4W9DC

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methyloxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 3)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 37
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9dC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9dC01
3ZTCC 4B95C 4W9EC 4B9KC 4W9JC 1LM8V 4AJYV 4W9HC 4AWJC 4BKSC 4WQOA 1VCBC 4W9GC 3ZUNC 4W9FC 4W9DC 3ZRFC 3ZRCC 1LQBC 3ZTDC 4W9IC 4W9CC 4W9KC 4BKTC 5LLIC 4W9LC
chains in the Genus database with same CATH superfamily
3V0HA 3A21A 1G9NC 3G7TA 1ADQL 4GFTB 4W4NA 1WH0A 4R2GD 2PO6B 2SODB 4WW2A 3BQVA 1DQDL 1RIUH 4N25A 3RIAK 5EOTA 3UYRH 4ERSH 3AG3B 2I27N 2W07B 3KEDA 1AIZA 1U91A 5HPOA 2IFFH 4P23C 3PWVB 3FMGL 2DJUA 4FG4A 3FRUB 3S3CB 2B2XL 5KSBF 3NCBB 5AW9B 1M1XB 3VI4E 4PJAE 1J05B 3HMWH 3DX7B 1L6ZA 1ZEAL 1JN6B 5DWPA 2NZ9C 1PKOA 3MR9A 4ZOEA 3FTZA 5L2KD 3FQXB 4N8VB 5IVZA 3GMMA 1RUPH 2EDDA 2JIXB 4AEHH 5C0RL 4IRJA 1RL1A 2GIYA 1JI2A 5INCB 2XN9D 5D5MF 3P11L 2YOAA 1JD9A 1G1CA 1UVQB 1KT2B 2X6UA 4H25A 1KMGA 2B1AL 3IK2A 1F3RB 3GTVA 2IVFC 3SE3A 3ZXAC 4TQ8A 3TV8A 4YSRA 1NCBH 2OSXA 5M7QA 3MOAH 3MODH 1OAYH 4Z7VE 4U7SA 5GS3A 5IFAH 1OY3B 5IV2B 3DYMA 2MWCA 4AEHL 5C0RH 3DV6A 2OW6A 1F13A 2J5LC 3GSWA 4OFYD 1F6AB 5DD3L 2DD8L 3SQOL 1XDTT 1KDJA 5KVDE 2UZXA 1JD7A 2ARJQ 4UU9A 4LMQI 3WKPA 3WJMB 3FT3B 3T71A 1QR1A 3B3IA 4GW5B 1SYVA 3HLAB 4LL4A 3BX7C 5E2VL 3CVHL 5C0JB 2XPYA 4ETQB 5C86A 1VPOH 3HHSB 3IF1A 3IFOB 4TULH 2OXGB 5KYXA 2GTZA 1ONQA 1ED3A 3TO2A 3KLHD 3LB6D 3F05A 2F74A 5IB5A 3US9A 1DVZA 3AMLA 4HH9A 5FXCH 3MX0B 1FFNA 1N0XH 2GFBA 2UYLB 3IXAB 1HSBB 4XOBA 3IGLA 3MLWH 4PLJC 4E36A 2VTFA 3AY4C 2P7TA 4M6ML 4UBDD 4XVUC 2Y6SD 5T5NG 2FJSA 5LNDA 2X4TA 1N3NB 3IMVA 4H7VA 4OQTH 3A6OA 5D7JC 3W82A 3ULUE 3LKNB 3HC0A 5CN3A 2F53D 2IFGA 5JO5B 5SX4H 4UV4H 2J4WH 4PJIF 3GHEH 5GGQL 2JJTC 4G9DA 4Y16B 1GS8A 4XAWH 4XE5B 2GJ6E 3L3KB 4PQXA 3HS9A 2EDFA 1CGXA 1FNGA 3L4UA 3ABZA 4X6CE 1E2ZA 5B1JC 1LEKA 1B4JH 5IEKB 1OCWH 2UY6B 4DN4H 4K3EL 4G5ZH 1G7LB 5AZ2H 4MDIB 3ZN6A 2VXQL 3WXVL 5EZJA 1MELA 4J27A 3GSOB 3MRGB 4FQIH 2XTJD 2Z91B 3TU6A 2EXSA 3DPBA 2ZX6A 2QGDA 2C7FA 3SQRA 5DO2D 5T3ZD 3U7YH 1VGKB 4XX1G 4JFPA 3SZ6A 3CVBA 2DV6A 1ZE3H 2A5UA 2FX8L 4FQQB 3VFRA 2VLMD 4FQ1H 1ASQA 4NNYB 4Y1AA 2TSAA 2NQ3A 2OK0H 1IGJA 5EDSA 1WCQA 2PYEE 2E8YA 4ALAL 4JG1L 4YPGA 1GTNA 4F93B 4OZIE 2XBTA 3US0A 1UZ6F 3OLGA 3UZEC 2BXYA 3VXRB 4KO5A 4EZMA 3T8XB 4FQXC 4PN6A 2DH3A 3HHMA 5ACZA 5I9QC 3KWXA 5F96L 3NSFA 3UTQB 5DRWB 3QEQB 1OV8A 1GJIA 3TA3B 5KBMA 1PJWA 3O3DB 5C0IB 4PJGB 3Q0HA 4YXHH 1GVIA 4RMSA 4LLYB 2ID5A 4IOIB 5DJ8A 3ILPB 4ANVA 4G1MB 5E9DE 3SGKC 1AE6H 2H6OA 3EZJB 3DOHA 3NJFA 4JFEA 3DTDA 4M7ZB 3TYFA 2YA1A 4KXZI 2QVIA 3O6KH 5HYJA 3EDDA 3QQ3A 1NCDL 3V9FA 1USQA 4NUJA 2C3WA 5JW3L 2VDOB 3KDMA 2QLYA 1DBKH 2D0HA 1JZ3A 2J1ZA 2ATKA 3CSYB 1DUYA 1F4AA 1KN4L 1FH5H 4HIPA 4WI5A 3TT1L 5C0BD 3VD5A 1XXDC 2FZ3A 4XAKD 5GRUL 4R4FH 3TJHC 3C2SA 1V3MA 5DS2A 5LUMA 4Y9GA 1MCJA 3G5VB 3NEOA 4DVBA 3VXQB 4JQVA 1JCVA 1H6UA 3NG5A 2UZPA 4PJ6A 3X13A 4XO5A 2DLFH 2VZOA 4ZTOH 2XVKA 4KKCD 1PLAA 1MCEA 1IC4H 3SQBA 3VH8G 2WLIA 3LB6C 2V0AA 3P54A 3WNKA 1BBJB 3QRBA 3LEVL 5C6TH 4YUEL 2BOBB 4XXDB 5EWIL 4HWEL 3MUY1 1K72A 3CSPA 3HEIB 3MJ6A 5IOPA 4HQQL 2WAHA 1FNFA 5GISH 4P07A 1JPEA 4PW3A 5IMLA 3MRBB 1CMOA 1KLGB 2NYKA 3AXIA 5C09B 4O4YH 4R26H 4G71B 3DIFB 5BRZD 3QIBA 3TTSA 1BFOB 3ATEA 3MLZH 3X3FL 5C09A 2QMJA 2XZCH 1SXBA 5D2LB 4OFYA 3SGDH 4EIGB 1H5BA 1QLEH 4LSQL 1RURL 2XNAA 1MFVA 2CJSA 3NAAL 3L08A 4G8FB 4JQXC 4JB9H 2VDNL 3D12B 4I89A 1SJEA 3FQ1A 4A6YL 1NAMH 1FGVL 3OR7A 4OV6F 3QWOA 1C5CH 1HXMA 4NXKA 4BFOA 2NXYC 5TE7L 1E43A 3ETTA 1BVKA 1TITA 3P69A 5D7KD 2NTFA 5SWZA 2HP4A 1YEEL 2AJYL 2WQRA 2ZWKA 5C07E 1OAQH 4OBRA 2XV3A 4HJGA 4PYHA 4F3FA 3TL5A 5KW9H 1EEYA 1PDKB 1R3JA 2UWEF 2VLJB 5FUZL 1NUDA 3D69A 4LNVA 2X42A 5H35A 1CDYA 1KOAA 1YNLL 1XO8A 3CFTA 3OKMA 4XO3A 5MHSE 5ESVA 3LPPA 5AAWC 5LG1A 2NR6C 3B9KD 1E6JH 1LK2B 2VAAB 1Z5HA 3ARBC 4IOIA 5DJ8B 3WJMA 2G2NA 1WEJL 3BCDA 1DQLL 5DWUL 2C3GA 3SCMD 3VXSA 2DQGL 3O6LH 4OCLC 2GJZA 3WEXA 1CLVA 1QW9A 1U2YA 4P9HC 3T0EB 4WK4B 5HVHC 4KJQC 4WWKD 2E7LA 5L7XH 1IC5H 3LQAH 1KPVB 3QEQD 4DUWA 4JFDA 5IFHH 3IN0A 4PI2A 1XTLA 4NO3A 1U93A 4PTUA 3D33A 5BRPA 2VQ1B 2IAMB 4A68A 1CFVL 4JL2A 3BWAB 3BH9A 3ZL2A 5DRWA 3SDXE 4RH4A 3C5XA 5I17B 3EJYC 1IAKA 2LVCA 2JIXA 1HDMB 2NW3B 3H7BA 4G7YH 4I9WD 4PJ9B 3VFSA 4BRJA 2K78A 3QPXL 1XEUA 3VE0B 4CJ1A 3N9GH 3QE5A 3R4RA 1S5HA 4OU3A 1G7PB 1D5IL 2VW4A 2OULB 5BXFB 4JCMA 1XGZA 5IW6B 4U1IB 4P59H 5DMGD 2Y3AA 3C8KA 3SDAC 2WQXA 4ZAKC 5KYUA 4K94H 5D2NE 5E5LA 1RU9H 3SDDA 2MQGA 4P9ML 3ILDA 5CBAA 1F2QA 3D0LB 3NTCH 1X4XA 4RGOH 5IGXH 3KXFA 2NW2B 3H3KA 4FXTA 4LSUL 1PLGH 3LIZH 4JUSA 2PXYA 1A4CA 4N2GA 5GGSB 3HCVB 2JH2A 4Q8BA 4IJ3C 4Y4KD 2D9QB 1A6UH 3WNMA 1UYWL 2AEPH 2MPAL 4MA7L 5JPNB 1XGYL 4ZO6A 1PKQE 1JYXA 1NAKL 1J0IA 4XTRD 1BG1A 4H25B 2YAPA 1T7XA 4WV1B 4M1DL 4M9OA 5JMRA 1UD2A 4LQFL 4GQ9L 3Q06A 3FO2B 5IJVB 3BXNA 5KSBE 2KZWA 1FZJA 3EJCA 3TPUA 2CBTA 2AVFA 4AYGA 3B5TA 2ESVD 1CBJA 4UYQA 3VH8B 3BT2L 4IRSD 3S3BB 3SBPA 4M7KL 1JN6A 1DJZA 