4W9DC

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methyloxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 3)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
140
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 37
structure length 140
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9dC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9dC01
4BKSC 4W9EC 4W9IC 4WQOA 4B95C 4W9FC 1LM8V 4AJYV 4W9JC 4W9LC 3ZTCC 3ZTDC 4W9DC 4BKTC 1LQBC 4W9GC 3ZRCC 4B9KC 4W9KC 4W9CC 3ZUNC 3ZRFC 1VCBC 4W9HC 5LLIC 4AWJC
chains in the Genus database with same CATH superfamily
1CXIA 3QIWC 1J8RA 4LP5A 4MJIA 4G8FA 4PJEA 4NP4H 2YGPA 4H20H 5BZZA 1OE2A 3F83A 3Q1SL 2GTWB 4GSQA 3HA0A 3ZE2E 5JHAA 2JJSA 1Z3RA 4ZO7A 5CN3A 2EXTA 1RIHL 1BHGA 4B9JA 2VTFA 2XKSA 5D7JA 4PPTA 3EF4A 3ZDYF 2ARJA 2OL3H 3M45A 1YNTA 4Y0GA 2IV9A 3OLDA 2JIXD 1YMME 1CLZH 1D7BA 2VLME 2X3CA 5BQDA 4G42B 4DK5A 1D6EB 5E5MB 1QFWH 4OZIF 5ACMA 1EMTL 2QEJA 3WGUB 4Z7WF 3SPVA 1YYMH 3TURA 4H1LG 1KJ2L 4H26A 1E5YA 1MREL 1QHQA 4YXHH 4RAVB 1A3LH 3G5ZB 2XSKA 4P9HH 4DP1X 1ADQH 5ICUA 2GJZB 4NHCH 1Q0XL 1H3GA 1GGBL 1GZHC 12E8L 5BVJA 1FBIH 1LQBC 1SY6L 5LDUA 5DFAA 1ZANH 2ZAHA 2C4FU 4IJ3C 5C0DA 1BQKA 4WI8A 3VYOA 2C3HA 2DYPA 3ZTNL 2UWEB 5LVEA 1TEGA 3GLAA 4PU2A 4WUUA 5D96B 2ZCLL 3P0VL 1YPZE 2XJLA 3QHTC 5TE7H 3ROLA 4LKCB 3E1F1 2DQIL 3II3A 1X5LA 4JQXC 2ITDA 3B34A 5DYOB 3V0VA 4GW4A 1NAMB 3LQZB 4WSJA 1BX2A 1U8LA 1U2YA 2FJGB 5FO2A 4F80A 1JDDA 1I3VA 3CX5K 4R96A 4XXWC 3SY0A 4KI5D 1UG9A 1X5JA 3DA0A 1LD9A 4YBLB 1KLGB 1H6TA 1G9NL 2DF3A 3NFNB 4I3RL 3ZT5A 4YXKL 2UZXA 3QI9C 4XNMB 1QWHA 5AYUL 3H9HB 2LQRA 1A66A 2A0LC 4GQRA 1SLVA 2J88H 3P54A 4A7GF 3UCRA 1LILA 1SJHB 4IKJA 1RJZA 3WTYA 4N2DA 3WXVL 5T5NF 4LSRL 4BQ6A 4P2QD 4HG4J 2Y6SD 4LVHB 4F3FB 3LEXB 5AB9A 3I6KA 4LESA 2YA2A 2AJUL 4HSQA 4APQA 1KBBA 1WP6A 1ZVHA 3MGOA 1OAKL 2VDLB 1YEGL 5F71A 5CIPA 1XFPA 4O2EA 2WIIB 1WBXB 4FFTA 1TOXA 4TM9A 5CZXC 2AQSA 2DQEL 2WLJA 3S35H 3MA9H 2WSKA 5DR5L 5FWQA 1HHHB 4B3EA 4BIKA 3I9IA 2E47A 4OIIL 4ODSL 2LLLA 3EO1B 4P5TC 2ZUSA 3D0LB 1G9EA 3LQAL 3CFCH 3B1TA 3RWDB 3X1GA 3LPGA 5IW1B 1A7PH 2GFBB 3B9EA 3PQYE 3Q06A 4O00A 4UV4H 3W0WD 2BIQA 3UZEC 3FF7A 2BDNH 4YMPA 3NIGE 4JR9L 1MW0A 2YMXL 1DVXA 2CHDA 4LVOB 5EBLB 4F37F 4ODBD 2DI7A 5K39B 1KN4H 4FC3E 3X1NA 3FC8A 2YPVH 3EAKA 5C2BL 2P42B 5DMGC 4JKWA 2ZWYA 4GKLA 1EZUA 1R46A 1NAKH 3WO3B 4AV4A 4JG9A 5DRWB 3HVDA 2EINB 2GCYB 2HRHA 1AIFB 3EGXB 4F37K 1LL1A 4JHAH 4V1DB 2JXMB 4XWGH 3GSNH 1X7SA 4L0PB 2IAMD 5JHDD 1XR8A 4P57A 4HIHB 3ZR5A 4JFQA 4YHPA 1CLYL 5INCB 1AI1L 2FQDA 5FV1L 4ZX4A 3B2DC 2NX5D 1IAIM 3PGDB 4OGYH 3C75A 1T0NB 2WKOF 4IBUA 2HLFC 2PO6A 3FF8A 4ODTH 1RZJH 1L0XA 2W60B 4MQ7B 3RB5A 3SQBB 4CKQA 3CFJB 3U7WH 1JVKA 4NZUH 3L1GA 5D2NE 2NY2D 3SDCD 3US0A 1C16B 1SDDA 1Y1DA 4HDIA 2OJEB 3CFBA 1QRND 1SLUA 2COQA 3GZOA 4XBEH 2YQ2A 3MKKA 1WWCA 3UJJL 2XZZA 1OM9A 1R3HA 4LCWE 3D6GA 5IR1B 1DVUA 4OZGB 1OAUL 5ABDE 1K72A 2VDRL 2OXGA 4CN1A 5F6IB 1BD2E 3SPIA 2QR0B 2Q5BA 3A6CL 3ELAT 5FYKD 3HG0A 3LSOA 4PVMA 4UU9A 2QPFA 2YFNA 2VIRA 5FAAA 2YRPA 1PZ2A 4MDIB 3WJJC 3VSUA 2FE0A 4PJ9A 1TG8A 3H7BB 3C60B 4X5LA 5KSUA 3GI9L 2DEYX 4I8DA 5AWNL 4BDVB 4KTGA 3OZKA 3BHBA 4N2GA 2X2HA 4KWUA 3IDYC 1R47A 4G8GD 3QPXL 5KAQF 1GC1C 2NDFA 1UXSB 3QQXA 3LH8A 4KRNA 1TLMA 3CHPA 2R2HB 2J8UB 5DD0L 3IGKA 3BWUC 4GIPD 4PW3A 1IBGH 1P7KB 1K3IA 3G6JF 3NFSH 2C9WA 3DROB 5DHDA 5HHOD 2DWEB 4AL8H 3G6JE 2YXFA 3A67H 1HINH 2PN5A 4GRLA 4NQCE 4YDLC 4ANWA 2R2BB 3BZ4B 2P5EE 3QPXH 5E4AA 2QQKL 5HHVH 1FFPB 3BEWB 4PV1C 4FYRA 4U1LA 1NDMA 1E9QA 5KVFL 1LO5A 3SBWC 2WVVB 4F7PA 3BKYL 2R0LL 3THML 3FTGB 1EBAA 2DQJH 3FAXA 4G80A 3LIZL 1VF5C 4QF1A 3FQ4A 3PV6A 1U95B 2EO7A 1E5AA 2C5DC 2P7TA 2V3FA 3Q6FA 5D7JD 1G7QB 4DIXA 4Y9CA 3IDXL 3IDJA 4MJHA 1CICB 1UZ6E 4N0FA 1E2ZA 4FFZL 3D06A 1MFAL 1EX0A 2VDNL 5FFLA 5A2JH 3F7YA 3IKCB 5FO7B 3QSKB 1C8PA 4JBSA 3VWJB 3HZVB 3ILDA 2XPYA 3NJKA 4QJ4B 3IEAA 4FNLH 1PYWB 4X5XA 4RMSA 2B1AH 2CKBH 4D8PB 1ZHBB 3GSQA 3HVNA 3D25B 4WFGD 4HXAL 4PR5B 1T1XA 3LV3B 4WF7A 3V5DA 4KJPD 3MRCB 3Q44A 4CJ0A 4MSWB 4YAQB 5DVOA 3SD5A 3UG4A 1YPZF 5IWLA 2HKHL 4N90E 5I75B 3GF8A 5E2WL 4AKOA 3S3CB 1EZVX 1NPUA 3VYNA 1HVXA 4QCIA 3IRPX 2VL5B 1LHZA 4PJFA 2F8VA 4HJJH 1NMCC 1TJGL 4GUPB 3AXLB 3L4VA 5CIPB 2EVGA 1KCKA 1BJMA 2DRUA 3P73B 3AM8C 4FX5A 1LK2A 2VM3A 2KZ1B 1INEL 3OJVC 2E7DA 5LWYL 3JTBA 2F53E 2O1AA 4NRZB 2N7SA 4OQTL 4UDUA 4YLBA 5DVKA 5GRYA 1BF5A 1DJHA 1BYNA 1LMKA 3MLXH 2UWEF 2GITA 2X28A 4MCZB 1WQVT 4JJOA 4PRHB 4UAHA 5DD3L 2AQQA 3ZSTA 2VR9A 4KITB 1E50A 1OF2A 1VHPA 3A67L 5DU7A 1VKXA 3O3BB 2EYTB 1XZWA 4PJIF 2XRAH 5E4IA 5FEBA 2Q76B 4N1HB 4PRNA 2WNWA 1R5WB 3ARPA 1XWVA 2IH3A 1TCMA 1JV2A 4M62H 5FFOA 5FLUA 3WOVA 5E0QA 3FT4B 5TD4A 3G5YB 1S9XA 2D7TH 1R19A 1AAJA 3TA3D 3K81A 2VXQA 2RJMA 3MR9B 3UIZA 4NO5A 5TDOB 2JB5H 2ZOLA 3MRCA 1XH0A 3ZE0F 5TDNA 1X9QA 3O11A 1BOGA 4G7YL 1BQLH 3RVVC 3ZDYB 4M1CD 1INQA 1YEJL 1PKQB 4KKBD 5DD6B 2QSCH 4FADA 3HC4H 5BZDA 5EOCJ 4KFZC 3HMXL 4OZIB 2DLTA 3F7RA 5IVZB 4Y89A 1FP5A 1O7VA 5TE6H 4FD0A 4YH6A 2DEXX 2E7LC 2JJTA 3LKOA 1U4EA 4E9RA 5HDBF 1NOFA 2P8MB 4ADGA 