5LLIC

Pvhl:elob:eloc in complex with vh298
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
141
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and selective chemical probe of hypoxic signalling downstream of HIF-alpha hydroxylation via VHL inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 31
structure length 141
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2016-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 5lliC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 5lliC01
5LLIC 4AJYV 3ZUNC 3ZTDC 4W9JC 4AWJC 3ZRCC 3ZTCC 4WQOA 4W9FC 3ZRFC 4W9HC 4BKTC 4W9LC 4W9EC 4BKSC 1LQBC 4B95C 4W9KC 4W9GC 4W9IC 4B9KC 4W9DC 1VCBC 1LM8V 4W9CC
chains in the Genus database with same CATH superfamily
2B39A 4GSDL 3QDMB 4NM4H 5EIIG 1TCRA 1E2ZA 4WAFA 5G2NA 1NTDA 1VEMA 1M2VB 1JWMB 4KJPC 5E5UB 3GNMH 2BW4A 1PY0A 3CK0H 2AQQA 5F9JA 5DURB 3O6ML 4KK8C 4TN9A 5FLUA 5KVFE 1JFQH 1CFBA 5T1MA 3DLQR 2IDTA 1MPAL 5IQLA 3HRZA 4AUJA 1CGYA 2QLVB 4AQ1C 4G82A 4ABUA 4GLRI 4PGDB 2WBKA 3UROR 1N5AB 1TVBA 2KT6A 1HOEA 4DGVH 4EAEA 5H37G 1YCSA 3SKJL 3FTGA 1K4CB 3NSDA 3TNMA 1A6VL 4KJYA 4PG9B 1GHFL 2YAMA 2DPKA 1VB9A 2BC4A 4G5AA 4JFPB 2OMXA 4MASA 3SJVD 3L2LA 2Y3NA 1RU9H 1NOFA 1WEJL 4M93B 3HZKB 4AYMC 3TA3B 4O2CB 4WO4A 4H13C 4FQ2H 2VDLB 1CDHA 3Q44A 3QNXB 4RGOL 4G43A 2F54D 2QMJA 5DMKB 1TTUA 4AVKA 2E7MA 4HKJB 3VGAB 3PUUA 3IJ8A 2GHWB 1ZLSL 5I1DA 1KC5L 2Q76A 5B1AB 4LSPL 5C3IA 5F3BA 2R4RL 1WK0A 2R1XA 1MHCA 4L1SA 4HGKC 1W0VA 4HJIA 3HE7B 2NXYD 1C8PA 4L37B 3LNDA 1AR2A 4JHVA 4TQEL 4I0PC 4KXZH 5D4QA 5E6RB 5EO0B 2EDDA 3MLYH 3FS9A 2C9RA 3OM3B 5J12C 1JXKA 2E86A 1SXNA 2F5AL 3QNXA 5EO1B 4OCRL 3RWDB 1AGCA 4IRSD 1UWFA 4OGQC 5MEPB 1NIFA 1ND0A 4EEEA 5I76A 2Y22A 3KXFB 3QQ4B 4S1RL 3AREB 5JW5B 4XPAH 3AM8C 3VFPB 2H0JA 1RD6A 3H9ZA 2QV2A 2BVOA 4WWNA 4LU5H 5EU3A 4FP8L 5FYJU 1W72B 1Y1DA 4NHUA 2XV0A 1Q0YH 3I02A 3A21A 5BUGA 4UTBL 5CSZA 2XWDA 4JO1H 4TNGA 4A2HA 1AJ7H 3ZRFC 4HPOH 4XCYA 3FU8A 1NM9A 4RZCA 5E95B 1EXGA 3GMOA 3LZRA 3PRZA 5IVZA 4BRVA 1JOIA 2WLLB 4CRPA 3E3QC 1ACZA 2WLZA 2H3XC 4IBSA 5DRXA 5IJDC 2F54A 3PNWB 1PU0A 5SX5K 1SMAA 4ONHA 3RX8A 2CO2A 1JZ3A 5DZJA 3GIZH 4PRDB 3G08A 2EVJA 1FORL 1BMGA 1UH3A 2QQLH 3GXIA 1YNKL 1CGXA 4ZNEE 1EA9C 3NOIA 1WZMA 4DK5A 5I9QC 2VR6A 1D6EA 2AJ3A 2VDLL 2VWEE 4PJ5B 3O2WH 5GRUH 2Y6TE 3RB5A 2F7OA 1RK1B 2NW3B 3T0WA 5MP6L 3L3IB 3CQFA 4RFNC 3GZQA 3HHMA 3FAWA 5HVGB 2CR0A 1AXTL 1KUMA 2DZEA 4H8HA 2CLZB 5CZXC 3SGJC 4BK5C 4WHCA 4RLDA 4LLVA 5GPRA 1JXDA 1UWXH 5KBPA 3VE0A 4MLSA 3RVTD 2B77A 2YC1A 3FXIC 5IJBC 2UXFA 5B4MC 4MJHA 4KOBA 2YXVA 1H15A 1AE6H 1IGIH 2FQDA 1DVYA 1RPKA 4GG8B 2V7NA 2KZ1B 4PJ5A 1FZJA 1N10A 1S9XB 4WK0B 5DD6A 8CGTA 3S3SA 4AQAB 1F6FB 4CN4A 4UF7C 4EUPH 5F6HJ 1L6ZA 4APQA 4URKA 1BZQK 4LPTA 1XAUA 3UDWC 1ADQH 3L2NA 1PX4A 5CINL 3EZ8A 1HOCB 3TV8A 1WH0A 4KVCH 2J20A 2QELA 5AW8B 4R97C 3KPTA 3WFZA 4AYID 5FHBH 2IBZX 3T2LA 3E38A 3EYQD 2AABH 4QTHB 4UU9B 1R6VA 5DDHA 1Q9KA 3U0TB 3WNLA 4DETA 3NIDE 4XCEA 1NFAA 4AEHL 1Z7JA 5C0CB 3MACH 4PVLA 4NFCA 4IIQA 3T2NL 3UZVA 4APQB 4ZD3L 2IALB 3D0AA 1PG7H 3FH7A 1ASQA 4C4BA 4LKCA 4E9XA 2IWGA 2NYYC 1PFCA 1WWWX 1EO8L 1P5UC 5DQJA 2EUXA 4NRYB 4NP4H 1GHFH 4YBHA 1OY3B 1PBYA 1QA9A 3HNTL 5C08D 2ATAA 3IJYB 2FSDA 1T22A 3EO9H 1BD2D 3V0DA 3MU3A 2ADGA 5FGBC 1ZTXH 2BJML 4LSTH 4TNWF 1YJDH 5AL0A 2P5WA 2NY3D 4GAGH 5A2AA 1QLEB 2X6AA 5D1ZA 5I66B 4F91B 2HMID 3TBWB 4JCWA 4ZMNA 3K4DA 4QRAA 1XVSA 3QW9A 1AY1H 5EF0A 1QRNA 4ZFFA 3VA6A 2NMSA 2V3DA 5TK4A 3QQNA 4H1LG 2IGTA 4PRPE 1AQKH 1IT9L 4U1HA 3VD2A 2DMGA 4OCSH 2NPLX 5JNYA 1QFWL 5TH2A 3ILPB 4N0CD 2VC2B 3N55A 1LO3H 1LK2A 3HC0A 1XEDA 2FYYB 1YUKB 3QUXA 5GS3A 1CE1H 4ZTPL 2MNJB 3T6XA 1JCVA 3V6FA 4YDKL 5E2UL 4OZ4A 3FOLB 3W5MA 1P7BA 4L48A 1INDH 4MA7H 4M7LL 5ESVB 3P3TA 4XNYH 5JHDA 2MFNA 3NPSC 4IBTA 4JUSA 4UQAA 5DYOA 5DK2A 4K2UH 5DFVD 4NO0B 5CR8A 1WIUA 2VR8A 4JFDD 3D48R 4NENA 4ZNEA 1FUNA 3F7LA 1R9FA 3ET9F 4NN5B 4XI5C 4DN3L 2AEQH 3AREA 1MKFA 4QRRB 2P48B 5IHUL 3HC0B 2ZNWA 1MPAH 5FYKH 4YDIH 5JIKA 3TWYA 2GJ6E 3EUDA 2V2WA 1C08B 4LCWB 1W72A 1WZ1H 5EDSA 1HINL 5IT2L 4XCNB 4XN1A 3BP4B 1SQ2N 2QADD 2WNWA 3FBQA 5J0BA 1XH3B 3IJ7A 1QFWM 2COVD 3OWEA 3CN4A 4P2AA 3SE9L 5ITFB 1CGSH 3WKML 1AG6A 5ALCH 1U8OB 1YQ2A 2CIKA 4HV8A 5C9JA 1R24B 4HKZB 3ZTEA 1A0QH 3GSQB 4UTAA 5DD5L 4PRNB 4MAYB 5E08L 2JB5H 3CVBA 4AWJC 2E7CA 2BY2A 2IAMD 1E4HA 3O6FA 4UYPA 4CU8A 3B56A 1WA0X 4JE4B 2DDQH 3IDYB 1CLVA 3ZXAC 4LSVL 5I1HL 5TDNA 3VFMA 2QPDB 1CS6A 1BJMA 4W70A 1C5CL 1P2CA 1GAFH 5C09E 5TF0A 4M5ZL 5FDWA 3T2PA 3DJ9A 4U1KA 4QHMB 2EJ1A 3ULUL 1S7RB 1MI5D 3KPMB 1TU2A 3DXAE 4F9PC 1IO4C 4XBGA 2HJFB 2ENJA 3U1SL 3MBXH 1WBZB 1EZSA 4KQ4H 1M7IA 4P2OC 1RURH 2WLIA 2IWEA 1NCWL 4HEMA 3MLRH 4WK4B 5EIVA 4L9LB 4NN6C 3IYLW 2GY7B 2DIBA 3IS0X 3VXSA 1G6RA 1HDMB 2C3WA 5A2LH 1EBAA 3VXSE 1CLYL 5DC2A 4LRIA 3O9WD 4P2QE 4PJ8B 1D6VL 4DIXA 4PGCA 5K1NA 2CR3A 3M7OA 1KPUB 3UMNA 1CWVA 5IOPB 1GL4B 3GKWL 3L1EA 4HWZA 4IKJA 3VH8G 4TULL 4IEFB 3BPOC 3V9FA 1NCDH 1DCLA 2GTZA 2A77L 3T09A 4UT6A 3IRCA 4YHPA 5JPMA 3B83A 3SYOA 1ZANL 3VI4F 4ERSH 4TLUA 3QDMD 2ADJA 4NQCB 4GQPH 3KL3A 5HHOE 3RILA 3QWRD 