4KC3B 3G6JA 3HMXA 3AWFA 1A21A 3ARBA 4CKVX 2P7TB 4X9HA 2XRAL 2DM4A 2BP8B 4GMTL 2QLVB 4AV5A 3QIWB 3UOAB 1QLRB 1OZTG 2AVGA 4XNZB 1INQB 4YSSA 3FQ4A 3MROA 1ZTXH 4DH2A 3G6JF 1T04B 4FQPA 1MKFA 2EXWC 4RWYH 1C8PA 1Y1DA 4A6YB 1U95B 2BVPB 2FEEL 1HH9B 1ZRUA 4MJID 1AR1B 3SJVB 1N5YL 1J5IA 2DMCA 2VDMB 3KLAA 1P84K 4TNEA 2EDXA 5K59E 2ITEA 4BELD 1DFXA 7FABH 4ZNEE 2AW2A 3I85A 1Q9OB 5E08L 4XMLH 3SPIA 4FYQA 1HNGA 3BZEB 5L2KB 4M5ZL 2WYZA 4Z0XB 2Z91A 3WGVB 4XP4L 3LD8B 3U0WH 1Y0LB 4N0RA 1ODUA 3HA0A 3KPSA 5E8NA 5EZJB 2H3NB 2FEJA 3RYMA 5C0JA 2J72A 5E1IA 2E27L 2OTWB 3A47A 3K80A 4DERA 4PYGA 3SOTA 4MB1A 1EDHA 1HKLH 4EE2A 3SYOA 4PVBA 2O61B 4W9EC 3IJYA 5INCA 4CL7A 5HP5A 5I76B 4BKLA 4CJ0A 4BK5C 2XSKA 2WB1A 3P9LB 1ZS8A 4NKDB 3ARDA 1NBZB 3IGFA 2MTPA 2WXLA 5ACZB 4OJYA 5KSAA 2X44D 4G83A 1ZHKB 4JVWA 1TU2A 2NY0B 2OI9C 2IO5A 4HZAA 4Q6YA 4PS8A 1CQYA 4NJAL 4AJVA 4PH8A 3HVNA 2DMKA 2VDML 1FWXA 1QATA 3RFRA 1F58L 2GK0A 5IVNA 2ADIB 5ESQB 1AG6A 3QA3A 2R0LL 3V6ZB 2W07A 4RVBA 4X4KA 5EBWB 2JQAA 5E6ZA 3RGVA 4WW2B 3D50A 4DOHB 1XCQB 1YSOA 2N1KA 3DNKA 4HT1L 4CADA 4F7KA 2AGJH 4KUCD 1Q72H 2VB5A 1BPLB 5GIRB 4X6CB 1NFDB 3SJVE 3MV7B 1KGCD 1W0WB 4W9DC 2W38A 1BMZA 1GGYA 2CO1A 3NP4A 3OX8B 4I0CC 2J20A 3IDNB 5B38B 5F89B 5BO4A 1J1PL 5ESAB 2KHAA 4NPKA 1LEIA 2WYIA 5F88B 2WSDA 2G3MA 1KB5A 4JMXA 5AOKA 4BEIA 8PAZA 3MJ9A 4ELKA 1HAWA 2FDBP 3FT3A 2P43B 4FFVD 3ZHDA 5AW0B 1E4KC 3QUZC 3AQZA 4U1MB 3T8MA 5I16B 4N6QA 5DEGA 4TQEL 1EO7A 1FI8C 5KS9B 1INEH 1NBVL 3LHAA 5TH2A 2PR9A 1THCA 5AL8A 4ZTPL 3DSFL 2C7UA 3RPIB 1S78D 2QKIA 3L7EB 2QELA 2DAVA 2JMRA 3IDJB 2BMKA 4P2RB 1OSZA 5BZDA 3IMUA 2Y22A 3TESA 2FJUB 4LKXB 1HKFA 5HHME 3E0GA 1A1OA 4NAMA 2J8UA 1EMTL 5I2IA 4QJ5B 4JFWA 3MBED 1YN7A 5BV7C 1F86A 2COQA 3PAZA 4MCZB 1MFEL 2ICWI 3NRPA 2LOEA 4IKIA 2H2SC 4Z8FL 1MFBH 1FAKT 1II4E 4Z7OB 2ZOOA 4HIHA 3ZE0F 1TJIH 4TVPH 4NQTA 5CCKH 2DQUH 3BSZL 3R1GL 1JNLH 1I7UB 2DQIH 3F7VA 3LNFA 4KJWD 3DX0A 4YDVA 1JGVH 3T09A 1E8YA 25C8H 2H3NA 4JPVL 4POUB 3DBSA 5JQHC 2YAHA 5E5UB 1P7BA 4LRIA 5GGSY 4JZNB 4PJ5E 3S5LA 3EIFA 4Y5YB 2EC8A 2GITB 4FULA 4XX1E 3RUGE 3CBKB 4HKJA 5IOKA 2BPBA 1F4WH 3CE1A 3N0PB 1P7QA 3EYOA 1A3QA 5DZ9A 1Z9SA 1PG7L 3GSNH 1EUUA 2C9QA 3FSZA 5DHXB 5A6IA 1FZMA 1TTUA 2O1AA 1VZHA 5D55A 4Q9QL 1YEKL 5T3XD 4JFQA 1V10A 3KNBA 1CF8H 4OT1L 4IOSD 2NY2D 5HGDB 1FFRA 2XFGB 3ZDZF 2ADJB 2HX7A 5GRZA 5F6IB 4DVRH 4XPTH 4NM4H 1EAQA 4PP2B 4HXBL 2VMDA 3C6LD 3OPUA 1BAFH 4P2QD 5IJKC 3S3PA 4WY7H 3UTTD 3DX7A 2Y2TA 3NJXA 2Z8SA 1CD1A 4HF5L 5CJ5A 4CADB 3H1ZA 1OARL 3FUIA 4TVPL 1GJUA 1BW8A 4BK4A 4GKOA 1JZ5A 3U82B 5JZ7C 4Z8FH 1KFGA 2QPUA 4PJ9C 3FT4A 4N2CA 4JN2B 3U25A 3V6OA 3QQ4A 1XCTB 1K6QL 5I75B 3MCKA 3WFCH 3GD1C 5EZLB 4APXA 3DROA 3M1BA 4JKWA 4MNGB 1MCWM 1M9WA 3RTQC 1XGTB 1JK9B 2ZWNA 4WY7L 3IXTA 4M3HA 3REWB 2XPZA 3H9SE 4XPFH 4V1DA 4KGLA 4EIUA 5JXEC 4NM4L 4ACTA 2Q7YB 4NXSA 1T2QL 4QXTA 3ET9F 1NMBH 1EUTA 3CC5A 3IT8D 3QHFH 1G6VK 3OLEA 3V0AC 2PXYB 2PCXA 1M7DA 4OCXH 2X4OB 3RTQD 4AOFA 1B2YA 3KXFB 4KK6C 1IKNC 1WAPA 5IBUB 1HHIA 1E4WH 5BS0E 4M5YH 1RZKC 2Z93B 3BVNA 4WNQB 2GCYB 2YAQA 3U48A 5IR1A 3STBA 5L2KA 1FZOA 4PJDE 2XTJC 3D0VA 4DOHE 5C9JA 4PGCA 1YN7B 3DIVA 4DCQA 2BWQA 5C92A 5CZVL 4X5RA 3BKCL 4Y2NA 4NO0A 5DRXA 4G8GD 5MP6L 1BFVL 1WIPA 4OZHE 3ZKMC 1A22B 5DHVA 2KUTA 2CLZA 5E0QA 1TZHB 3PIQA 2AJXH 3A67L 3ESVF 4B7LA 4D94A 5EOQL 2R4RL 4HIXH 4NBYB 5KUKA 1MFDH 2UX7A 5E0FA 1T03L 1JJUA 4NX0A 3RPIA 1SOKA 2AGJL 4PB9H 3JVGC 1QSEE 2YGPA 5GRVL 1KYAA 4Y4FD 1HHJB 1XTMA 4DTGH 2WMPA 2IDQA 4OZ4A 3QUHA 1HJCA 3PJSB 1IEAA 2CRZA 3LKSB 1EJ8A 3EO1A 4P3CH 3G6JB 4I1NB 4F58L 4OD3L 4MWFB 5ABZA 2KI6A 3DVNA 1OE1A 1KULA 1WC7A 4HWZA 2VXTL 2FNBA 1M2VA 1T1XA 1JZFA 4YE4H 5E2TH 3GHBH 2J2ZB 4L1DA 3MRPA 1XF3B 4NHCH 5BVJB 3QJQB 4P4KC 4UBDC 4I0PB 5HHXL 5C0GA 4ZUUA 5IROC 5AD0B 1NFDA 4QYOA 5KAQF 1Z1WA 2OL3A 4K9JA 4XODA 2JELL 1NGQL 1IC7H 1CU4L 1IKFL 4Z1PA 1X5XA 3BZEA 1E9OA 5DC4B 4E0RB 1ADQA 4PRAA 3BIKA 1I9IL 2VLRA 1WZAA 4FHBD 5HVWA 3DMMC 3WCYA 3CZNA 4TRPH 4XCFH 2BC4A 2MNJB 3H55A 4IIZA 1D7CA 2BHZA 2CSPA 2K4AA 3ARTA 3I9GH 3A6BH 3L3HB 3BP7A 1TU2B 2DWXA 5GZOD 1LD9B 2ATAA 1AZUA 1I3RB 1ZS8B 4X98B 4BFBD 1PNCA 3KM2A 5JW5B 3ARRA 4XCCH 3UIZA 4BKLB 4OD1H 2LLNA 2W0FB 4N1CA 2E7BA 3VQ1C 1MHHA 3CGTA 2VR7A 2WCPA 4JPWL 1WT5C 2CRMA 1TENA 2H1LM 3Q3GB 1H8OA 2AK4E 3U1QA 2CJUH 1I1AD 3ME0B 5D2NC 3PY9A 4FZ8L 5LJYH 2QVTA 2YRBA 5ABAA 2HFGH 1S9YB 4PWFA 1IIKA 2V17L 1LNUA 4QRSB 2QFPA 1TSHA 5EC2B 3E8UL 1DUZB 1OIOA 5IVXF 3G5VA 1W72B 1BFSA 4NQCE 3PYCA 2BRQA 4U7KA 4I3GA 2Y23A 2VL5B 1KJVB 3KH3A 3IAGC 3I2CL 4FFWD 3L3GB 4IS6B 1QPXA 1WZKA 1Z0NA 3D06A 3GDBA 1ZTXE 1XR9A 1DLHA 4G6AD 1QP1A 4PJFE 5HDQH 3VFNA 2G5RA 4Y4HA 2VLKB 4AV4A 2BSDA 3FQRA 1PD1A 3PXHA 4HIQA 4XO8A 3OJVC 3BN9C 3L4VA 5TPWL 3DLQR 4J2QA 1QFHA 3GKZA 3QQDB 2GVYA 4NP9A 3MOQA 3MRJB 5I5IA 3JYBA 5TQ0H 3O6FA 2JLLA 4KX7A 2EVHA 1DQJB 4WI6A 4XZ4A 2OSWA 3UEZA 4X6DA 2VZ1A 4H0LC 1IT9L 3BZ4A 4WFFD 3WENA 3KHOA 3THML 1CYGA 1G4MA 3QXAB 5FUCE 4R90H 1L9RA 4J28A 4QHLB 2KLRA 3INUL 1SPDA 3FFDB 4YJZL 1V8HA 2WQWA 2Y9RT 5AW5B 4Z7UB 4ZNCD 4OJAA 4JR9H 3D39E 3HBQA 3DOIA 1ROCA 4JAMA 