4H1LB 5E8PA 4K55A 4LP8A 2Y36H 1I85C 4L1BA 3P4MA 4LCUA 4GIOA 2YAEA 4ODVL 1SZNA 2CR0A 3ISWA 3O6MH 4NN7B 1QBLL 1HWHB 4IOSA 5KTEL 4G42A 3EYQD 1KGYE 1YRKA 2MH4A 2VISA 3IXAA 1J5CA 2Y22A 4JN1L 1M42A 4H25B 5IMLB 1C1EL 3ULVE 1TTUA 4FQLL 5I19H 1QEWA 1GJUA 2ZP8A 1HKFA 2H6OA 5DC2A 5EF1A 2HTKD 5KVFE 3NFPA 1KEGH 3VMNA 3P0VH 2H45A 1JMZA 2BERA 4AGLA 3GQFA 5FYJL 2HPTA 1G5GA 5GRUL 4H8QA 5DT1L 5A16B 1B9KA 3AG2B 3KDMB 1V3MA 3OF6D 2OAAA 4KUCD 2P24A 2H6PA 4HIIB 1U8NB 1HXMA 3TVMD 3QEQD 1U8MB 2YD7A 4DZBA 3IBOA 4H40A 4P2OA 1NCAL 4NBZB 2L0DA 5TDPB 1TNNA 3MHZA 1D9KB 1NGZB 2IWKA 3BVTA 2P28B 1NKRA 3VI3B 4LLQA 1G4RA 1WFMA 3MV8D 4M6NL 5DURD 4PJGA 1CFSB 1ANUA 1CS6A 3MJ8A 2NNFA 3HHRB 5F7LB 3B6SB 1G1CA 1ZKAA 3DTXA 4LB8A 4LO9A 5TQ0L 4LCCB 5D5MA 3U82B 2D7QA 3HPJA 4U1KA 4AC2A 5JOFB 2VQ4A 1JPGB 2Q3ZA 3P9WB 2GSGB 1EDHA 3BQUC 3IGFA 4J39A 4JRYD 2X38A 2XN2A 3MRBB 3VXUA 3MA7A 4CW1A 4XBPB 5HI3C 1JGIA 3DOIA 2XTJC 1CT8A 3EDJA 4L29B 2X1XR 1N9PA 4XAKE 4YN3A 3BWUF 3MLYH 2YPLD 3C6LA 1IKNC 4ZUUA 3N44F 4XVTH 2QVTA 3TBVA 3KXFD 2HT2D 3E8UH 4P5SA 1BQHG 1UB5B 2C8NA 2IQAA 3T0ED 5JPNB 4EKJA 2OSXA 3B37A 5F6HI 3RWCA 1TQBC 4U1SB 3FO0H 4H8VA 5IB1B 1AQHA 3O4LD 4D0DB 4X5WA 1CBVL 4CADB 1IFHL 4D7PA 2TAAA 3DK2A 4TUUA 1KFGA 4K23H 2WJ7A 2G2RB 3K71B 1JF6A 2E3VA 1XT5A 3ULUC 1BSIA 4JFHE 3SGEI 1NBVH 4AIEA 4POYA 5IEHA 2WXIA 1FGVH 1J0ZA 3REWA 2BCKB 3WNLA 5FO7A 2XZCH 3QRGL 1AXSA 2MFNA 5AZEH 3CK0H 3OWEA 1TZHA 3QO0A 4GUCA 5E1AB 4P2AA 3QUZD 1JK8B 1M56B 4D9QE 4MZ3A 2XQ0A 2B0SH 1FVCA 3GXFA 5HD8D 1BWMA 1GL4B 1GAFL 3TCLB 4HMDA 2IPTH 5EBWA 3FUHA 4AM0B 4XO9A 3W11C 3ZUNC 2YC1A 1QUNA 3BP7A 1QASA 3NDZE 4NAMA 3SJVE 1IUZA 3AGWA 4JRYB 3JV4B 3QIUA 1IZKA 2BZCA 3BKCL 4E0RB 2J5LC 1K2DA 4F15B 1UZ8B 3KWTA 3TBVB 2DBLH 1J5OH 1DSWA 2GG1A 4PY7A 4ZXBA 1WG3A 5D7LD 4HUVB 2K8QA 3FTUA 3WY2A 3OB8A 3VFTB 5I1EH 3TTSA 3UTPD 1F2XK 4PJHA 3LKRB 5GJSL 1K5NB 3AG3B 4JFOB 4O9HL 3MOBH 4PHZA 2ARJB 1MNUH 3K2MC 2BC4B 1KT2A 1QVOB 5TFSL 3FPYA 2B1HL 3QFJB 4UTBH 5LDSA 2X41A 4GAYA 3EH4B 3MCG1 4PJGB 4NKQB 5FYJE 3ZE1E 4XVOA 4M7ZC 2JV6A 2CO7B 3O6KH 2W9LA 2YPVL 4XNMA 5TTRA 4HULB 4HCRL 4FJ6A 3OXSA 4FQCL 1GMIA 1A7RL 1A3RH 5KYUA 4ZS7L 3UJTH 3QDJB 2ZOLB 1QBBA 1E28A 4URKA 3BC9A 3HBPA 3QUMB 4NT6B 1SY6A 4X5QA 3BGAA 1MFCH 2FX9L 5IHLB 2BS71 4M5SA 5CCKL 1F0LA 3MNZB 4MXQC 5AEAA 4RGNE 3DETC 4ELDA 4R7VA 4NC2B 1GYAA 1M71A 1TENA 2X87A 3R7QA 4B9GA 5MP6L 4X7TA 1RZKH 4AMXA 3C2AH 4A7VA 2MPAL 4Y8DC 4XCCH 5GJTL 2QQQA 3AQDA 4IBZA 4M1GL 4AZUA 2JTYA 1AVAA 3OKNA 1K8DB 1C12A 3LPPA 3BXNA 5CCKH 5C09E 5CLYA 1CXFA 1Y0LB 1FRGL 5SWZE 3QIUC 3KM2A 3HG1D 3PP3K 1JBJA 1RK0A 1JF5A 4K15A 2DOCA 3SB3A 2XTJB 3HJEA 1FE8L 2CALA 3MRNB 3GSWB 3U0TB 3U2IA 3T2PA 3I6GA 1BZEA 3AU0A 3RGVA 4JY6A 3KGSA 1MCEA 4ALAH 5DMKA 3GLDA 5SX4H 3VVVA 5I5RA 2BP3A 3EFOB 3B3IA 1KENH 2H32B 3QEHB 3IGLA 3SQOL 3MQIA 2IH8A 1S3RA 2PMZA 3QAQA 1DN0A 3QXWA 4PRIB 1HXKA 5HGDA 3N42F 2X1PA 2ZPKL 3EOTH 4K7PY 2WZPD 4NGHL 5DEJA 5CEXB 3H3BC 5KSBE 1M7IA 3O8XC 5EBMA 5GGRY 1XGPB 3K80A 1AGDB 4HBCL 5DUPH 1IM3B 5AOKA 4Q74A 1SPDA 1HZHH 3RVWC 5F9AC 1OSPH 3WIFA 1DCEA 2YO3A 4UTAH 4KNTA 4BZ2H 1NCTA 4EI5A 3QZBA 2VMCA 1WHPA 2J73A 1KF9B 3Q8FA 1JWUA 1KIRA 2GTZA 3X14B 2VZTA 4Y4HA 5GS0C 4BFNA 2YPLA 3UL4A 1EGJL 1NMCB 1SEBB 4JM0A 1WEJL 4G80B 4DCQA 3BD3A 1J05B 3QRBA 1AGBB 4Z7NB 3OAZK 5KSVB 3GT6A 3NT0A 2X6CA 1T7YA 3BLPX 5J12B 4BFRA 4OLYH 5I6LA 2C9RA 2WAHA 2MCPH 3CXHK 4W68A 3V0DA 1ADQL 3VFVB 4OZGF 3PPSA 3ZKJA 2RD0A 2DQUL 3KJ6L 4G7VH 3DSFH 5EC1B 5I17A 1HYRC 2GITB 2X2YA 4IIQC 5JTWA 4ODUB 1X3DA 4KHTL 3FOLB 3PYCA 1C08A 4AJWA 4U6YB 3U1SH 4E9TA 5K9JL 1PYWA 4HYTB 2F58H 5K9QG 5JQ6H 5HYJB 3JWDH 4I89A 1BCIA 1KGUA 3CDZB 1CDHA 3SKOA 3CV5A 5FECB 1DQDH 4WFED 3SGEH 3V0WH 2V3DA 4MMXC 1BVKB 1F13A 3PUUA 4OCRL 1EAPB 3NG5A 3T0XA 3CFEA 5IV2B 3QIWD 5ITFB 2P8PA 4EI6A 4F8OA 2GI0A 5DK3A 5J1AA 3GSWA 1IAOA 1G0YR 3NEOA 3LMJL 3PGFL 3R1GL 4M3JA 1OQOA 1TSHA 2ITDB 3K6IA 4XPGL 2EXYC 1ACXA 1SXBA 3MGTA 3L5WB 1BZ9A 4IRJA 1GAFH 3OHMB 4GAFB 4HA1A 4X6CB 2QPDB 3FQXB 1A6ZA 1E3ZA 1D5IL 1R3HB 1AQKH 2JI1A 2WLLB 3QWNA 4RWYL 3SKNB 3KYKH 4JO1H 4JZJA 1EO7A 1RVFL 1ZRUA 4H2CA 1JL8A 5IIEA 1MCLA 2IPKB 4H5SA 3O9WC 3H2PA 1J1OH 1QO3A 2P7TB 3WJLA 1H8NA 4UDTA 3ZDZE 1M7DA 3KPMA 3RBGA 1L9NA 1HQRA 1JRHL 2ZSWA 4WTWA 4GKZA 4MXVF 2WGXA 5AQ0A 3PIQA 2D31B 4WW2C 4PJ9B 2IBZX 3FSWA 4YDZA 4R7NB 1DVYA 1TTFA 1H3WM 1BW8A 1GOFA 5IESH 4WI9A 2F9BT 4LL9A 4GAJH 3HNSL 4M7ZB 1J1PL 4MAUH 1NDGA 4L0ZA 3EOBB 4WHYG 5AOJA 5GHWL 2N0KA 5FDYA 5EBLA 2A2QT 3RWJB 1YYCA 2BVQB 4LSQL 1F02I 2BSSA 2BVPA 3VXTB 3NJMA 4ZFOA 1YUHB 3WAKA 4M6OL 1CWVA 2AF2A 3IYLW 3L16A 4JRXA 4UQ3A 5GIRA 3APMA 1N64L 4EDWH 4KZEH 3PL6D 1KXTB 1RULH 1VGEH 3OXRB 1VEMA 3WGVB 1JZHA 4WO4D 1ONQA 1XGYL 3V0EA 3Q9PA 3WNPA 2JH2A 1E40A 2AI0L 1WBZA 1O6VA 2EVHA 4J7RA 4JLRA 2XY1A 5AL0A 2Y36L 1GSMA 3LEYL 4JFQB 3MV9A 2Y0SA 4TLSA 4NQXA 4JFEB 4P2OC 3SDCA 3PWPB 4FE9A 4AEIH 4S1DC 5E8OB 5ANME 4J3VA 3AXHA 3ZKSD 1P4IH 2R29A 1VPOL 3HLAB 1HZKA 1W8EA 3OKEA 4Y19B 2GIYA 3L81A 4FJZA 4X8CA 4D7BA 3ARBB 4Z7WA 1AP2A 4I9XA 2HLFD 2PYFA 3ZX1A 3VNYA 4E9SA 3VXPB 4PJ9D 5LGHL 1SYSA 4GP4B 4NPJA 