1U3ZA 2FO4B 1WTLA 4UM8B 5ITBH 1MRFL 4AOFA 2UWEE 4JFFB 1FL5B 1NEPA 1OM3L 1JNNL 4EI5D 3V4PA 1JGEA 2CH8A 2XKUA 4JDTH 4MAZA 1GY1A 2GJJA 1NDGA 3RQ3A 4U49A 4AQ1B 2CLRB 2HA1A 2Y36L 1HQRA 1VZIA 1K2DA 2DQJL 4PN6A 4Z7WF 6CGTA 2DLGA 3G5VB 5IB3B 5F7DB 1U8MB 4HPYH 3RP1A 1XMWA 4KO5A 3DX3A 1Y07A 3OPZH 4PWIA 4GBXA 1UOLA 4WI2A 1U8PA 3VFWB 2BNRA 3IE4A 2ENSA 3AU1A 5JIIA 4ZZKA 4ZSOE 3QXWA 4FA8A 1NDGB 2H32B 2VLKA 1CD0A 3FTXA 4CILA 4IIQC 3SBWC 5D2LE 3FT3A 4YVNA 1LO2L 1HH9A 1H8LA 2PCPB 4OFYD 1LILA 4AV5A 1E4KA 3MROA 5IB3A 3PHAA 4F1ZA 5MEQA 1SHXA 5FYKE 1V7MH 4LDEB 4BV1A 4Y88A 3ME0A 4HAFA 4DWHA 5C7XH 5DHXB 3F12B 5JZ7C 2MCMA 3L81A 1DQMH 4JEGB 3SDDA 2NY5C 2X2HA 5ESAB 2AEIT 3FK3A 5IBLD 2D0HA 4A39A 2W5PA 3Q8EA 3I6LD 2Y9RT 3V7MA 5FS5A 32C2B 1U58A 3Q2CA 4QHUA 4G59C 5ID1A 4OJYA 4JW3A 1R5IA 4QI3A 1RZFL 3ZKNC 3NH7L 3P2BA 1DTUA 3E6FA 2VO8A 3GPSA 3D9AH 3PIQB 1OK0A 3BVNA 3EJYC 1KLUB 1I8KB 3ME0B 4WWKA 1QBLL 1CE6B 4G7SB 1MRDH 4JY4B 3D85A 2OYKA 2BWIA 1X5JA 4AMWA 4A38A 1DUZB 3SDAC 4P5KB 3BGAA 1UZGA 1FYHB 1P6FA 5HVHB 2P5WE 3ARBC 4WUUA 5FC9A 5FYLD 3RIAK 2A73A 2ZWZA 2I5YH 4UUJB 2ENYA 2JQAA 2XWBB 3CFNA 4JB9L 3QORC 1YG9A 2XZCL 4PJGB 1ACCA 1ZHLB 4URTB 1K4DA 4JQVA 2UXTA 1UWGH 3FU7A 1WE5A 5TPWL 4YQXH 3ABLB 3CVDA 3GSQA 4ZXBA 1RZGB 1S7TA 4NQCE 1FNLA 1QRNB 4X5PA 1ROWA 3CX2A 1TJHH 4YR6B 3QPXH 5DK3A 4M1DL 4Z7QE 4B60A 2K4WA 1N5YL 5MENA 3E8UL 3CU1A 3WLWC 1U3HA 4WFHD 5L8LB 2RCSL 2ZPKH 3F2LA 1Z0MA 5FCUH 1PZAA 2RA1A 4R7DB 1SXAA 5C07A 3V5DB 4KGLA 1I9JL 4NX0A 4RWYH 4HU2A 4F8NA 4BGDA 3BIAX 3B9KD 2TSAA 3J07A 1NAMA 3ARDB 4LSPH 4ZUSB 1ZV2A 1BV8A 2BM3A 3P3YA 4Y19B 2J2ZB 4W93A 1QO3A 1JYNA 3PWVA 1I9IL 4RMTA 1IAOB 3F01A 1AS7A 5GGSY 2WJ5A 4U1GC 3MV8A 3ZL4L 1UB5B 4J4PA 2P49B 3QJUB 1UD6A 5EZPA 5CKGA 1FLTX 3NT0A 5JW4Q 3TS8A 5DO2C 3T8VA 4UAOC 4DEWA 5D2LB 3ZSSA 2NZ9D 2QHLA 5IVXF 1A6UL 5IIEA 3SDAA 3X11A 3MRMB 2NT0A 1XBDA 2CRYA 5EZOL 2EDQA 3NA4A 4KH9A 1NCJA 4I3RL 4HS8H 4HIJB 1MRFH 1LGVA 1EVUA 1ZSDA 2XN9E 2G5BA 3BAKA 1PG7W 2QHRL 1PZCA 3QR1A 1TVDA 4HFUH 4OZGB 5E2TH 1OCRB 5IQMA 1CBVL 3ALWA 3K2MC 4ZMZA 4PJEB 2J44A 1EH9A 3O4LD 4HUXB 1F97A 3HR5B 3OJDA 2EVHA 2LV4A 3LMJH 2Q10A 4X4ZA 1T4WA 1F6LL 2ZT9C 3NCYP 3CIAA 2EYSB 2APWA 3KL0A 2CK2A 4M48H 4WENB 3APFA 3EFFB 4WSGA 3NGBB 2PTTB 3MLPA 4NNPL 1IJ9A 3OXSB 5C0CD 4OFKA 4KNUA 2C9QA 3A67L 1A1MB 1ORQA 5I1EH 3P2TA 3FQRB 5F9AC 2CUIA 1BQLL 1CDUA 1BYPA 5C0AB 4AXWA 4PTUB 3TESA 2X38A 4I89A 2X4TA 4B9KC 2PXYD 4JJ5A 1RU9L 3IDGB 4KX7A 1DN0A 3O41B 3VDBA 4YPJA 4Q6IC 1MW2A 3EFFA 4XN5A 4TTDD 4AGOA 1ODUA 5A6LA 4ZD3H 1SBBA 5J9PA 5D70L 2XVGA 4KMTH 2FVNA 3W0WA 5EO9A 2ERJC 5D96C 1SVBA 1ZGLP 5DJ8B 1AHWB 1JD9A 3SQBA 2PWEA 1CFTA 2AEPL 2XUWA 3Q6FA 4KJWC 4AK2A 3BH9A 4DQOL 2BSSA 3CVIH 2EADA 4WFGE 4XXCC 3TCLA 3E9UA 3CFEA 1BOGB 1WQVT 2XFXB 3E9TA 2PXYA 2VMEA 4CSPA 3QCTH 1EFXD 3U6RA 3VB9A 1RZQA 2XYBA 3C6EA 1FRGH 2VWEC 1VF5C 3EGDA 1T5XB 3B3IB 5E8DL 1OGPA 1FLRL 5EO9B 3BGFB 4NHUB 5E1AB 1FAKT 1BBDL 3ZDYE 1A7RH 4HOXA 4XCCH 2QFRA 5FV2A 1KXQE 2AQNA 5IVZB 1N4XH 2BSSB 3CWGA 1K8IA 5F6HI 4POZC 3UAEA 3T0DA 3MZGB 1PSKH 1AHWA 2P1YA 3WS6A 3HNSL 4LF3A 3W5NA 3G5WA 4DP1X 4FEMA 5FECA 2E4TA 1G4MA 2GK2A 4Y2OB 2AXGA 3JUYA 4G71B 2FIRT 5CCKH 1M53A 3N91A 1J88A 1QFWH 2GTQA 2J3SA 4JKWA 4ODBD 5D6DC 1KN4L 4KRMB 1XB3A 3LJ3A 4FCHA 4ZS6D 4YDVA 4YBLB 3R18A 2XTLA 4XVJH 1BF8A 3N06B 5I1GL 4TQIA 4U6XB 5E9DE 3UYPA 4KQ3H 3ZDYB 1TTBA 3M07A 3SO3C 3S5LG 1S3KL 1JGLH 3DIFA 2WP3T 2R0ZH 5DD0H 1GSMA 5CN2A 1KXTB 4GQ9L 2WXQA 4FZ8L 1FL3B 5E8PA 3RGVC 3GSRB 2ALAA 1Y0LA 1QUPA 3LRSB 5C7XL 2XBDA 4UU9A 2LVEA 1P4IH 1I8LA 1IBGH 1ZS8B 2YGNA 1Y1UA 2F53D 3P73A 2YMXL 3VI3B 2WQRA 5AB1A 2B1AL 4C58B 4ZPVA 2DI9A 2V2XB 3GJEB 5TE6H 5H94A 4F1SA 2FAUA 4UOW0 4PY7A 2G0LA 3LPWA 1DUYB 2YXWA 3FQTA 4OLZH 4Q52A 1QR1A 3PL6C 3GSOB 1IGIL 1E30A 4X99B 1A4AA 2R2BA 3IM1A 2FX7H 4MKTA 3QZWB 2W0FA 4PJAA 1XSIA 3PE9A 4HS8L 4NC0B 4MRBA 3H9SB 5LG1A 4K3DH 1SLUA 3NK3A 3SE3C 1A4KA 3AQXA 3ISWA 5K93A 1M05B 1OTUD 2EDBA 4NEHB 4C57C 5EFIA 3GSNA 1F42A 1Q94B 2WYIA 1KBKA 4FXGA 2Z31C 3GJFA 3WD5H 4X7DC 1S9KC 4HCGA 4OI8A 2OW7A 2GI0A 1OGAE 3WXWL 3IU4L 1E40A 1UM5L 1B4JH 4J3WA 4LLDB 4R5XA 2HT4D 3EOBA 4KH2A 3T77A 4DVBA 5DZOA 1XGTB 3Q8CA 4M5SA 5G5DA 2NLJA 5AVTB 1D5BB 5JQ6H 3NMEA 3ZKMC 5IMMA 1YMMD 2ZF9A 3SY0B 2ZOUA 2YUXA 1MREH 4IRJD 3S36X 2BDNL 5HYSG 4MQ7A 4JGHA 1H8NA 3V7AG 2XIDA 4YDLB 2H1LM 3MBWB 1U3HD 4L29B 1XCTA 4QHMA 5CJBA 5IMOA 3WNKA 4Z6AT 3B43A 2C3VB 3TZVA 3HJ0A 2FX8H 4PP2A 2HG5B 3GBLA 5DJ2B 3RZCA 2C9WA 3N40F 2Y1YA 4KJQC 2QQNL 3LHPL 1XR8A 5B8CB 3HRZB 2Z0UA 1LO4H 2Z8SA 3Q1SH 4PBXA 5DJ6A 3X12B 3HBZA 4LL4A 1DVFB 3RHWF 3GTVA 4P5RA 1NDMA 1T1XB 1X7TA 2HLFC 1JNLL 4WI5A 4PG9A 5E6IA 4FMFA 4FJZA 3C5JA 1TUPA 1EEZB 1PZ5B 2WUBL 5IG7B 1KJMB 4WU5A 2Q0ZX 4QJ4B 1OHQA 3EDJA 3DRTA 3W0WB 3V0FA 3NFSH 4Q9RH 2LE9A 2X0UA 3MBXL 4FMKA 5LXVA 2P24A 2VN3A 3MJ8B 4GH7B 5HHNB 2O6FA 3QUZD 4F20A 4RGMC 3D4GA 5KVEL 2A2QT 2Y7QB 4AY0A 3CE1A 4Y19A 4U05A 4G42B 4NOFA 1OB1B 3GRWH 4AKOA 1ZEAH 3QXDA 3CSYB 4QRRA 3MRKB 2JELH 3ZNGA 4YXKH 4JJOA 4E0RB 4I0CC 3BT2H 1I8IB 4P23C 1VDGA 1KV3A 3JVFC 4L2YA 1QOKA 1HS6A 1A02N 1S5HB 3KPOA 4M62H 4HFWB 1F3DJ 