2BHFA 1NCGA 4V1DD 3FRPB 1L5GB 1I8LC 1ZV2A 1HHHA 2JJVA 4LHUG 2ZXEB 4IU3A 4PJBA 5DUBB 3BRGC 4XBPB 2EZ0C 3DWTA 1N18A 5EEWA 5I6PA 3PCYA 1XGRB 3HNVL 3HS0B 4F92B 4MQSB 3BWZA 1T4WA 2EVFA 1TT6A 5LDUA 1MCPH 3CPLA 4JFFD 3R8BB 4HPOL 2V9RA 4ODXA 3SDAB 3UTZA 1WD8A 2AAVA 3GSUA 2BIMA 3TN0A 1XGYH 3ZE1B 4NI6A 3BIBX 2MCPH 4QGYA 1OGPA 3FUJA 4FQHB 4Z23A 1N9PA 2HN7B 3HFFA 3KLSA 3B7RL 1JWSB 4H88H 4KRPD 4QY8B 4V2CB 3SBWA 4BA8A 4F3FB 2IPKA 2JKSA 3EH5B 4MAYB 1JPFA 1HX0A 2AXFB 4GNKB 3HKFA 5I17A 3LKQB 1FAIH 1Q4NX 3SJVA 5I8EA 4QRBA 3UBXI 1CQKA 3FF8A 3EBIA 1T04A 2ZICA 3GJFK 2GBUA 3IPBA 3O2WH 1ZVNA 5TE7H 5DYFA 3T6WA 1KCUH 4UAOB 3WL9A 4C4KT 1DJHA 3X14B 2J43A 5EIQA 3V5HA 5AEAA 4ODVL 4MQXC 4P49A 4ZAKD 5IT2H 3O2WL 1QFUH 4XRCB 3P9MB 1UC6A 1ZHLB 3B9KC 3LPOA 1N64H 3EFOB 1RZ7H 4FLHA 3WHXB 2XBZA 1RURH 1VGEL 2DY2A 5C9JB 3EOBB 4P2AA 3AGVA 1SDAB 3TASA 3UL4A 1YEJL 1NFIB 1UEMA 4WUUA 5AVYB 5TE6H 3QEHB 5T3ZE 2QQKL 1WSST 3KH4A 2R29A 3CV5A 1HILA 3KPPA 4YDJB 2LU4A 4JQIL 5CSBA 1T5KA 3B9KA 5MEQA 4M8VA 1A6ZB 2MCPL 2NXYD 1TZOA 3VXMA 5B8CC 3N3EA 2R1WA 1ETZA 4F15B 5EWIH 5FK9A 3AXLB 4ZYKA 2R9HC 5E8PA 2WXJA 3HNVH 3NIFB 4YX2L 3WDJA 4AE0A 3SCMC 2LAGB 2V5YA 2ZP9A 3ELAT 1R6VA 3BUPA 4PCTA 3BUYA 5I0WA 3VWKD 1QZNA 3NJLA 2J2ZA 4UDUA 2UZXB 1SJMA 4MA3B 1G0XA 3VSTA 4ZTOL 4PS4H 2BY3A 2GJ6D 1M2VB 5CUSL 1SFDA 3VD9A 1AZVA 3RWEA 4GG6A 3LN5B 1MLBB 3OKLA 2AJYH 1FNGB 2EP6A 3NJMA 1B2WH 5BJTA 1LO2H 3RWCA 2VRKA 1SEBB 2ZOUA 1HU8A 4ISVB 4MASA 5DQDH 2APWA 2BXZA 3CIAA 3WYRA 2BSCA 1BLNB 3SDCC 4AVKA 3G5ZB 3FUKA 4R90L 3NDYE 5H2BB 5JHLL 1I75A 3DURB 3SE8H 1KB9J 1T89A 2H26A 4JFFA 1Z32X 4N0FA 4QCIB 4FMFA 3DX4A 5I26A 3SKMA 3U6RA 1EXUB 5KVFL 3U0TA 4KMTL 3ZDYF 1I8LA 1Y1UA 2BRRH 3EADA 4NPYA 3APNA 4N6RB 3JWOL 2DM7A 4RDQF 3X3FH 3MLRL 4M8QA 3QNXA 4NO0D 5LWYH 2WBJD 4G9DB 1Y6KR 2GAZA 1N0LB 3MYZA 3PPSA 4I3SL 4JJ5B 4KKQA 4WEBL 5E00A 4QYAA 3II1A 4HU2A 5JO5A 3LXBA 5KYNA 1YDPA 5E8EA 2G2RA 3EKCA 2ENQA 1D2OA 1HL8A 3F7YB 3LZFH 3C6SB 4BUQA 5LBSA 2X4QB 2JKXA 3CZEA 3AITA 1QBML 4YL9A 1S3RA 3QRGH 5E6YA 1OGAB 1DBAL 3U6XA 3LEVH 5C6TL 4QOKA 4A2GA 4D9LL 1NCTA 2IH1B 3MV8B 3A5VA 1T83C 2WXIA 3LN4B 3RWJA 1KSRA 1FPTH 3L3IB 5A7BA 4KI5C 3UAAA 3V6OE 5D1QB 5GGRA 3ULUD 1C16A 1IV8A 4FQ1L 4KNSA 4FGMA 2JXMA 4QKTA 2BFGA 5KJ7E 2HG5B 2O6CA 4XH2B 5IIEA 3TFKD 1J18A 1AGEA 4G6KL 4XNXH 1RHHA 1Q9KB 1I31A 1NDGA 4I0PC 2C26A 2Z9TA 3F7LA 4OUOA 1YPZE 2Y4SA 2FYVA 2BERA 2G5UA 4DP0X 3FO1A 4XN1A 1ZD6A 1DBKL 4ZUSA 3X12A 1E4XI 1EGJH 1G43A 1U8CB 2PP7A 3GMLA 3IFLH 3QI9A 1VB9A 2CO6A 1NCDH 2GTQA 1CBVL 3C60B 4GSDL 1TLMA 4UOW1 3UZQA 4XP6H 3OB8A 4HBCL 5D7LB 3LEYL 4R6UA 4A7UA 3QIBD 3T0BA 4RRPM 3L95A 2GYSA 4KI1A 4NZFA 3CZLA 4Z95H 3UTSE 1BD2A 4ODWB 4DGVL 2CMRH 3ARGC 3L3HA 5CJXA 2EAEA 3P73A 4Y16A 5GS1B 1TQBC 4PJDA 4JGHA 2IJ0C 4GI6A 4PJEB 3SSGA 4LLAA 1L3NA 3ES6A 2Y25A 2C3HA 2DJ4A 2N3JA 3QDAA 3ZT6A 4NPJA 3PJNA 4YZFE 1ET7A 1XIWA 5BV7B 1HI6B 1ZVYA 4BA0A 4OLYL 4E0RA 1S7XA 3PFUA 1S8DA 4KTYA 3AB0B 3MV01 3MV9E 4F7PA 5C0BE 1DQMH 1T5WA 2X3CA 3HI5L 2X4UB 3NIGF 4NKIH 3DETD 1A6AB 1DFBH 3K6IA 4YMPA 5IHZB 4M6MH 5G5DA 2VZSA 3ILEA 1DLFH 1X7QA 1IGCH 1XF3A 2XTJB 4GW4B 4QF1A 5LQBL 2WZAA 3U7AA 4HW6A 3BP5A 3T2NL 4UTCA 1MUJB 4X7EC 2FO8A 1GZPB 3GBNL 5EIIG 5KJRL 1P5UB 1J0YA 4Y19E 1XF5A 2K70A 2P5EB 4YLQT 2HLAB 5K39B 4F9LA 5GZOC 2UUDK 2M8XA 1EO5A 5IW1B 3L3KA 1JYWA 1WO2A 1JGIA 1U8OA 4W1TA 5AAMC 4AV0A 4HG4K 4NKQB 4ZODA 3HAEH 5JTWA 2AQPA 5IBLD 2AXHA 5JQ6H 2WQAA 1SOXA 1HSAB 1KJ3L 2CHWA 3WOVA 4ABWA 2ITFA 1J5HA 1R75A 3QFJE 1HHJA 1URIA 2A74B 4X7SL 3LKNA 4TN9A 5MP6H 3ESNA 3BKCH 2DIJA 5CZVH 5DJ2B 5EUOB 4C47A 3ARGB 1MZZA 2E6QA 3VI3B 2NZ1A 1VFOA 1MFUA 5AVWB 3DX3A 2JKLA 3OF6A 3RVVD 1ZHBB 4YL4A 3STZA 1K2DB 4MJ6A 5G4MA 4FXKC 3LZQA 4HGMA 4J3OC 4WJKB 4GKSA 2B4CL 3KPSB 4ZUTB 3VXRE 4HCIA 1YNTF 2F53E 1WP6A 3ELQA 4L8BB 5FA3B 5AOLA 1HQRA 2CU9A 4XC1L 4ZXBB 2HG5A 4CMHB 5IIEB 1OF2A 2W80C 5CXPA 3HC4L 5ADPL 3MXWL 4K15A 1W15A 4G6JH 2JCCB 4YK4B 1L6XA 3JUYA 4WSKA 3RP1A 1M7XA 3OB0H 3ZKXB 4Z7VA 4X8JB 2EDRA 2XVGA 4M61B 4B0MM 2EYSA 5DQJB 5KVDH 5A43C 1BD2D 1RMFL 3EH3B 1QFWL 5IG7B 4F57L 5KJRH 1JDCA 3GBNH 2AANA 4X4ZA 5F9AC 1J9RA 3MNVB 2IOIA 1NMAL 3II3A 3QIWA 1QFWH 2H3KA 1KTCA 3D9AH 3PAVA 4AVIA 3UXFA 3FFCB 4NKOB 1IKNA 4FLSA 4G8GA 4XVOA 4FL4B 4B5EA 4YWGL 3MJWA 2IIJA 4NKIL 2X70B 1UD8A 2FJHA 3V0WL 1RUAH 4QIRA 2H32H 3GB7A 3FO0H 3FUMA 4N8VA 1TNMA 2HVBA 5IVZB 4CA4A 4PCSA 1ET8A 1FDLL 4TNVK 5MI0B 1LWRA 2RIKA 5BO1H 4PV9A 4H8PA 4QT5B 3C5SA 1CLCA 3TO4A 5FKPA 2WLKA 5CZXC 2KPNA 2A9NL 1T6WA 5DC0A 1YEKH 4Q9QH 2K1MA 4ZPTB 4FFTA 2QTEA 5C0AB 3OVUB 3HRZC 3N1FC 3MRFB 4Z7WA 2ROYA 2P42B 2AJSH 2L7EA 3WJLC 4LB8A 2DJSA 5IKCA 4Y4FC 2Q2LA 2CUHA 1R3KB 4NDMA 2ZPKH 4X6DE 4CC4C 2YD1A 3LZRA 1R3LA 4UB0L 1CBVH 1F3DJ 15C8H 4QRRB 2P9RA 1GW6A 3HMWL 4JVPA 1AHWB 3CFCL 5C07A 1XZWA 2ADGA 3BSZA 3JWDC 3ULUL 2VR3A 3TTYA 1GHFH 4JZOA 3OPZL 3PHSA 5KYXB 5GGVL 3ZRFC 4ZFZA 4PRPA 5D7LE 3KBFA 3DI3B 4IMKC 4YGVA 1M57B 3ARSA 3QEUB 4G6KH 5EEYA 5I0VA 2F1BA 1T3FB 5EG6C 2FWOB 2WB7A 5IMOB 4TUKL 5I73B 2EIEA 4BZ1L 4OQ1A 1DVFA 3BSHA 3L5HA 1F3JA 3WG7B 4QRTB 4QXWA 4L8CA 3FSVA 