4WUUE 1UEMA 2PTUA 4HUXB 2P49B 4OZFG 5CFHA 3BT2L 3LDBB 4IJTA 5EA0L 5F0MB 2W8CA 2KLRA 3WNNA 2TSAA 3TESA 2Y06L 2NY0C 4MXWH 5I74C 3DURB 5A2KH 4P5TB 4MAYC 3I50H 4D0DA 3LKNA 4ORGB 5C08E 4NC1C 2WN3A 2KBGA 1TVBB 3GNML 5FYJD 1Z9SA 1EFXB 3MACH 4FKEA 2EE0A 4K23L 4FNLL 2Z92B 3WXVH 2NY7H 4DKFH 5HI4D 4MD5A 5I1AA 3WDIA 1KLUB 3DWTA 1JV2B 3EADA 3Q2WA 4N9OB 1QO3B 2FO4B 2ID5A 5E2UH 5MI0B 4W81A 3OGOE 4UINL 5I18H 4PUBH 3TJHD 4TYUA 4MA7L 2AK4A 3ROLB 2AJVH 3P4NB 5C0CE 3RU8L 43CAA 1F8TH 1OD9A 3CGTA 3O45A 5K1VA 1DBAH 1AXTH 1O5DT 4AE1A 4ZNCD 4EE2A 1FFNA 1ZPLA 2B0SL 1PKOA 3G5WA 5C0DB 1R3LB 2E9JA 3LY6A 1H3VA 4HIJA 4TV3A 3UX9B 3DX7A 3P9MA 2AQ1A 3IMSA 2X05A 1CDUA 1K5WA 5C0GA 4R3SA 3SJVD 2ILLA 3VI3F 2QQKH 5HHVL 1BBJB 3FTVA 3W81A 3EGDA 3QR1A 4HUNB 4MQXD 4P2QA 1UGNA 1E9OB 3U4EB 3BESR 5EZLA 3VI4B 1PNDA 3WE1A 3CFKB 3ZQXA 2JE8A 3K6DA 4ZUTA 1E8YA 5EN2A 3IU3B 4JJ5A 1DQMH 2P48B 3NAAL 3NCCB 4FNRA 3ZPDA 5AVYB 1AHWC 1O7SA 1W80A 1S7UA 5I66A 1AKJB 4CL7A 3UTTD 4GXUN 5CLWA 4XAWH 3V6OE 2A4EA 1MWAH 1RUAL 2DL2A 1GKEA 3ZGHA 5B1KA 5CBEB 1K9TA 3SBQA 1ASOA 1MFBL 5I1CL 2WVSA 4CC0A 3L1EA 4NERA 3VGEA 3WEAA 4HHAB 5D1ZI 1DQLH 3LKPB 3Q8AA 3VXRD 5LXVA 1PSKH 1DBKL 3PWVB 4N2CA 4AGOA 4UQDA 1TETL 1DJZA 2X70B 3EO0A 5AOMA 3UBGA 3V5KB 4QNPE 1R3KB 5MENA 1A6AB 4BH7A 1S3KL 1BAWA 1XMWA 4L3FA 4P4KC 3T0EE 5I6OA 4F91B 4I88A 4Y19A 1H3XA 4EN3D 3VFPB 4TKWA 3NCFB 2EKJA 5HPMA 2HVKB 1CFNA 2FIKA 4LVNC 1U95A 3VJ6B 5BZWA 1QNZH 1I9RH 5JHBA 3MNZA 3ZRCC 3MJ9H 1T6VN 1L6PA 1F3JA 2ZOOA 1ZDQA 3D87B 4R4NC 5HHXH 2H9GB 5AVZB 1NCBL 1F6LL 2EICA 2RA1A 3NH7H 4ATWA 4N8PA 1EAQA 3EYVB 4YQXH 1ZXQA 4MB4A 3UBFA 1MLBB 1MH5A 4Z3IA 1UOWA 2ATPB 5BOJA 4MTMA 3T9WA 4X0KB 4LSTL 1AOZA 2VDNB 2C3VB 4RA3A 3FQ2A 3I74A 2OZ4L 3X2QB 4N8CL 4A6YH 2CO7A 1M6OA 1A7PL 4HUMB 4QHUA 1OEZW 1LE5B 4MA3A 1N3NB 4OCNC 1UKQA 5DC4B 3K91A 3AACA 3QEHA 5C0AD 4PJ7A 5J6SA 1S7QA 3DGDA 5K59E 1OPGL 3PABB 5TQ0H 2YK1L 5EN2B 4IMLB 4DQOH 3QZLA 5I1IL 5EOQL 5F97E 4R7NA 3F7VA 1XIWD 2R0WL 3LRGA 4NRXB 3RZCD 4KV5F 1XGQA 43C9A 4PRNB 4W9DC 4JFFE 5EULV 4YSPA 2G9HA 4UAOB 2GK2A 2PPFA 4N2NA 3BXNB 2IC2A 2VERA 2XQBH 3T6WA 3IFPB 1NEUA 1ECYA 3TWCL 3UYRH 4IOIB 3UC0L 1OCWL 2PKDA 4KXAA 4TUJB 2X4SB 4CA4A 5I0DA 3OX8B 1VZGA 4G72B 2C9SA 4DN3H 3AS3A 1TJHL 3NCWA 3PJSB 4MRBA 4AEFA 1AQ8A 2DJ4A 4FTVA 3HJ0A 3MRLA 3WEXA 3HN3A 1A4CA 3REWB 3ABMB 2JTDA 4GRWF 1YEGH 4WTXA 3VXMD 2ZICA 3GLEA 4LGSB 2DS4A 1XIWA 3B3BA 3FO2A 3L2LA 5I8KH 3LEVL 4XNQA 3DK0A 1YMMB 2QZQA 4FG0A 1JZFA 2BSTA 4Y5YB 2XXMB 4GSDH 3UFIA 2DTSA 4F27A 3H55A 4K7FA 4WJ5A 5TE7L 5CD5C 4UAOC 5I1JL 5A43C 4LSTH 4U6XB 1GYVA 2H1LM 1MSPA 1LO2H 4A7TA 1EJ8A 2FGWH 4HXAH 1MLCA 3SPJA 3SGDH 1BQ5A 1KCUH 5DMIL 1OHZA 2BDNL 4P23A 5I74B 4P3WA 3V7AG 2AXGA 2KDYA 3KCPB 3TCXA 5E2VH 3JVGC 1S5IL 5I6NA 4LLMB 4YGVB 1UT1A 4IDLA 3RAJH 1SFDA 3RKDD 2F7IA 1FN4B 1IC0A 4ETQA 3RWDA 2EH7H 5E8OA 3QG6A 2YK1H 3TF7C 4MYWB 4NQDE 5BRZD 4G8GA 3GXMA 3RILA 1U8CA 4N2KA 3UJIH 5I8CA 1AGBA 4HIJB 1NDMB 1OGSA 1MWAA 2PW2B 4I9WD 4K5MA 2EC8A 2K0RA 1MI5B 4AIZA 3O9WD 3IWUA 4O2EB 3AT9A 4QRSB 1TTRA 3VXMB 2CBOA 2O5NA 2NUPB 3O6FA 3CFUA 2Y5EA 1I8LA 2GT9A 4OLXH 4Y4KA 2MWCA 3TBYB 3HIZA 2CA3A 4YHNA 4PJ8D 1GZPA 1WYJA 5T1LB 2AK1L 5J1TC 3S5LG 3EFFB 5GRZA 5DJ8B 2CCLA 2ORBH 3PLYA 3QRFM 1U4FA 1JNJA 3F5WA 1MFEH 2Z92A 4ES9A 4Z77A 2PTTA 3VH8B 2X10A 2E7HA 1NCGA 1KCWA 3O2WL 1VACB 5B21A 1GOHA 1N7ML 2VN6A 1ZVNA 5LBSL 5HJBA 4Y2DB 3TL5A 3UBXB 5CJOL 2VDPB 5GJSH 4KMLB 4NNYA 5KVEL 1U8IB 5ILTH 2VIRB 2R0WH 1BXAA 5GGVH 4OD1H 2BHZA 3CZJA 1SMAA 3ETBJ 4BGDA 3BWSA 1EHLH 4PJAF 4GAJL 3MBXL 2C9QA 1HNGA 1JS4A 4XBGB 1G7PA 1MCBA 5IR1A 4LSUH 3BKJH 5BRQA 4DP7X 3W1ZA 4XN9A 3RHWK 2R1XA 2ITFA 5HBBA 1AHMA 3HE7B 3QIWA 2ZYRA 3L4UA 2RALA 4NFCA 2EDRA 3BJLA 3T5WA 3O41B 5KUKA 4JM2B 4JCMA 2OTPA 2WQRA 4J8RA 3ZTEA 4ZYKA 3ARGC 1ZVSB 5LGJA 4FNQA 3HE6C 4UB0L 1MVYA 2W60A 3D2UB 4X0KA 4XBEL 1WA1X 3ARSA 2W80C 7CGTA 4GG6A 3KL3A 3X3GL 2EDYA 2WYIA 5FYKU 5E5LA 2DMCA 3W37A 1DQTA 2WBJC 5A6LA 4Z7WE 2B3IA 1F58H 4ODHH 4KTEH 3ZKXB 2XWTB 3P4MB 5GGUB 1HSAA 2VM4A 5FA3A 4W9ZA 1CFNB 2FIKB 3B2UC 1S78D 5F89B 2QSQA 5AUMA 3P11L 4NRYB 4F92B 5I6XC 1UGKA 2W9DH 2RMNA 3BPCA 4HPYH 4MD4A 4RH4A 4HJGA 1RHHA 4KXZI 4E42B 2B4CC 2DLFL 4G8GE 1HIML 3ARDD 4W70A 1EJ6A 3MREA 4NP4L 1EERB 1KXQA 2K78A 3BFWA 4JG0H 5JZ7D 5DD6A 2CLZA 2I07A 3E9TA 1PLGL 4P3DA 1DVFA 2D03H 3CN2A 1AO7A 1S7WB 3TPKA 4I13B 4ZSOA 1ND0B 1T2JA 2BVOB 2CM6A 3NZHL 4L9LB 3OKDA 4FLQA 2XPGB 2XYBA 3QVAA 2BP5M 5FM4A 1BQHA 5FW6A 1FRGH 4JKPH 4KJYB 3I85A 1BD2D 2WKLA 4XMKH 3CLEL 3HAEB 4K3JH 4X6CF 5AALA 4O51B 2G3MA 5FFGA 1DBBL 4LCWD 1Q9WB 4HK0A 2Q8BH 1K2DB 4KRPD 4M3HA 4QXTA 4V1DE 5H37A 2YD0A 5IK3B 4N9GB 2N0MA 4Q6KA 3ALPA 3C8KB 5T5FL 3MVSA 3P9MB 3W56A 4W4OC 5SWSB 3RBSA 1S7SA 1ECZA 3BPOC 4WWKB 1U8KA 4EVNA 2X7LA 1I82A 3PAYA 4JEGB 3LZPA 4HS8L 3POHA 5D1ZB 1KB9K 4KROD 4HEPA 4G6MH 3B2VH 1HK6A 3HG1A 5JUEL 2VR7A 1L6XA 5EO1B 4I5BB 2ZYHA 1CE6A 3BAEL 3FBKA 4DP8X 4YEEA 3ZL1A 2LLGA 3BDYH 2RQEA 3M1OA 4OLWH 3D5OF 1TVHB 3CC1A 3K4ZA 1YAZA 3CFTA 4Y1AB 2YHGA 3KPPA 5F7NC 4YHLL 5I1AB 4BZ2L 3VSQA 2OPCA 4H8WH 5IJDC 2IPUG 4MKMA 1A1NB 3DV4A 4M4RB 