5LLIC

Pvhl:elob:eloc in complex with vh298
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
141
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Potent and selective chemical probe of hypoxic signalling downstream of HIF-alpha hydroxylation via VHL inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 31
structure length 141
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2016-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 5lliC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 5lliC01
1VCBC 4W9DC 4AWJC 4B9KC 3ZTCC 4B95C 4W9KC 4W9IC 4WQOA 4W9JC 4W9HC 1LM8V 4W9CC 4AJYV 3ZRCC 1LQBC 3ZRFC 4BKSC 3ZUNC 4W9GC 3ZTDC 4BKTC 4W9EC 4W9LC 4W9FC 5LLIC
chains in the Genus database with same CATH superfamily
4WHTA 4ZOBA 5F88B 5T1KA 1FNSH 5IY5B 4UCFA 3ILEA 3DVNA 5C6TL 2PABA 2NX5E 4KK6D 4DK6A 2XJKA 4EIBA 3S98A 4XVTH 3E38A 3MOAH 1I8MB 1L9TA 4QHLB 2PW2B 1SF3A 2K78A 3AQYA 2ZE0A 5H4ZA 3NABH 4O02A 2NUTA 2N1KA 1TO4A 2I60L 5JIKA 3CQPA 1ZA3A 5IEHA 4KHTH 3VXPB 3FCSB 4OGXH 4GRMB 4E9QA 1J0YA 3K6IA 1NL0L 3CFEB 2V5MA 4U1NA 5IOKA 2ED8A 3MBXH 5B38B 3GSOB 3NCBB 1GRWA 4LNRA 2NYKA 1IBGL 1LEGB 5EA0H 4YEFA 1BQRA 1DUZB 1CE6A 5JPMB 3WO4C 1FL3B 1KN4H 3U82B 4Y5YB 5CN1A 3II1A 1FFNA 1ZMYA 2RR3A 3N85H 3FT3A 4AI7A 4GRLA 5JIPA 2B2XH 2VJXA 1SYVB 2FCBA 1FFOB 3I02A 1DVUA 5IM7A 1AR1C 1TSRA 3IGAA 3H53A 2JMRA 5CBAA 3BAJA 2DRUA 1I1YB 3VA6A 1JNJA 4FNQA 3PHAA 4HV8B 4JFED 4BSJA 3D0VB 1IGIH 3F6IA 4QT5B 4EZMA 4HX1A 5TQ2H 5E2VH 3ATDA 4KUCF 5FUOH 4LQFL 9PCYA 2FHCA 3HFML 4Q0XH 3UAJC 1JFHA 1MCJA 5E2UL 2OYKA 2EVIA 1Y0LB 2VZOA 1G7HA 4NC0B 2GFBB 5DJ8A 4GI9A 1T6WA 3WN5B 1RXLA 4JGJA 2W91A 5H37G 3L3IB 5DTFA 1EGJH 1FP5A 1WT5C 3P11L 1TU2B 1J0ZA 3VG9B 5HDWA 1CICD 3I9IA 3MLPA 2GSMB 4WEEA 3LTVA 2AJUL 3K6FA 4ZMLA 3LRSA 4PIBA 1DSFL 2EZ0D 3U36B 1AQDB 2AITA 4YNYA 1PKOA 5GS2H 1CICB 3I9GH 2JB6B 3MLTB 3MRQA 2XPGA 3H7BB 4ENZA 3MLSH 3ZYJA 2HKFL 4RSVA 4NKOA 1GSMA 3QDJA 2X5PA 4G8IB 2WQUA 4IOIA 2JLLA 3GXDA 3KLHC 5J13B 4R4NC 2XA8L 4FS0A 5EMYA 1MSPA 1WFTA 2R1WB 3B9KD 5AW9B 2VTFA 3N44F 4H1LH 1W0WB 2FYVA 3AU0A 2GBTA 4ODTH 1NLBH 4NFCA 4WIQA 4JG0L 4B9YA 3RWIA 2HJFA 1J1XH 3B9KB 1HH6A 4NLHA 3FTUA 1PLAA 3HHSB 2E9GA 3SDYH 1U8JA 4PRPB 4YS4A 5IFJB 2VM9A 1NEZG 2QGCA 2VZ3A 1YC7A 3FNKA 1EV2E 3QXWA 3L9RA 1T1WA 3SPCA 1E6OL 2QTVA 1CR9L 3PGDA 4AGOA 1HJBC 2J25A 1OGAA 4FXKA 5AVQB 5A6LA 3MZGB 3CFCL 4MBOA 5AOKA 1T5XB 5JPMC 4RIRB 4F24A 2AGJL 4JFTA 5E8PA 5HGAB 3RWHA 3QB7C 1IAOB 1E40A 4X6CA 4Y5YC 3T0AA 3W56A 2EVHA 1BEYL 4RFNB 3FT9A 2EIBA 3J2PA 1MFCL 3R1GL 4MMYA 5FX3A 3CD4A 2IGFH 1RK0B 1ZLVH 5A1AA 4GSUA 2DWDA 3S96B 3G08B 4QNPF 1AY1L 2ZF9A 3ZKJA 4MKTA 4YE0A 1WP6A 5ERWB 3GMOB 3ME0B 5MENE 3VXTA 2BY3A 4HD9A 4I0PD 5DRWA 3MLUL 1OANA 3CMOH 3VFMB 1FUNA 2WINA 2X4RA 3ZX1A 4ELKB 1ND0B 3VFUB 1OE1A 2IG2L 2B4CL 2KERA 4OFIA 3GHPA 5CIPH 5IREA 3FBKA 4HGKC 