5JOFA 1DQML 4WUUB 4YPJA 1PX8A 5EUKB 4D9LH 1IQDB 1KBGL 1ZIAA 3D7PA 4NUMA 5ECGA 2G2RB 2RQ8A 4PJXE 3VWKA 4GKSB 1GYAA 1IEBB 1ZXKA 4OFKA 3SKJL 3BP4B 2NX5D 2PYEA 4IGBA 2HFEA 1K4CA 4N3UA 2J8UB 5I75C 2VH5H 4LSSL 1MCIA 1KWGA 4JHWH 5CILH 4D9QE 2BY2A 4DKTA 3PL6B 3KWWB 3WL9B 4DKFH 1MRCH 1XF2B 4Q14A 2R69H 5BOZG 3GIZL 3EYVB 3HI6L 4ZMPA 3TBBA 4N0FB 1KLFB 3DUUA 4LP8A 4UDTA 1BDYA 4Z95L 3IS1X 3P9WB 3BHBB 5E9DB 3T6ZA 3D2UB 4G6AC 2BFVL 1S7UA 2WXKA 3D18B 5FM4A 3PNRB 4IBQA 1MFCL 3W56A 1WS8A 4RX4A 2E4TA 2AQSA 4MCMA 4NM8H 4TQIA 3RKPA 3TZVB 2MNUA 3VUAA 3D8MA 1DVFC 1P69B 2XWBA 4HK3N 4IOFC 4OFVA 1QZ1A 4QRRE 1JBJA 4FN0A 4Z7NE 5BJTB 1OWRM 2QZQA 2ZUXA 2IPTL 5DQDL 2A2QT 2TAAA 2UZYA 4HK0B 4GG6B 3LPFA 3WTTA 3UC2A 1QQDA 2EKJA 3RNQB 2WTOA 3MUUA 4P2OB 3V0IA 2X88A 4AEEA 2F19L 1FHNA 1OWWA 4Y5VA 3A4DA 4DK5A 2CHNA 2HSIA 3PLYA 4G1EB 1L9SA 1OGSA 4BK8A 3MRHA 3BPLC 1S2EA 3AY2A 1YN6A 4LSTL 2NY5L 5D71L 4JKKA 3TBVA 4J5VA 3DGGA 4GBXD 1G9NL 1KGCE 4PJDF 3B9KB 1FVDB 3OKEB 3MSPA 4BZYA 4X99B 3ZKSD 2BHYA 4FXGA 4N5EC 3K71B 3EH4B 1KCWA 2W9LA 4BDVB 1HILB 5F9DC 4R7XA 4NAQA 5CIPH 2D03L 3M1CA 4ONHA 4IDJH 3WMQA 2NY7L 3LKOB 5DS1A 4Q2ZB 4LDLB 5J9PA 2W81C 2QQLH 1MFAH 1VADA 1JK8B 4KRPC 3HG3A 1U8KB 1QFPA 2GBVA 4LGSB 3OG4B 3UZQB 3ARDB 1HH6B 5D1XD 4WFED 3TBYA 1F42A 5CEZL 4X5QA 1A4AA 2P3YA 5EBLB 3WO4B 5FO7B 2JXMB 4JDZA 4GINA 3MFFB 1JWMB 1IUZA 3MO1B 4OJFL 4JPKL 2HG0A 5E2UH 4XP4H 5HY9A 3QJTB 3N04A 3ZL4L 3NESA 2HLAA 2HKHH 3DHMA 5JHMA 4CW1A 1WV7T 1PLBA 2I69A 3V4VL 4ZNEA 4XNBA 2D8KA 4P4KD 3S4SG 1MQKL 2XACC 3CVHB 1J8HB 1AR1D 2R0ZH 2XY1A 3QG6B 2AERT 3ILQC 2O6DA 3MFGB 3QCUL 4FFZL 4AQ8A 4LLVA 4KK8D 4HZ1A 4WUKL 2DQCL 4F7TB 4PJBF 4EF3A 1WGVA 1ZTXL 4ZMWA 2YLHA 3LN4A 3Q8FA 1VKXB 1LVEA 4IMLB 4U6XB 2Y7SA 2IWEA 4L4TD 3KPPB 4FMVA 3FRPG 3UZVA 2CK0L 2Y1VA 3OWRA 4OGAC 3ZTEA 2JB5H 1FBIL 4K3JL 4U1SA 2XKNA 2J7LA 3QG7H 1MCPL 4QRUB 5LG6A 3IN2A 1GGBH 1QUNB 3L48A 3EYFA 1XSKA 2X4RA 1IE5A 1GAFH 1NL0H 3I9AA 5E4EB 5F1IA 1DCLA 2CLVB 1HL4A 1DVTA 3MJ9L 2E59A 3O3EA 1PL3A 3BN9D 4EI6B 5FS5A 3VTTA 5EA0L 2XWTB 1OCRB 1YNTA 1SDYA 1LP9E 3MHZA 1AGFA 1ID5I 2CDFB 4DEPB 3I50L 5EU3B 4CC0A 2WYTA 1NAKH 1YNTB 1MREL 1MPAL 2OMYB 2XWTA 4MA3A 2CHXA 4ZXBC 4AGQA 4MA8L 1LDSA 4U2YA 5JIDA 1CDBA 4UIKL 2LABA 4L1SA 5A3ID 1GW0A 3BQUC 1FC1A 1U9KA 4F7MB 1RZKH 4BCYA 4S2SA 1PX3A 3OM3B 3RRQA 1AAJA 3GXIA 3L5IA 2AKRA 1XBRA 3CPLB 2TSBA 4OM1L 3L9RB 3X13B 1HYRC 2ZKXA 2CIKB 2ZKWA 3WFZA 2ZX7A 5IY5B 4M48H 2IGLA 5TDNA 1PZ5A 5J8OA 4J4PC 1OGAA 1H6FA 5HDQL 1XH1A 4EZJA 4FKKA 4ZG1A 1FA4A 1LDPH 1OTTC 1ZWIB 4DKDC 4MD0A 5D7JB 1ASPA 2CCVA 4JN1H 2PP9A 4HPOH 5BXFA 4XMPH 5AW7B 3NZHL 1T7VA 3FSWA 3VE0A 3O4OC 2V5SA 2YMOA 3WJLA 4HGWA 5GS0H 1QRNB 1RK7A 3O3UN 8FABB 5EO9A 4ES9A 3FUFA 3NABH 4WFHE 2HTKD 3MJ8A 4HC1H 4POYA 1BZ9B 4ZQTA 4YZFF 4FZ8H 4NIYE 4OKVB 4QRRD 1SVBA 1D7FA 2IAMA 3CUPA 4B9CA 4PTTA 3B7YA 3KW8A 3M46A 1R5VB 4MDJA 4XMPL 1HXYA 4JN1L 4JFDB 3ZE2B 3P9MA 3R06A 3VYPA 3DV4A 4ZMQA 1E6JL 2ZIDA 2WZ5A 1PFOA 3CFKB 4K5MA 4Y4FB 5SV4A 3NSJA 5DVMA 4JFYA 3NIDB 4XPBL 5INDA 3GT6A 4MRCA 3IJSB 3EBGA 4XNYL 5IR1B 2QR0B 4HBQA 1DLHB 3C5ZA 4TXVB 5F7EL 3HN5A 1GH7A 1QNZH 1V3KA 3UAJD 3V0DA 4M3KB 3FQ2A 1NC4D 4XHQA 4F33B 4NZJA 2BSSA 2FR4B 3QVAA 1JF1B 2B14A 1UM4H 2NY1B 3FCGA 1UH2A 5J7CC 1EEYB 3EFDH 3MVSA 4NHUA 2DMHA 4TNGA 4A6YH 1TFPA 4U3SA 2A3TA 3X1BA 3DV6B 1MAMH 3T9WA 4Z77B 5FM5M 3B56A 3RUGF 1QTYT 3K8LA 1E0OB 1JTOA 1KPUA 2ADGB 5KOVC 3ISYA 1QI3A 1SBBA 2Y24A 3PDOB 4YFLI 4ONOA 2VE6A 1NGQH 3GRGA 4UUJB 4KKRA 4TUOB 5C07D 5DGQA 3N43B 2FUQA 1AZBA 5D7KE 3L4WA 1BPVA 1FFTB 4IKLA 5HHXH 2AV1B 2G30A 4X0KB 3IDXH 3DVNB 4RMWA 4ACPA 3MRFA 4EOWL 3NCFB 4XMVA 3FU7B 1EBPA 1MCWW 1KIPB 1BIHA 1GAFL 1NL0L 3OGOE 2B9AA 3ULVC 5EF2A 5DFVD 2AQ3A 2X4SA 3OMAB 4PY7A 1RSYA 3MI6A 3Q2CA 4CBZA 4HWEH 5I18H 4WWOA 3NSYA 3ARQA 5FYJU 4AH2B 3IDGB 4HWBA 2NY5H 4OD1L 3EYVA 5KSAD 5F0LB 2XBDA 1NCOA 1UD6A 2XKNB 2AJVH 3LRMA 2JTYA 2P44B 3QIBC 4FFVC 5KVMC 1E9OB 4NZUL 2QV2A 1MW0A 1BBJA 2CR6A 3QNZB 1SDDA 1YUKB 4ICXA 4V1DE 2X4NA 2A77H 5F7YC 1HOCA 1GMIA 3CDYA 3W81A 4BUGA 1P6WA 2VDQH 4QRQA 2BSED 3F5WA 1ZGLM 5BQDA 1PZCA 4CVZA 2R0ZL 4KXCA 1IRAY 4GG6F 3UTOA 2IPTH 3NACL 4KVPA 5F7DB 4O9HL 1R33A 4N2IA 1T1XB 1C1EL 1UOKA 3UJIL 1I9EA 2VLKE 4E41E 3HG1E 3O3AB 4WFFE 5C0DA 1F2XK 3CFQA 3EYSL 3BCFA 3CCHB 3PGCB 5CZXD 3UDWC 4JKMA 2OAAA 4XMXA 3HJEA 1S7VA 1EFXB 2YQBA 3PU7A 4TF4A 3DUSA 2VN5A 2XQYG 4IEFB 4QXVA 4J39A 1BVZA 4I2XB 2WVUA 4JFHE 4W4OC 4OCXL 2R7EA 3BGMA 1JHLH 4Y9FA 3QDMA 4JFEB 4LMQE 3RB7A 3IVKB 4NWTH 2Y2YA 2YPKA 3KBHE 4BH8B 3IJEA 3VQLA 2ZX5A 3F58L 2P8LB 3M1BB 4RGND 4YHIB 1HE7A 4ZMTA 4MMZA 4OD3H 1KBGH 1Q0YH 4LVHB 4O5LL 2QPEB 3LXUX 4EKJA 1X9RA 4PD4J 5DVKA 3APMA 2Z7ZA 3GRWL 4YHKH 2OK0L 5DQ9B 5GSVA 3QXVA 2DQTH 3G08B 5LGYA 3IKCB 5KS9A 2QSCH 5DMJB 2C3VA 2QADD 3WBDA 4FRWA 3JWDL 1IBFA 3ULUC 5I16A 3TBCA 3EFFA 4PJXA 3LZLA 3SDCD 4XZUB 3ASOB 4XN8A 3HAEA 4NO2A 3X1EA 4YHMH 3AZUA 1FFQA 1HNFA 4B9ZA 4JRYE 3H8NA 3QEUA 4NT6A 4HFWB 1FZKA 3CIQA 1ZS2A 4M5TA 5AZEL 4IBZA 3DVFA 4HYTB 5G5DB 2A6KA 4XN9A 3PNWB 4JY4A 1CF8L 4HKXB 5EORL 2X3BA 3N91A 3QZWB 3AWEA 3HZMB 4OJEH 