4WLCA 2G5UA 3RPIB 3ZRSA 1RZIB 4GW1A 1DE4B 3M1BA 5C3LD 2XVBA 2P7TB 5IHUH 3ULSB 1QI5A 1MNUL 2JVUA 3FFCE 4QNPF 4E9RA 5GZOD 2VDML 2VDNH 2Y3AA 2A6KA 2F58L 2HKFL 2PYEA 4N5EC 5K39A 5GRVK 4ANKA 4F7MB 4DPCX 1KULA 1UASA 5CEZD 2IMNA 1N59B 2JXMB 5CP7A 1ZLSH 2VT0A 4CBPA 1J48A 5L8JB 5ADOL 5IMLA 5HI4D 5KVDE 5KBDA 3US0A 3MA7B 1F8TL 2R2EB 1GH7A 5DEJA 1O9WA 5SWSA 4X7TA 4H25B 1FAIH 4G80B 1FVDA 1LYQA 4FCAA 5DZAA 1X4ZA 4NI6A 1OAXH 4K94L 3ZDYF 4D9QE 5I1HH 5DR5L 3L3OB 3V9CA 1CTOA 3U0PA 2GTZB 4PRPB 3WUZA 4YZWA 2H0EA 1E65A 4NQSA 4G72B 5I74C 1JWSB 3EADA 1IAIH 2P5PA 1JPSL 3CZSA 5JOFB 3ZRCC 4IOFC 1OM3H 1D5MA 1KB5L 1R34A 2WO2B 1JXGA 1ASOA 3VXTA 4DAGL 4KPHL 4APXB 1ASPA 2RJMA 4OIBA 2WXPA 2IDUA 3ZE2B 1CICD 4XCCL 2FB4H 4BDVA 5CBEB 2A38A 3BPNB 1UXSB 1ZVSB 3LQZA 1OZUA 1YMHA 2A9AA 1I85C 3JV6B 1E2WA 5A2KH 3BVUA 2PYED 2R2BB 2UY7A 1ROCA 3WEAA 2XPGA 1B4JL 3DMMB 3SJVE 4LHUD 3HFMH 3HNTH 1S7WA 1Q0XH 4RFOH 1DJGA 3QO1A 5F9OH 3GRGA 1EGJH 4FNLH 5TQ0L 3BP7A 1FL6A 3EAKA 2XETA 2IG2L 2VTFA 3CZUB 5HYJE 3GK8L 1YEKL 5BZWA 1AOZA 3AFLA 4G8EB 1KYAA 1TDQA 4FERA 3FTSA 1SXBA 3G5VA 4YGVB 2X0WA 4UM9D 2BS9A 4GG6F 3KYNB 1I9IH 5TF1L 3V52H 2UY7B 5C86A 2BMKA 4LARL 4LFHD 4KXDA 3ZDWA 5I75C 3NSXA 3EFOB 2XCMC 2FD6L 3TLRA 5DA4A 5KBNC 3C6LC 1BM7A 1ZT7B 3GUFA 3MV01 2HX9A 4NHCL 4GG6A 5HJ3A 4TL5A 2GSIB 1R5VB 5BRPA 1HVXA 4YDJA 4KDTC 3V6ZA 5D5MA 4JB9H 2DRUA 1SEBB 4P4KB 2EKSB 1AD0A 1LEIB 5C0DA 1CICB 3CFBA 4G8GB 1BM3L 1JNLH 1XGQA 4W9IC 3CV5A 4ZS7L 4ZMYA 5ES4B 5JHLL 3D9AL 3CXFA 3ZK0A 1F11A 1NEZB 4JS7A 2DV6A 5FKAA 1I53A 5DRWA 4D0CA 1EV2E 1SXZA 2ITCB 4JY5H 4QRQA 5JPNC 4ABVA 4EI5C 1MUJB 3G6JA 5IROA 3CXHJ 2WLHA 2VCOA 4JVUA 5ICXA 2X89D 3I6KA 3RTQA 2H3NB 7FABL 1JZ8A 3T1WA 3IVKA 1Z6JT 4Z77A 1RJZB 5T5FH 4Z3FA 2FLBT 3N5AA 1OP5K 4G6JL 3H3BC 2DQTH 2J8UE 2YA1A 1E6JH 2X2JA 4WO4D 2Y6SC 2VR7A 3QIUA 2DJUA 4Y4HA 2IEPA 1ZRUA 2ESVD 1VCAA 3L3HA 3U1QA 4RFEB 4N0RA 1IKFL 5I6PA 1XCWA 4WCYH 2B16A 1PG7L 3KYOA 5E00B 4AUYA 1AGFB 1IGFH 2FT6A 1A9VA 3HRPA 5CEZE 2I9TB 3CFJA 3H7BA 1WG3A 1EO8H 4M61A 4P04A 1EX0A 4QXGH 4ADGA 1JVKA 1UJ3B 2AXFA 2V8LA 2TAAA 5IESL 4HEPA 4BA8A 3BEVA 4KTEH 4ZO6A 4QRSB 5E5MA 4U0RB 4WNQB 3M88A 1R47A 1IAKA 1MVUA 5CMAA 4RMQA 4X9HA 1E0OB 2IPTL 2CDGA 5AYUH 2BIIA 5GS0H 3GMMB 3HAEA 1S5HA 2ZOOA 4BSWA 3CFDA 3ZE2E 3NJIA 3INOA 2XQBL 4XBMA 4X9GA 1NFIA 2GIYA 3ARFB 3TYGL 3LN5A 4RGNE 1FP5A 2RQEA 1ETZA 3V6OC 3GIVB 1A66A 1XEUA 4K94C 3F7KA 2HT3D 1D2OA 4TYUA 5JZ7D 2AQRA 3MNVA 1E27A 4CC0A 2XN9B 1Z9OA 3TN0C 3QA3B 5EWIL 1NGWB 3S96B 1MJ7H 2H32H 3VYNA 3VD5A 2OSLB 4AM0B 1HX0A 3BP4A 3LNIA 4JPKH 2AEOA 4RA0C 3S5ZA 1UACL 2W38A 1XR9A 5DMKA 4IBUA 4UB0H 2YQGA 5F7YC 2YSSA 3WJMB 2EZ0C 4YXHH 3L3IA 3IETA 2DQIL 3BGMB 4PJGF 5KSVB 4OCLC 2PYEE 3EOAB 2HT2D 4FQXC 3VD3A 1P53A 3R1GH 3C2SA 1RSFA 1WGOA 2EABA 2VR9A 1URIA 2HTKD 3NIGB 3MV8D 4YAQA 4IRZL 1BOYA 5DMGD 2DQUH 2PPAA 4V11A 1EAPB 4ZT1A 4GP5B 5B8CA 3EGDB 4ATTA 3DBXA 4JDVB 2MKWA 1OSEA 3F65A 2WVVB 3MJ9H 3ATAA 4MDJB 1CF8L 4NOBA 3UH8A 3WMQA 1DVQA 2PCFA 2VDRB 3FQNA 1T1XA 2AVGA 1NOAA 3TCLB 2EXYC 4DKEL 5F8QC 3TWCH 2Y1AA 2EVGA 2NY1C 1S9XA 1ZV9A 3VXQA 1ACXA 3HFFA 5DVNA 1M71A 2GB2A 3UZQA 1S3KH 4J6IA 3OAYK 4IKKA 4MWFA 3NRQA 1A3RL 3H2QA 2AJSH 3FQ1A 2IBBA 3V4UL 5KYXA 3WIFB 3V8OA 2W59A 1T7YA 2YRZA 2QQKL 1AXSA 1BDYA 1IKNC 2P47B 3BO8B 4Y1AA 2VDNB 4N2IA 2FBJL 4LGSB 3VTMA 3K2UL 4U1NB 2APSA 4NYLB 1N3NA 1J10A 3LKQB 4NIKB 3N6YA 3VVWA 4UMGA 4BINA 5IWLC 2WXHA 4FJYA 1RV6X 1DE4A 4AXWB 4P0DA 4JHAH 4LARH 3UOAB 3HUJE 1PSKL 1NPNA 1B3IA 4G1MA 4I13B 4LSVH 1QLRA 1TVHB 2E6JA 1S7SA 2PTTA 3PWLB 1JK8B 4M3JA 2RALA 4UQCA 2HH0H 2OPCA 3NN8B 3P02A 1HXYA 2AJZB 3MLVH 5F88B 2DYRB 4IMLB 5F7AA 1T22B 3LKSA 5HJBA 5D7JA 4JHZA 5F3BB 3QIBA 2YOCA 5L0QB 1I8MB 3ML8A 5ICUA 3E7JA 3JWOH 5FM5M 2HFFA 1FLRH 5A3IC 1QRND 4JM2D 4JY5L 5C0BD 1ZD6A 3IJEA 1CI3M 1CIUA 2AXJA 4YL9A 5DI8B 2EEXA 2AF2A 3SOBL 2R27A 1PEZA 2WOBA 3B9EA 5CZVH 2K8QA 5FA4A 1SMOA 1REIA 1KOAA 3HC2A 2G5BB 2DIEA 3UTPD 2EEFA 3EF7A 5C0FB 5L2KE 3DVGB 1JPGB 2NY2B 4XVOA 3C8KA 4KDVA 1RH8A 3U30C 3NDZE 1KNOB 3IAPA 2BVYA 2A9NL 4FTVE 1FFNA 2VDPL 3MXVL 3TFBA 3DJRA 3UC2A 3WDIA 1A64A 1UB6B 1MCHA 5DRNB 3GJEA 3CLEL 3HG0A 3MNDA 2XN9D 3QEHB 4HIHA 2WXMA 2AITA 2OSYA 1VEOA 4NBYB 4Q4IA 3SGEH 3BD3A 3HG1B 2GPZA 2J1XA 5I1GH 1HHJB 4JFYB 3MGTB 5IHLB 1HOCA 2IIJA 1Z32X 3LPPA 4YN3A 3MLUH 4LMQI 4EE2A 1E7UA 5L2KB 2VR4A 3UAAA 2NOYA 3D3VB 2ZXBA 4P57B 3HZYB 3GMNA 1WBXA 3HMXL 1HHKB 1R3KA 1J05A 2HT2C 4X2UA 3SE6A 4QRTB 1DN0B 4ALAC 3WE1A 3QZWG 4J12A 3R7RA 1XGYH 1Q0EA 3TNNA 4XNZC 2IXQB 4R7NA 3Q5OA 4LLDA 4W4NA 3ECQA 1WZLA 3T8MA 2MNWA 5E5MB 1PLCA 3L5IA 4WFFD 2NY5H 3O4LB 4JFPA 4JFYA 5BO4A 4OR1A 3FBKA 4OV6F 2NY0D 2Z4TA 4WWID 4BYHA 4EMZA 3VXRA 5IB1B 4ZMWA 3HAEB 2WGXA 4Z7IA 2BY3A 1V7NH 3L3KB 2NTFA 2P3YA 4MX7A 4FQCH 4TVUA 1JF5A 5J3HD 1UKQA 1X6LA 2EACA 1D9KC 2VLJB 4PJBA 4M4PA 4DN4L 4OD1L 1OTSC 3VSUA 5J5EA 1M2VA 1BVKB 5BRZE 5FFGA 2G2RB 3U7AA 3EH1A 2CGYA 2QDWA 2VDPB 4EI5B 1GGBL 3HA0A 3PHOA 3P0GB 1DR9A 2AJXH 1ITCA 1LWJA 1YYCA 3IDNB 3MKGA 9CGTA 5D7SH 3GSUB 3E3QE 4OGAC 1JV5A 1KJ3L 4HULB 4DKEH 3TWCL 3QUXB 1Q8MA 3SCMD 5I74B 3QJQB 3QNZA 2CLVB 1TSHA 