1U21A 3MRNB 4NRYB 3BKCH 3FO1B 4PJDF 2A7BA 4I0PB 4KHXL 5B3SB 4UYPA 5ADPH 3WN5C 2QLYA 1IFHL 1EHAA 3CSYA 3FUJA 5MERB 3ULSA 2VLLB 3F6LA 3BH9B 4PS4L 5GZND 3CHRA 4YLCA 5I76B 1G7QB 2VITA 3CZJA 4DETA 3IU3B 2AJVL 3WFDH 3UC0H 3GSXA 3BN3B 4L1LA 2IWFA 2FT6A 4KVCH 4BZ1H 3TS8A 2LFGA 2AQTA 5LB1A 3EDDA 3VGHA 1WD8A 3IDGB 4ZNEE 1F4AA 1CICC 3WTXA 2G3XA 4NQDA 2PUQT 5GISL 3SBPA 2Q1EA 3NVQA 1IM9D 2EZ0C 1JYXA 1GTFA 1LEIB 3RIKA 2EH8H 1DBKH 2IXQB 2KQNA 1IEBA 3FQWA 3RHWF 3RWFB 4D7BA 3BSHA 2E3VA 5B39G 5J13C 1IIIA 4F2ME 4JRFA 2V7NA 4NDMA 5HDQH 3MZTA 4JVUA 4U3SB 1FORL 4TSBH 1C08B 2EYSA 3NSXA 1IM9B 1IGML 5EOTA 5EF2A 2C3XA 3EZ8A 5E8DL 4EQ3A 3CLWA 1EIBA 1OB1A 2BHZA 2BIHA 2O61B 5KYXA 4ZUSA 5HHPB 4HQQL 5HGHB 1Y6NR 4LLDB 3B9KC 3MLXL 1XR8A 3E8UL 3EYOA 3Q5TA 3WV0A 4N68A 5DK0A 3DUUA 4P57A 3O3EA 4UIMB 4ZW7A 1J5OL 2GTZB 4PM1A 5AW1B 3ZUNC 2ZUYA 3O4LD 4JM4L 2JIXD 2WIMA 3E6FB 2Q10A 1VGKB 3O6KL 5EF3A 2FT8A 4RFNC 2D73A 5F1IA 5C6PB 5HYEA 2YMXL 2YS4A 3FHEA 2OJZL 1TKWB 3CHXA 1FZOA 5K39A 2AI0L 4XXDB 1MFDL 5KSBF 3O4LB 1DL7L 2JIXB 4NWTL 1L0XA 4CSTA 4N5ED 3ZGHA 4DAGL 4FADA 2WXQA 1T2QL 4KK8D 1FWXA 4XPBL 5HP5A 4AUYA 2VDOL 1MJ7H 5ICXA 1VFBB 1V3MA 1XH1A 1XL4A 1UXMA 4YSAA 5IB2A 2OCFD 1IE5A 1N0XH 3B83A 4FQPA 4IBZA 4N8PA 4UU9B 5FGRA 1XGTB 1T89C 3FT4A 5B22A 1MCBA 4MMXB 4I0PC 4DEUA 4ZX3A 2WTRB 3MI6A 4TLUA 3HNSH 1NGYB 1JNNH 3UIZA 3TCXA 1ZSDA 4HXAH 2DIJA 5HJDA 4BYHA 1XEUA 1GGBL 4KNSA 2A6KB 4AM0A 1E4WL 2DKSA 2NY2D 3QQ9C 5D55A 3AM8C 3BWAA 5DK2B 4HLEA 4KUZH 3GTNA 3QDGA 1NC4D 4J3OD 4LHJB 5KTEL 4OZ4B 1MAJA 4A6YA 3WKML 1PLGL 1YG9A 3PXJA 1G0YR 3VQ2C 4UILL 1HZLA 43CAB 2CALA 5GZNC 2NY2B 4DVBA 3WTUA 4HGWB 2HRGA 1NGXA 1G7IA 3JWOL 1NC4B 2VR6A 5TPWL 5LHDA 3WIHL 2J44A 5F7YC 1UKSA 4N8UA 4B95C 1F4WL 1D5ZA 3KL3A 5MEND 5CEZH 1GA2A 3WLWD 3FL7A 1BQKA 1KXVC 2IWGA 5EBLA 5FYLE 3T4YA 3Q0HA 2J88H 1ZK5A 4JPIA 3F7YA 1U36A 4ZI8A 1O7VA 1VHPA 1WUNT 3KD4A 5FDWA 2P7TB 3U46B 4KDVA 4JDTL 4HHGA 5I6KA 4ISVA 5BO1H 1W8EA 2XWTB 1FYTE 3HPLB 4TRPL 1NBQA 3FU0A 3WL9A 2EDOA 2W9EH 3UAFA 4GG6A 1DCLA 1NFIA 4R26L 4X9IA 2VW4A 4UAHA 1QACA 3O6FA 3QRLA 4BUGA 3DSNA 2CMRH 3QUXD 5GRXG 3PRZA 4OTXH 5HHXL 2XBDA 1Q1JH 3QUHA 4AH2B 2APTA 1MI5A 2WLLB 4H26A 2WWKO 2EYTB 1HE8A 4C58B 1PJ9A 5GRVL 4MNQD 3WNMA 1JGEA 1P4BH 1U3NA 1UJ3A 2VZVA 3T2NL 3FAXA 3D34A 3BUYB 2VSKB 5CEZE 3ARBA 5AAWC 3WKYA 4OZIE 4TLTA 2EIZA 3LRKA 1IL1A 2CA3A 1KYUA 2P43B 4WF7A 4MNQB 4F7TA 2F8XC 1AKJD 2LABA 1CXEA 3PY9A 4BE6A 1BF2A 1WFMA 1X44A 4Y1AA 3WHE1 4F7MB 5J5EA 3ARSA 5IB1A 5T3ZD 2DPKA 4HUUB 5IVNA 4N5EC 5HYSA 3Q9PA 1XF5A 2CUIA 3F6JA 2A4ZA 3Q13A 4MA8H 4KK8C 4DGYH 1K6QH 4G8EB 4MMXC 4R96A 1HX0A 1OAZH 1LDPH 3M1CA 1QVOA 1INQA 1RUPH 2D03L 2DIEA 3OM3B 1YEJL 3KYNA 4ZG1A 4JPVH 1GR7A 5CD3A 1I1AD 4ES9A 4P46A 3QNXA 5D6DC 5DD0L 1WICA 4YIQB 4PRAA 4PJIA 3NA9L 1E3ZA 4FG2A 2B7DT 4GQPH 2GJ6A 1FG2B 2JELH 4R0LA 2WQAA 5HHNA 5C9JB 1U8CB 