4YDIH 3FT4A 2DMKA 3IJ8A 3A6BH 4L3CA 4NYLA 4AVHA 4XVSL 5BS0E 3EGDB 4OF0A 4U2YA 4Y5YA 3T0AA 3AUVA 4J3XA 2F74A 1IGFH 4KKCD 1NUNB 2DMHA 4XC1H 3FT1A 1ZCRA 2B3RA 1RUPL 1R24B 2NY4C 3HHSA 4XHJC 3EF7A 1IBBA 3OMAB 1NGXA 3CG8A 1MCWM 2YZ1A 4KUCF 3ARTA 3D3VE 3HMWL 4KH9A 4DW2L 2R1YA 2DQUH 2ZXQA 3HG4A 2CO6A 3KPSE 2NSQA 5FUCE 4A7GA 1B3IA 4NRZA 2EDTA 2ZOTA 2BOCA 3ZTJH 3GBEA 5DEFB 3D12B 2FQEA 1E8WA 2F08A 1CUOA 5ESAB 4JM2C 3T0WA 4YHIA 1RZGB 2Y07L 4JFDD 4MVBC 1ZLSH 3RP1A 1TITA 3WUZA 4OGAC 1IM9B 4F9LA 3QO1A 4ZMOA 1AE6H 3S37X 1DLHA 1PZDA 4LLUA 1BPVA 3KWVA 5D72H 4HD9A 3GMNB 3ZHDA 3WIHL 5CNHA 2JKIS 5CJXC 3P2TA 5I16B 1BEXA 2NXYB 3LRLA 3QDJE 3QEGL 5B1AB 2ED8A 4MS6A 2WLIA 1S7WA 4NX0A 3FQTA 5FGBA 1FVDB 2LVEA 5A40E 2OCFD 1CPUA 2Y9RT 3FQUB 2BWIA 1RH8A 3LSOB 1AGDA 2OX5B 4Z3EA 5E8EA 2AJZA 4PGCB 3V2AR 1KPUA 4HJ0D 4NQSA 4ZFOB 4JKMA 1KOAA 3L3GA 4RRPG 5HGDB 1KTKE 2O5YH 5EUOA 1P7BA 3OKOA 3V6FA 3SPCA 4ZUSA 1RZKC 2E9WA 1DCLA 4ZS7H 3UJTL 4O4YH 1W0VA 4F57H 3LVEA 5FUOH 5EU4A 1FVEA 4IYKA 2VLRB 4MBOA 3CK0L 4NIKB 3Q6FB 1SJEA 3LZQA 4NQEB 4YFDB 1EEZB 1JDCA 4FULA 5T1MB 4NQXB 2GW5A 3ALXA 5SWZB 4PY7B 2EUWA 4U6VH 4X83A 1G4MA 3L3IA 2BRRL 5DJYA 3RA7H 1VJSA 3DVFA 1N2RB 1SY6H 4ZAKC 3SDYL 5DQJB 3DHUA 3IJ9A 1WUZA 3RTLA 3SY6A 1X9LA 4DVBA 1QUNB 3BP7B 4HAGA 1NOLA 1N64H 2X4OA 4YWGL 4LCCC 2E59A 3FUKA 2D3NA 3UEZA 4R6UA 1JRHI 3QXDB 4HKBB 2H1PL 3QUML 8PAZA 1FNFA 2A4ZA 4FFVC 5ERWB 3QHZH 4LHUD 2FJFA 2WTRB 1MUJA 5BMFH 4X6DB 1Q94A 5IW6B 1RQ5A 5JQIB 5DUML 1Q8MA 3BAEH 1EK3A 2YUXA 4YEFA 4YZWA 5B4MD 1OHQA 3MGTB 3TX4A 2D0HA 1MIML 3DX8B 1Z9LA 2OLDA 3KLDA 2R56H 2KLSA 2VLMD 2Z91A 3MNVA 3O6LL 4IGBC 4KZCA 1U30A 1KLFB 5EFIA 3FT0A 3W57A 5HJ3B 4UQ2A 5JW3H 4QXGH 3V0FA 3CFNA 3IU3A 2OR8A 4U1SA 5EN3A 1LYQA 2P5WE 1F4WH 2N4IA 5DS1A 1DFBL 4ZZKA 1P9MA 3GIZH 5IUSA 4S0HA 2J71A 2F7OA 2DLIA 5GISH 2O5ZH 4OF8A 1M2OA 5FV2A 4OFYD 5I5JA 4OFPA 1JZDC 5SWQB 2NTFA 2P9RA 1MHEA 3QXTA 5HPOA 4M00A 1F1DA 4E9QA 4HWBL 4NO3B 3UMNA 4K71C 5JPMB 3S88H 4JAMA 4R2GD 4F7TA 2ZG1A 1EGJH 2CXGA 2NQDA 2X12A 3X13A 4JJHA 2GEQA 3QJFA 5BOZG 15C8L 2R9HD 1GH7A 4HEME 5LNEA 4CUCA 5AENA 2ITCA 4FXKA 4Y9BA 3N5AA 1JZ6A 2FVNA 3C6SB 3ECUA 2I9LA 3HI6H 5I8EB 5DSCA 3O4OB 2EDFA 4P46B 2WZ0A 3O0RL 2ZOKB 4PJFE 1S2EA 2QVMA 4X9FA 4GS7B 3PV7A 3VM5A 4FQPA 4OKVB 2ADFL 4XMWA 1A6UH 5JHDB 4OLVL 2J21A 3SYPA 3FCSA 1XCTB 4I1RA 3ILPA 1K4DA 5KG9A 2CDGA 3FBQA 2DY2A 1ZOXA 1ZLWH 5IG7A 3GUTB 2G75B 4JPVH 4Q14A 4Z5RB 2K7QA 3F7KA 4QHLB 2R7EA 4M5TA 2DD8L 4OCSL 4CMHC 5B8CB 1B2YA 4G8EB 5I2IA 2HZHA 1T7WA 4YSAA 3US9A 2B2XH 4GRWB 1MJUL 2F74B 4B96A 2WLKA 3FYIB 1S8DA 3IPBA 4NDMA 4G71B 1IC7H 3C2SA 2AJYH 2Q86A 3FU9A 4F57L 2K9FB 4PB0L 4OSUL 4TL4A 1G7IB 3SSGA 3RE0A 2KS0A 2DWSA 3VTMA 1AY1L 2CRIA 1KPVB 4G9FD 2WK2A 5CEYB 2HJLB 1JVOA 1QTSA 4DPRA 1LE9B 1XXFC 3IDNA 2PYFB 3DV4B 2O61B 2IF7A 1I4FA 1PBYA 3GIVB 1O6SA 2CLVA 4BFJA 3OGCB 3FB5B 4PJ5B 1SM3H 5IQ9B 1MCJA 5D4JA 1HAUA 1HCYA 3G6DL 3QQ4B 5BRZA 4KQ3L 1MRDH 3ALWA 2YARA 4PEEA 3S37H 1S7RA 4WI2A 4RIRB 4EOWL 4KJQC 4P2RB 3MLRL 2GK0A 1P7QB 4TVSa 1RJLA 2X4SA 4HK3N 2D3VA 4I3SL 1E4WL 1BA9A 2EZ0C 3HI5L 2UYLA 2IDFA 3PS6A 2WSPA 4EIGB 1RU9L 4PJBB 4MMZC 4YUEH 1IZJA 4YHOH 5DLLA 5LCVL 1ETA1 4MLSA 3N55A 4R4FH 1HHIB 5ALBH 5IGXL 1RMFH 4LLQB 2XWJA 3U4KA 1OW0A 3GFUA 4JR9H 4BELD 4RQQB 3HFFA 3HNSH 4P2OB 3VGBA 4G8IB 3E9UA 5BJTB 1UWYA 4WKXA 4BFEA 2Y7OA 3EJZC 2AZAA 4WU7A 4ZZFA 4MJ5A 4OD3H 3NJJA 4GQZA 3T8XA 4QLRA 2CJUH 3J7HA 3T0DA 2MQ0A 4HH9B 3PP4L 2BMKB 5B1JC 4RFNC 3CLFH 2PPCA 3QUYC 5CKAA 3GB7B 4UQEA 4BFIA 1B6UA 4DUWA 2K8MA 3L8QA 3H3PL 4X9GA 2UY7B 3TT3L 3T3PB 4K0OA 3UROR 4AYMC 5ECGA 2Y3AA 1M2VB 1C1EH 5KYWA 4PRHA 4ODWB 2QDWA 2ERJB 2R0LH 5I1HL 5J06A 4BZ1A 2ZWSA 5KVFH 1YN7B 1J5HA 1A2YB 1DVFC 2J43A 1BREA 3QZMA 1YEIH 5F3BB 3IN0A 2W5PA 1KXVA 4Y4HC 3BQUB 1C5BL 3S4SG 3DO7A 3DOSA 3U9WA 1IGJA 4U4BA 1SYVB 4UANA 5EO9B 1MAMH 4L4VD 4GSRA 2EVJA 2YAPA 3DX6A 4YDVA 2A99A 3TFKC 4DKTA 1JFHA 2FDBP 3AVEA 3U2SA 4LLYB 1ITBB 1MVUA 3K5RA 5I71C 5KSAD 3MV7A 1AXSB 4KTDH 2MKLC 3V0HA 5D1QD 1FQ9C 2NY0B 4JFZH 1DSYA 1T4KA 5CR8A 4WLCA 1UTDA 5G2NA 3ABKB 3DETD 4Y16C 2A74C 5JLZB 1XD0A 3IN2A 4UM9A 3EOAA 1CDCA 4LCYB 1ZIAA 3AW5A 4D0BB 1GPOL 1NBQA 1KTLB 2W1NA 3ARFB 2DBLL 5HHOA 1J5OL 4HGWB 2FR4A 1RZ7L 3GKZA 1KYUA 4PTTA 1ZLDA 4FI6A 1HFUA 1XEUA 1FC1A 3GINA 3VTTA 1RP9A 5G4NA 4OLXL 1MCPH 3FFDA 1RUKH 2PTTB 4B60A 3TBBA 1N0XL 3CVHH 3FT2A 1OAYL 4B5ZA 2JK5A 2BFGA 4KDVA 2NY5H 1HESA 1G6VK 4OQ1A 2JJWA 1ZHLB 4HH8A 5BW7A 3BO8B 4AEHH 3IJYB 4Y9EA 1HH6B 1PZ5A 2ADIB 1Z2KA 5A2CA 4UILH 1XTLA 3ULSA 4FFWC 1ID2A 1CDYA 1U92B 4H0LC 2JJSC 2QVIA 3QAZC 2D7TL 5E2TH 4K94C 4EF3A 5A3IC 1AR1B 3M1BB 2IIJA 3UJJH 2LABA 1A8ZA 1MCWW 3QFGA 1MJ7H 2VQTA 2WW8A 4KKLD 4X8JB 1T83A 3CCHA 3CHOA 1Z9SB 1RFDL 4MMZB 5H8DA 3TO4A 2FB4H 1U91A 4DESA 4I0PD 3SGJA 3LHPL 2PW1B 5EWIH 5C8JA 1NGZA 2BIOA 2APVA 4I0PB 2O72A 5DMGD 3SDAD 3V6ZA 4LAQH 2IAAC 5HHOB 1VADB 4WI0B 1W9XA 4IW4C 3ZW3A 4NO3A 5JPMA 3G5VB 4NC0B 1AS7A 2VKWA 3HZMA 2D0GA 5FHBL 3MACL 1NGQH 4U3CA 4G1EA 5HYJD 2CUAA 3RGVD 5E5UB 4RBPH 3DNKA 3BVVA 1IGML 2XN1A 4P4KD 2D7NA 2CZNA 2A6KB 4M29A 3JBG7 2ESVE 