3GMPA 3KLLA 5KVFL 2B59B 1AGDA 1EAPA 3BT0A 5E94A 4XP6L 1KXQA 1ZXQA 2BNRD 2P24B 3S34H 5HSFA 3P2DA 4Y8AA 2HPTA 3U4AA 5MENB 4DO4A 3ZR5A 4ZDHA 4PGJA 4GRWF 4YHKL 1T0MB 1TPXB 3QZBA 4KZDL 1AHKA 4PGCB 5SWQB 4OD3H 4FTVD 1MI5E 1IU1A 3ZOAA 4R7DA 5KVDL 4R2GC 5BMFH 4XMZA 3SZKC 4FGMA 4IOIA 3MV7D 4JHAL 3MA9H 3I2CH 5TGBA 3TF4A 5SX4I 2I5YL 1O7SA 1YC7A 4Z7VF 2ICWI 3T3MF 3HE7A 3LIZH 5I5RA 2CDGB 3DJZA 1F1DA 4ENED 3LS5L 4GUPA 4GRMA 5EU5B 5T3XH 3F84A 2FH6A 3HG1E 2MCAA 2EC8A 4AGQA 4S1SH 2BSCA 1AXIB 1UEMA 3E1F1 1EEQA 2YPVL 4HC1A 5FYKD 5IVXB 1DBAH 4MJID 3NFSL 4HG4K 5C2BL 4Q6IA 4MMZC 5D5MF 4ORZC 2ID5A 4TF4A 2CRMA 2ARJA 5B1BB 4DTGL 3QHZL 2E27H 2HJLA 3VD4A 1AP2B 4GUQA 4ZZFA 3LEVL 4OZGF 4W9ZA 4OZHE 3FB6B 4DGUA 5KOVC 1J0JA 3AS0A 2VLKD 3F05A 1F56A 4KKZA 3BI9X 2R29H 2OJZH 1QEWA 2DQUL 4FQ1L 1XIWB 1OARL 4KUCD 3MYJA 3WV0A 2VDRH 2ZCLL 1KACB 2D7MA 3LH2H 1UD5A 3TO4A 4M7JL 4W9CC 5LGKA 4UT9H 1BZ7B 3WHXA 1XR9B 3TIEB 3DTXB 4DZBB 1FDLL 3QORB 2BCKB 5D2NA 1HKFA 4KROC 2R8SL 1II4E 4H40A 3SDCC 2DQDH 3CX5K 3MUGA 1TT6A 1TKWA 4F15C 1EJ6A 4MJ6B 5IQ7L 4PTUA 4JQVC 4Y2DB 3KZ8A 3OJVC 1MCOH 5ID0B 1PLGL 1NEZG 3FQRA 1IL1A 3KGRA 2OBGA 3IFPB 1QUNB 3VXNB 4G6MH 1JHLL 4OI9A 4D3CH 5C0BE 4D2NA 1SDDA 1E3ZA 1JGUL 1UURA 1UWXK 2ZYHA 2FEDD 2B1HH 4UNUA 4HS3B 2COQA 2MOQA 1OGTB 2NCMA 1QNIA 5JDJA 3F58H 5LHDA 3MLTA 1ILUA 3NSFA 4KC3B 1QYGL 5TDPB 4KTYA 4Z7NF 3KD4A 1U92A 2A3TA 5AOJA 2X41A 4DW2H 2CDFB 2FGZA 1KEGH 2OCJA 4L4TB 5EIIB 1NSNH 4JFEE 4HIIA 3IB4A 3ESPA 1DQJB 1B9KA 1OGTA 4NFDA 1CE6A 2E46A 2VLRD 4PS8A 5TE7L 2QPSA 3ZDZB 3QS3A 4YE4L 1K6QL 3EOYG 4L0ZA 4MB1A 4QT5A 2WBJC 1G9NL 4AL8L 2EYTB 1V3MA 4FQHB 4OJAA 2DMHA 3D50A 5CLZA 1FVCA 4RRPM 1U2YA 2NY2C 3OC5A 4QDGA 4MDIB 1RFDH 5E5RB 5ICYA 3HE6B 1M57B 2EXYD 4UIKH 2YUWA 3CQQA 3QK0A 5CLXA 3U0WL 1L3WA 2H2SC 5JA9A 3NDYE 3H56A 5EEUA 4HYTB 2P45B 2PO6B 4XO9A 4JFEB 4KI1A 2YPKA 3LKOA 4LGPB 4TTGA 4N8UA 1QKZL 4N1CA 4K3JH 2EDOA 2BERA 4PJ8A 1ZOXA 2AQTA 2HAZA 3G9VA 3EJQA 3OX8A 2R2CA 2RBLA 2OI9C 1E8XA 4OVVA 3UZVB 3DSNA 1SY6H 1K72A 1JG9A 2G2PA 1JV5B 3KPSA 1ZAGA 1N26A 4PRAB 1IAIL 3TBYA 1G9MC 4YHZH 2IQAA 4G8FA 1HZHH 1IVLA 3V4VL 2NUTA 1DLFL 2XZAH 3V0VA 5ISZA 1N19A 1P4BL 2I60H 3LVEA 2DDQL 3CVHA 2LFEA 4L5FE 1N0LB 1OGAA 3KCWA 3WFCH 1XGPA 1TZHA 4MMXA 4XN4A 5G55A 3PV6B 1HE8A 2UV3A 4LPXA 4AIOA 4LAQL 1W0WB 4XGZB 5EDXA 1ESOA 1JRHI 2NZIA 1T80A 4J2XA 3FZUC 3MV7B 3NJNA 1BJ1J 5E5LA 1RZKL 1P7QA 3QEQA 1RZPA 3TBYB 4GXUN 5I30L 2WBWB 5IMKA 2YAOA 5MEOA 1YEGL 4N2FA 4OLXH 2MPVA 3KPSB 2WSKA 1NC4D 4PJDF 3FU0A 5F96L 4DGYH 1Z5LB 2FNWA 3MAWA 1ZT4B 4QPEA 4KKNA 3ILEA 4ZQKB 4ODUB 3ZE1F 5EFIB 1CGUA 1YYML 3NJVA 1XF3A 2CBMA 3UTSE 2XWTA 2ZAIA 4YJZL 2X4SA 4K7PX 4RCAA 5L6YL 3VRLE 1J1PH 2H1PH 3HZMA 1YRKA 1JDDA 4M7LH 4PHZA 5FYJL 4HBQA 5DD3H 3MV7E 2AC0A 3VH8A 1DQTA 3D69B 2ICWA 5IKCB 1I7TA 3MCKA 2O5XH 3FONA 4XZUA 5GZOC 1ES0B 1HILA 3FQXA 4O9HL 1PQZB 3PWPE 5EC2A 5B39B 5ISZD 3QEUB 4IIZA 4GFTB 2UWEA 1E4XL 3KPPB 1HI6A 2YBGA 5KVEH 3DURA 4XNMB 4CW1A 2WQWA 1NBQA 4WI3A 3OLIA 5F9DC 1ZDQA 4HAGA 3EYFB 4NSKB 4D3CL 1KBBA 2Y5QA 3QWOA 1DVZA 1U8HB 3O6FC 4TUKH 2EE6A 4JKNA 4P5MA 4XZUB 2X6CA 1SUJA 4LIQE 1GGCL 4JPIA 4RMWA 4DOHE 4DZ8A 5DJ2A 1ORSB 1WUZA 4V33A 3V0IA 3EH5B 3SODB 4HU8A 3BAYA 2HVJB 4GAJH 1XF4B 2UUDK 1HJCA 1THCA 5CEYB 1FJ1B 3D09A 4L8SB 5HHXL 2WXGA 1DDTA 1MNUH 1QR4A 2ZF8A 3SPIA 2FCBA 5EO0A 4HIQA 1U8JA 1QZ1A 2A74B 2MQGA 4AYBA 4OGAD 2DWEA 3C5ZD 4PLKD 1R3IH 3OHMB 4WFEE 1RVFL 3TBTB 1CTNA 5DS1A 2Y5EA 1B2YA 1ETB1 3DGCR 1UZ6F 4GKZA 3IMVA 5IB5A 4E9YA 1V3KA 1I3VA 4P4RA 3T2NH 3RFRA 4J27A 1UWEH 5HDBE 3DO7A 2SEBB 3BVVA 3O8XA 3FN3A 5K59F 3OLEA 2FEEL 1SNRA 3KLQA 5FW6A 2MCPH 4AEIL 4BBWA 5L4FA 3IS1X 1VLXA 3UDWA 3A4DA 4MMYB 1T83A 3EJYD 4P2QD 4A7GA 3TT1L 1KNOA 2X0VA 3EKCA 3LNFA 4F57L 3SDCB 3ZGHA 5IB2A 3MV9E 2WUBH 4MQXC 3GEWB 3RL2B 2ARJB 5FA4B 1ITBB 1ID5I 3UBFA 1MW3A 1TYRA 2YD8A 4L1HA 4HWEL 1L7TH 5J9PB 1FVEA 3PJNA 4RGND 2N7SA 4YLQT 3CZJA 5ITBL 1AY1L 4Y5YC 4YDLC 5KAQG 4TVSa 1JHLH 4NGHH 4CC1A 1H8SA 5IEKB 4HK3J 2BFGA 2YXMA 2B15A 4WHTA 1I1FB 4ZMAT 4XVTL 4UV4L 3P9MB 1BD2A 4HD9A 3B34A 3LEXB 4FG6C 1W8EA 5ACLA 1G9NC 1D5ZA 3FDWA 4LNRA 2XSKA 2OXGA 4N9GA 4PRHB 1E5BA 3KS0J 3LZFL 4XAKD 4XH2B 4QHLA 4IM8A 3CIQA 4FFVD 2K9FB 2OXHA 4FNRA 5IWLA 3VJ6A 4OLXL 4DP2X 2MPAL 5IW3A 4L0PB 3VFUB 4EN2A 5KW9H 3GIZL 3A0OA 2VM9A 1R3KB 1G0DA 5EZIL 1JMXA 2D4DA 4PGBA 1G6VK 2ZIDA 5I24A 1Z1WA 2A6JA 3S5LB 2J8UA 3KR3L 5IK3B 3EYUH 3GB7B 3GS4A 2AABL 3L1GA 1N6QH 1A1NA 4OD2A 4YX2L 1K8IB 3CFCH 4NJAL 4NQTA 4WK2B 4LPYA 1OF2A 1XCQB 3E6HB 4PG2C 3S3BB 3D3VE 1TPXC 2Z93B 4L3CA 5J13C 3G6JE 4WEUD 3TJEL 2FQEA 3FQNB 2AQ3A 3OB0H 4D9LL 4JM2A 4FQLH 4P9HC 4HHAA 4JANA 1X5YA 5SWZB 3RVWD 3FQWB 1DL7L 1IT9H 1R19A 4N0CC 4ANUA 3QXTA 1M2OA 3PABB 2Y4SA 4FQIL 4JFDA 1LK3L 5T1LA 3TV3L 1A1OA 3IXTA 4NM4L 3C8KB 3C12A 2CHZA 4JPSA 3M17B 4JY4A 1QSED 1YEWA 1Y0LB 4YSAA 3T4AC 4OD2B 5E70A 1SPDA 2Y7MA 1F86A 1CR9L 2HCZX 3DHMA 1RUPL 4B0MM 4L3FA 7CGTA 4HFUL 2WZ5A 4JLRB 2X88A 4OM1H 1UB5A 3BZFA 3UJIL 2FT7A 4EJ1C 3VFSA 1H5BA 4Z78B 3BFWA 4PV8A 1KCLA 2Z91A 2VQ1B 1BPLB 4Z7WB 2VN5A 1NGZA 1WISA 3MOBH 4FQXB 2F18A 1TZGH 4F15B 4X5LA 5D7SL 