3T6XA 4YE0A 5C07B 3LH2H 4X6CA 4MNGA 3NK3A 1FL6B 1ETB1 4YSQA 1E5CA 3GIZH 3SJVD 4V2BA 2A9NH 5CGTA 3VFOB 4F2MA 5E1AA 3TNNB 1A5FH 1QD0A 2EIBA 2XN1A 2J8UF 4NN5C 1PSKH 3QHFL 5FYKL 4UOZA 1R17A 4LOUD 5F7LB 1C5BL 5D5ME 2XYBA 1U33A 4UV4L 4MFHA 3T0XA 4YHML 1JGVL 3LRKA 3P0YL 4PEEA 1TVDA 2E7CA 3H0TB 2PW2A 3GI9H 3DJTA 2IGFL 1F90H 4B50A 1HK6A 3VFUB 4HUUA 1U3HD 5I2IB 5D6DC 3N41B 5C08E 1D7BA 3FQUB 4Y1AE 1IEBA 2DQTL 3A4FA 2Q7AA 4YDLB 1UXMA 2FBJH 1RV6X 4LEOA 5GGUB 2WINB 3K0YA 1N0XL 5IREA 2VISB 1A4KA 2ZXQA 1WZMA 2JKRM 4EUPB 4DETA 2Y1YA 2F54E 5EIVA 1F90L 1M7IA 1FQ9C 2I07A 2BDNL 3P4MB 4YO0A 3D25B 3V7AG 4PFEA 1BAFL 4N24A 1ZK5A 1RHHB 3QWNA 5DEFB 3APFA 5KVDL 5BZWB 4OKDA 3BDXA 4KDWA 2RALA 4OUUA 4Y4HC 3SODB 4P2OC 4DVRL 1YG9A 3CFCH 3L5XH 3MNWA 5MENE 3TC9A 4AQZA 2CGRH 3BVDB 4KGJA 4H8WC 2PPAA 1ZLSH 3INOA 5B1KA 3VGAC 3H9HA 4E9YA 4YGAB 2JI3A 4XO4A 1X5KA 1JVLA 2P46B 4M61A 4L4TE 3VXTB 1HCYA 4PV8A 1NDTA 1J9SA 4JFVA 2FATL 4M43L 2YXFA 5LBGA 4HWBH 2XWXA 3EYSH 3MROB 4AQ1C 4DO5A 3D3VE 3IDIB 3OX8A 1PU0A 2V7HA 1CICD 3L81A 4MWFA 2ZCKL 4HMEA 1RSFA 3WFBL 1FDLH 3P4OA 2EEBA 3BDYL 3IKCA 5GRVK 1W80A 2GT9B 4Q56A 5ICUA 2OCCB 1XWVA 4GFXA 1KT2A 3BSZH 4BRVA 3G6DH 3P2BA 1UWEH 1AQHA 1A25A 1UJTA 3RVTD 3UG5A 2E75C 1Q72L 4FQXB 4Y8DC 4GQQA 2UY7B 5E7FA 1RH8A 2F7IA 4QHKJ 3NUKA 3BFQG 3BRFA 2AJVL 3GRWH 4YHKL 1EAPB 3TURA 3D9AL 2L7JA 3UIYA 1I8UA 1LP9B 1W6LA 4XAKE 4P99A 2BW5A 4O5LH 2R4SL 5IWLC 4A67A 1ZT1A 2VC2B 4MMYB 1G7JB 4PJBE 2YK1L 1QSEA 3O11A 4UILH 2AEQL 1F11A 5I30H 1LO0L 4LCCC 1E3ZA 5DRZB 1BWWA 3BUDA 1FE8L 4LLUA 5DZNA 1IBDA 1ZANL 5PCYA 2PCFA 3MV8E 5F88A 4D0DB 5DRNA 1NCCH 5IZ7A 3SBWC 1UB6B 5MENB 3LD8C 5HI5C 5JXAH 3VWJC 2QHLA 3IAPA 3NFSH 1BG9A 3RY6A 1HOEA 4QR7A 5EU4A 2NY0D 3EYOB 5GZOA 4P23A 5IMMB 2E5EA 1BV8A 3H2WA 2G5BB 1OP5K 1ZLWH 2VC2H 3UGUA 1S9KC 4PLJD 5I5JA 5KYUB 2ZYSA 1UZ6E 4LEXH 1NSNL 1PQZA 3Q8EA 1BEYL 5F7UA 2PYFB 2C9SA 2E86A 2MQCA 3JWNH 4AQ1B 4CVZB 3W9EB 5HYEA 2C1PB 3R19A 5E2WL 4EDWL 1KJMB 1YZZA 1MNNA 1Z5LA 2A1WL 1W0VB 4HC1A 2BZCA 2ARJA 3MOBH 4X7SH 1P7KB 2GK0B 5LN8A 3CFJB 5HYSG 4TKWA 3FN0L 2VDQL 5DJ2A 5HHPA 3TH2T 3S7GA 3GXTA 2XZQH 1XIWC 3PV6B 1KCBA 4HT1H 5F7EH 2HRHA 2CO4A 4PJ5D 9CGTA 2MEJB 3GI8H 2MNWA 3C60D 1N12A 2X6AA 3D85B 2JSFA 4U1LB 2W0PA 4JJHA 2R0LH 4JO2H 3V5DB 3UCQA 2ZXWB 1AKJA 1DSWA 4NPYB 3O8XD 5K39A 3AW5A 4U6TA 5JLZB 2J6EL 3UJJH 4PR5B 3MJGX 4JFHD 5C0BB 5C2BH 3BT2H 3Q6FA 2LV4A 4X5LA 1FVCA 4K3DL 1PF3A 1AI1L 3HZVB 1GMEA 4QO1B 4D8OA 3H56A 3M7OA 4RDQG 1LJMA 4PMEA 3PJLA 1G9HA 1HKLL 5F7MC 4HKJB 1IAIM 4HJSA 1TVBA 2Z7UA 2EE6A 2VZVA 5EF1A 5A2CA 3ATFA 4AZ8A 2VITB 2GSMB 2HVJA 5C7XL 1LK3H 5LWYL 1MOEA 1FJ1B 4NQCA 3V7AE 2MKWA 4D0BA 2PO6D 3QA3B 2A9ML 3IDGA 4WDIB 5CN1A 1OT4A 1PKQB 1HHHB 2NXZC 1NIEA 1K5NB 1CTOA 5HI4D 2IG2H 2X1PA 4AUYA 4P9MH 3GJFB 3WIHA 1RU9L 3V4PH 4KUZL 2EDMA 3S37X 4CKQA 2FX9L 2YUZA 2DLTA 3LQZA 4OJDH 3FL7A 4FQXD 1SF3A 3K6SA 4XNMB 3R06B 5KWYC 2X1XR 4K2UL 3QCVH 3BH9B 2XQYA 3X3GH 3EYUH 1EH9A 2AQ1A 5G55A 4W70A 3GMLB 3NCEB 3QPXH 1ACYL 1U8MA 4KJPD 4TTDC 1BVLB 1BZ9A 3WIIL 5L88H 4K7PL 4BSVA 3A6CL 5CM1A 4L2LA 3MUJA 5F6HJ 2EKSB 3MYJA 4Y19B 4BWUA 1P5VB 2Q7NA 4M7KH 1Z5YD 2WBJB 3K81A 3BKJH 4HSCX 4H26B 4IRZA 3EO0A 4Z7OE 4GUPA 4WU7B 2R27A 5L7XL 5CSGA 3MUGA 4LQFH 4N87A 5DFVC 4HFUL 4XVUD 3LZFL 2J12B 3BKYH 2A83B 2VDKB 4AEIH 1DP0A 5E8PB 5EUOE 4C59B 5DS8A 3MUGB 3LKRA 4HHAB 4JQIH 1PMYA 4NUJB 4WHTB 4YXKH 3KYKH 1EV2E 3LKRB 3CZFA 1F4XL 5TE6L 1G5GA 1JTPA 3TZVD 4QHKI 3CPUA 3BP6B 3RDTB 5IGXL 2NY3D 3NPSC 4R5XA 1OAQL 2UWEA 2IADB 4KMTH 1WBYA 1N64L 4HUXB 3MJ7A 4TUJB 3C9NA 4GRWH 1N4XL 4HPYH 1MQKH 2MCG1 2AJZB 5ID1B 1DANT 3P4NB 1Q0XH 5K1VA 2LT9A 4E42A 1N4XH 4NN5B 3QS3A 5FKAA 3OAYK 1MVYA 2OTPA 1MREH 3S6CA 3CFMA 1JXGA 3RTQB 1XL6A 1FO0B 2VIRB 4EEEA 3QJXA 4GLRI 5JIMA 3ZTDC 5EU6B 5JIQA 1GSKA 1H0DB 1BQUA 1G7IA 1YPZB 2WUBH 2YPLE 4N2BA 2VO8A 4LPCA 5E6ID 4JG0H 4LHUB 5IMLB 4IHOA 2F08A 1CLZL 3TJEH 1H6TA 4R26L 1WYJA 2ZJSH 5EN2A 3DSNB 5HSFA 3CQQA 3REVB 5B39A 3Q2LA 4DP7X 5G2NA 3KPQA 5EPMA 5GISL 1Q38A 3UDWA 3BWUF 5CSZB 5J11C 1WEJH 3MRGA 2J8OA 4YUEH 1Y0LA 3OR7B 1CGSL 1A2YB 3TJEL 3QHZL 1MCFA 2E56A 5I15H 1KB5L 5HGAB 4ONGL 3TEWA 3FQRB 2FT8A 5ACLA 1UZGA 1FLTX 1UB6A 1PZSA 5FUZH 1CCZA 3MGOB 4E2OA 5GJSH 2ZF8A 1P4BL 2ZZUT 3TN0C 1OAJA 3R0NA 1LEGA 3CH1A 4FD0A 3J2PA 3C8KB 2Y1ZA 3DK2A 1WIUA 3TBTA 1Q0XL 5INDB 1EHKB 2EC9U 2P1YA 4W6WB 1MY7A 3VX0A 4M4RA 1U8HB 2VMJA 3ZL4H 3BLPX 3QORB 2EE0A 1AXSA 3WS3B 2CHZA 3E9TA 3LYRA 1AKJD 2X1QA 4OIAA 5D6DA 2O6FA 2MJWA 2BSBA 2VOTA 4QHNA 2HT4D 1ND0B 3T2PA 1TQBB 2A9MH 2Q2EB 4PJGA 1WZ1L 5D1ZI 4NO3B 4QTIL 2CKBB 5D6CB 5BUAA 2ETWA 4H88L 4PGBB 3LEXB 3JZYA 1HYSC 4GG8A 3RWDB 5IHBA 1VKXA 1E2WA 4TS6A 3VYNA 4PJ8C 1WFJA 1QBLL 5D5MA 3W9EA 3MX0A 5DVLA 2BP3A 5F96H 1L0XA 4HHAA 3FUNA 2F74B 4F8NA 4HFUH 4M93B 4Q89A 4RRPG 3VFNB 2OMXB 2GC7C 2NX5E 3HHSA 1SN2A 3IF1B 4LEEA 4IS6A 2J8UE 3GSUB 3IFNH 3MMEA 4M02A 1D6EB 2BX5A 3D69B 4MZ2A 4ALAH 3BIKB 2J6WA 1PTZA 2A73B 3GXPA 3MNMA 4I3RH 1BIIB 1ZLVK 4KFZC 4UM8B 5B3SB 5KVFE 3QQ3B 3D0LA 1X5LA 3GSWB 1S5IH 3QWQB 2NTFB 4IU3B 4PJBB 1MF2L 1XGPB 3FSOA 5IMMA 3PWUA 