3AADB 2W9EL 2GSGA 3QUXB 1CYXA 4P49A 4GW5A 4F7CB 5JMOC 3JWNE 4H8WC 5DD5H 1SDDB 1NC2A 3O3EA 1Y07A 4NKMA 3W9EB 1E8XA 3MBEC 3QJZA 1W16A 2VDPH 4RZCA 4Z6AT 3SDXB 5EU5B 1BZ7B 2XKNA 1Z5YD 4J4PC 2NRDA 4XNQB 4A04A 1TYRA 4P23C 4JN1H 4R9HA 5DJYB 3RYMA 1ZK5A 2HA1A 4WHTB 3PHOA 1F3JB 5GRWA 4XO8A 3NIGB 4Z78B 3KPRB 4XP4L 1J5IA 2IJ0C 3MUZ1 4FZ8L 1X5GA 3GS4A 1BYPA 5AVXB 4Q97A 1YNTB 4G8IA 4JZOA 2B9BA 3EOYG 2NCEA 5F3FA 3G08A 1T83C 2DIJA 3FN9A 4X9IA 3RIKA 2Y7SA 1IKOP 5EUOB 2P5EA 1BAGA 4JHUA 5CD5D 4OTXL 4D9LH 1A0QL 1IEBA 2J8OA 2ENYA 4WFHD 2DQTH 4KXCA 3VXOA 4Z7OF 1A14H 3ZYIA 4Y5VC 5E03A 4UQIM 1JNLL 2MCAA 5IOPA 1KTDA 2UXFA 3GMMB 3Q6GL 4IGBB 4PJEE 2Y5QA 2NT1A 1CD8A 2GK0B 4FHKA 3MFFA 1RV6X 1A6WL 3HNVH 1O9WA 3KYMA 4IIQB 2Y23A 3QR0A 8FABB 4OFKA 1XD1A 5DFVC 2NYYC 1R75A 3I75B 4LDLB 1JAEA 1IBGL 2I5YL 4X4ME 1HILA 4PRAB 2WIIA 3S34L 3B7YA 2H41A 4Y4FB 4FA8A 3P1VA 2ZWNA 1WLHA 4QHUB 3Q13A 2AGJL 3H42L 4KU1A 4UYQA 4POZD 4Z76B 3M7OA 4HUCA 1USZA 2LU3A 2CO6B 3ETSA 2H8PB 2X1WL 1UWGL 4L8SB 3PU7A 4OIBA 3MBEA 1BPLB 5HI3D 4HIPA 1PZSA 3ARZA 1YQVL 2WCPA 3AU1B 1QBAA 1FPTL 3P4OB 3PGCB 1DJIA 3CLWA 5A2IH 2Z0BA 1WITA 2EH8H 1J8HA 4OIFA 1ZV9A 2X0UA 3KYOA 5AZ2L 5HTSA 5AB1A 3PXHA 1KJ3L 5BXFA 2BCKA 4HEMA 5GGQH 1DLHB 3DOHA 4LLUB 2ZCLH 4LLWA 3A47A 4AJYV 4TLKA 2BNRA 4LDEB 1KGCE 2ZCHH 2QLYA 1UWGH 1PG7X 3E80A 3VRJA 1BMZA 2MJWA 3WNIA 3EH1A 4EI6B 1OB1A 1TCRB 1EH9A 4I77L 2F1BA 3PY9A 4WW1A 1XCTA 2JCCB 1BM3H 2OSLA 2UVEA 2FECI 4KH2A 4NN6B 4BH8B 4CGTA 5MHSE 5ACLA 1B4LA 1QRKA 4YR6B 1DLFL 4IGBD 4XB7A 2PABA 2ZE0A 3VD3A 1NMAL 2MQCA 3LV3A 4OBRA 3WKML 4AQAB 5E6RB 3WLWC 1THAA 2DD8H 4WO4C 4XWOD 3QXAA 3ZGIA 5JIDA 5I28A 4R83A 2DLFH 1BM3L 3RI5F 4DK6A 3UAEA 4FHJA 1U8QB 3NJIA 1AC0A 5D55A 2E76C 3HMXH 5TE4L 4F7TB 5DHVA 4E41E 4XCFH 3OC5A 1I3GH 1RLWA 4O5LL 3NACH 4N0FB 4CGUB 2Z4TA 1I9JL 1AXTL 1QOKA 4LZKA 3TBSA 4N0RA 3MA9L 5DR5H 2EEDA 5C6PB 5AD0B 3HS0C 4ELMF 3V0JA 2VSCA 3PQYA 2ZOKA 3WHE1 3FFCD 1EAJA 2HPOA 4OF5A 2CCVA 4N8VG 4C55A 2YWZA 3MJ8B 1UXLA 1DBML 5C0GB 1JPTL 4LGRB 3DX7B 5DJCA 5D1XE 2R0KL 2B5IB 4X6DE 3GBLA 3V5DB 1S6NA 3B2XA 4IRSB 1CDIA 1RL1A 4XZUA 1M1XA 4I2XA 4PIBA 4F2MA 1TQWA 2LOEA 2X7LB 3GMMA 4ADIA 1N6QH 5IHWA 3UO1H 4C57C 1KXTA 1WD9A 5BO1L 4Z7NF 2ZWKA 2CLZB 2I07B 3TVMB 5C0NC 2OZ4H 4EZMA 2H2PD 3QW9A 3IT8D 2XXFA 3LKSB 2ZSVA 2Q6WB 1NWOA 4LBAA 5HHMD 1CLOH 1QEXA 4MQSB 3HI1A 5GPRA 1FIEA 2XT1B 1ASQA 5HDBE 2H32A 3UG5A 5JR1H 3A0OA 4YK4B 3KYKL 4JO1L 4K8RD 3D7PA 3BDXA 1NC4B 3KS0J 4J3OD 5DHVH 1RUAH 3MFGB 4JO5A 1V55B 3Q8BA 2C26A 4HIEB 1Q1JL 2W07A 3QUYD 3SBWA 1V05A 4Z7UB 2CKBB 2CRYA 5E1GA 2KI6A 4PRHE 1KWKA 1N2RA 3DX8A 2WOBA 2CK0L 4X7DC 3G6DH 5E6UB 2FUTA 1DBKH 5EU5A 3MODH 1CDJA 3HS9A 3CDGB 2R2BA 3VG0L 2JLPA 4FZ8H 5IJKA 1RZQA 3UYRL 1G9MC 1TQCB 4B9YA 2LFEA 3IFOB 3HKFA 3T2NH 4QWWD 3O41A 2X89D 1OGPA 5MENE 2LT9A 3TA4D 1VAHA 3D0AA 3QJXA 1ZGLA 4ZW8A 4YSUA 3O2VH 1T1YA 3TPUB 5T3XH 1B88A 3QCVL 3TO4C 4KZDH 1QABA 1NFIB 3DXAE 4MASA 4LBEA 1JZJA 3A3YB 4BUQA 4XRCA 3MV9B 3GSUB 3OVUB 2FL5A 3GIZL 5EU7E 1T5XA 3SQOH 3L48A 1PZCA 3NJLA 4HV8B 5FHAL 5JIHA 1BZ7A 4M8UA 1FNHA 3WJJA 2ED7A 3OJMB 1E6OL 4EUPH 1F18A 1CLYH 2F15A 4TNVK 3MRGA 4DN4L 1XSJA 4WWKC 1RUMH 2VR3A 2DQFB 2VWEE 1CF8H 3UO8B 4P9MH 1ZLUK 1WA0X 2R83A 3UTZB 1L9MA 1NGWA 3IAGC 1N6QL 4L1HA 1OP5H 3RFZA 1Q9KA 2AXJA 2XZAL 4NN6C 3TJEH 3T65A 3ZYZA 4HS6B 3UMTA 3WKQA 5AOZA 3W11D 1W72A 1DTUA 5FCUH 1XX9C 3FU0A 2XTJE 4LPTA 5DWPA 5MEOA 5DEFA 2Q3XA 5CCGE 3VXSE 2DIEA 1IEAB 4J3UA 3IFNL 4Y1AD 4F8PA 1QAWA 1X5IA 4KY1L 3L54A 4DJMA 4IU3B 2BIHA 2NDGA 3OSVA 5F2FA 1YNKH 2BY3A 1J11A 2G2NA 3BUYA 3QCTL 3M88A 2LLNA 4R2GB 1A7OL 3AJ7A 1I1YA 2W0FB 3NIGF 1KB9J 1JZ2A 3V5HB 4H8PA 4E41A 2GPZA 3J8F7 1QLRB 2AJXH 1VENA 3PPEA 4YDKL 3UTSD 3BE1L 5BV7H 4S1RH 5JLZA 4F58H 3BVNA 3KCPA 5EUOF 2HT4C 1R1CA 4S0SD 4A2MA 4IU2B 3FZUC 4PREA 4PR5A 2BIPA 1T2QH 1IAIH 3QS3A 1CD9B 2J6EH 5IUCA 1ET8A 5L2JA 3MOBL 3ARDC 3GYRA 4NB7A 4E36A 4R5TA 5C0JB 2I26N 2HB0A 1QSFA 5DUMH 2G2RA 1CL7H 4KO6A 4ICWA 2AK4E 5C8JB 2XTLA 1MJJB 3F8UB 2ARJQ 5DHEA 5AOLA 3S37L 4WWKA 4EVNB 1FORL 4HETA 1UKTA 5MERB 4KZ0A 4GO8A 1KTBA 3KAAA 1GYCA 5HVHB 1KACB 3WFBL 2R4RH 4N9GA 4WI5A 3ZDWA 2OP4H 1EO8L 1LVEA 2XA8L 4Q9RL 3B7TA 1AQKL 5CWSA 4JVPA 4PLKD 3U4BL 1MW1A 4K3HA 4ZFOL 1A7BA 1NMBL 2WUBH 2FGZA 3A4EA 3FT3A 5EU3B 4OGZA 1RK7A 2DM4A 1AY1H 4I85A 5H2BB 1LO5B 5ICZB 1WEJH 3HG1B 5D1QB 1AHWA 1HQ4A 1MIEL 4PJ8C 4CC4C 3WIFB 3QDGD 1D2OA 2EXYD 5CGMA 4C59B 2P5WA 4M7LH 2XDHA 4YXLH 1S7SB 2C3GA 3HRPA 4ZNEE 1RZ8B 1BAFL 3UPCA 4ILDA 1RURH 4XP4H 4UV4L 3DOSB 3DROA 3KBFA 1KYOK 4LCWA 4D8OA 1MNUL 2Y7LA 2ADJA 4PJ6A 4IU3A 4PWEA 4FNUA 4D0CA 1VGKA 2ENJA 3F7VB 4P9HC 3DX9A 3U0PA 4DZ8B 1F41A 5FGBC 4LCIL 1PEWA 5A3ID 1A2YA 4OTXH 3QQNA 5ISZD 5TK2A 3TT3H 2X4PB 3Q2LA 5JW5B 2F1EA 3RTQB 2L7EA 3OX8A 5KYUB 3KR3L 1KY7A 1C5CL 1B4RA 2ZKXA 2MNJB 4JFED 4IGBA 1RD6A 1TU2B 4PJHE 1U8PA 4ETYA 1CVSC 5IFAL 4YK4C 3MLPA 1GZQA 3ARDA 2XZAH 3P77B 2E6PA 2OSWA 3VXOB 1FDLH 2WZAA 2XA3A 5EPMA 1KPRA 2UUDK 1UXWA 1IL1B 2H0EA 1D7DA 3L6FB 2R4SL 4TQEL 5TQ2L 1DEEA 1TJMA 1FIGL 1YZZA 4QTFA 3HUJF 4XNUH 4LPWA 4ALAC 3PWUB 4L2LA 4N28A 3I6SA 