2BP0A 3K7UA 2EKSA 3RGBA 4LCCA 2P5WD 3MBEB 5H2BA 5M7QA 5LBSH 1RHFA 2WBJD 2UWEF 1KIUB 4HA1A 4LAQH 2GYSA 3BZ4B 4AGMA 4D8PA 5GGQH 4FQ2L 4HLZG 4MZ3A 3ZN6A 5ESQA 1NGYB 4JRYA 6PAZA 2J43A 3QYCA 4R0LA 3V5KB 2IG2H 1KJ2L 1EZUA 5AOKA 3MRNA 4U4BA 4XMWA 3U82B 1U3JA 3QP3A 3L8QA 2VOTA 1INDL 4MA7L 3CBKB 5J1TC 3FT2A 4JZJB 5INDB 1CFQA 4AG4L 3NA9H 3EF4A 1ZLDA 1F6AA 2EH8L 5D72L 2P5ED 1YECL 5FW7A 5BMFL 1G7PB 3IJSB 5LJYH 3GINA 4BCZA 2YD5A 4HX1A 5C0AE 3MA9L 1PTZA 1UB6A 4RFEA 1G7MA 1SFHA 2JLLA 2WXLA 4M56A 4MQTB 4PH8A 5FB8B 1FF5A 4L4VB 4IYKA 4KTDL 1YEFH 1CFNA 3BQUD 3DMMC 2X42A 4YE0A 1NMCB 1CD9B 2ICWJ 5I71B 4QRPB 4B9JA 3KH4A 2EIEA 4HUUB 4P2OA 4XNUL 4N0FA 3REVB 2GIXA 3UC0L 3O9WB 4PJ8D 4BXSV 4CJ1A 3VI3A 3SE9H 1QHQA 2Y5TA 1K8DA 4WFED 4M4RB 4CGTA 4CVXB 4YXLL 5D2LA 3M6DA 5HY9B 2X05A 3BE1L 2VW7A 2XN9A 4I9XA 4CDGC 1TCRB 3EDEA 2OLDA 4Y4HC 4NWUH 1BFTA 4AYSA 2FLRT 3DTXA 3ARQA 2EVIA 5BQ7B 3AXIA 2JTYA 2WCGA 4JK0D 1A9BA 2PYFB 5L9DH 3K6FA 2AJSL 3V4UH 2BSDA 3DX0A 4H2CA 2BSRB 1YY9C 3W38A 2QQKH 2B3IA 5AOMA 2AMGA 4K55A 5JUEL 1F1AA 2CJUH 2V9RA 5LAPA 4JPVL 4QWWD 1YO4A 4IHOB 4WGKA 4GOSA 1JZ6A 2EXTA 5FECB 3FUKA 5I1EL 1BPVA 4BRJA 4UILL 1P69B 3S0PA 3U9UB 3B1UA 4XRCA 1YY9D 5IJKA 1VIWA 3DVIA 2W91A 4DEPC 3VD9A 1LP9E 2NY6C 4KJQD 3RDTD 1DDHA 3FU5A 3L1OL 4NAQA 4B9YA 4N2OA 4AX3A 4E2OA 3RPBA 2QKIC 4KAQH 1HHGB 1MCRA 5HHNA 3BZEA 4BFIB 2N3JA 2FUQA 1EERB 1OD9A 4D9QD 1DANT 3MLYL 3ULVH 1BOGA 1DQLL 5KS9F 2EDKA 1U6AL 5K9KB 1XFPA 3MV8B 1QW8A 1T04B 5KZCD 1SZNA 3L2MA 3DDGA 2XJLA 4XNXL 2VSCA 4Z7NB 1EFXA 4X5XB 2WXNA 4WNJA 3MXWH 3T9WA 2ED6A 4HIEA 5DLMH 3AQYA 2HFGH 5D96B 4I9WE 4LB8A 3S3PA 3TVMC 2L04A 1BYNA 4TQPA 1TCMA 2QKIA 4HUCA 4IKLA 1OAYL 2WZ6A 1KELL 4F5CA 4E9WA 3L9YA 1BXAA 1WS8A 5L7XL 5D7IB 4QY8A 3WKQA 5C09A 1TYJA 4ZX5A 2EVFA 1KDIA 5ERWA 5EZLA 1DQML 1SY6A 2DWDB 3TBSA 3PS6A 2X89A 3WXWH 1T04A 2JJTA 3QIWA 2VDRL 1AZVA 3NJKA 3GI8L 1JN6B 3QJFA 1QQDB 5DHDA 1M9SA 3LZFH 2BNRB 1AQHA 4D8OA 1JZEA 3MROB 3I84A 4AKPA 1NMBH 1VPOL 2NUTB 4I3GA 3FT3B 4ZODA 2WXOA 2DQ6A 5D1XD 2D4FA 4JQIH 3WFDL 3IFOA 3MRFA 4HT1H 5AOZA 1A65A 4ZXBD 3EUUA 5I1CL 2DWDA 2VW4A 1X5MA 3EO1B 4MCMA 4G1EA 1CLOH 3L5XH 4AGNA 4XPGL 4YX2H 2WLYA 3BLKA 2CLZA 3FQUA 4FFYL 4R7LA 4JG0L 2VKWA 1AGBB 1ZSHA 2YMXH 3OKNB 4ZUTB 3GHBH 3MUGB 5JW4R 1KBPA 1BLNA 2XN1A 1YN6A 2Y69B 1NBYB 1R3JB 5IM7B 1RZJC 3WNJA 2JCCE 3ARGC 3Q3GA 4QLWA 4GMSH 5D7JD 4E9QA 4EOWL 3FRUA 1G7QA 1E6OL 4WI4A 1FN4B 2ORBL 4PREA 1HKLH 1SHMA 3F6IA 5DWUH 1JGVL 1JD7A 4FQPA 4NQSB 4BSVA 5I17B 2TSBA 4F37F 1AD0B 2FK9A 3ILQC 4OB5H 3MRBB 3MRDB 2D0FA 3AWEA 4JGMA 2PWFA 1KJMA 4WU5B 5SWZA 5I16B 2QTVA 3MRHA 1O6SB 3PWJA 3AU1B 3GM8A 1GZQB 3ROOB 3UABA 4HIIB 1OQOA 3WTWA 3UO1L 2P4AB 5I1LB 1M4KA 1YEEH 2VB5A 2YQ2A 1KBVA 4Z7NE 1RI8A 1K4DB 5C92A 4C56E 4F2EA 2ZX8A 3IJ9A 4P99A 3T71A 4Z3HA 3BUDA 2VDKL 3DV6B 2FATL 2HVKA 4X6DB 3BJLA 1NLDH 4FNPA 4IDJL 4Z0BL 3REWA 5F6IB 4WJ5A 5I6XC 3QO0B 3L5JA 3L4UA 1UHVA 4GYBA 1XGYL 3BMVA 3IWUA 3P4MB 1DHKA 5DFAA 4GW1B 3SKUD 4A7QA 3CVIL 2WQAA 1GAFL 5GSVA 4EIUA 1WICA 3UPCA 4MJ2A 2G0KA 4EXPX 5I15H 2GUOB 3NTCH 4IBVA 5KS9B 4RNRA 3AUWB 1C5BH 2OYPA 4HUVB 4O9HH 1WF5A 4B9PA 4PJIB 3TO2A 3CBRA 1AYRA 1T03L 4UOZA 2XTJB 3FCGA 1G7HB 3BD4A 3H54A 1KGIA 4X8GA 3TH4T 3B9KC 4I2XA 4J28A 1MF2L 4LPWA 3LIZA 4ZOCA 1G5AA 2F8IA 4DN4H 3CHQA 1J87A 1RVFH 2PW2A 1IEBA 1BQLH 5E6IB 3R0NA 3FU9A 5I0VA 3ZHNA 4H8PA 4TKWA 3PGDA 3BH8A 3VFRB 3AGVA 4Y4KD 2EDHA 3QXVA 5D1XB 3V4VA 1E4XI 1OKEA 1WWCA 2NNAA 1VJSA 1KIPA 4L23A 5I0DA 1U8HA 2ZCLH 3LH2L 2DWTA 2VABA 3IGLA 4K2UL 1QG3A 3KDPB 3RVTC 1MNNA 3L9EA 1IBYA 4MD0A 1BMWA 1L6PA 1UXLA 2AK1H 1OQXA 4KKRA 4QKXB 1BAFH 3AXLA 5HGAA 3QUYD 2F74B 4H8WH 2JKXA 4M48L 2PP7A 2IV9A 4U1KB 3HFML 2EYRB 3KS0H 1M6UA 1WGVA 4N2EA 4U0QB 4ZFOA 2VE6B 3KBEA 2YEVB 1HIMH 2N0MA 4ZMOA 3FFOA 2NNAB 1LDPH 3CUPB 4PV1C 5F21B 5IBTL 5A2CA 3FT4A 5HHMD 4TVPD 2CD0A 5ALBL 3VGDA 1LVEA 2MQCA 1A5FH 4P23B 4PY8J 4NAJA 4RSYA 1JZFA 2ZKYA 4NPJA 4LEEA 1KPVA 1ZT1B 1FFOB 2NY3C 5DZ9A 2WUCL 2H6OA 3AMLA 1RUML 3M1BB 5FO9B 3TN0D 3TA4D 1QLEL 4KUZH 4E9VA 3FFDB 3JV5A 4LP4A 4FDWA 2DQFB 2NW3A 1JTTA 3BAEL 3DPDA 4GRWH 5B7MA 3OBAA 1W8NA 4RAHA 3WTVA 2WY3B 5ANHA 2JKIS 1PIFA 2JH2A 1A6PA 3TOPA 4A6YH 2JKWA 4MZRA 5KYNA 3HS0C 4KI5E 3L4WA 2B14A 1MCPL 5DO8A 3QCTL 7PCYA 1EHKB 5I1KL 1NCCL 3DIVA 2DM7A 4PB0H 4F7CA 3F04A 2R1WB 3EGXB 5HXMA 2FZ3A 5EOQH 3JUZA 4PV9B 5C9KA 1A7QH 2VR5A 4Q6KA 5DJZB 5DHEA 2OX5B 3KW7A 4X6DE 5D1QC 1I3GL 3ZPDA 1P4UA 1KV7A 2FH8A 2H26A 1T2QL 5E1GA 2DM4A 4LL1A 5C07E 1TMCB 4Q0XH 4C4KO 2ALWA 3G5YA 1HWGB 2WINB 2D73A 5CJXA 2O6CA 3QRLA 4WW2B 3QXAA 2XBZA 1JRHH 1FFPB 3QCVL 2D3NA 2WLMA 3CHSA 3J27A 3W9EB 3EOTL 1H0DA 4G8GD 4OGXH 4ODVL 3STZB 1U3YA 1WITA 4LPUA 2BVOB 1KCUL 2ZUXA 2D7TL 3EO0B 4X6FA 4OLVL 1KJ2A 3QIBB 1YVLA 3WJJA 3FFCD 4N2HA 1FCCA 4YHMH 35C8H 2B0SL 1CD8A 4YHZL 3IJEB 5F3HA 5DJDB 3UZEA 4F2MB 1OSZA 3PU7A 1MN4A 3IMSA 1CQKA 3UCQA 2WZAA 5BZXA 3FTUA 1FBIL 5DEFB 4UDTA 1VPOH 3GC3A 2AJUL 2JB6B 4OM1L 5BW7C 1W15A 4G43B 1Q38A 4LCIL 4F7EB 1AZRA 3MHZA 1YEFL 4IJTA 5TF1H 3CH1B 1KYOJ 4QHLB 5LAXB 2CA4A 1Y6MR 3F7YA 4Z7UE 5KG9A 2KDGA 2I07B 3D05A 3AJ7A 4UANA 3KLDA 2R0WH 