1CDHA 4W93A 5IUCA 3A0OA 4NQSA 2TSAA 2A73B 4YGVB 2V5SA 3FN9A 3VQLA 2NY2C 1GOGA 5I1KL 4P0DA 3BSGA 5KS9E 4HJIA 5KBDA 4JEGB 4G7YH 4J3OC 5IESH 3E9TA 3W38A 1LP9E 2YD3A 1E4XH 4JFVA 3CGTA 4UANA 2NY7L 3V4VB 2A74A 4EKXA 2DQUH 3N5AA 3LEXA 4O58H 5IHZB 2R39A 3MA9L 4N0UA 1WC7B 4UDTA 4F8NA 2VDNL 1ZT7B 2YAMA 2HG0A 5IW1A 4F8PA 1CBJA 3ZL4H 1KIUB 1KPUB 1LQBC 4I0CC 5BXFB 1JPSL 5CSZB 4OLUH 1AGDA 1N10A 3DV4B 1P7QA 2CNZA 5D71H 1H3PL 2CJSA 5F89A 4QWWC 3G6DH 1VCBC 4NCC2 5EIVA 1AGBB 3KYMB 4G7QB 2Y72A 1G9HA 2BERA 1KV7A 1BJ1H 2AVGA 4OGZA 1NWPA 2VR9A 3SSGA 5BNXD 3AT8A 2YRPA 5KJ7E 1YEDB 3K2UH 5BUAA 3BPLB 3K6OA 1EJ6A 3P9MB 2F74B 2ESVA 1ETZA 3QA3B 4NQXA 5EOCJ 3PDOA 3QRFM 1KXTB 1TETH 4UT6A 4QAWA 3CLEH 3UZQA 4WEUD 4ZD3L 3B3IA 4NT6A 3U1PA 1EVUA 5CFHA 2X4SB 3VRJA 4HEME 5D7IA 3QO0A 1M42A 2R0WH 5AEAA 5FYLD 1O6SB 1IBFA 1M3IA 2O5ZL 3S6CA 5G4NA 4X8JA 1I3UA 4ORZC 4NQCE 1F6AA 4B0MM 2MHAB 1J8RA 2MOVA 4KZ0A 2OJ1A 5I5JA 4XP1L 5EC1B 3QXDA 3SE8H 1RLWA 5EF0A 3VFGH 5SWZE 1M57B 3CVHB 5I8OL 2Q87A 4X6DB 2Z65C 4MNGA 2FQFA 5EN2B 1PLBA 4L37B 5DLMH 4LU5L 5FW6A 3P0VH 3UDWC 4TPRH 3O9WA 5BZWB 2P44B 3ZMNA 5JO5A 3PNWB 5I8OH 1B4JH 3IAPA 1KDJA 3ULVF 5FHAL 3PAZA 5ID0B 3GZQA 2ICES 4HCRH 1WG3A 2CZNA 2GJRA 2VL5A 4PGBA 3QJHA 1SBSH 4AIXA 1SY6L 3IF1A 4TF4A 2E7HA 5DMYA 2ZSWB 1ID5I 3OJDB 4PJHF 5CGMA 3SE4A 2FD6H 4ONOA 3IJSA 3TONA 5IMLA 4QO1A 3DSFH 2IFFH 1R6VA 2PXYD 1HHKA 4U3HA 5E1AA 2AZAA 1EFXA 3QXVA 5I75B 3PWNA 1CFBA 4FNSA 3ASOB 2BOBB 3QZBA 5G4MA 1KBVA 4GG8B 3S5LG 4PS8A 2ZG3A 4Y9FA 4XCCL 4OT1H 5EEXA 4QOKA 3LEYL 3VU1A 2PXYB 5C09D 1OQXA 1HILA 4U1SB 1CU4L 5IEKA 2VDLL 4YDVB 4S1SH 5JMOC 2AQ3A 4RGOL 4PVNA 3QJFA 5E1HB 2WNKA 3I75B 1TJHH 5IVZA 2ZXWB 3ZXAC 5HVFB 1MJUH 1WD9A 3MRGA 3QZWG 5C09B 3UBXA 3AXLB 4AL8L 2YQBA 5D5MA 4GQ9L 4FQCH 5E1GA 1T20B 2NCMA 3INOA 4XN7A 1HAWA 4NQUA 3VACA 2F7QA 3TNNB 3HUJB 3AREA 3B8YA 4RETB 4G9FB 2CJUL 1J5DA 1UG9A 4WK2B 3SYOA 3FDWA 4PJ9D 1QSFA 3BPLC 3RX8A 4U6YB 5D1ZA 3U0PA 1K8IB 3NG5A 2Y9RT 1PY4A 1N12A 2JKTM 4JDZB 2ZOKA 3NIFF 4GQZA 4PWEA 2OI9B 4XP5H 1WAAF 5GGQH 2YQGA 4PJ9B 4JFSA 1KJ2L 5E94B 1G6VK 4BFFA 3VXSD 1XGPA 3A21A 1EQWA 4R4BB 1CBVL 2KL6A 3JZ7A 4JANA 4HZ1A 4K3JH 3RWCB 1DVQA 2C9WA 4WENB 2W07A 2HJKA 4D0BB 2QPUA 1I8UA 2WNGA 5HJ3A 1YO4A 4YXHL 3VXSB 5C6TH 1RKRA 1WA2X 1KLGB 5C0FB 1U92A 1VFUA 3AVEA 3HVDA 3LNEA 4LEOA 3IB4A 3NJKA 4PLKD 4AVJA 3KGUA 3APMA 2AMUA 3H8NA 4OV5B 4DN3L 4QMEA 2V9TA 5GS0L 7PCYA 1AIFB 4ZMTA 2YUWA 5DT1L 2PWHA 2I60H 2OMVB 4RESB 3DO4A 4AV4A 3VE0A 2B15A 3ZZQA 4DNLA 9CGTA 5D2NB 3ATBA 4LCUB 3CH1B 3NACL 3V7AG 4LLVA 1E8WA 3IDMB 3G5ZB 1AH1A 2IALA 2WXPA 4JHUA 3EJCA 1IBGH 5C0IA 2KT6A 5J6SA 4JHVA 2YFOA 4XGZB 3FQNA 3NP3A 4WUUE 1QSZA 4LOFA 5DQ9B 3OKNA 1NFDF 1R0AL 2DB8A 5JHLL 5E99L 2DLEA 3PP4H 5I75C 4A7GF 5BVPL 2YGQA 3ILQD 1DVZA 2DN7A 4YEEA 4NQCD 3WIAA 1P6AB 3QHZH 2PXYC 4OUUA 5FCUL 1BAFL 1E67A 5GSVA 4X6BA 2M2DA 