NAAL 3EJTA 5F1IB 4F7KA 1M2VB 3CMOL 5JPNB 2YGOA 3OB0K 1BDYA 1KGCD 2CIKB 5AQ0A 4DKDC 1KCVH 1Y6MR 3NIFE 1KB9J 3HN3A 3D39D 4C56D 2HXAA 4Y7OC 3UZQB 3IRZA 1I7ZA 3TFKC 4Z0XB 3U9PL 1QSEB 3DYMA 4RNRA 4JFSA 1RY7B 4B97A 2RACA 2XZCH 2Y06L 1EZUA 2C3HA 2PLTA 3LEXB 4FKEA 3HI5L 3IS1X 4LGPB 4WZ9A 4XN1A 3SIKA 3D25A 4DQAA 1WF5A 2V9UA 4UZSA 1AFVH 4H1LA 4PJAE 4LCWA 4Y16B 3MRMA 3QUXD 2VABA 1KCBA 1UZ8A 3TA3B 2EIKB 4L4TD 5CSZA 3VMNA 2EVGA 5EIIB 2IH3A 5IKCA 3ECVA 2GHZA 4DGYH 1XF4A 3MRBA 3QRFM 4IU2A 4YE4H 3TEZA 4M8QB 1X9UA 3DBSA 3VWJC 2QMJA 2ERJC 5IF0A 3ULVE 1U3HD 2Z0BA 2DWEA 2OK0H 3LZQA 3W9EA 2H1PL 1KLUA 3MX0B 3PJSB 4TL4A 1BAGA 4BGLA 1FVEA 5BXFA 4LCCB 4RETB 1U2CA 1IKFL 3D87B 3ULVC 1Y7VA 3NPSB 3SGEI 4XTRC 4CAGA 2ADFH 3UTQB 3UTSA 2E47A 3DI2B 2GC4C 1F97A 2C9UA 2IWFA 2MTAA 2WLHA 5DRZB 1AR1B 4WUUE 5HGDB 1RL1A 3EOBB 4F58H 4QD2E 4L29B 1V7NH 1X9RA 2GG1A 4XO9A 2EKJA 2P26A 2DJSA 4LCWB 2I85A 3MRMB 2VABB 4LP4A 1SJEB 1H9VA 4MMYA 4OM0L 5CSZB 4TTGA 3BC9A 1TITA 2IH3B 2AXGB 2P1YA 4ZOEA 5IKCB 2CA4A 2XSKA 1XF4B 4Q9CA 5CP3H 5INDB 2R0KL 3OTTA 2PMZA 1M1XB 2JF1A 4I3RH 2YWYA 1OAJA 2WWOA 3GBLA 5IF0B 4PRPD 6PCYA 2DWEB 1DL7H 4LHUG 3UTSE 3W9EB 3DNKA 4QDGA 1KLUB 5E51A 3ZUNC 2XV0A 3S48A 3VM7A 4S2SA 2WKOF 1N7ML 4BHUA 3D85D 4GKZA 1I85A 2DQHH 3B9VA 3IRCA 4LSTH 4MAZA 5CLZA 1KJ2H 5AVXB 2CO4A 4ANXA 1OGAA 3M17A 2QKSA 3ARBA 1EVUA 1VGEL 3PGCB 3I6SA 1S7QA 3S5LG 2O6FA 1MFBL 3T6WA 5C6TH 2HX7A 3KXFA 2CALA 3M86A 4JJOA 1GJIA 2KBGA 3SJVD 1JZ3A 3A6BH 4OT1H 3HMXL 4IOFC 2YK1H 1M71A 3CC5A 3UBHA 3CFJA 4Z8FL 5DYFA 4XCYB 4FZ8L 4UQ2A 1YAIA 2HFFB 1JNNL 5AW9B 3VXSA 1KMGA 4M6ML 4UV7H 2JKWA 3DX7A 3IFLL 4ERSH 3K0WA 3S3PA 4BWTA 4AYFB 3PWPD 2AXWA 3UCQA 4KV5E 3K2UL 4LSRH 1R3HA 3IETA 1Q9WA 2YEQA 3MUHL 3CBKB 3W57A 4HWEL 4GRMA 2GI0A 2R29A 4JKPH 5CR8A 1UADC 5EZIL 3GTTA 5DVMA 1AXIB 1PS3A 2XV2A 3LSOA 1WUNT 2W9LA 2YD7A 3BP4B 3FUNA 3BRGC 2NY0D 1KGWA 3KPMA 2EE9A 4AKQA 2YMXH 3P3UA 4NZTH 1D6VL 3IDGA 1RZJL 3O41B 1CDJA 3T0VA 1LDPH 3AY2A 2FCBA 2Y7LA 5DWPA 1OGAB 2XA3A 3ARBB 1JGDA 3CZJA 4HXBL 4LU5L 2X4NA 1IQDA 2ITDB 1T0PB 3LH2L 3QEHA 5DRNB 3VXSE 1CU4H 3VX0A 3BCFA 2HX8A 1HEHC 3OF6A 3AB0C 2QLVB 3BD4A 3KXFB 3S88L 4W6YB 4LKCA 3BPLC 5DQ9A 1M56B 2G60L 2WZAA 2DKMA 1BZ9A 4AENA 2GFBB 5CCKL 2I26N 3HMWH 3RVXD 3CC5B 4K5MA 4YZFE 1Z3GL 3CFJB 3WFEL 3HE6A 4O58H 1XB6A 3DX7B 3RWFA 5HDLA 3DRQA 4QRQA 3SKJH 5HTSA 3UAAA 4RGOH 1R3HB 1J0IA 1Q9WB 1NCBH 3SDCD 4KOBA 4RMUA 