4AV4A 2FWOA 5K9JH 3QO0A 1SXCA 3K2KA 3KPNB 2Y0SA 2ZG2A 5F7MC 5HI4C 4XMKL 2XWBA 3NESA 1LO0H 3H53A 3TBVA 1UADC 2PCYA 3SBPA 3E0GA 1DJXA 4Y2DC 1R75A 4Z0XA 1KGYE 5EHFA 2OW6A 4LRIC 3RUGB 5C2UB 3LY6A 1DUYA 3IDJB 1N68A 5J06A 1AKJB 5D71L 2VISA 1W2KT 2E0PA 3PXHA 4H0LC 3CHOA 4OZGA 4G2AA 4H26B 3MRLB 4JFOA 5FUCE 5FA3B 4JO1L 5FYLL 3AC0A 2C8NA 3WD5L 3TF7C 3VI4B 1OF0A 4N25A 3GDCA 4A7VA 2VERN 3OG4B 2GAZA 5DLLA 1SN5A 4XP5L 3ATDA 2DLFL 1YMHB 1NAMB 2H0PA 3U9PH 1MWOA 4GEJA 1U8KB 3U48A 5CJ5A 3C2AL 3JYBA 2LTQC 2XRAH 2HRHA 1IGFL 1BZ9B 4N0UA 2F54E 4FD0A 2OR8A 4EDWH 4FI8A 2CHDA 1L0QA 2BHYA 1T2JA 1HL4A 1AMYA 3QEGL 2AFNA 3GSXB 4HXBH 4UWQB 4BA0A 1ZT4A 1OCZB 1SJHA 5IQNA 1SJEB 1UQSB 5FCSH 2NR6C 3MJ6A 3FO1A 3VYOA 1ZA3B 2YKLL 4ZYKB 4U3HA 5FIEA 2DY2A 1LHZA 3V5DA 4RAVA 4OM0L 1PKQE 2E74C 4YK4B 5D7KD 3GZKA 4RQQB 5FOBB 2KYIA 1KT2A 3ARFA 3T0AA 2J8HA 2ZAGA 1Z3GH 3LHPH 2G60H 1QSZA 2VSKB 4M8UA 4AH2B 5HYIA 4BFGA 5DD1H 1L9SA 3C09B 4TOYL 4N3TA 4PY8I 4AL8C 3ATFA 4XPHH 3FULA 5E1HB 3CXHK 1NCOA 2EE0A 1I7RB 4AVJA 2OTUA 1YUHB 3LNGA 3LN5B 4R2GB 3MLWH 4KRPB 4TV3A 2P8LA 3SBQA 4U6HA 1DZBA 3L3JA 4PVBA 1MCCA 2AI0H 3ZGIA 3QEUA 4V1DB 3ARFD 4JRXB 4ONFH 3ASWA 2JIXA 4MBRA 3NCBB 1QX1A 2VUYA 2EILB 3HN5A 5GGTH 2KHAA 3OAYH 4Z23A 5IHZB 1RUAH 3I74A 1KJ2H 3ABZA 5EC1B 1DLHB 2BCMA 1PPIA 1ZHBB 2AK4A 3LDBC 3MR9A 3Q2NA 5KSBA 4KJYB 4DKTA 3POCA 2F5BL 4NT6A 2CXGA 4ODHH 4ZI8A 5E6SB 3BCFA 3KW8A 3TL5A 3IMBA 4RFOL 5LDUA 3TIDB 4OUOA 2DMBA 4Q9QH 5GJTH 3D39A 4WEBH 2RD0A 3HJEA 3PAVA 3WG7B 5IFAL 4DP5X 4Y5VC 1CCZA 4HWZB 4V1DE 4LDCA 1USZA 2ICES 4XHJD 4CUCA 3ULVL 3SYQA 3ZT7A 3SCMB 1QI4A 4IK6A 1NIDA 5AAWC 5SWZE 4CVXA 5IREA 2G30A 1I85A 4MD4A 3TASA 5C6TL 4W9LC 2Z3FA 1LDPL 2R1XB 5IBTH 2BNUA 3D52A 3EYVB 3RVXD 4LEOA 2UY6B 4ES9A 2ZXDA 1FIEA 3TFKC 4PU2A 2UYLA 3B2MA 4YPGB 2G5RA 4JMXA 5GGRY 2KZBA 3ZBMA 4QCIB 4BE5A 1FPTH 3QAQA 3WN5C 5K9QG 3NFPA 4P9MH 2X2IA 5T5FA 3DX6A 1MG2C 3FN9A 3IF1B 3VFTB 3VW3H 4KUZL 4HZLB 1T3FB 3KGSA 4PLJC 3W2DH 3MA7A 2V37A 2OKMA 2WBJA 1I8UA 4LKXB 1DJSA 3WTXA 2HWZL 1ZE3H 3LRMA 5D2LF 4K4KA 5DR5H 2XWZA 3HBPA 5KJRL 5KSAD 3VXMA 4U3CA 2XU9A 2H45A 3DWTA 5CD5D 2YKKA 2K0RA 3HUJB 4HWNA 1FNFA 5DZLA 4ANWA 1ET8A 4Y1SA 5D1ZC 3FHEA 4K3HA 5EU5A 5SWSD 1YEKH 2HRGA 2V2TB 1GGIL 2IANE 4OT1L 3LN9A 4O58H 4AIZB 5KANG 3D18A 1JFQL 4G42A 4HK0A 1OV8A 1BP3B 4QLRA 1X6NA 4NUGL 2CQVA 3CN2A 5HGHA 5BQDA 5J7CC 3NEXA 4XC3H 3H3PH 3PJSA 4WKZB 1DJYA 2N0KA 2GJPA 1BMZA 1GZPA 4FX5A 3E8VA 4UAHA 5ISZE 1UT9A 4B41A 4N6RB 5C0EA 1EQWA 2R2HA 2JKSA 3E2HC 4GIOA 1JK9A 4TS6A 2XQYA 3NBNA 3LSOA 4WDIB 1SM3L 1YC8A 3MUJA 3L1FA 1XQ4A 1TMQA 4MDIA 4HIHB 3VQLA 2DBLL 4HK0B 4K3EL 3L6FA 1QW9A 3BUIA 2ZKWA 2OL3B 2DWXA 3U6RB 3GXDA 3ARXA 5AVQB 2X3CA 2ZP9A 1IFHL 3FQTB 1QR1B 2BH0A 2XC8A 3GI9L 3VWKD 25C8L 3IDUA 1FV1B 1MXGA 1QBAA 1GYCA 3IWVA 1J1XL 4ODTH 1YPZF 4UT7L 4Y7MA 4AVHA 5IW1A 1WCBA 2E4FA 4R8WL 4J4PC 3DV6A 2ZSVB 3AVEA 1FNGB 2D2OA 4ZUWB 1GIGH 4HS3A 1T03H 1XIWC 2VXQH 5GGQL 1G4RA 5KYUA 3SDXA 3WKYA 2BOCB 1UD2A 3Q1EA 4RQQA 3MLTB 5TDPA 1DUZA 2NTFB 2FJGB 5D9SB 5IFJB 2C3XA 3SGJA 4LSRL 1Z5YD 3M86A 4BFFA 5KW9L 3VWKA 5C2BH 3S8WA 1ZK9A 1EEYB 3JVGC 2J1WA 1LP9A 3GGWB 4OCSL 1S7VA 3QH3B 1UH2A 2R39A 1H5BB 3P4NA 3LKNB 1M05A 5BV7B 1N0XL 5HYQA 2BP5M 5M94B 3V6OA 3QVAA 3GD1C 5E0FA 3NIDB 3DROA 5F0PB 5CIPA 5JQIB 5AKVA 3X3GH 2Z31B 5ECGA 5HPMA 3L9RB 1NL0H 4Z7WA 4OCNC 1A4JA 3GSUA 2WXFA 5T3ZH 1XTLA 3O3EB 3DOSA 4TVPL 5F1SA 1KLFB 5I15L 4AYFA 3QWNA 1YQVL 5IOPA 3CZGA 2DQDL 2KKQA 4N22A 3ZDXF 2R0KL 1PS3A 3AT0A 3O2WL 5EBLA 1A6ZB 3TV3H 4L8DB 3QCUH 2NY6B 2Q7YA 3UJJH 2WQXA 3FB6A 1Q72L 2MNUA 3DETD 3DVNA 3RTLA 1CDIA 1AS6A 2CIIB 2ZNXA 2VUOA 2VNCA 2MH4A 3GHBL 4Z3GA 4PY7B 1KIQB 2EH7L 3AQDA 3MRLA 2XQBH 2VABB 1KCKA 3QZMA 3X3FH 3RLSA 3AZUA 1ET7A 3ULUC 1SLXA 3JTSA 1UD3A 3VD1A 4YHYB 2DQEH 4OH2A 2DWSA 3MCKB 1MLBB 3V2AR 3FUEA 3MVSA 4NO3A 4MMYA 5EF2A 1UYWH 4GXVL 3CSTA 2CO7B 2YA0A 3OVUB 4JCLA 5AW9B 2FYYA 3CXDH 1BAFL 3EBGA 4PRNA 5CJXC 5F72S 1HSAB 5D1XE 3HI5H 4DPAX 2CIKB 5C9JB 4HMDA 4M3KB 5FO7A 4ICXA 3LS5H 5BXFB 1CN4A 5TGBB 4BFBD 4WCYL 1QWUA 5KS9A 3SN6N 3K6DA 1E28A 5ABDE 5G5DB 4M9PA 4U6YA 3IAQA 2OMVA 4Z7UF 3OHXB 4FFWC 5ICZA 4LQFH 2VDLH 4CSTA 1V7ML 5F7UA 1VFMA 2LU7A 5D7JC 3N1PC 1WBYB 4NS0A 4MLIA 2BSED 4IRJB 3LEVH 2D7OA 4L5FL 4XP4L 1E43A 3MRJA 3O2DH 3BAEH 2VSMB 3MZTA 5FGCB 5F9WB 1DQLH 1D6EB 2AJ3B 4HDIB 4HIXL 5J6SA 2DS4A 4IHBA 5FUCC 1VGEH 2CWRA 2F74A 2OCCB 2YWZA 3OXRB 2AXFB 3PYCA 2M83A 3UAFA 5I18L 4OW6A 3TVMD 2B0SH 4F8QA 1RZFH 3MFGB 3BH9B 2NY2D 5BV7H 2V6HA 1BWWA 2APFA 3QUKB 3W9EA 3MRRB 1DQQB 4MZ2A 1Q9WB 3MRJB 2ESVB 2PXYB 3E6FB 4IRJA 1MCOL 2WINA 2WMPB 1HHHB 3W37A 2D9QB 4X80L 2R2HB 1PQZA 3K4AA 3JSSA 4D9RE 4PM1A 5I0ZA 4Q0XL 4ZW6A 3S4SA 1IQWL 4MXQC 1WFIA 3BN3B 1I8LC 4UT7H 4XBEH 3VAEA 4BSJA 2M26A 3F7QA 1LE5B 3KWWA 1NWPA 1T1YA 3MXVH 2SEBA 1NJ9B 4C56A 2YGVA 3NIFE 3ZYJA 3WFBH 4NZJA 5JW5A 2AXWA 1U41A 4IRSB 5F9OL 2WOYA 3W2DL 2WK2A 4FYTA 2GUOA 2AK1L 5D1QA 4QHKI 4C83A 1OB0A 2F53B 4FNLL 1RZKH 2WYHA 2MEJB 4FFZA 4MAYD 1HYRC 1SGKA 3ZSTA 4TSAL 3RWDA 4F7EA 1EJ8A 1QACA 2GC4C 3LRKA 4G9FB 4UBDD 4PJIA 3RWEA 3TO2B 2FQGA 1JNJA 5EOQL 4DFHA 