3MRHB 1KJ2H 1OGTB 4HOMA 1F56A 3KS0H 3DX4A 2ZXBA 5FA3B 2GYSA 2H1PH 3QUMH 2EIJB 2IXQB 3H3PH 2OFQA 1J1OL 1HYSD 1W0WA 3L7FA 2ZF8A 1RY7B 3TPUA 4ELMB 4LEXL 3BZFA 3SHSA 3ZHKA 1FIGH 3FH5A 4NQDB 4X8GA 1I9RL 1BFSA 3QJHB 4AYSA 3EHBB 4F2EA 4CN4A 5K33A 4EN3A 4AMKL 4Y5XB 2C9AA 3QFJE 4KNSA 3SO3C 4NN5C 4ODVH 3FO1B 3DGCR 1MIMH 4EOWH 2ZXCA 2VC2H 1RIUH 3R4DA 1CXHA 2XN9A 4LLDA 2H3NA 4PB9H 3UC0H 5T1KA 2P4AB 3LYRA 2DQIH 4F58L 3NCMA 1U8HB 1AKPA 1J18A 4NDMB 5DO8A 4QD2E 3VXSA 2VJ8A 3RWHA 4OV5B 4XPAH 4GO9A 4OCWH 1WIOA 4PRIE 3QJTB 2ZYSA 4KK9C 4NWTH 2YAHA 3GMPB 4NKDB 5LCVH 4AUUA 4XNXH 3EJPA 2K70A 3BWZA 4ANKA 2F68X 1LP9B 2ZXGA 3QUMA 2A9AA 3DXAA 1JYXA 2CBQA 2JKNA 4R4BB 4LU5H 1KIUA 1TKWB 2GSMB 1PIGA 2WXQA 3ZVVA 5HI5C 4ENZA 1KN2H 3IDNB 5FPIA 1S4IA 3QFDB 5FKPA 1E42A 2B59A 3QI9A 3O2DL 1UT9A 1ZSHA 5IB1A 3VXUE 3CVHA 1S7VB 3PWPD 3TZVD 4FZEH 1Y7VA 1JD7A 1MCCA 4Q9BA 4UT9H 2X9XA 2QHRL 3OB0K 4CKVX 3X11A 2NW2A 2AJUH 1FN4A 1RJLB 3QZNA 2JJVA 4EKXA 5FKAA 2OMVB 1OARL 2BW5A 4L8BB 5D4IA 3SE3C 4WW2A 1OZTG 5K9KB 3JZ7A 2JF1A 4L4VA 5CZVH 2PO6C 5D9SA 3BUTA 3IDIA 1DP0A 1XMEB 2VDOL 3QNZA 5AD0A 1E67A 3NCXA 3FOMB 2MQ3A 4XNDA 5GGVL 3CXDH 2V2XB 1QFOA 3OHXA 5T8IA 1JN6A 4BK8A 4TSCL 1A6TA 3J27A 4HWEH 3WI9A 2V7NB 4RISL 3C9NB 2HG5B 3F12A 3T0EB 2IGFL 1X4ZA 3QAZB 4M56A 2ZT9C 3MRRA 2XA8H 1N10A 1IEAA 2YLHA 5DJDA 3I6LD 5D6CA 3BVUA 4HJUA 4ZFFB 3KDMA 3ULUE 2HXAA 3LRKA 1OK8A 1Q0YL 2EE9A 2KT6A 5EEXA 3I2CH 3EFDH 3WL9A 4TS6A 3NCYP 1WPCA 3F04A 3A6OA 3F2LA 3MBWB 5GHWH 3NP3A 1FO0A 3EJSA 3PWLB 5I26A 4OV5A 3OR6B 1MCOL 2LU4A 3PJSA 1JXJA 4S0TD 4X99A 1CFTA 2BNRD 1A47A 2DB8A 3V5HA 1MI5D 2HJKB 4P5TA 3G6AB 3ZL2A 4KV5E 4WW2F 5LJYH 2QSVA 3DO7B 3GO1H 2WVVA 2X6BA 2CHZA 4WDIA 4ZD3H 4ZTOL 2MPVA 4XE0A 3T0BA 1D9KD 4XMLH 4PJ8B 1AO7E 3FAWA 4Z0XA 5IBTL 1IT9L 5C07E 2QV2A 1H8OA 3GI8L 3VD5A 4KTYA 5CO1A 4XBPA 5F1IA 3DYMA 1FVEB 3OQ3B 4UT6H 1L9RA 3BP6B 1WZKA 1GKOA 4JRXD 4HKBA 1T2XA 4YOKA 3S5ZA 5IB5A 3MV7D 4DUXA 1JZGA 2CKBL 1I8KA 2FX9H 2ZKYA 1P1ZB 1JNNH 2QBWA 5KYYB 5EEZA 3BX7C 3B4NA 3R18A 1D6VL 3QPKA 3BSHA 4WO0A 3MFFB 3VD1A 4PJIE 2OYLA 5L4FA 1GRWA 4O2FB 1Y1UA 1WFTA 3Q7JA 5K9OA 3F05A 3EBAA 4RFNB 2IAND 5AW0B 4A63A 4PWGA 1QSVA 1BFVH 2BNQA 3V8OA 2Z91B 4G3YH 4DGWC 4FNTA 1A9BA 3VE0B 3QWQB 2DQGH 2WP3T 3DUUA 4K3EH 3VFMB 2AVGA 1HXYB 3H7LA 2DM2A 3NN8A 2DQTL 4DZ8A 2IFGA 1S9XB 4KBPA 1J1XL 4PJDE 5C7XL 3LNFA 4DGYH 5C0RH 4LRIC 3DIDA 1ZGLB 3O6ML 5EMYA 4AWJC 5ENWB 4LCWB 5DMJB 4OM0H 3BEVA 1B0RB 1FAKT 4KI1A 2CIIA 3EH3B 6PAZA 4N22A 3N04A 2Z8SA 4KRLB 3ARFC 2IADB 3EO9H 3CBJB 4JY4B 5GGSY 4ZXBC 3OTTA 1P5UB 4K8RL 4EXPX 3MUUA 3QDAA 4KY2A 2G4GA 1LQSR 3EYVA 4XVJL 5DGQA 5AOIA 5EZJB 1PKQA 4J3OG 1U3JA 2QGCA 3MLTB 4BK5A 4L3CB 3MMEB 5FHAH 1JWMA 1YC8A 4MB5A 1FNSL 3H6AA 5FYJU 2AJXL 4OLEA 4TPRH 3TBSB 1G1OA 5F44A 5J8OA 3SYCA 5IQOA 2I7OA 4KNUA 3GC3A 3HNTH 5EU6A 4Y1AA 5HYJA 3O9WB 4RFEA 1DBBH 2AFNA 1KCBA 2EE3A 2HG0A 1ED3B 3V6BR 2Q6WA 1XGUB 4YSDA 1ZT7A 4BHUA 1I85A 1N4XH 3QXAB 4ZQTA 3FXIC 3CZNA 4R8WH 4KKAD 1A1OA 1OE1A 2F0CA 4ZAKD 2HN7B 1R5VB 3MV9D 3KW8A 3OV6A 3LPWA 1DBMH 3FL7A 1TZGH 4B97A 3V4VB 1K4DB 1HHHA 1HH9A 4S1DD 3CQPA 4N2MA 3T6XA 5KSVA 1HJCA 5KBNC 1S7XA 4WWOA 4M93B 4J8QA 4Q52A 2W0FA 1A7OH 2YWYA 4WFFE 4YBHA 3FTGA 5CINH 3W2DL 1QPXA 4XMZA 1R3LA 4ZS6D 2WO3B 2XWRA 2WXMA 3FOLA 3KEHA 4PJEF 1BD2A 5DFWH 1NAKL 3P9LB 4JHZA 1I9IH 1NBZB 1VFBB 2NW2B 1CIUA 2WHVA 3BH9A 1KIPB 2IADA 2Z64C 4AMWA 3K7UA 5JR1L 3QPQD 2X9WA 4QRPE 4ZT1A 4N3TA 2GAZA 3L3JB 4OUUB 1OANA 3P4NA 3V7MA 3GPEA 4NCDA 4BFBD 3HE7D 3EGSA 3FFDB 5M94B 2WMPA 5E23A 5DF0A 3T0EC 2FO4A 4PRIA 1CE1L 5FYLE 3QFDA 1ZWIB 3L9YA 2AQ2A 3KYAA 3VFOB 1KCSH 4PFEA 3RKDC 4MD4B 1QYGH 1ACCA 5CJQL 1ILSA 3HE6A 2G5RA 2Z7YA 2P8LB 3M6DA 1NEZB 3NSXA 2VDQL 4C56A 3HRZC 2VNCA 4FI7A 1BQHB 3BSZH 3GD1C 2GBVA 2Y2YA 2W91A 3VG0H 1GGTA 2X1QA 1YEJH 4NXKA 2LW3A 1B2WL 3NIDB 4RWHA 5HHQA 2XVGA 2M1KA 3BUDA 4TULH 3EDKA 1IM3A 5DD5L 1WZLA 4JQIL 5C0BE 4WJKB 4OF3A 3L95A 2DPKA 5C7XH 5HY9A 4F1ZA 5FWRA 4BA8A 1AANA 3BUBA 4OZGA 4RFEB 2NY5C 4GINA 3ZE1B 1U8KB 1L0QA 4PGZA 1FAIH 3NTCL 3L5XH 1O7DE 4X6DA 4N25A 1E6JL 2RCSH 2ZUQB 4PCSA 2BSSB 3E2HC 2GBTA 4XHQA 3VFGH 4CVUA 1F58L 4ODHL 4QXTB 5F1IB 4C4UA 4QOKE 3D4YA 3CFJA 4LHUG 4WTZA 3MODL 4R97C 4LEEA 4OY9A 1HCZA 3FJTA 3BHBB 1QLFB 3ILQC 5FA4B 4BDVA 4YXKH 3SCMC 4JLRB 1I31A 3TJEL 5E24E 3DVGB 1AFVL 5C09B 3D4CA 3OKDB 3VYPA 3VD9A 1J9RA 3QJRB 1MCIA 2BVYA 1GY2A 1N8OE 2BIMA 5E70A 5IJVA 2FECL 5IHHA 5C9JB 2XC8A 3Q9QA 4L8SC 3WN6A 3VFSB 2Y7QB 1KPRB 5JHLL 1ZLVK 4RDQF 4NNPH 4HXBH 3BH8A 3F64A 4GT7A 2UZYB 3JQOB 1D7FA 1JZ5A 5GZOD 3D85A 4TVPE 1A7QH 1TZ8A 4QHNA 1XCXA 4JDTH 2E4TA 3GDBA 4Q89A 4BM7A 4XP1L 1P84J 3LKRA 4PV9A 3BCDA 4NQCB 3ULVL 1NCAH 4K3JL 3TBYA 4QHMB 3W0WB 1MW2A 4W9KC 1QTPA 3VRLF 3PHOB 3ZT6A 4G7RB 1P5VB 3EYUL 4MX7B 1DUZB 1GGYA 2DMGA 1PTZA 4M7LT 3WIIL 5DJCB 4E0RA 3MX0A 1TQVA 1L9PA 1A7NL 4PCTA 2OW7A 3A24A 3SDXA 1WCQA 1KCLA 3IFLL 2MKWA 3B9KC 2AS5M 3KWWA 4PJXE 1II4E 1EEYB 4G6ML 4GB9A 3QJOA 4XVUD 3EW3B 4XNAA 1YEKH 4ANXA 3QG7H 3QCTH 1KJVA 2DI8A 1VCBC 4AKPA 3PG2A 1FYTA 3AWGA 5D1QC 1IKFH 3GHPA 1REIA 4HJJL 4WWNA 5BO0D 3MNMA 3CN3A 