3V52H 5DJZA 3X1EA 4OAWB 3GIVB 3BOVA 4LQFH 4X50A 4JHWL 1C1EL 4NQCB 2JJSA 3O0RH 3QJXA 4BFEA 2CO7B 3NZHL 2V2XA 1W0VB 1S7RA 2WNWA 1LE9A 3VJ6B 5GS3A 4GI8A 3H55A 1ED3A 2D7OA 5H35A 5HGBA 1F4YL 5CCHE 2FVNA 1A2YA 2X1QA 3EH1A 3S8WA 2R2HB 5GRVK 1R24B 3SJVA 3QJVB 4J3UA 2DMGA 2GJZA 3CVCA 5I0ZA 5IF0A 2EXSA 3KE0A 2BZDA 1HSBB 3KXFE 2OI9C 3PU7A 1DSFH 5D1XA 3C5JA 3MXVL 2GW5A 1BZDA 2IH1B 4PJ9C 2YZ8A 1KLUA 4M03A 1C8PA 5TE6H 5CN3A 2ICCA 3LN9A 5E9DD 1B4TA 3RUGF 2HKFH 1G43A 4WWOA 2XWDA 2MMXA 4YHML 2BS9A 3ZVVA 3HZMA 1NKRA 3ASNB 2D4DA 4JK0D 3PWJB 2XA8H 1IFRA 2A6DA 3VB8A 5JOPE 3IAGC 1Q94B 1SYSB 4HETA 5E9DB 4P23B 4X9FA 3W81A 3GSQB 5T1JA 4OLXL 4Y8AA 3VG0H 4Z95L 2A38A 3D0LB 5E0FA 1E8ZA 3UTQA 2L7UA 4OM0L 1ZVYA 5I1HL 5C0RL 4GBXD 1Z5YD 3JWDC 4UINL 4P04A 1V10A 2WQVA 2Z34A 3HPJA 2K6WA 2UVFA 4KK9D 3RWEA 4PLKC 1E4JA 5INDA 5HHOA 3VXRA 3MRJA 4KXZI 4S0SD 1HCZA 5D2NC 2K9UA 3N2JA 3ZRSA 3HJEA 1E6OH 5EU3B 5J11B 5CLWA 1RURL 1AE6H 1N64L 3C6EA 4HAGA 3ARGD 4K3EL 4UV4H 3CFCH 5TGBB 3OMAB 2XZAL 3B7TA 1DQKA 1PY9A 2AGJH 4FNRA 5DQDH 2HFFA 4BH7B 5DUBB 1W8OA 4K23L 3R1GH 4NWUH 4BQ9A 3ARGB 2V9RA 1ZGLB 1VZIA 4TUKL 2RMNA 2K3HA 3C60A 2CGZA 2Z91A 3R8QA 1PF3A 3FJTA 4FHKA 3MLUH 3OKDA 3DXAA 1A6ZA 1T1XA 5J0BA 1HN1A 2A9NH 3ILQC 3D4YA 5JIDA 1K85A 4UTAL 1ASOA 3MX0B 4NKMA 2CHDA 3LPPA 2KZKA 2CKNA 3MJ7A 2KUTA 4D8PB 5A7BA 1YPZF 2A6IA 3LXCA 3KYKL 3WNNA 1T0MA 1MDAA 2YAQA 5AOIA 1NM9A 4AV0A 1YNTA 1GMIA 4PJDB 1N6QH 2WZ0A 4OCRL 1WE5A 4LVEA 3ZR6A 4AUUA 5C0BE 5ALCH 1LD9A 4PS4H 4MZRA 1KGCD 2I07B 2AJVH 3DV6A 4XBPA 1OP5H 3AITA 3MFFA 3EO1A 1F00I 5BZDA 5J1AB 2ZUVA 2FJHA 2OQJA 4QRBA 5CM1A 4WUUD 4GO9A 1J9RA 5F70A 4I9XA 1R3KB 3TIEB 4Z3GA 3SGDH 2BVQB 5JYLA 1WGVA 4EVNA 3U2SA 1KCKA 3X12B 4FE9A 3QC6X 1N67A 4Z1PA 2FJFB 1X5MA 1RJCA 1QEXA 2B1AL 3MV7D 4IHOA 4Q4IA 1FNFA 3FT2A 1Z9SB 1XH3A 1PZDA 1QAWA 1R3LB 4P23C 1IGMH 2YRBA 1CG9A 4PJXA 4M9OA 4JFHE 1SVZA 1HEHC 5IP4A 5JA8B 1QWNA 3ES6A 2V2WB 4FQIH 5BS0A 2B16A 4ZUWA 3MLRL 4MA3A 4NI3A 2NY4D 4UV7L 4M93B 3MV7B 4QRRD 2WMPA 1HSAA 5F3BA 3E8UH 4ONGL 5AL8A 3W57A 3EGSB 1FZMA 2AEIT 3IS0X 2NY4B 4PU2A 3LZNA 4QRRB 5J11C 1JGVL 3B2UD 2PF6A 1D5MB 4LDOB 1SMDA 1SLWA 1MIEL 1K3IA 3A3YB 3TO4D 2X6VA 4GKNA 43C9A 4KK9C 3UG5A 3FU6A 5ACZB 1GKOA 4MAZA 1I4FA 3T5WA 5LDSA 1U8OB 4JM4H 2EUVA 3GMPB 3MMEA 3O6KH 4FFZL 4Y4KD 4PVLA 4U3XA 3U6XA 1JBJA 1DQDH 5DMKA 1S7QB 4M9PA 2YMXH 4CC4A 5I0DA 1AMYA 4GG6F 2WWNA 2EUXA 2OJZH 1NCBL 3AT9A 3ARGC 4HAFA 4XO5A 1BVLA 3A6BL 2CDFA 1MFDH 1H3VA 2CNYA 5LWYL 4NWTH 4G43A 4N9OB 4LCYB 5CUSL 2F54E 5EO0A 2NXYD 4Q9BA 4ZMNA 4DAGH 3V79C 4XPBH 4UB0L 5KSBB 5JOPD 2ITDA 4GKSB 1MJ8H 2ENYA 2QVMA 1AXIB 3ZRCC 5FFLA 2Z9TA 4HUVB 5DZOA 1A5FL 2NXYB 4RMBA 3ZUCA 4LEXL 2Q76B 1SVBA 5D4HA 2FR4A 1CFQB 3GLAA 3OGCA 4ZBJA 4HW6A 4CC1A 2VO8A 5IQOA 2R1YA 3TA3A 2E27H 4JPWL 4B9ZA 3HN5A 5CLYA 5ENWB 1PYWA 3GUTB 2XHNA 1RIUL 2OMUB 1GGBH 3KWXA 2QDVA 