1HXMB 4KOBA 1V5JA 3KCPB 4UTBA 4WENB 3OPZH 4NIKB 3ILPA 1JXJA 3X3GL 1IGML 2XC8A 1B88A 2OJEA 5E70A 1A66A 3ECVA 4HLJA 2H32A 4MLIA 1XBDA 4EN3C 4LVOB 2H9GB 4NSKA 3NIGE 5AZ2L 3UBFA 2HB0A 1KELL 3BQUD 5F7WC 5F8RC 4BFJA 3A6BL 3QDGA 4LCWA 4MMXB 5E4AA 2DIAA 3H2PA 4WWPA 5TQ0L 4DP4X 5C71A 2VMEA 2UVEA 4GRLC 3FT0A 3MGTA 1S9WA 4L4VD 4R0LC 3RDTD 4Z7WE 2ISDA 3UTTA 4MJIA 1BEYH 5T1LA 3FU9A 3DUHA 1NSNH 4IMKA 3OC8A 2APVA 2VSDA 4LHJB 4GEIA 5E5RB 3HN3A 4F2MB 1V7ML 5T3XL 3RU8H 1WF5A 5IUCA 4M5SA 1OF0A 2BINA 3AUVA 2X4TB 4CN6A 3LN9A 3VXTA 3PP3K 1P84J 3TPKA 3MLYH 2RD0A 5JXAL 4JM2B 3GPSA 1QSFE 2VR8A 3PUUA 4QO1A 4YWGH 2GITA 1I8AA 5DJZA 1G0YR 5ICXA 3CXHK 5TD4A 2WM0A 4IRJD 4EJ1C 4JPWH 1HYSD 2BH0A 3WJJC 1QKZL 3KLQA 1MW2A 3LNGA 1OO2A 3FZUD 4UOW0 1KCKA 2BS9A 3SCMB 4DTGL 2QBWA 3WLWC 3TVMD 3GI8L 4F7EB 2ESVB 1JWMA 1HQRB 4PB9L 3SKOA 2W60A 4ZXBA 1P2CA 3F6JA 5HYJB 1I7RB 15C8L 3HTLX 3CTTA 4G6JL 5EFIB 1XH0A 3TX4A 5FO8A 2NY2C 3HNSL 2X0VA 1I8IA 5F7NC 3LH9A 4G1MA 2A1WH 5IFAL 3WFBH 4OCSH 5E8DL 3ZE1E 1DJXA 1X4ZA 4Q6KA 5L2KE 1NIAA 1VFUA 2E7LC 2WN3A 2Y5EA 2EEFA 5EIIA 4FXGB 5A2BA 2X4PA 3KXFD 2XX1A 3VJ6A 1VJSA 4X4XA 3LQZB 5TH2B 1BJ8A 2FWLB 4PJ9D 5DHYB 3O41A 3FT1A 3AREB 5JQIB 4EI5B 1PYWB 2GT9A 2O6PA 3IRPX 3VFMA 2NR6A 4NQDB 1PY9A 3P4OB 1E9QB 3OF6D 4YE4L 1ZA6B 1NCCL 4H1LH 3SQBB 1RULL 2CGRL 2Q86A 5LGJB 5HHOA 5KSUA 3T3MF 2A6KB 2W8CA 3MRNA 4X6CF 1DEEB 2CR3A 1FE8H 2X4OA 2Z65C 2DS4A 1DN0B 3QUML 4GW4A 3FH7A 4LL1A 3EZ8A 4NT6B 3S88H 5A2KH 4FXLA 1NMAH 2YK1H 4W9JC 2NNFA 3JV4B 4MCYB 4P3CL 4NO5B 4JHUA 5CCGE 3QZOA 1ADQH 2WKLA 1KXQA 1B3IA 3OHXB 2J8HA 2WSPA 4F7PB 3B8YA 3GHPA 4L29B 2I32A 1BZ7B 2ZP8A 1C9SA 1A6TB 3G3LA 4MB3A 4AUJA 3TP4A 1AZRA 3HI5H 3G04B 4HIXL 4P57B 4JRXE 2FX7L 2N59A 1JNHB 4HF5H 2FHFA 4RAVB 3SQOH 1G1OA 3VWJD 1S7TA 4YO0B 5KS9F 5DD3H 1NFDE 4G8GE 3S37L 3CG8A 5AAMA 4CGTA 3N50A 5FYKH 1PSKL 2ZCHH 1MCHA 5HDBE 4LARL 3Q43A 3SE4A 2NUPA 4JFXA 2HT2C 1KYDA 5ITBH 1FNEB 2ATPB 4NWUL 2EUZA 1KG0A 5JIKA 1PVHA 1ORQA 4KPHL 2C9RA 5GSRB 2WLZA 1KB3A 5BVPH 2OMZA 1P7KA 1MQ8A 4JUTA 4ELDA 3BOVA 2EEDA 4YBQD 3RVTC 2G9HB 4M9PA 1P0SE 3VFGH 3AAZB 4Z7OF 5F93C 3O3AA 3OMZA 4J4PA 3BGMB 3W2DH 1SXSA 2DQFA 4Z0XA 4OGYL 1JV2B 3L5WA 1KBPA 1FYTD 1N70A 1UXWA 2BDNH 1JGLH 3I75A 3Q01A 4OZHA 1C16B 1SXCA 5D4IA 1S7VB 4N0CD 5FA3A 2F18A 1S9VA 3IGAB 4ADGA 4KHTH 2QSCL 2YPLB 3FTGA 3O0LA 1BM7A 1K6QH 2RHEA 4LLWA 4YDVB 4DHLA 2L3BA 5CBEB 1MFEH 1B9KA 3H42H 1LEIB 3BQUA 1CXKA 1DQTA 3QJHA 3SBRA 1QSVA 2CHDA 3MLYL 3JWNG 1UWYA 5FAAA 5IBLC 3TEYA 4WEMB 3GKWL 1EK3A 1J10A 4IOFD 2BP8A 3HKZA 1I8MB 3KHQA 1A1OB 3PS6A 4N5ED 3NCJH 4ZTPH 3L95B 3QZMA 3CSBA 4LLQB 4PI0A 5A1AA 4U1KB 1E3XA 2BVEA 5F9JB 5LXGH 3ULVH 1DJGA 3PHOA 2ROXA 4XCNA 3T2QA 4FQXA 4BCXA 3HC3L 3PE9A 5EO9B 3GSNL 4CU6A 5HGDA 4NCC1 3VRLE 1J11A 2BRRL 1V05A 1CDJA 3QB7C 4P0DA 4HWNA 1DVSA 1EEZB 1X7QB 3FUDA 1VCBC 3PPEA 3QH3B 2J1KA 3MLUL 2BOCA 4L48A 3VSUA 2RFXA 1EA9C 3OR6B 3QIWD 4L3CA 4MNHA 2YPKB 5AZEH 1A6AA 2GFBB 2UYLA 2ZP0T 1EBAA 2E9WA 3PNWA 2D7MA 2VDPL 3F85A 3SN6N 5HJDA 2DICA 2YGVA 3W57A 1FFOB 4PLKC 3RJOA 4BQ6A 4LAJH 4KY1H 1TJIL 1OGAE 1CXLA 1VAHA 3N6YA 1GCYA 3R7QA 2OP4H 1ZGLA 1E4KA 1CD8A 3S5YA 4ABUA 3D05A 1CE1H 3QJRB 1BHGA 2DDQH 3CN0A 3DIDA 3KPOB 5IB1A 4I3RL 2H1PH 2XZZA 3ZBMA 3EJTA 4GP8B 4NHUB 3FQTB 3NA9L 4KQ4L 1JHKH 3C60C 3GSNB 3L2NA 5DHEA 5LGKA 5GQBA 5B22A 2ZG1A 4JPQA 4JJ5A 1I9RH 2NT0A 4NJAH 4NRYB 2IANB 4R7VA 5T5NF 5D6CA 2R23A 3VXOA 2GIMA 1OK8A 3GSVB 1L7TL 4OZIA 2EDBA 1WTGT 3ZDZE 2WWKO 4WEBH 1KY6A 1JE6A 5GSRA 4U05A 1T1YA 2CLVA 3HG1B 5AAPA 4TPRL 4R7DB 2QQKH 3RGVC 5DFTA 3MA7A 4ZFOA 2F5AL 4NYLB 2KMWA 2P4AB 3BT0A 4JRXD 7TAAA 2NY6B 1P2CB 2CBQA 2VLME 4MXQC 1EFXA 1MCKA 4YDNA 4IEFA 1KYOJ 3RY5A 3T1WA 5JHAA 3SCMA 3VXSD 4MNQD 3RLSA 4A2EA 1NCIA 3Q5OA 4JFEE 3CAFA 4CN4A 4G82A 4A04A 3TVMA 1XXFC 1J1PH 4HEPA 1OW0C 2BVUA 4GI9A 4JFOA 4RZCA 1AO7E 4XMLL 4ELKB 3QCTH 3BH8A 4AMKL 4OVUA 7FABL 1NC4B 1E9PA 1QMUA 1MIMH 2XWDA 5ELIA 2PR4L 4GW1A 4YBHA 3IDMA 4N2AA 3ECWA 5DJZB 4XBGB 5ICXB 4DAGL 2HN7A 1WFMA 2VLKD 2C9XA 2J3SA 1G1YA 5SWZB 4Z7AA 1MVFA 2KC0A 1CK0H 1U58A 1DBML 4TVUA 2OMWA 1TYRA 4OF3A 3F7QA 3EH1A 4L18A 4PJ7A 4YX2H 5KSUB 4CN1A 5I6XB 2DYPA 3D5OF 3BAJA 3EFFB 3P30H 4PJXB 5T1LB 2EO9A 3V6ZA 3S8FB 4P2QB 1E4XH 4JKPH 1E5ZA 3QC6X 1DVYA 5ESQA 2VLJD 3APDA 3DOSB 4JM0A 1KXHA 4M1CD 5IQNA 3AG4B 1QX1A 4GAYA 1J8RA 1N8ZB 1OPOA 5DO8A 3RVXD 5E6RB 4ZMYA 2X4SB 4NP4H 5BRZA 4AIOA 2K6ZA 3WAJA 1XGUB 3KPMA 1PZDA 3NZHH 1WWWX 4Y2OB 5CJOH 5CGYC 3ZE0E 3KJ6L 3U2JA 5KVEE 1V54B 1T1ZB 2QV4A 4EPSA 3SPVA 2W59A 4B96A 2QHRL 2E27H 3OKEA 1H6EA 3QYCA 3SGDI 4IOSA 1UGKA 1UYWH 9PCYA 3GUTA 1T0PB 5CGYD 3ECUA 1EHLL 5D9SA 1PY4A 3VXUD 1DEDA 3H3PH 4ZS7H 1M71A 1FC2D 3CQFA 1KBBA 5BRQA 3RVXC 2EDNA 4WFGE 4P4RA 3E6FA 5BUPA 5LN4A 3PL6D 3MRRA 4FNTA 3MZTA 3V4UH 3T3MB 4N28A 2Y6SC 3TV3L 4U3SB 1GOGA 2VLKA 2FE0A 3UYOD 4WJG3 4WI2A 5B8CB 4OZGE 4XBMA 5HGBB 5DS8B 4HIIA 5HI4C 1WAAE 2F8IA 1XMWA 4UQDA 4YC2C 5T1MA 5CBAB 5SWZE 4GUQA 1U6AL 4MA8H 2NLJB 4K23L 4M8UA 2QR0A 2YJLA 5DI8B 3K6DA 4KROB 3MUHL 4RFNC 5F9OL 4D9RD 2ODIA 1U8IA 2FLRT 2P24A 4OCRH 5L4FA 3BKYL 3QEGL 