5LO7A 1JP5A 2QQKL 1ODAA 2XZAH 5I1AA 1LK2A 3BVVA 4S1QL 5CLXA 2WP3T 2D3LA 3AC0A 5CZXD 1HH9A 1EVTC 1XTMA 2OJZL 4HKBA 2JK5B 4E42A 2FB4L 1E2VA 5J13C 1SXBA 3Q48A 2LU4A 3QWOA 2BVPA 5LN8A 5B3NA 3FQNB 1UD5A 1Q9OA 4BBWA 5T3XH 5DJ0A 2FWSA 2F7PA 5MI0B 3HW7A 3T3PF 4J1UB 1LWJA 3P69A 5HDQL 3LS4L 2VM3A 1CXEA 4X9YA 5E4OA 3LVEA 3N44B 4QXVA 2X2UA 2FJSA 5DQ9B 5A7BA 3H7LA 4HUCA 2V37A 1RJYA 2YZ8A 4JL2A 4AENB 3BHBA 4KXBA 3HE6C 4IOIA 1EHKB 2CA3A 4KXCA 3PJLA 4JRFA 4PJDA 1T1XA 3PHQA 3QIBA 1T21A 3RWFB 3DRQB 5IFHL 4QRQB 3BFWA 5IMMA 4RLDA 1YPZB 1FA4A 2R23A 1JV5A 3K6IA 1AG6A 5CHNA 3CZSA 2MIZA 5I1AB 5D7LE 3AXLB 3ZTCC 1KPUB 2AEPH 4U1KA 4L05A 4FCHA 2PTTB 4HKBB 4P23D 3QE5A 1AQHA 1WZ1H 2HLEB 3QWOB 2BVPB 3EFDH 5DSCA 4R7VA 3MV7D 1J8SA 1FORH 4GEJA 5DJ0B 1VZHA 2AJYL 2V5TA 3QXDA 4L23A 5FUOL 4XCNA 3F5WA 2WLYA 4HWBH 2VGLM 4P05A 5AOLA 4WEBH 2P5PA 2GJJA 3C08H 2FUQA 3QO1B 1JL8A 2Y22A 4Z7QE 3EYUL 1M9SA 1RJYB 3K1DA 2VXSL 1AACA 3J8F7 4ZSOA 1ESOA 5HI5D 5DK0B 2RCSH 1VPOH 4GO9A 4IOIB 3R0NA 1WJ3A 2ZICA 5GGSB 3QIBC 1KTLB 2W9DH 2JV6A 4PJDB 1T1XB 3PHQB 2P28B 3QIBB 3F7QA 1T21B 3TO2A 4DVBA 3BDYL 3WGVB 3EDKA 4Z7QB 5T1MA 5IMMB 2FX8H 2E59A 1OQOA 5IR1A 1G0DA 1BOYA 4TMPA 5IUCA 1MW0A 2B8OT 3BVTA 2X6VA 4N0CC 5CHNB 4UTBH 5A2BA 3GZQA 1WYJA 2QHLA 2QT6A 2LAGB 3U83A 4EVNA 3NJMA 2NSQA 2V4LA 3NJFA 3WFHA 4UNVA 1KEGH 5C09D 1R5WA 4MHHG 4ZUSA 1KT2A 1J05A 4J3VA 5B21A 1YAZA 2B1HH 5E5LA 5JQHC 1A4CA 4ZSOE 4RRPG 2WV3A 4KRLB 3PRZA 2BS8A 3QXDB 1CFTA 4XCNB 3F5WB 4HOWA 1KFAL 3JWOH 4XP5L 1XX9C 4M7ZC 3MACH 3FSOA 3QJZA 1BQ5A 4Q14A 5HDWA 1JNHA 3TGXA 3UCRA 4MMZB 4OF7A 3N85L 4PN6A 1HILA 4FLSA 3JYCA 2VW6A 4UDUA 4X7CC 2APBA 3KPQA 3Q6GL 2X70A 4XE5B 5E94B 5K1VA 3BH8B 3VE0B 3MHZA 2PW1A 1CS6A 4DVBB 4W9ZA 5SWZA 3P0YL 2GBAA 5AVRB 3D2UA 1KGIA 2DTSA 5T1MB 2L7UA 4GO6B 4WW2F 5I9QC 2IDCA 1GZQA 3C8HA 1MHCB 3CUPA 4K94L 4KXZH 2ZUQB 3Q8FA 5KOVC 1JHKL 4EMZA 3HI1A 5IQMA 4WENB 1ED3B 3RGBA 2Z1PA 5ESVA 2UUDK 1E28A 1P53A 4KHTH 4YN3A 2W0FB 5FECA 2Q8BH 4XCFH 3TWYA 4K3JH 2BFGA 2Y07H 4ABVA 3RI5K 5ADPL 2R4SL 3WHXB 3WGUB 5DI8A 3FSAA 1CFTB 1UUSA 5K1JA 3HVDA 2XXMB 3B56A 3H6JA 4IYKA 1RURH 2NDFA 5SWZE 1DVFB 4KZDH 3QWNA 3TEXA 3ZHKA 3V10A 4JZNB 4XMWA 3RWJB 1VFMA 4Y9CA 4H8WH 4Y5VA 1QBAA 3FQWA 4X4ZA 1T6BX 5HI4C 1WFTA 4UDUB 1W9XA 5F8QC 1Z6JT 2X70B 4FHBD 4XMKL 4Z7AA 4U2YA 1KXHA 3O45B 3OJVC 2PW1B 5FHBH 1U8QA 3RTQA 1AQKL 5FOBA 3AQXA 2B4CH 4DESA 2F19H 3D2UB 1XGQA 5IBLD 5IT2L 3EOAA