2MIZA 2MCG1 4QT5B 2CGZA 1UA6L 4KK5D 1XAKA 2EICA 4Q74A 4XMLL 3US9A 1H6UA 2HFEB 1ZV5A 4MYWB 3BSHA 4C56B 5DJYA 2ZUYA 1G9NH 2PW1B 3O11B 4LVEA 4UT6L 3G08B 1GJWA 3HIZA 4XNDA 2I25N 4GW5A 3QG7H 4LKXA 3FO9B 1MFAH 4BQ9A 5I1AB 4NUGH 1DANU 4GAAA 2JCCA 3AXLB 1MHPL 4KAQL 1BM3H 3HG4A 3SB3A 3JT0A 2R69L 3EH4B 1HYSC 5ANMA 4OGYL 4WTXA 4CN6A 1AQKL 2OX5A 1QKZH 4BKTC 2N7BA 5CJQL 3JZ7A 5I8CA 4PD4J 4RESB 4GSDH 4N8VB 3RUGA 4H88L 3TEXA 1YPZE 2Q5BA 4LGRB 4EKJA 2X3AA 1LXMA 4JFQA 2DIAA 2NXZD 2JB5L 2VSDA 3HZMB 2ADJB 4ZAKC 1MG3C 5I6LA 4OGZA 2YSTA 3J8F7 4ESKA 3PIQA 1KLFA 1PZUB 4LVHC 1HAUA 2CCLA 4U1HB 5JPMC 4D7BA 5MHSE 2CKBL 4APXA 4G1MB 3SGDH 2DLHA 3WTYA 1TJIH 5BZZA 3EXJA 5T1DH 3FB8B 2AANA 1MHHB 3Q48A 4XVUD 3RNQB 4F80A 1AGBA 5AZEL 1E42A 1JWSA 1NCBH 3LKRB 4P4KC 3SCMC 2BPBA 2Y6SD 1CICA 4A7UA 4FTVA 3HMXA 1VA9A 2CM6A 3VU1A 3QPQC 3U1SH 3BVTA 3V0HA 4AEHH 3N44F 2X4NB 3EOTH 1B0RB 4JDEA 4X8JA 1NCWH 5CBAB 2GBAA 5HI3D 2VXQL 4EXKA 5CF3A 3VI4E 3IBEA 2N4IA 2QFPA 1AR1D 4BQBA 1OK8A 1RUAL 3OJ2C 4ZFZA 2IDSA 4AE1A 1RZJH 1T66C 4MJ5A 1XF4A 1OPGL 3SDXB 3BEVB 1EAJA 1J9QA 3FU7B 4MA1B 2R7EB 2R0LL 2XA8L 3VXRD 1IEHA 2RCSH 2ZPKL 5DK0B 3MRQA 1IBFA 1BREA 1SN2A 1EMTH 4G8GE 4QXUH 2WO4A 3ETBF 4L5FH 2V0AA 2BRRH 3I85A 1L6XA 1USQA 3U9WA 4JCMA 2NQDA 2NW2B 3TCXA 1XH1A 3OB8A 4PS7A 1OLZA 3OQ3B 1MCSA 2EQDA 3ZQXA 4GP8B 3GXMA 5EUOA 2XKNA 2ZX9A 3SGKA 4WO0A 4HV8B 1XGRB 4HGMA 3NP4A 3Q6FB 3DV4B 1JE6A 4I0PA 5DS8A 3P54A 3QEGH 2FR4B 4U1SB 4N2LA 3GO1H 1FNEB 4N1EA 5CWSB 5EN2A 1I7TB 4OF5A 4K7FA 2KERA 4Y1AE 1NCAH 5GS1A 3S2AA 3H6AA 1NBVL 1PL3A 2R56L 5JYMA 3S3CB 1F02I 3BIKA 5GSRA 4KTGA 3X1EA 5HPMB 4RMBA 3W39B 1MCJA 3HKZA 4P2CG 1NEUA 1JL8A 3L13A 3BUQA 2ADIB 4Q8BA 1W0VB 3D8MA 2XG5A 4FLQA 1OIOA 4OB5L 1TTRA 1NSNL 2OJZL 5GIRB 3B37A 4RNRB 1TVHA 4XNYL 5EN2B 2BNQE 3APDA 2YQ3A 3HE6D 2YZ1A 1GS8A 1LO2H 4YR6A 5J13B 3QUML 5KTEL 5EORL 2K70A 1NKRA 4S2SA 4G7QB 3C08L 4NQDB 4TSAH 4DOHB 4B95C 1MWAB 4UZUA 3OJDB 1URLA 5BS0A 5AYTA 3OTTA 5KANI 1CZ8H 4A7GF 3QPKA 2WBJB 3MV7A 4KITB 1S9WB 4QD2E 4NNPH 4GBXD 4QRBA 1VZHA 4JPWH 4MCYA 1Y18A 4BCYA 5EBWA 1MDAA 2BP8B 1MY5A 3RAJL 3GSWA 4WNQA 2FEJA 2VIRB 3H9HB 3Q01A 4N87A 1MAMH 2BY0A 5GGUB 4A68A 5EPMA 3UTOA 4XHJC 1TYEB 3HMWL 4FQQB 1E9QB 5AVWB 1YAIA 4L3AA 5CP7B 5TQ2L 2VRKA 2WN3A 3EYSL 3CD4A 4GUCA 5F0MB 2Q3ZA 3MRMA 4QIRA 2RFXB 5D7HA 1T1ZB 2PYEB 1KFAH 1IIIA 4AJWA 4WIQA 1QEXA 2W60B 4BFNA 4K8RD 1JGEB 5CO1A 3PHQB 2HRLA 1PG7X 1BZ7A 1JHKH 2FECL 3SDDD 3MRIA 5ADPL 2LQRA 1KGJA 2ADFL 4ZQTA 2ZQKA 4KO9A 2YAPA 3Q43A 3R4RA 2O26U 1C16A 5A3ID 3C60A 4S1QH 2JJTC 2W1NA 4FL4C 2X6UA 5F1IA 4OTXL 2NNRA 1VADB 3BVWA 4NPYB 5E99L 3RIFK 5I75B 2L7QA 2OSLA 3ZTJG 4AM0A 1KPRA 5KBMA 1RIHH 2VXVL 2Q8AH 3SDDC 3EH3B 2CNZA 1PFOA 1D7FA 1YEDB 1S7RA 3KPMA 3C87A 5JORA 3IMTA 4YHML 2V7HB 3FO0L 2HRPH 5E4EB 3DO4A 3VRJB 2WLIB 1KN4H 2EYSA 2J56A 2ZSVA 3QUZA 5EA0H 2FJUB 4YSPA 3VUAA 4YVUA 4G7RB 2YPLE 2YAQA 2NY4D 4RZKA 4PJBB 4K3EH 2WKGA 5L88L 1FBIH 3F3HA 3MREA 1I1YB 1FV1A 1MFCH 2NX5D 5FUZH 3IFLH 4PPTA 2AVFA 5E1IA 4TXVB 3DMMA 4HLJA 1NFKA 1OCWL 4MQ7B 3DUSB 5EEWA 1VACB 2FL5B 2WKLA 1VFAA 2BIHA 3EW3B 2W0LA 3LNEA 1DEEA 2V7HA 2ATKB 3H3PL 5E6ID 4Q2ZA 3LEYL 3HVDA 3A6BH 1KENL 3NSJA 5JORB 1UXWA 4ZW8A 1MW0A 3ZW3A 3RX5A 3KH3A 1F2XK 2CHNA 3MRNB 3QCUL 4WV1C 2ZOKA 4X4XB 1CXIA 4PLOB 5EZOH 4A67A 1CMOA 2CLVA 5GRJH 4DO6A 1NFDE 1TKWB 2HFTA 3TYFB 1S8DA 3LKOB 4P06A 3T8XA 2QL1A 1OPOA 4U1IA 5EUKA 2ZUUA 3D3VA 4XMPL 5CN1A 4S0SD 4FHKA 4BWTA 4IRJC 1TETH 4D0CB 1AZZC 4AC4A 3B2VL 1WJ3A 3RGVD 3PAUA 3CG8A 3APNA 3MV11 4N2DA 3DARA 3ZTNL 1YYMH 3LPFA 1UWYA 2AJXL 3WY4A 5C0DB 3LRHA 5C0BA 3RWFA 1MCFA 3G6DH 3VXRE 1FVEB 1Z5HA 4NQCD 4OV5A 3NFNA 5HHXH 2FGWH 3GLAA 3LPOA 1I1AD 1FNEA 4RZCB 5CWSA 4YDIL 5A2BA 3HLAB 3HOGA 4N0FB 1IGMH 3WHE1 1TJIL 4JFFD 3D85D 1BIIB 1RJLB 4QRPD 4LXFA 3RU8L 2A9ML 1A47A 1WFNA 5EBMB 2X6BA 4XMTA 4GQQA 3QDJB 3KPQB 2E7DA 2PW2B 1X5GA 2J1YA 2F19H 1FGVL 2AJYL 2HZHA 3JWNH 4UT9A 1V5JA 2I24N 4BHUA 1N5YH 4G8IA 3ZKND 2I32A 4NKIL 1UG9A 3FCBA 1TNNA 3TT3H 1TQUA 3SKNB 1PAMA 1MH5B 2R29A 3EZJB 4A55A 4K9EL 3BZ4A 3V4LA 4M9OA 3RVUD 2P5WB 3TJHC 5CNHA 1N8ZB 3HZYA 1MWAA 5HVHC 1CICC 2RAMA 4NWTL 2Y7OA 1AD9B 3L5HA 2OMVB 2A6JB 4N8PA 1U8QA 1YECH 5SWSE 2G75A 2MOGA 4O2EB 1ETZB 1ZTXE 4RMRA 1OAUL 4M6NL 2YBRA 4LVOC 1DVXA 3C6LA 3ROLA 2IQ9H 2WNXA 4I4WA 3RL1B 1JPFB 3N9GH 2EO9A 3QUMA 5FO8A 4LOEA 3OX8B 2A4CA 1BZ9A 1UXMA 2WHVA 4NO2B 4R0LC 1ADQA 3BAXA 3B9KA 2VJ8A 1HXMA 3GSNL 4FAAB 4PJBF 4R84A 4QNPE 2I9LA 3J7HA 5ITFA 5F0JB 4CKVX 4EUPA 1RUKH 3MNWB 5EIQA 9PCYA 5I8OL 3GJFB 1GC1C 4WI7A 1EO5A 5BPPA 1KY6A 1JV2B 3FFCA 5LVEA 2WN2A 2D0GA 3GMQB 4S1QL 1X9UA 1IBHA 5EOCJ 4CVZB 4MKMA 3IXAA 1ZGLB 3GBNH 4UTAH 3UFIA 3ARTA 2BFVH 4P5MB 1MFNA 3E8UH 3MRRA 1ZVNA 4KXBA 2E56A 4I8DA 2WKOA 4J3OF 5FCUL 4QUOA 1M7IB 1TTAA 3WE6B 2YN5A 1XDTT 4ALAL 2AEQL 2DI8A 3O2DL 2ZD0A 4ZUVB 1T5KA 4L8DA 4XVSL 5C70A 5D7IE 3F8UB 1AIZA 4OBSA 1QBMH 1TNMA 3EHBC 3FB5B 3V79C 1AHMA 2OFQA 2OZNA 2PP9A 1FHGA 3EIFA 3LXUX 5JYLA 2FRGP 3FCSB 1RIUH 1FG9C 2ZJSL 5CHNB 3LXCA 1JWUA 4O02B 5IMMB 3F6LA 4XTRD 3VU2A 1KIUA 5I82A 2OTWB 5EH1A 3SDYH 4HWEH 1I8AA 5JDSB 1MFCL 4MQSB 3KHQA 