3NCWA 3FTUA 2BIOA 3QFDB 4NQVA 3WS6C 2ED8A 4G8IB 4UCFA 3DUUB 2H6UA 2FB4H 3KMDA 1QEXA 2EIKB 2H5UA 2VWEE 5IJDC 3VXSE 4Q2ZA 1I1YB 5C0CB 3WLBA 1EZUA 3HG4A 2EDOA 2DQGH 2C3XA 2F8VA 3BAKA 3QPKA 4JFDE 4M56A 2AK4D 3U0TB 4OCRL 3VXNB 5FC9A 1GIGL 3VM5A 5E94B 5T3XE 3NIDE 1A6UL 4JFZL 5D7JA 3UGXA 2BSRB 1GRWA 3BYYA 2KLSA 3ML8A 1J5DA 4N3TA 4G9FD 3NN8B 4K2UH 4QMEA 3ALXA 3FTWA 2ZG3A 4JPIA 4UTAA 1ZWIA 2RQEA 1TTRA 5EEXA 4JREC 5KYWA 4MAUL 5ACMA 5HVFB 5D2NB 2PWEA 2PR4H 2F8OA 5H35B 3JWNC 2JNZA 3UTSA 1A8JH 4Z7QE 4H8UA 5D2NA 4XTRC 4TRPL 5IQ7L 4X5XB 1HZHL 3GSOA 3FCUB 1BOYA 1CDGA 2XZAH 3ARFD 2VDNH 1LK3L 3NYKA 1DVUA 3HMXL 5C0GB 5J6SA 4GXUN 4PRDA 1S7QA 4G1EA 1T6BX 5AAWA 1SY6H 5EU7C 1LNUB 2QHRH 1MJUH 4POZD 1G7LA 4QRSA 5ISZE 1WIOA 2H6PA 4XMZA 2CLRA 4KKCC 4CU8A 5T1KB 1NANH 1E7VA 2CPUA 1MCRA 3MRQB 3MLZL 2WKOF 4L5FE 4KDTA 1T1ZA 3GMRB 3H9SB 1DBJH 4JRYB 2V2WA 3RFZA 3LIZA 4UTBL 5JHBA 2BNRD 4K3DH 4O4YL 3C5ZB 4BM7A 5DHVH 4Z7IA 3BWAA 2JJSA 1L7TH 1T21B 4AKPA 3EJRA 2YD9A 4E9RA 5LDSA 4EI6A 1EVUA 3COOA 2LR4A 3PGDB 4PJGF 3O6LL 5JORB 1CDCA 3QZPA 3O6FB 1G9NH 3M1OA 1RK1A 3V79C 1DDHB 2MPVA 4PMFA 3LVTA 4HS8L 3ZZ1A 3AREC 2DN7A 4QOKE 2D7QA 1UURA 1DBMH 3OL2A 5E4EC 4A55A 1ND0A 3F62A 3O3DA 4CSZA 2VJ8A 1CGYA 2BWIA 5J11B 2PYED 4IGBD 3VXOB 4OZIB 2VM4A 3MCLL 4IHBA 2ITCA 5HDOA 3NZUA 3BN3B 2YWZA 4HCRH 1A1MB 1TCRA 5FO9A 4WNQA 1ED3B 1FH5L 1OALA 3FN9A 2GKIA 2G4GA 2Y7MA 3VFPB 2HKHL 3BGFB 4W9CC 4RGNE 1NGWB 4OCMC 1J1OL 4UQ3B 3HLAA 4YXLH 2KS0A 3BPLB 3O45B 3QDHA 5AUMB 1IKFH 4IBVA 3S4SB 3QJOA 1HT6A 4BFGA 5B8CA 5IWLA 2HX9A 4ODTL 2ENSA 2BZDA 3BESR 3B2XA 3DJSA 3KDMB 3AJ7A 5EBLA 3IB4A 4JPSA 4BYHA 1XGRA 4JDZB 3HC3H 4QRPE 3EJJX 1S7WA 1KG0B 2NY7H 3HPJB 4ATTA 32C2B 3TIEA 2CD0A 2WLLB 1P9MA 5TGBB 1XGTA 3IMBA 2LE9A 2YUWA 5J9PB 1MVUA 1ZANH 1ZLEA 2EZ0D 2XG5B 4MNQB 1IEAB 2MH4A 2VRQA 3LKSA 3S5ZA 4JLRB 1C12A 5DSCA 3TCTA 3ARGA 3WY3A 5I30L 3ZIMA 5KN5B 1GY1A 1CF1A 2YQ2A 3WV0A 2R4SH 3JTTA 2VGLM 2H0FA 5DDHA 3GSNA 4GO9A 3ATBA 4MA1B 3P0VL 4DJMA 4LLQA 5E9NA 2IQAB 5IB3B 3W9DB 2AZAA 4S1DC 5AW8B 5FF6B 5K9JH 3PWPD 2CDEA 1UACL 4KY1L 5B7FA 3BP4A 2Y7OA 3LMJL 3A67H 4QYOB 4RSYA 2AJXL 4Y0GA 1JGLL 1MI5A 1SBSH 3D0VB 3FONB 4X5WA 1AH1A 4R4FL 5FGSA 4GKZB 1GHFL 1W0YT 2CIIA 4I0PA 3WNOA 1BFVH 2ZONA 2YFNA 1KYUA 3F7RA 2ZXDA 4XN2A 1KIQB 3T3PB 3KGRA 3B7UX 3NSDA 4AMWA 5BS0A 3LXCA 4Q6IC 1ZDSA 4S11A 2D4DA 5IMKB 3HFML 3LQMA 2XWCA 4G80A 3RX8A 2ZPKL 2WLJA 4MJJA 4MS8D 4OSUL 2A6JB 3P3SA 5KBDA 4G59C 4KPHH 2AJSL 1PG7H 3GLDA 1AE6L 1BQLL 3IDMB 6FABH 1E40A 1F4WL 2DYSB 1F4HA 5K5YA 1WFTA 1Z9NA 3WY4A 2Y6TE 1IGTA 1M42A 1TZIA 1P53A 4RMVA 5H8DA 5JR1H 1NOLA 3VGGA 2IDTA 5D9SB 3GMQA 4JHWL 3BVXA 1SMOA 1U3ZA 2D2CC 1T20A 1Z9OA 3D08A 3JV5A 4GP4B 1JNLL 3R1GH 5JW4R 3EJSA 1XF4A 4ZUWA 1NMCC 4XVJH 4L0ZA 1QLEB 3KPMB 3T6VA 4JG1H 2IQ9L 4WLCA 2VYRE 1D5XA 1SLVA 4NENA 3C5SB 3DOSA 3LDBB 2DI7A 2FUTA 1YYLL 3GZOA 3T65B 5I71C 4AZUA 2ICWA 4BDVA 4JVUA 3MUZ1 3D2TA 1BVNT 4JHVA 4X99A 1OSEA 5C0NC 3PWLA 2H3XC 3JWNE 4PJEF 3LSOB 3QDJE 4NZDA 3FQTA 2W0LA 4DFHA 5E2VH 2AITA 6PCYA 1OEZW 4JZOB 3ZTJH 1RULH 3MPCA 5DHDA 4ZFZB 3LY6A 5I73C 5KTEH 1AO7B 4K3EH 1JGUH 4AGPA 3QJFA 1I3GL 3AY4A 4HKBB 1QI5A 2DL2A 4HIEB 2JTDA 4MLSA 4XC1H 3B3IB 4KKLC 4P23D 3D6GA 4A63A 3LH2L 2L4OA 3O9WD 3EG9B 1HVXA 4HFWA 5LNGA 1O7DE 4NNXA 3VTAA 5T5FA 2J6EA 1SEQH 1NKRA 3T4AB 1SLXA 1N68A 4XAWL 3RWHB 2BVQA 3O9WC 43CAB 1PZ2A 2NUPB 4KNQA 3VDBA 4IIQC 1AQDA 1ZJBA 5EZIH 1CGWA 1YA5A 2CA4A 3R0MA 4Q6IA 5E99L 1ITCA 1NCAL 1OB1B 1VFAB 4LCYB 5AYUL 5FDWB 4L8BA 1KJ3H 1RUAL 3QEQE 4OQTL 1QRNE 1H8SA 1KJ2H 5AWNL 5JQ6L 1K2DA 3O4LD 1KTLA 4QI3A 2VDLH 3FF7A 3IJ7A 1GS6X 4NN7C 1KV3A 4OZFG 2W94A 1D9KA 4ZSOB 4UQBA 1AKJB 4EI5C 1RY7B 2FO4A 4PW4A 2PWFA 5SX5H 4DUXA 4N68A 4ORZC 3GSVA 5KZCD 4AJYV 3R4DA 4LOFA 5BS0D 1QKZH 2D7PA 4ZW3A 5K1NA 3UYRL 2I9LB 5FB8B 2VLLB 2DWSA 4R5TA 4OZGF 5KG9A 3A24A 5D7LA 1P7QB 4UT9A 2ZAHA 2VDMH 1TQCC 1GOHA 1IGCL 4P2CG 2A4CA 5FGBA 3ZZLA 2XT1B 4IYKA 2Z92B 3K2KA 1NOAA 5IG7A 2HRLA 2PF6A 4KX9A 4NWTL 3T08A 4KKNA 1JHLL 2OA9A 4P48A 1SHWA 3C6LC 2KLTA 1MXGA 4ETQA 2DD8H 2WWOA 1XSIA 2ZKHL 2WD0A 2AJUH 1MW3A 3WN5A 3CLWA 3OWEA 1I53A 1V7MH 3I6LD 1OAYL 3NCXA 3Q44A 4P4KA 4N90D 1A7BA 3CDGA 3I6GB 4I88A 3O6FD 3DXAB 4R96B 5F89A 2HTLD 4OUUB 4GRMA 3T4AC 1EQWA 1MFMA 3QNYB 3OJDA 5I1DB 4JDVB 1ID2A 1ZOXA 3UPAA 2I9TA 1ACZA 3LZNA 4DGVH 1JXFA 1P6AB 3Q9QA 2MQ3A 5EC1A 1FG9C 3IU3B 1TTAA 1HEHC 5JXED 4XP6L 2V2XB 1A8ZA 5LO7A 4J6RH 5KSBB 4P5MA 1NCHA 4O51A 3ARDC 2ZXGA 4UM9A 5CEXB 5F21B 1OSPH 4AW4A 1KXTB 5E00B 3MRDB 4OIBA 4RGMB 3B4NA 1IGMH 4RBPH 3I02A 4UZSA 2FQGA 3P73B 4K07A 4C56E 4DW2H 4A7TA 3RZCA 3GSQA 3RVVC 4ZX3A 1O9WA 3QDGD 3AFLA 3KCWA 4LOEA 3KLKA 4OZIF 2WGXA 5I18L 1D2PA 4JBSA 3EHBD 2NSXA 4MQ7B 5AVUB 4OM0L 1TQSA 3DI2B 4Y1AD 4NZTL 3DO7B 1RZ8A 3JSSA 1X5JA 5DC9B 2X89D 4ZT1A 1FL6A 5I6NA 1O6SB 3BGFC 4GXVL 5EZOH 1SEBA 2YZ1A 3IDXL 3QWRA 3HZMA 1BZ8A 5I1EH 4KKBD 4P2YA 5F1NA 4NO5A 3RX5A 4HKXA 2X4UA 1BXXA 2QMKA 5DD5L 4MXVF 1NC2D 4WW1A 3VRJA 2OMUB 4N2LA 3FO9A 3PXJA 2WBXA 4KXBA 1UCBL 2D7NA 4L05A 3HE6D 2Q3AA 5HGGS 4XWGL 2OYMA 1CFTA 3VJ6B 3VXMD 4FI7A 3VD0A 