3WEBA 3GT6A 1E4WH 4L3EE 4M3KB 3KYAA 3WNLA 2R27A 3KWWB 3VUAA 4IMKA 1IAIH 4WSGA 2Q0ZX 3AY4C 3HC3H 4UILH 4WI2A 3VSVA 4Z78A 2ITCA 1A1OA 3T6WA 2NX5A 4N2KA 3LQZA 2YXFA 1CXLA 2GIXA 4X7TB 3U4BL 4R7NB 3CZFB 2BWIA 5GIRA 3WIHH 4NIYE 1XR9B 1F4WH 1AS7A 2WKOA 3E3QC 4LKCA 4W9IC 2X6UA 3ATEA 3C5SA 3ILDA 5ISZA 1QW9A 4P2RA 2QFRA 2QKIB 5C0JA 4X0NA 1XCQB 3FH7A 2ZWSA 1K5NB 2PWFA 2EVGA 3QS2A 1A6TB 5HYIA 2UY6B 4MYWB 1QTYT 4HWNA 4M93C 5GRJL 4M6MH 3ZIMA 1KC5L 4TRPH 5B3JE 3T2PA 3WEXB 1HH9B 4JZOA 3Q1SH 5DI8B 3DMMA 3L4TA 2XACC 4R26H 1NCHA 2NY4C 5LN4A 1ZVSA 1FGNL 3GSNA 1NDGA 2OCJA 1WZAA 2RTTA 3V0FA 3KDPB 1UT1A 4WWKD 3TYGH 3F12A 3V10A 5HHXH 3U1QA 3T04D 3G6AA 1H15A 4TQIA 4WZ9A 4JLRA 2VAAA 1EZVY 3B2UC 4OSUH 4YXLL 4WTZA 3BD4A 2JV6A 2F7OA 1OV8A 5I8KH 1BIHA 2XG5B 2B8OT 3BGFB 1Q1PA 3KAAA 2E86A 3T2NH 4DIXA 5IJVA 5J9PB 4HWEL 2AJZA 2Z8SA 4WI4A 4X4MA 1JPFA 2XWRA 1O9ZA 3IGLA 4JFFE 4ZAKA 3GHBL 5LAPA 5DZLA 3DRTB 3ZE0E 1OO2A 3SDAA 2PYEA 4F8OA 3L3GB 1PFCA 4O2FB 1QO3B 5DZAA 4TVPL 3ZIYA 2NXYC 1JI1A 2PP9A 1NUFA 1M71B 1P84K 3OLDA 1R46A 5IMOA 4EDXB 3QISA 1DVYA 4GRWF 4H4NA 2OSLA 4OLWH 3IJHA 1L3WA 1HK6A 4FYRA 1TZIA 4PWKA 1JXJA 2XWJB 4UOQA 2DJ4A 4XPTL 2MCMA 3TIDA 1HTYA 2FSEA 3B6SA 2D03H 3BO8B 3CLFH 1JPGA 4OCXL 4XXWC 5AZUA 4B97A 4GUCA 2VW6A 2XTSA 1VEPA 2NY5C 2DL9A 2CD0A 3IN2A 3QQDB 3WY3A 4JJ5A 5D2LF 3R4RA 4WEBH 1DYZA 4DVRL 1OEZW 1ZWIB 3KNBB 2PO6D 4FI6A 4WFFE 3FKUS 4CU6A 5FUCE 1KY6A 3BHBA 1SZNA 2DI8A 3BPNB 1EO7A 1SOKA 2H26A 3DTDA 1I1CA 4NUQA 2QPEB 1J86A 1WGOA 2PO6B 1IE4A 5CWSB 2RQ8A 2IBBA 1MRFL 3NFNA 2OMZB 1R5VB 3BPCA 5AOMA 4IRZA 1PZBA 1G0DA 1ZA6B 4JFXA 2QSQA 1D5IL 1IUZA 1CFNA 3ARZA 2VIRA 4OZFG 1NBVL 1EGJA 3DNKA 3OZ9H 2QKIC 5CEYB 3W0WA 4G8FB 3UXFA 4WNSA 3T6VA 3OKKA 1PL3A 1FZJB 1PZ2A 3L4WA 4HPYL 4ODXA 4UQEA 5FOBA 3U4EA 1SM3L 4G3YL 4U49A 4MB5A 2JKLA 2OMXA 3EJRA 2WBXA 3C2SA 1NOFA 1PAZA 2QGEA 1QFWI 4H8UA 3NCXA 3W82A 3ROOA 1ROCA 4ODVH 4U6TA 3WLBA 4A1RA 4MQTB 5AW0B 1G94A 1PZAA 3E9UA 2MRYA 1ILUA 4DCQA 4FYSA 4JO3L 5J8OA 2X4TA 1OP4A 1I8LC 1QBLL 4NAJA 1VCAA 4PBXA 4YDKL 2AXJA 1CTOA 5BZZA 4W9JC 4JRXA 4APXA 1CURA 4JN2A 1BXAA 1AD0A 4ZFGL 5I1IL 4B5ZA 1VZHA 3ZRFC 1LNUB 3BGFC 1BA9A 1DQLL 3RGVA 2D9CA 2A9CA 3NJGA 3QQ4A 5AVUB 3PV6A 4QRQA 5D7KE 5DZJA 3I6KB 1BPLB 1FO0A 1XB6A 3UYRL 1GJUA 1RZ7L 4MASA 3I6GB 3VRLF 5DC4B 2RA1A 2G2PA 4ELDA 5T33L 2NSMA 3MJ8B 4OD2A 3V2AR 1T21A 3H2PA 2VDOB 3TBSB 1C16B 1DJYA 2EDLA 2FX8L 1U93B 3VTAA 2ZOWA 2XWZA 2X53A 1L9RA 2ICEB 4L4VA 4MJJA 4N1HB 1PQZB 4S2SB 4S1RL 2B4CC 4FFVD 4K9EL 1HE7A 2DOCA 4V1DE 5EUOF 3W2DL 4FMVA 1E5BA 4JRYD 4IS6A 5LLIC 3EFOA 1OLLA 3VX1A 3WFCL 3FCTA 3BP6A 1BWWA 2Z35B 3I3DA 4PV9A 1NC2B 4E41D 3BIAX 1T83A 4W9KC 3RX5A 3SO5A 3J7HA 3BH8A 2FWOB 3N3EA 4F2MA 5LKNA 3V9EA 4JRYB 2YMTA 3VXOA 1S9WA 4EI0A 1SY6H 4X4ZA 2E9JA 3BPNC 3L1EA 3S8GB 4MKMA 4E41B 2OXGA 4NKDB 5BRZD 4BFIB 2JJVA 4YQXL 3U6RA 3UMNA 