3DDFA 3S3JA 3AG4B 3ZDXB 1NC2B 4UCFA 3VW3L 3U30B 3II2A 4S2SB 1MCLA 5J6HA 4I3RH 5F7WC 5L2JB 2CDEA 3TBWA 4M6OL 4HPYL 4OCXH 2ESVE 3RKDC 4IRSA 4A63A 2AQ1A 3FPXA 4KJPD 4KVNH 3VNYA 1EAOA 2VXUH 1EGJA 3RBSA 4XX5A 3RWEB 3KLHC 4U6YB 1SEQH 4EVNB 4CJ0A 1KPVB 2L7UA 2EDYA 4J1UB 2FJFB 4YSUA 4LVNC 3MCG1 2MPAH 1G7IA 1F4XL 3AAZA 1W9XA 2ZICA 4QOKA 4B6ZA 4H5SA 1HTYA 5IR1A 3DETC 2ENPA 1OT1A 4D0BB 3RDTB 1R3HB 1DQQA 2JJUA 4APQC 2APXA 5CJOH 4HUUA 4P2OB 1KYFA 2Z65C 4XAKE 2DQHL 2IDQA 1TZIB 2ORBH 2OMWB 2V9UA 5AW7B 2DAVA 3UTSA 4AYEC 3FOLA 4PWKA 4CN1A 3L4ZA 1ZGLM 1GZHA 2JCCB 3WL9B 3PPSA 2GFBB 1ZJBA 4FLRA 5C0FA 3O3AB 3T0ED 5LNDA 1XWVA 4XCYB 3OZ9H 3VSVA 4DK3A 2BOBA 2OYLA 4D0BA 3JWDH 3IPFA 3V4VB 4LCVA 4NNYA 3SDCD 1RXLA 4ABWA 2H6PB 3B4NA 3QEQE 1ZE3C 4K7PY 3BRDA 3NG5A 1B0GB 5G4NA 4KRPC 3P0VL 5EZJA 1D9KA 1TTFA 5A7BA 4WWKD 1M1XB 4MJIE 1T21A 4Z95L 3CSGA 3QULB 4LLYA 1GS6X 3BGFC 3LX9A 4Y9GA 1F2QA 2GCYB 2E7LA 1ZLWK 1NLDL 1J5DA 1EMTL 5HGHB 1PAZA 1JUFB 1LE9A 3ZTCC 4HC1H 5CBAA 2WWKO 4MFHA 4HBCL 5KJ7E 4NP9A 5IQ9A 3MBED 2EDLA 4G7YH 4AI7A 1A9EB 4H1LB 3WFDH 2CMRL 2X70B 3UACA 1RPUA 1MFBL 4G8IB 1FFOA 4AW4A 5IMLB 3C6SB 1PLBA 3PQYA 3AACA 4AQZA 2OZ4H 1UCBL 1IGJA 4PRIE 4NM8L 4YFLI 3TZVD 1EJOL 2DQFA 1IV8A 1U2CA 4FFZL 4PWHA 4B9GA 3BDYH 3SE8L 5CCKL 2VMFA 4UINL 4YBQD 1N0LA 3O3UN 2AV1A 3VFWA 3MRPA 1GOGA 4J6RH 2A73B 2NRDA 1NBVH 4WW1B 4X6BA 3UAJC 2HTLD 3ECBA 3STBA 3BIBX 2IBGA 4MD5A 4AYGA 1GCFA 4P5KA 2KI6A 3KG5A 4PRAA 3QRGH 1IARB 4PJIE 3OKEB 4KHTH 1JGLL 3BHBA 1NGQL 4LBAA 5FFOA 2BX5A 1W91A 5EZIH 5FWQA 1T0OA 2B1OA 2CCWA 3ZYOA 4UTAL 4M6AA 1SYSA 4UQ2B 4P3DA 3COOA 4MNGA 5L8KB 5J8OA 3PL6A 2H7WA 2O93L 1T6VN 2DYPB 3RKPA 3GHEL 12E8L 1QVOA 1UM5H 4BM7A 4M5TA 4CBZA 3UAJA 4UIMB 4MD5B 1TTCA 2UX7A 4G7VH 5DJ0A 3ESMA 2J4WL 1NGPL 4PJ5D 3JV6A 4WW1A 1MFAL 4X6BB 5LDSA 3OKDA 1FL3A 1J8RA 4DGVL 2OP4H 3QRBA 4I87A 4BD4A 4EDXA 2W95A 1DFBH 4YMPA 2GHZA 4BGLA 4QYAA 3PFQA 3ZKXC 2WVTA 3RVUC 3GGWA 4GG6B 4Y4KB 1OPGH 1CYGA 1UEYA 1X5XA 3HMWH 2WUCH 5AW3B 3AT9A 3SDDB 3VA2C 4E42A 4BE6A 3EG9A 2YGQA 5EEXA 2ICCA 2J7LA 5CD3A 5AW5B 5J11C 5F7FA 4OZIA 1I7UB 4Q7DA 1XCXA 1CLCA 3BSZH 1C7SA 3NQKA 4XPBH 1UKTA 3PGFL 1E9PA 5C0CE 5EF3A 3SKNA 2R4RH 1HU8A 2ATPA 2Y2WA 1VSCA 2E8YA 4OZIF 4PJFA 4XBPB 4JFHD 2NSQA 3GIVA 3QG6A 1JNHB 3P4MA 3K1DA 4PJDB 4JY6B 4DGWC 3K8KA 3QUMH 4JFWA 3UC0H 1TQSA 2H32A 3KPPA 1EEUA 4N26A 2BP8A 3BRFA 2Y2YA 1A7QL 3VWJA 1KELH 3GJFH 2PR4L 1SJVA 5TFSL 4K23L 2YEQA 2EE2A 2SODB 2VRQA 1Q1JH 3SKOB 5DUPL 4ADIA 2DTMH 1G1CA 3KPSD 3THML 2ZWKA 3S37X 2OMTB 4P2RB 3GWJA 1WO2A 1AGFA 3MNWA 4LFHG 4HIXH 2X9XA 1Q0YL 3IKCA 2Q9OA 5B8CC 5ESAA 5I18H 1AI1H 2Y07L 2O5XL 2X1WL 4P46B 2DYPD 4U4IA 4P4RB 3WY2A 4JKPH 5LXGL 3O41A 4MRCA 3T0EB 4CNIA 1OWRM 1J18A 2CK0H 3MJ7B 4NN7C 1OM9A 4KFZC 1IBZA 3BIKB 3GEFA 3I50L 4GO9A 1RMFH 1JYVA 4O02H 1BFOA 4NQUA 4OZFA 4MB4A 5D1ZI 4QO1B 3UXFA 1QTSA 2EO1A 5BCAA 4DP9X 2ZWYA 3GLEA 1NCHA 3C5JB 1QPKA 5I6OA 2OSXA 5HGBA 2VO5A 4AENB 5A16B 3L3GA 1NCIA 3LCYA 1JPTL 3BUPA 4GMTH 1YSOA 1J7VR 2B2XL 2OTWA 3WS3A 3AABA 1QBBA 3QDJD 2LLNA 5BS0B 1EVTC 1OE3A 4LSUH 2K8MA 1YNLH 1UCBH 2UVEA 1J8SA 2YK1L 4KGJA 4MYPA 2FL5A 4QRUB 3FT9A 4XMPH 1Y18B 3QWOB 2P42B 3MLVL 4L4TA 3LZPA 4WUUB 4LVNB 1X5IA 2N1KA 3A67H 1R4XA 1G87A 1I1YA 1VFUA 2XG4A 1GXEA 2A1WL 1KB5H 2JQMA 3WO4B 4GG6E 4KI5D 1TZ8A 4IBZA 4WGWB 3FSAA 5HGBB 2A83B 1PNCA 5DUBB 4A6YB 2YMTA 3DBXB 4JDVA 4POUB 5I73C 1ZA6A 1AO7D 4OJDH 2QVKA 3BUYB 3CC5B 4FTDA 5E6YA 3SOBH 3SDXE 1WZAA 4JN1H 4KZEH 2AGJL 3L08A 2VW6A 5EU3B 5EUOE 5L4MA 3ILQD 4FRWA 4XP4H 3Q9QA 4YAQB 3MV9B 4OUUA 4PJBE 1D5XB 1KTLB 1Q9OB 1T4KB 5CGTA 4N2AA 5ERWB 1KENH 5EZLB 4XPGH 2F9BT 2NY4C 3T1FA 1U2HA 4MJ4A 5C09B 5CJQH 1LK3H 4ODXB 5C07B 3C60D 4OY9A 1IGCH 4N90D 4OFDA 1KFAL 5ICYB 2YN3A 1BQHB 1H0DB 5ABAA 1QTPA 1ZA6B 2BNQD 5DRNA 3BISA 3JTTB 5HDBF 3H2WA 1A7RL 4F7TB 3TYGH 3MLUL 3ZU8A 2CBPA 2D31A 4PR5A 3WIHA 3BPLB 3STLB 3VI4A 5J1AB 4ILDA 5T1LB 2HX8A 2AJVL 2UUDH 5E8NA 3DOIA 3HTLX 2AMUA 5AEAA 3ZTNH 2JI3A 3ML9A 5J1SC 1JGVH 1KTRL 3G5ZB 5FK9B 1IQWH 4XBEL 4J5VA 3IFNL 4H1LH 4O2FA 1I3UA 3A4AA 4I1NB 2QSVA 4TUJA 3BPCA 4KUCF 4HX1B 1FVDB 4PJ9B 4ACPA 4MJIA 3H4HA 5LBSL 1FWXA 1LEGA 2VXVH 3QQ3B 3WO3B 5FYJE 1G84A 1SDDB 3RWCB 3K1KC 3P9LB 2IAMB 3Q7JA 4XT1C 2Z8VC 2OA9A 5J6GA 5AOLA 4Q9CA 4PMEA 1ERNA 4GUPB 1HXYB 4GIPD 2VN6A 3HRZC 5LGYA 4HJGB 1INQB 2X7LB 4Y5VB 5IB1A 3RDJA 3QFDB 1E4JA 2ITFA 3NIGF 1FO0H 2CM5A 3BAJA 4G9DB 1DP0A 2D3JA 3MODH 2WQ8A 4Y7OC 2NLJB 3QAZB 2JTDA 2X70A 1I4FA 5E56A 5C8JA 3O6MH 1UZ8B 1NGZB 5ANME 5BOPA 2H9GA 3KYMA 1PLAA 4ENZA 3WTTA 5BS0E 4PRBA 5IB4B 2ZP0T 2P5EE 4FQLL 3EYQC 1JYXA 4XCNA 1NA8A 4QYOA 5FDYA 4JGNA 3OAUL 4HQQL 1MJ7L 4JFOB 2VL4A 4DGIL 3P77A 3BEWA 4OQTH 3U25A 1CGWA 1NICA 2DLFH 2B8OT 5AVYB 5C07D 3AREC 1IX2A 3QFJD 3KYKL 1HC1A 1ZLVK 3VWKC 3ZE1B 4AITA 5DUMH 1HHIB 3CCHA 4YDJB 2JSFA 4NC2B 1RULL 5JHLH 3RGVB 3ASNB 1SYSB 3Q0HA 5GGRA 1J5OL 1UOVA 3FONB 4J3VA 1LQBC 2X2UA 3MCLL 1B3JA 5D4JA 3L4CA 4AH2A 3UG4A 2O5YH 3WUWB 3O4LE 4Y16D 1FZJB 4TUUA 1R46A 5B1JC 2BY1A 2OTUB 1S9VA 4LSUL 4J3TA 2HWZH 4L8CA 3UX9B 3TO4C 3V5HB 2OV0A 4PGEA 1J8HB 3KAAA 4B3EA 1C1EH 1CXEA 3PQYD 4POYA