1ZV9A 4UQ3A 1JDDA 3NPSB 2A99A 2ZWYA 4TTDD 3UX9B 1IBBA 1EAJA 5FK9B 4ZYKB 4QJ3B 1UM4L 3QQ9C 2AQTA 5EU6A 3CU1A 2OZ4A 2FK9A 1EZSA 3V6OC 3WXWL 2JB6A 4P59L 1M7IB 4A2DA 3VI3A 3QI9B 1IFRA 5DJ0A 3FH5A 2PWHA 4G8EB 5D1ZB 2XRAH 3M6DA 3MDJA 4R0LB 3T04D 3TNMA 1MVUB 3BEWA 4AWJC 4G7QB 3B37A 2O26U 5GHWL 1NLDL 5F6HI 1J8HD 1KB5H 1F1AA 3VB9A 3GSXB 3IYLW 3NABL 4C83A 3ZHLA 3B2UD 1XH3A 4RFEA 4Y2LA 3L3IA 4TNWK 5HHNB 5J6GA 3GINA 1AHWC 1IU1A 3KJ4C 3O2DA 2FBOJ 2NXYB 4M1DH 3ZGIA 5J1AB 1YY8A 1UG9A 1IAIL 5BS0B 3VQ2C 1NGXB 1XHHA 1LDPL 5T1KA 4OI9A 3C6SA 2OSLB 5ESAA 1CLZH 2CO2A 2B20A 4MAYC 1YDPB 5DCCA 5E8EB 5IHZA 4FFZA 4GKZA 4F8TA 3MLRH 2WUBL 4KNUA 2P48B 4APQA 5BW7C 5L4IA 3STLB 2WOBA 3F5WB 3QJFB 5KAQG 4G80B 1G9MH 5HTSA 3GXDA 1E27A 2HRPL 1Y6MR 2DQHH 5HJGA 1RZ7L 3O41B 3IWVA 4IK6A 4WI9A 1I82A 4KK8C 1QFWI 4R4BA 2WVTA 5L2JB 4PREA 3X17A 1RZKL 4K94L 3TH4T 1ZE3C 5F3BA 1C5CL 3L3OC 2K7PA 2FJGB 4LCWE 1AGCA 1U8QA 4YEEA 4IU2B 3ES6B 4CAGA 4HJEA 2UWEE 2P47B 4KKAC 1U8HA 3UTPD 1CL7H 2NY3C 5CU9A 5HBBA 1AY1H 3BH4A 1UXSB 3BMWA 1U93B 3T1FA 5DJXB 3EOBA 4YHNA 3KD4A 1KEGL 3I50H 4AVHA 1LEGB 2JLPA 4KBPA 5F7KC 3V4PB 3OKDB 3L13A 1ASOA 4NZRL 1KCRH 3X12B 3U4AA 2Y5TA 3E7JA 4L2YA 1PBYA 3UBXB 4BFRA 4FABH 1L7IH 1TG8A 3LDBC 5I6MA 5EO0B 3A0OA 4MRBA 3ZKXC 2ZG2A 1BZDA 2R1YB 3PWUB 2VXVL 1IGTB 1TZIB 4UV7L 3SHSA 4NQVB 3AXLA 2NMSA 1L7IL 2Z0UA 1S7WB 3F84A 5JDJA 3ETBF 4NS0A 3LRHA 2R1WB 1R9FA 1YYCA 3N40P 4NZRH 4LF3B 5MEPB 3EOYG 3WNPA 1X5MA 4JG0L 2NLJA 5DI8A 5DEJA 4GG8B 5DXWA 3MLSL 2YAOA 4L37A 3RWDA 4DT2A 5FCUL 4D7BA 5AENA 1YEJH 1R3IH 4N8CH 1L9PA 3A6CH 1JZ8A 4DKEH 4JR9L 3QCUH 1H0DA 4FFZH 2AQQA 1AY1L 2OJ1A 4U1NA 5FYLD 3VFWA 1TDQA 2CM6A 2P8MB 3IGKA 4GMSH 1A1MA 2JCCE 4MX7A 3O6ML 1FGVH 4OIFA 4X7TA 1RFDH 4F5CE 1A65A 3G6AB 4I18C 3GXFA 5D7EA 1J9QA 43C9B 1BD2E 4LDEB 2P8PA 1BFOA 3U0PB 1HCFX 3NAAH 5FGRA 3TCLA 3S8WA 2OFQA 4JX0A 3O6KL 1SHSA 4IRSA 4IKNA 5C0CA 4HS3A 4IBSA 4OZGB 4I18A 4HP5A 2Y7QA 4XB8A 1CE6B 4MJ5B 4ZMLA 1FZJB 3RKDD 5ITFA 1KJMA 1N26A 5HXMA 2DBJA 2AMUA 4DF9A 3OJ2C 2NY1D 3N42F 2TRYA 2XG5A 4KOCA 4YPGB 3OXRB 1WA1X 1XR8B 2RB8A 4LCUA 4FQHA 3PWNA 2A83A 1I7TB 4CNIB 4X50A 2COVD 3QUXB 4IJTA 4WDIA 1R24B 1MHPL 5C8JA 1ZVSA 2ENPA 1T1WB 4U1JB 4BWTA 3KAAA 1VLXA 3Q1SL 1NCWL 1ZVSB 1KXQE 4YVNA 2GJRA 3MACH 4FTVD 3G6JE 1VZIA 4JDTL 2NR6D 4MJ2A 4TSCH 5FFGA 5L88L 5TJWK 3U7YL 2BVOB 3FN3A 3QDMD 1J88A 2FNWA 4F9PA 1MW1A 4YHNB 4RFNB 3FB6B 3V6BR 3EYUL 4ZK8A 3FPYA 3INUH 2BNQE 2UXTA 3AT8A 3WXVH 5MERB 3MV8D 5HVHB 4E42B 5JW3H 1YEHH 5J89A 1IT9H 4OQTA 4KUZH 5C97A 1GTFA 4ZZKA 2R1XA 3I9GL 4DN4L 4KQ3L 2CZNA 3MOBL 3D39B 2JJUA 1GGCH 3JVFC 3K8KA 2KT6A 4XCFL 2YAFA 4JDEB 4LPYA 4DZBB 5E2WH 3BP6A 4ZO9A 4R9HA 3LQAC 3L3OA 1IM3D 3D34A 4MDJB 3TWCL 4AC4A 1QLFB 1NEZG 4HV8B 3BP7B 4AIZA 5D96C 4AM0B 2AXJA 4U7MA 1H9DA 5AYTA 1UQSA 3QUZA 2VN6A 5EZOL 3AADB 1XCXA 4LDOB 3GHBL 5E2TL 3WNJA 2DWYA 2E9IA 4HJJH 2PO6C 2WBWB 3LKPA 2JQZA 4O2EA 1JNJA 4L4TB 5I0XA 5I1AA 4P5KA 3BISA 4UILL 2HLFC 1QSFA 3K4ZA 4ZFFA 2VR9A 5AD0A 2YD7A 1D5MA 2R2BA 4P5RA 4DW2L 3WO3B 5D1ZD 4XCCL 4TULL 1E5BA 1OP3H 4L0YA 4NGHL 5EZLA 2JJTA 5MENA 1PD0A 1OD9A 4G8FA 4MS8C 1LILA 1P4IL 2C9PA 1MFDL 2HZHA 3MRRB 1R0AL 1KPRB 1TVHA 1LE5A 1G7IB 1YPZA 3FN0H 3JWOC 5AOZA 3G6DL 1B4JL 5E51A 3ZMRA 1FVEB 3NJKA 4Y4HD 1ZSDA 4ELME 2LTQC 1WK0A 2FIKA 3DJ9A 3MOAL 3MODL 4MYPA 5D1ZC 5TDPA 2ZCKH 1KDIA 1M1SA 4S1QL 2NNAA 3HG0A 1L3WA 3FTVA 3QW9A 5T1KD 5DU7A 5JHDB 2B1AH 5EU3A 5C08D 2WZ6A 4ECNA 3FYEB 1G94A 3MBXL 1CDUA 3L1GA 5DZVA 2DYPD 2FAUA 1E4WL 3F64A 1WBYB 4HUXA 5D72H 2DTSA 1FV1A 1OZUA 4WW1B 1E27B 1HWHB 3TBWB 3QORD 5D1XB 3PWVA 1C7SA 5DMIL 4ZUUB 3UPCA 3V0WH 5I8KL 2OL3B 1KJ2A 1U8PA 4N2FA 4D8PB 3DDFA 5E23A 3AS1A 3L5XL 4JE4B 4WHTA 4Y5VB 2V5RA 5AG8A 3ZE1F 3POCA 3QJHB 4YVUA 2BSTA 2QADC 3VFTA 3H7LA 4JZNA 4B95C 2IFFL 4PR5A 5C0BA 3PUCA 4GH7B 1SQMA 2UXVA 1M05A 3FCSA 3MNDA 2EYSB 2FEDD 3RHWF 1QEWB 2MQ0A 3UGEA 2KDGA 4ZOAA 4F27A 4I13B 4KZCA 2XWBB 2DKUA 4QKXB 3G5YA 5IEHA 2BNRB 3CHXA 3FU6A 3CVHH 1BECA 4RFOH 4XBGA 3QXDB 4FNLL 1MN4A 4ODUB 1S7UB 2OBGA 3O81A 1XCWA 4L9LC 1UWEL 4V1DB 2R4RH 4Y19A 4PS3A 3JUZA 3NJGA 1U92A 5C3TA 3EJZC 3TNMB 3MBEA 1TOXA 2A6DB 3U46B 2VDKL 4XPTL 4FL4C 4TVPE 2B4CH 2M1KA 4UINL 4YBQC 1NCBL 3BUBA 4F2EA 1VENA 4F9LC 3FB5A 4JN2A 4AJWA 4ZD3H 1I3RA 1SEQL 4X98A 4EN3B 3BPNC 1HEZB 5DK2A 1P1ZB 3WDIA 4Z3TA 1GYWA 4LKCA 4AQAB 3BO8A 4KK6D 2O72A 3Q5YA 3ASWA 2GCYA 1GL4B 3V95A 1U8IB 1RUPL 1URZA 3C8HA 5EU6E 5I1HH 3BQUB 3MRIA 3TA4D 1GZQA 1QA9B 4FS0A 3PP4L 4G9FB 4LVNB 4PBXA 4PW9A 1ZLSL 4DGWC 4LBAA 1P5UA 5LB1A 1NCUA 1WHPA 4APQC 3AM8A 1J9CT 2VJ0A 1KB5B 1X5AA 3G04A 3GZQA 4LOVA 1F8TH 5FOBB 2D2OA 1EAOA 4WWKB 4YLBA 2DQIL 5I6LA 4G7SB 1S9XA 3CC5B 1M6OB 4U1MA 4OZFB 1JI1A 4HULB 2IDUA 3EJUA 4R8WL 3IXTB 1MI5D 3JV6B 3REWA 3BC9A 4UT7H 2WVSA 4HDIA 2PABA 4WGVB 2VCOA 1DFBL 2YEQA 5IK3A 4AGMA 4Y4KB 1WA0X 4PRNA 3M17A 4MSWA 4GI8A 5F7BA 2ZNWA 3UO1L 3K6FA 4H0IA 1LLAA 2OX5A 1Q94A 2VERN 1Q1JH 1JNNH 5CINH 5I71B 3ZDYB 4YFLF 3QAZC 5DT1H 5FHBH 4GUCA 4U1LA 4E9SA 3TO4D 1NKGA 1KTKE 5SWSB 2IAND 2ZYHA 1TEFA 1NBVH 4FOMA 2X4PB 1A3ZA 1NMCB 1NWPA 4KWUA