1JK9B 3HFMH 2VDOH 4EI0A 2OI9C 5CMAB 1G9NC 4U33A 4L4TE 5B22A 1XR8B 1PQZA 1EXHA 2XG5A 5IW1A 2JXMA 5F7AA 4EQ2A 1N0LB 5CGTA 2ETWA 3AWFA 4ZMWA 4Z7VF 2VDMB 2R8SL 1JV5A 2IH9A 1GIGL 4HWBA 1NM4A 4GY4A 1IAMA 3IJHB 1N4XL 4NO2B 1AZNA 1S8DB 4M5YH 4PS7A 4TUKH 4XP5L 1OP3H 2V2XA 3OR6A 4AEIL 2FATH 2VDKB 4PGBA 1MREH 4YXHL 3R8QA 4AYDC 5I76A 4X6CE 3AAZB 5DJAB 1EANA 1BEYH 1U92A 3GJFB 4K94H 2AKRB 2AANA 4XCYA 3RTQC 4B9FA 1EVUA 4LLWB 5KBDA 4FFZH 3Q3GB 5DD3H 4HX1B 2F7PA 3E6HA 3MV8B 2YUZA 1GHFL 5IFJA 3MLSH 1NCJA 3K71A 3QIBB 4K9EL 4XP9H 3HLKA 1U0QA 2W9EH 3RVXC 4KXZH 2OMTB 2E74C 2VXTH 4K7FB 2L7QA 1FWXA 4OGXL 3S3BB 2H8PA 4L8SA 4AGQA 1YNTF 4B5EA 2GY7B 2BSTB 2O30A 1UH3A 4K07A 5IB3B 1AZVA 4FERA 4S1SH 5CEXA 3NK3A 2HKHH 1TUPA 4ICXA 2X6VA 3F3HA 1P5VA 1TPXB 5DQDL 4MKTA 1XBDA 4HSCX 2E46A 2ATKB 1XV8A 3ILQD 2VDQH 2A9DA 4OCRH 2OCCB 3WMSA 3MRHA 1DQDL 4PYHA 4NQCA 4L9LC 2OMBA 2YEZB 2AXGB 3QQDB 1RERA 2HN7A 2WWKO 5LWYH 1EFQA 2J1XA 2IANE 3V0IA 4J2XA 1NAMA 1RJZB 1USQA 3MGAA 2O6EA 3RFZB 4WKZB 2WZPA 4YSEA 5FM8A 2AMUA 2XBDA 4KI5F 3JZYA 4XN2A 1PF3A 4JDTL 1M6OB 2W0LA 4RMQA 4ESKA 2Y4SA 4OGYL 5IHUH 3B9KA 2QT6A 3ZJAA 1JJUA 3VNZA 5H4YA 1EHNA 3U1PA 3GMOA 1KLFA 1F6AA 5HGGS 2XQYA 1IGJB 4UOW1 1KBPA 2VISB 4PTUA 3V4LA 4NQDA 2DDQH 3FB8B 4CU6A 1QI4A 4MCYA 1BYOA 2YRLA 1X5HA 2XX1A 4Z78A 2V0AA 1A6VH 4MWFA 1FV1A 4NZTL 1PX4A 3EUUA 3NAAH 3KNBB 1ZMYA 2FYYB 2PXYB 3MXVL 4MA1B 4RRPM 2EC9U 2JB6A 3QDJA 1JPTH 3TN0A 5CEZD 2MHAB 4MMYB 4ODWA 1GMEA 4P23D 1KBGL 3G7TA 3PF2A 4XPBH 5E99L 5EOQH 4BKLB 4AVJA 1MI5E 4Y9FA 3IFPA 3WY1A 4NLAA 5INDA 3DBXB 4FMVA 1IKFL 1K3ZA 3KLLA 3ZHLA 5BQ7B 3T6ZA 1M71B 1KCVH 5AWNH 4RMRA 5D7HA 3QORD 1IGYB 3FQRA 4M5ZL 1MFDH 3SO5A 5HHQB 3ARUA 5J6HA 1N59A 3TNMB 4CVZA 3QDGB 1I9EA 5DXWA 3RTQA 2VLJA 3AS1A 4IIQA 1J88A 1N67A 1EDYA 4M43H 1CZ8L 1UWXK 4EDXA 5CEZL 3VXQB 1KEMH 1P69B 4ABQA 3D33A 3ARGD 2VDKL 4L3EE 4AL8L 2HX9A 3E0GA 4UINH 4G82A 2BH0A 5JMRA 3V5KA 1KTDB 2VO8A 2Y25A 4ONGL 1QUPA 5EPMB 3WD5L 2ADYA 1OCWH 4ZW7A 1CQYA 2GJ6D 3WFEL 4DSYA 2CJUL 4J1UB 5KSBF 4I1NB 3VB8A 1UYWL 2PCYA 3MRQB 3OJDB 3TIDA 5JORB 2P5WB 1VFUA 1NFDF 1E9PA 1AKJA 3WMQA 3MCLH 3FSZA 3ULSB 1Q4NX 1BZQK 1QLEB 3CHRA 4JMNA 3D9AL 1NH6A 3OAUH 3LZFH 4KMQA 1MG2C 2BHFA 5AVSB 1MAKA 4U0RB 2PXYD 4PJ9C 3IDUA 4IK7A 1WT5C 1PX3A 3ZLQC 4C4KT 3TV3H 2LTQB 1L5GB 4OLVH 4P2QB 5DJZA 2NNAA 2BSDA 1CLVA 3NGBB 1BVOA 1FUNA 5EHFA 3IMTA 1J86A 4JFYB 1CXLA 2WXNA 3C8HA 1QW8A 1Z0MA 2VZOA 4G8GB 2FJSA 1YEFH 5CS7A 5TK4A 1VKXB 5GGTL 4PGDB 1TYEB 2DZEA 3G6AA 5IZ7A 1BF8A 3JV6B 2HFTA 4FTVD 1O6TA 5DMIH 1X5YA 5F0PB 1J1PH 4GW5B 4MAUL 2YD3A 1KCRL 1NQBA 2FUQA 5E8NA 1A4KA 4UDUB 1NM9A 5BS0B 3D39E 4NP9A 1AGEB 2AJ3B 5DD0H 3QDHA 2VT0A 4RGMB 4HS6A 4PRID 3ZBMA 4Y2LA 4ZMAT 1Q9KB 1UVQA 2JFCA 3FTWA 3K46A 1WZAA 3RVVD 1KJ2A 1OGAB 2CA4A 1UM6L 4FJYA 5D7SH 5DVMA 2IWEA 4OFVA 2WXPA 1GTNA 4UILL 3KPPB 3RX8A 3KZ8A 1U42A 2V9TA 1YY8B 5L0QC 1B90A 3B5GA 1ZLVH 2ITEA 4PJHF 1FF5A 3QJSB 5ES4B 1GJIA 1EAOA 5DO2C 2R0ZH 4PRPD 4YHYC 1UZGA 5C0IA 5KYNA 3BUYB 3QIBC 5TPWH 2VQUA 5LCVA 3QCUH 1UD8A 1WWBX 4OCYH 4XI5C 1G9ML 1BFOB 5GGSB 5ALCH 5B3NA 2NQ3A 3GGWB 3WNKA 1N5AA 2IAMB 3ATDA 2FEEI 1CL7I 1QP1A 3HEIB 2HRPH 3ZDXF 1A3RL 2VO5A 1AP2B 3RUGB 3ZT7A 5I0YA 2K4WA 2R0ZL 5DS8B 2VXQH 3V6OA 3Q3GA 2AQTA 1UA6H 4WK2B 2J8UA 1MRCL 3D08A 4OZHB 4CVWA 4HPOH 3ZQWA 2VLKB 1IC5H 2X5PA 1Q0YH 2YR3A 4Z18A 5E4EB 1Z66A 5AB2A 1S46A 1IT9H 1BQSA 3D69B 4TQHA 4M48L 3UABA 1ZJAA 4J1UA 5EC2A 3O4LA 3U6XA 3UCQA 1EXUA 4RAUB 3DDGA 1QEWB 2JKXA 3VI3A 4R26H 3DURA 2MOVA 6PCYA 3PUCA 1VESA 1FG2B 1NFDE 3QXVA 5DWUL 2YJLA 2HFGH 3ZN6A 3GS0A 1DBJL 2WVUA 2F18A 3L1OH 4WTQA 4PJBE 2OMYA 4ELME 2QSTA 3QWRA 5IFHL 3DIFA 5I18L 3FCUB 5AFAA 1AJ7H 5KVDE 1PG7W 2WZ6A 1O9ZA 1AYOA 5C86A 1JF1B 1G6RL 5I1KL 3C5ZB 3MJ6A 3EYUH 3JTSB 1DQQB 1FNLA 2A5UA 4Y4FD 1JZ8A 4UIKL 3AS0A 3JVFC 4LRIA 5CCHE 4BQCA 3H4HA 2IALA 4HUUA 5IIEB 3R0MA 4HWBH 4DHLA 5TF1L 1N68A 4YIQA 1RPQA 3JWDC 3AG4B 4AW7A 2ZKHH 3K6SA 2A6IA 1MQKH 3DX3A 3P02A 1W8OA 3P40A 3IJEA 1A6PA 3DVIA 3MX0B 4KO5A 1NCOA 4JM4H 1YCSA 1J9QA 4Q6IC 3FFOA 3RZWA 3FUIA 1TMCB 1W2KT 3QQ4A 5BRZB 1U58A 4ZTOH 2F5BL 5TDNB 3AROA 4KKPA 4NNXB 5CILH 2CPCA 3WTSA 1FFOA 1F97A 2V17L 5I1GL 4EZKA 1SF3A 4V11A 1J9CT 3VXTA 1DQJB 2OYMA 2BHYA 2O61A 1OGAA 4HLJA 1BXXA 2A6JB 2Z3FA 2BW4A 5E7BA 3VFOA 1RZJC 3MBWA 2BNQE 3WMPA 2AK4D 2IH3B 1M57B 3HC4L 3DYPA 1UA7A 2PO6B 4H7VA 4FXLA 4AK1A 2F5BH 2WMPB 1CU4L 3DX0A 3DHMA 3LNHA 4HALA 3HFML 1GZQB 3ARDB 1ZS2A 1GJWA 3P77A 4YHZL 1BOYA 3SDAA 1TZAA 3NYKA 2HCZX 5HXMA 4NHUA 3TCTA 1U8IA 3DRTB 3BAJA 4JO3L 3KH3A 3BH9B 5AW4B 1YECH 3RDJA 2CIKB 1UHVA 1B4TA 3O4LB 3T3MB 4F8LA 5KYXB 2BY1A 3D09A 1W72H 3IAQA 4GI8A 4XXDA 1NCDL 1UCBH 1KFAL 4UBDC 3WTUA 1R5WA 1XO8A 4TSAH 4UCFA 3F7PC 1BQRA 3DSFL 3BPLC 5B38B 2C4FT 3GK8L 3CX2A 2V5SA 5GGTH 5CZVL 1TZOA 4HP5A 4P5MB 4PVLA 4JS7A 5ABAA 3Q1EA 2GFBA 2HRPL 5I9QC 4DEPC 5EF0A 2VABA 3LN5B 1TJIH 5C6TH 3QHFH 4XB3A 1WZ1H 3D0LA 4PWHA 5L9DL 2XWXA 2NY0D 3QZWG 2H2SC 3ARBD 3A4AA 5GZOC 3ZKNC 4ZMZA 2NCMA 3MV01 4RFOL 1DL7L 3ERXA 2ESVB 4NAQA 5EZOL 1AGCA 1CD0A 3M8OL 3IDGB 4D3CL 2Q7AA 1T0MB 3SBRA 1YEEL 1LP9E 