2PO6C 4DJMA 4DP1X 4LE8A 1UWYA 3MJWA 3BLPX 4PJHB 3JXAA 3TP4A 3WIFA 2IBZX 1E28B 3SQOL 1XCWA 3VVVA 3L95B 3RDTA 4J3SA 3QJUB 5BRZB 4I4WB 5I28A 2WB1A 4BUQA 3BKJL 4XCCH 4GAYB 4N24A 1R9FA 1YMHB 3DBXA 3NJMA 2D7MA 3UTPD 1HI6B 3EJUA 1CU4H 4A38A 2VDLH 3UERA 3FRUB 2YAPA 3ARDD 3MRDB 4IKKA 4C59B 5K9OA 2H8PA 3QDMD 2C26A 1TJMA 4HPOH 3ZTJH 4PMFA 4AYDC 3FTVA 1UVQB 2VLJA 4QYOA 4GQ9H 5SV3A 3QCUH 3NZUA 2R69L 2VDKB 1KXQE 3SKNA 3ARDB 1EUUA 3VQ1C 3VFVA 5AB1A 3KPPB 3QDMB 5IT2H 5DRZB 2CPCA 1UENA 4JDVB 4J3BA 2CJUH 1UWEL 3NJVA 5DZ9A 2YXMA 1Z32X 2SODB 3BUBA 2AK1L 3EFFA 2ENJA 4LFHD 2H1PL 3SDXA 4E5XA 4HWBA 4W6YB 2ZX9A 3VO0A 2HSIA 4UZUA 3FOMB 5FV1L 2OJEA 4UM9A 3ABLB 4PJCA 1A6AB 3D07A 1BD2E 1UURA 3F05A 3MV9A 3QWRA 4FYQA 5C6WH 5C8JB 4XP6L 5T5NG 3U9PL 1CBVH 4HK3J 1DQML 2ZYSA 1NA8A 2DQCL 5CCKL 1OAXL 3GUFA 4NOFA 1PW3A 4QXVA 2ZWZA 1A1MA 2O6CA 4WNJA 3VH8A 1CIUA 3MO1B 1U8QA 1C5DB 4LPVA 1CDBA 3DX9B 1QRNA 2X10A 4MQ7B 4BGLA 4Y2NA 5AKVA 2XIDA 4FG0A 2ICEC 3MCLL 3FFCE 4DN3H 2Z31D 1NINA 3VXNA 4NBXB 5FYJU 2ZYIA 3L3HB 1DCEA 3UTTD 1WH0A 2RFXB 5JHDB 2DMHA 4BUHA 3ILPA 4D0CB 3JUZA 1KTDA 1NCCH 1S9VB 3QPQD 4AEEA 4FFVC 5HYSG 3QFJA 2Z31B 1XIWA 3OKLB 4ZFQA 2CBTA 3GFUA 3NACH 4XCFH 4CN6A 1YMME 4UOZA 1T1ZA 3UTTB 3KVPA 1RPQA 3V5HB 4KKZA 2X4UA 3C8HA 4KNTA 1ZRUA 2ATPB 1XQ4A 2OBGA 5HVWA 4JO5A 1TQCB 4JO2H 3MRKA 5I15L 3STZA 1NAML 2Y25A 3NH7L 4JE0A 2P4AB 4L4TE 1BMWA 2IPUK 1JWUB 3BUQA 2MCG1 4AQAB 1Q38A 2IWEA 3CZUB 5T1DL 1X5HA 5L9DL 1OK8A 3UADA 3FTYA 5D7KD 5BVJB 1DEDA 2ZUTA 3OHXA 3JWOC 4FTVB 3JWNH 5BVPH 1NFDB 3HCVB 4X4YA 2UZXB 3DYPA 1BW8A 5CP3A 1R4XA 3LKSA 5FCUH 3TBYB 1MY7A 1I9EA 1KENL 1TYEB 2J20A 3O2DH 1C9SA 1MUJA 5CKGA 4TUOB 1LXMA 2VDNB 4I18B 4M62L 3VD5A 3TV3H 4V1DD 1S7VB 5CF3A 3GMRB 1GC1C 2BY1A 2EDQA 2XTJD 5T1LD 1FNEB 1DQQB 1Q8MA 2IFGA 2ZUWA 4HK0A 4JM2A 3ARDC 2KLRA 3QVAA 1T7XA 4RAUB 1EA9C 2HT3D 2EJ1A 2I7SA 4X98B 4E42A 4LOVA 1M05A 1KCVH 2XN9E 1U8KB 3OAZH 2EDDA 3KDMA 2XTJB 3OGOE 4JY5L 5T1LB 5ANMA 2FX9L 2XX1A 3QIWD 5D7LB 5IG7A 4I48B 5BRQA 3WHXA 2GJJA 2NT1A 3MXVH 4HH9B 1KB5L 1ORQA 2MNWA 2E4FA 3O8XA 4XBMA 4EI5D 3QIWB 5DEZA 4LT7A 3SOBL 2AV7B 4HC1L 3L9YA 1ZLDA 4OCWL 2HLFD 2XA3A 1YN6B 4KV5E 4PWGA 3BP5A 4Y2LA 4WU7B 5JNYA 2HX8A 1C8QA 3HG2A 1MH5B 3CZNA 2WUCL 2VH5L 3RUGB 2ADFH 4KFZC 4XNQA 4EI5B 4Z3TA 1BEXA 5D4IA 4ZUUB 1J9SA 2C7UA 4BQBA 1GCFA 1EAOA 2SEBA 3C6SB 2IAMD 5DDHA 1I9IH 4MS8D 3L7EB 1BZ9A 2R7EA 5C0RH 2J4WL 2X12A 1X3DA 4WU5A 2N1TE 2CM6A 5KS9A 1J18A 1H9VA 2EYRA 5IIEA 2IAMB 4J6IA 1LP9A 3ARYA 1L9MA 2XKUA 4XMVA 1HIMH 2Z31C 3LQAL 3QEHB 5E8EB 3SDDA 2IDFA 4PRBA 1SEBA 1N64H 5JW4N 1B9KA 3NIDF 4K3EH 2BWQA 5H37H 2Q7YA 3NZ8B 1CFTA 1Q9WA 2Y36H 3VI4A 3QPQC 3B3BA 1TQCC 2R51A 1HHGA 2NW3A 2EILB 5I18H 2ZAIA 1X6LA 4MD5B 4CJ1A 3IBOA 2NR6A 4K23H 4PJEA 3WUZA 1T7WA 4UZGA 3RKDD 1UM6H 2UWEE 4LEBA 4F7EA 4DZBB 1YQVL 1DLFH 1OQOA 3BJLA 4A2HA 1MVFA 1JZDC 4IU3B 5I73B 1IGFL 5EZOL 1QSEA 4E9WA 2VJ8A 5K5YA 5IBLC 4JW3A 4ANUA 3S34L 1JZFA 1ZT1A 2WC7A 4HUMB 3G6JA 4I18C 4Q6KA 5IBUG 3PCYA 1UADC 4QGTA 1HCYA 2PTUA 3VFSB 2BVOA 1MZYA 3UPRB 4HEPA 3EBIA 1CS6A 4F3FA 3D9AL 1CIDA 5EZJA 4Y1SA 1YPZB 4P5TD 4YVNA 3BAKA 4V33A 3T3ME 1FJ1A 2BSTA 2K0RA 1WFOA 4L8BA 1FN4A 2XTJC 5KYNA 4QRTA 3J07A 2VLKA 3UJTH 3RA7L 5HY9A 3DJTA 4P5TB 2HT3C 3UBXG 3WJJA 1JV2B 4EUPA 5I5RA 1YY8B 4BFGA 4N8VA 4ORGA 2QV2A 1U3HB 4JFOB 2IOIA 3QIWC 4PV8B 3QRGL 1WV7T 3V4VH 1JS4A 3UPAA 2B59B 4FZ8H 5LAXA 1H3WM 4NRZA 3TWCL 4C4KT 1KJ2B 4RDBA 1SN2A 4OLZH 3N06B 3IJ7A 5KVDL 3TVMB 4R7DA 2B1AH 2WOYA 1D6EB 2J8UE 3UIYA 4EI5C 1RUKL 4RQQB 2F2HA 5FM4A 3VYPA 1VACB 3JVGC 3UJIH 3D39D 2PMZA 4P3CH 5CLTA 1S7XA 2HLFC 4Y5VA 2R4RH 3GJFK 2I9TB 4ZSOA 1RIVL 5GS0D 3G5WA 1TQUA 3FQTB 3DURB 3NPSB 4UV7H 3HZKB 1YEKL 3KW8A 4AYID 1WZKA 2WKOF 1H8LA 1OT4A 3N1PC 1H3TA 1FLRL 4HUXB 1MQKL 3D39B 4UNVA 4ONGH 3IFLL 1X5KA 4DO5A 3T0WA 1PZSA 2IAMC 3AJ7A 3P77B 4ERSL 4MS8C 3D4CA 2WLIB 5KSUA 4LSUL 3BIKA 4M61B 5DEFB 4OCNC 1KLFB 1BG1A 1N70A 1QUNB 5IROD 1MIEH 4LKXA 4LSRL 1E3XA 3F8UB 1FVDA 1A7NH 4C47A 2KMWA 1MFUA 4QRPE 5B4MD 4Z3IA 3GWJA 1B0GB 4FFZH 3O6LL 2F8OA 1WDAA 1UQSA 4GI6A 2MKWA 4QRFA 3FXIC 4RA3A 5DRNA 5E1IA 1NCBH 1HJCA 2GK2A 4GINA 2A9DA 4LVOC 3A6BH 1DDTA 5AAPA 3LPOA 1TNNA 1UWGH 1S9YB 5CUSH 3SGKA 4HALA 5A2LH 4GKZB 5I73C 5GGTL 2XWBA 4CGTA 4UB0H 3SYQA 3RKDC 3N9GH 2HRPL 4G1MA 5M94B 2C3GA 3UTSE 2X4PB 4WI3A 1JZGA 1UT2A 2QQQA 4KXBA 4UM8B 4G6KL 4R83A 1KTJA 1NEPA 4NQVA 5IHHA 2M83A 3CPLA 2CLZA 4LEXH 3V0IA 3SQBA 2X1OA 4JR9L 4JAMA 1U30A 2FJGA 2UYLA 1T4KA 1XWVA 4PJGE 3KPRD 4PTUB 3KPLB 3LXBA 2PPEA 1KBGL 5E6ID 4BE5A 2EABA 2E6JA 3KPQB 3QSKB 1U8HA 3HE6D 2ZKXA 5F2FA 4AL8C 3OAWA 1ML0A 4KRMB 15C8H 3LNFA 1RIUH 3HG5A 3KPRB 5FF6B 4HU2A 1IKOP 1DBBL 3O81A 4DOHB 1I7UB 1BXXA 2ZICA 1OARL 4P2QB 3HE6B 4V2BA 5T3XD 4P5TC 2ZP8A 2C4FT 5IMKA 4OJYA 4IOSD 3LKNB 3C09B 4N6QA 1MZZA 1ZDSA 4N90E 1RERA 1U3HC 1F3JB 1SPDA 2DBLL 1QD0A 3B43A 3H1ZA 4O02L 4Z7WA 1ET5A 5I6LA 1RULL 1ZV5A 1KT2A 5DWUH 2UVEA 3TVMC 1TVHB 2LFEA 5ABAA 1DVXA 1A1NB 1BOYA 2O5YH 3MRLB 2UWEB 4KTYA 3N55A 4BRJA 3C6LD 3D3VA 4OW6A 4UI2A 3WE6A 3U7AA 3RZCD 2JKWA 4ETQA 1Q0EA 5B1JC 2QTEA 4N2DA 1QBML 5TDPA 3BZ4B 1M6UA 1E4KC 1NMAH 3NPSC 1KC5H 1VF5C 2QQKH 3C6LB 2Q3ZA 2NSQA 1OK0A 4AZUA 3NZSA 3FSWA 4JFYA 3RZCB 5IB3B 2C9AA 2JK5A 3A67L 3SZKC 4YZFE 3S3SA 3MLYL 3NQKA 1XD1A 3PHOB 5KOMC 2AMGA 1KYOK 1IKNA 3AAZB 3HN3A 5I66B 3DX2A 1SJEA 4HWZB 1QABA 5BZXA 3HS8A 3K8LA 5I0XA 3GKWL 3NFPB 1NCAH 2BP8B 4MSWA 1JZ3A 1FNGA 4LMQI 5G2NA 5IROC 4YXLH 4AQ1A 4B7LA 4PJ8A 5FO8A 4FZEL 4MX7A 1JNLH 4Y9GA 3LHPL 5B4MC 3EXJA 2EO7A 4HWEH 1QHQA 3N1GC 3PREA 2EE2A 4GKLA 2QQNH 3TZVA 3WUWB 1EJFA 4LL1A 4O2EB 1M7DA 4EIZC 1JRHI 3CFNA 3LKOB 2OFQA 2VXUL 3NOIA 5L8LB 4YSQA 3UH8A 1N3NB 2IVFC 4UAOB 3LZFL 5ILTL 4BZ2A 4XMTA 4C4BA 3VD1A 4TVPH 2BCKA 3V7MA 4FFYH 