3HE6B 1X5MA 2ICWI 4U1IB 4D0BA 2ZXEB 1UVQB 3G04A 2HJLA 4ORGA 2EVFA 1WD8A 4U1JA 4F3FA 1MXDA 4WEBL 5GRXG 3ZTDC 4WI7A 4X6BB 1RAMA 2Y07H 3NA9H 3PP4H 4YSRA 5IOPB 3KPRD 3L9RA 2VGLM 1DVFB 1ETZA 3MLVH 4GQQA 3FUEA 4LE8A 3MV7B 4PJ5E 1E9QB 3CZFA 4D8PA 3QCUL 4HS8H 3ZSSA 3TONA 1RXLA 5B8CA 5DLML 4RMUA 1MRDL 2D7PA 5J4MA 2J1WA 4QHLA 1RJCA 4AGPA 5LBGA 1NCHA 2VMFA 6CGTA 3QR2A 1CICC 3DX6B 2NR6C 2I85A 2MSPA 3VGGA 3F01A 3QK0A 1TR7A 2JQMA 4KGJA 3MLVL 2FYYA 2PXYA 2XXCB 5I1LB 1MQKL 3OL2A 4MJID 4HK0B 5LB1A 4DH2A 4JPKH 4XXDB 3KLAB 5MEQA 4CAGA 4FP8L 3ARVA 5E2TL 2XIIA 5LHDA 1OAXH 3DX2A 3IJSB 5J9PA 1OIOA 4PRHD 3TS8A 2VJ0A 2WWKT 4UUJA 3C60A 2L3BA 3WENA 5DVLA 5FCUL 3DRTA 3QWRD 4FFYH 4GQ9H 4YC2C 4JG0L 2FHCA 3L1OL 3ARGA 2FHBA 3SDXE 3GTNA 3EJRA 4YNYB 1WZ1L 2R2HA 4Y4FA 3CVBA 3C5SA 1P1ZA 1QQDB 1U8PB 5DZAA 1U6AH 1UM5H 5K93A 1IC4L 2QSCL 3VO0A 3N6YA 1C5CH 4CU7A 4XPHH 4AY0A 3UZVA 4XCCL 1XSIA 2WB1A 3MLUL 1IRAY 4OM0L 4UTAA 3N43B 5HP5A 1SOQA 3BJ91 5BW7C 2XNAA 5D1XD 3HW7A 4FQJH 2EJ1A 2BP8B 3S4SA 4E9YA 1R4XA 1NCWH 1QFHA 2VDRB 3ULUH 3F6JA 4AG4L 3LB6D 3OM3B 3F5WB 3FFCE 1BLIA 5DI8A 1I8KB 1ZVSA 1FVCB 4YE0A 5DURB 5JXAL 4P5RA 5ESAA 1W91A 3BEVB 3QUXA 3SDDD 1KG0B 2OMXB 2Y1VA 3VFTA 2ICEA 4AENA 1XF2A 3RLSA 4ZDHB 4HJSA 4UQAA 4UIMB 3UTSB 2ROXA 5BCAA 1KIQA 3QDMD 2A74A 1PDKA 5T33L 3TT1L 1ETZB 3L1FA 1DQVA 3RDTC 3SE9L 2K7PA 4AM0A 2UY6A 4OD2B 5B39A 5GRUH 2E0PA 3N1PC 1IMHC 1G7IA 1CFBA 5MHSD 3VA2C 3BZDA 3MC0A 5KEZA 4GW1B 1ZGLP 4IOFC 1KJ2B 3IAPA 1A7NH 3MRFA 3QS2A 4GPVA 1AQDB 1EUUA 1KGCD 4GMTH 4K5OA 3OD3A 3VFRB 4IRSD 4Z5RA 4KJWD 2A9NH 3RWEA 3GUTA 4BQBA 3MGOB 2W88A 4PJHB 5B7MA 4WW2B 1CD1B 2AJZB 4PGCA 1C08B 3RY6A 1XBRA 1FH5L 3PNWA 2VUKA 5KW9L 1A4KB 1IVLA 2QMKA 1XR9A 2H26B 2PR4L 3VM7A 2BSRA 3A4DA 4XOAA 4PQXA 4XP1H 4QO1B 5TPWL 3FTZA 4NQQA 4M93C 1OTUD 4OJDH 3EO1A 5KAQG 4MS8D 3HR6A 3SBPA 2Y7MA 3BPLB 2LHAA 3GMNA 2W81C 2OR9L 4GXVH 3S8FB 1OW0C 4NUJA 3M17A 3EJCA 5GS1A 3A5VA 2NY6D 2YD9A 2Y7NA 4LSSL 1N6VA 2Z9TA 2AP2A 4OLUL 4IS6A 4CW1B 1JHTB 1LGVA 2OR9H 4PG2C 5H35B 5IF0A 2X4UA 2H2PC 4JK0D 4EBQL 2Q10A 4WHCA 5IEHB 1VB9A 3B2PA 5DRZB 1DQIA 3JT0A 4XTRD 5DQDH 1AQDA 4KUZH 5DJDB 5EBGA 4N2FA 3X3FL 4UT9A 5EBMB 3BRDA 3FSOA 3HRZB 2AXFA 2C1OA 5ETUA 4BFIB 2NXZD 3H54A 5GS0D 2Q9OA 2J6EL 4Y1SA 5F0LB 1OCRB 2FJUB 4KGLA 4WUKL 4AE0A 1IGCL 2ZUXA 1N0LA 5I75C 1CGYA 2RIKA 4GP8B 5FO9A 5IEKB 3SO3B 4XOCA 1MCQA 2H0JA 2YBRB 2R69L 3R7RA 2AJYL 3BUQA 3SY0B 5HD8C 4S2SA 3SODB 1HI6B 3MDJA 1BJ1H 1H6FA 2EH7L 3DMMD 2YEQA 4FQXD 1JVLA 4MJ4A 5J6HB 2ZJSH 3FUNA 4X6FB 1RZKL 1OGTA 2GJRA 4P3CL 1N3NA 2YOAA 4PLNC 3QCVH 4MA3B 3IJEB 5C07B 3B83A 4MVBD 4KZDL 3GSRA 5JO5B 3EXLA 3IRZA 1U8HA 1SXZA 4WI6A 5HDRA 3SCMD 1EEYA 4OD3L 1Y6KR 4IBSA 5D2LA 4G43B 4E9VA 3DSNB 4BSWB 1WAAE 4Y4KD 4FS0A 2DLHA 4EUPG 1NBYA 1T21A 2QADD 3OJDA 4L8CB 2XBTA 2OJ1A 1JERA 2ESVD 1DE4A 2GUOA 4Q4IA 2VUOA 4U6HA 1I7TB 4XR8C 3QIWB 1IBDA 1M6UA 3SCMA 3T77A 5BV7B 1SJVA 2M8XA 5EUOE 5ACZA 1LWHA 1ONQB 3Q5TA 4XBGA 4YUEL 3REVB 4AV0A 4HH9A 2H47C 4DZBB 1QSEE 2RQ8A 3VFMA 4KHXH 2BY2A 4IDJH 4QRUB 5L4IA 4UTBL 4EDXB 3KMDA 2APTA 2DQCL 1TF4A 4EDWL 3OB0H 4RSVA 3BT0A 1A4JB 3WHXA 1MJ8H 4MZRA 2EDHA 3OKOB 3V6FB 1JI1A 4TQIA 3D18A 4GAGH 5D2NA 1Q9LB 3LKSA 2MOGA 2MRYA 3K2KA 5JYMA 3IFNH 3K1KC 1CFQB 5IP4A 3IDYB 3IKKA 5JXED 1G7LA 2Y5TB 3BFQG 3LIZH 2XQYK 2HLEB 1FNGA 5DRZA 3WO4C 4DPCX 1GCFA 2V2TB 2WBJD 2VXSL 1JPSH 2ZX7A 3CDCA 4MJIB 1GSKA 5JO5A 4LEBA 1P7QA 2VOTA 4L5FH 3UEQA 2EDBA 2I27N 2ZSWB 4BXSV 3CU7A 1QACA 3EJYD 5EZLB 4JPIB 4HOWA 3QO1B 1A5FH 5KVMC 2DWXA 5F6IC 1I8AA 3L3HB 4Z8FL 2WWMD 1XGTB 1RZIB 1U36A 3FQNB 2XHNA 4MJJA 5ESQA 5GGQL 5L0QB 4K9EC 1I8IB 1CZ8H 4WQOA 4CBPA 1SBSH 3BGFC 1WA2X 4XPTH 1ZD6A 2B4CH 5EA0H 4NBXB 4H1LH 3RDTD 1IBFA 2ZCZA 4FQHA 4KTDL 1VA9A 3PAZA 4XNZB 2RAMA 1EJFA 3EUDA 3ZHNA 4ERSH 3TT1H 3K6FA 1FNAA 1FG9C 1BVNT 5C07A 2IAMC 3QORA 3U4AA 4JL1A 4B41A 3GBML 1OPOA 2X6AA 1OXYA 3VI3E 1MAJA 3RDTA 1BMGA 5L2KD 5T3ZD 1TQUA 2BVUA 4P23B 4X6BA 1IFRA 4DKDC 1OTSC 5D1QE 4JJ5B 4PJFB 4JGUA 5B39G 3FCTA 4IKIA 1DLFH 4HJ1A 1YEIL 3BP5A 5F3HB 5CJQH 3HC2A 4P2OD 3S88L 4WJG3 1NCBH 4UV7H 4BE5A 5E51A 5LBSA 3ZZSA 5SWSE 2X4TA 2DLEA 3MN8A 1WC7A 2CM5A 3NP4A 4UT6L 5DJXB 3WDHA 2ED9A 3ZE2F 2WXOA 1A3LL 4P9HL 1D7CA 5EO1A 1YAIA 5D7KE 5PAZA 5IMOB 3IS1X 3QISA 2WNXA 1OO2A 5D2LF 3BEWA 5DJ8A 2IPUK 5EC1A 5I17B 1P6AB 5AYTA 3X13B 4FDWA 3CC5A 2FK9A 4PWIA 2X3AA 5IFJB 2NQCA 1RUQH 4KKRA 3MCLL 4PGEB 3U46A 2EYRA 3QG7L 1F6FB 2EIKB 4QRPB 5CINL 3W2DH 5CZKA 4EQ3A 2IOMA 5TH2B 5IJKC 3TXAA 4JB9L 2ARWA 3N91A 3QUZA 4NZDA 5CSZA 4H2AA 5GGRB 1UURA 3LPOA 3PHSA 3VI4E 4JPWH 3OKMB 4WRLA 1I1AA 43C9B 5I8OL 4RMVA 1ICTA 3WN5B 4MA1C 1T04A 1S9WA 4M6MH 1R0AL 3N41F 4B7LA 3KPLA 2I9TB 3GUFA 3KGRA 3VDAA 2V5YA 2NY3D 2XG5B 2G60H 3MBXH 1JXGA 1KZQA 1MNNA 4ZSOE 4YHMH 4IMLA 1PLBA 1RZFH 2VCOA 2AJSL 4HIIA 3EG9B 2XETA 3KPSB 3HN5A 1S7QB 3NK4A 4IU2A 5GS0L 1ACYL 1PZ3A 4QLWA 1WAPA 3HZVA 4PGJA 4LSQH 3FUDA 1TEYA 4FTDA 4FQ2L 3S3PA 4NQUA 3G08B 4YSTA 2NR6D 1CICA 3TYFA 3LAFA 1P53A 5HGHB 3KCWA 5IVNA 1T80A 1DYZA 2A83B 1B2WH 3VVWA 2FJHB 4JDEB 5E8EB 3RVTC 2H3NB 4F9PC 4EIUA 4U1MB 3GSXA 4YDVB