3ZN6A 2Q86A 1AFVL 5D1QE 4ECNA 4NAQA 4FHJA 4ZXBD 2R1XA 5FECB 1I31A 3IYLW 1I7TB 5L88H 3FB6A 1DLHB 3JWDH 2BW4A 4AT6A 1NTDA 1NDMA 3LKRA 3RJOA 2I26N 4OCXH 1NCNA 3DK2A 4FLOA 4PSRA 4GRWB 3D48R 4ZXBB 4K3HA 5T1MA 2P8MA 1TVBB 4ALAC 1NFKA 4ZUVB 4F33A 4EDWL 5DF0A 1DUYA 2Z4QA 5FYKD 1ZXQA 4DVRH 4AG4L 3V4PB 4C83B 4JGNA 2WLYA 3EF7A 5BO4A 3QORA 4WY7L 4KRPD 3HE6C 3MNVA 3N41F 4EE2A 2J57A 5DVPA 2JKNA 2V17L 4G6ML 1N59B 5D2LB 4WI9A 3ZDXE 3C09C 2HVJB 1DJIA 1SJHB 2GEQA 3F5WB 5F3FA 3EBHA 4NPYA 4JG5A 4AYFB 4TLKA 5FDYA 4EI6B 4DP9X 5EWIL 2WZ5A 5EU6D 4XNMA 2AF2A 3QGVA 3QUKA 1AOHA 1D5IH 1UHVA 3IVKA 4HD5A 4PJBE 1V3LA 1RZGA 2EECA 4TVPE 2E9BA 1L3NA 1A21A 3ARQA 3AROA 1JPTL 5EU6B 1E2ZA 4MCNA 5IJKC 2EE3A 2VXTL 1QZ1A 2MKLC 4HPYH 1SM3H 4G3YH 4AQEB 4IGBA 1N5YL 3BZFA 4OF7A 3LN5B 5DJ6A 3C6LC 1HC1A 1TDQA 2EDTA 3THML 2GAZB 4PW4A 5IVXF 3X3FH 1YDPA 3CFDB 3RZCC 4NCC1 4KXDA 4JO4L 1N4XL 2YBRA 3COOA 1YYMH 5D9SB 1E9QB 3VD2A 4LGRB 5I17B 1NDTA 5AKTA 5DHYA 4EXKA 1LWJA 1AOZA 2XDHA 1DFBL 1QBLH 1DJWA 4YDKH 5I0VA 3F64A 3K72B 5IK3B 3BZEB 5J57B 3X1FA 4DTGL 1J8HE 2GIMA 3FQRB 2YMOA 4J3VA 4PJ7A 5DA0B 4ZFGH 1Y1DA 1CQYA 2YPLD 1I1FA 4HFUL 3SPVB 1ES0A 2XUWA 2R0LL 4XOAA 4RX4D 3IPBA 1THAA 1GZHA 1W16A 2FAUA 4Y7OC 1JMZA 1VPOL 3LQMA 2YPLB 4KQ4L 3T77B 2AXFA 3H42H 4UAOC 5T33H 1UZ6E 2EIDA 1P7KB 2R0KL 1XMWA 3DJSA 4PB9L 5KYWB 2CLVA 4NP4L 3M07A 1SLUA 3MCG1 1B0RA 2H2SD 5SX5H 3VU2A 1UOKA 4TSCH 4LIQL 4XCNB 4K9EH 4G6AD 2UXTA 4BXSV 3KCPB 3Q2CA 3GJFH 1KPVB 4PLJD 3L4XA 5AW3B 4ZXBC 4OGYL 4IU2A 3WFCH 3SYCA 4GUPA 5EUOB 4NUPA 5EUKB 3PP3H 1BFOA 3QUYA 3PF2A 1M53A 4HLJA 3SKOB 2ZOLA 1AXTL 4WJKB 5HHQB 5JXED 4WO4D 5DYOB 5C07A 4HBQA 3ZMEA 1TQSA 1MLCB 5EOCL 3ZE1E 1PFOA 3VXUA 3U9UB 3VD4A 4NO5B 1P1ZA 2VZUA 3VA2C 2W59A 4NX0A 5IJCC 3L16A 3CN4A 5C2BL 3PABB 4OFQA 3SQOH 1CD1B 1A14H 2NQ3A 1FHGA 3PGCB 4LHQB 4GSDH 3BKJH 3DDFA 3PWUB 1A7PL 2WWOA 1OWRM 4P3DA 3LH9A 5ETUB 2W60B 2CO6B 3K71A 4Y19A 4O2CB 4KH2A 3HAEB 1CUOA 4L8CA 4TQEH 3RTQA 4G80A 3WXWL 1BQUA 3L3DB 1NBYB 5DQJA 3RWDA 1CDIA 5DFWH 3ZE2F 3IGUA 3GBMH 4FRWA 3QC5X 4NO3B 1RU9L 5IR1B 3VDAA 1IC4H 1KJVA 3QYNA 5I1GL 1EBPA 2DS4A 3P4MB 3RL1B 5FB8B 4CL7A 1I85A 4APQA 3RU8L 2IDTA 1SXBA 2XVBA 3HNTL 1UWEH 3OR6B 5GRZA 4YHNA 3WENA 3FU7B 3BQUD 4XO3A 4OM1L 4X0KB 5DU7A 3BFWA 4JFDE 1JNHB 2Z8RA 2AK1H 4NXSA 2Z0BA 4JHBA 1CXIA 1OGTA 5CGTA 3ULUF 3B7UX 3GSVA 5E00B 3JV5A 3BQUB 5C0DA 2ERJB 3L9BA 4H8WH 3LZQA 3MV8B 5CSGA 1U3ZA 1GYCA 2APXA 2NNCA 4XP6H 4LLMB 1AYRA 1DQMH 2EO1A 4HJGA 2DQCH 2OMYA 2DWSA 3NIGB 4QF1A 4MA1B 3IJEB 4QNPE 5CCKH 2ZCHH 4TVPD 2ZXBA 1T22B 4WTZG 4A6YL 4FCHA 2CKBB 5JQIB 4XPHH 3PWVB 2OYPA 4ELMA 4PR5A 5F1SA 3ZTEA 2VDRL 4HKZB 1AD9B 1PPIA 2KDYA 3FBQA 4I2XE 3X14B 3MCLH 4NN7B 2NW2B 5IMMA 1DO5A 2LE9A 5KZCB 5EIIA 3S4SA 1FGVL 4F9LA 5DD5H 1J05A 5E6SB 1BMZA 4PJ5A 5A40E 1TTBA 2EDKA 2X6CA 2CLRB 1H19A 2VSDA 1MVUA 3FQ4A 4G6AC 4PRHD 4F58L 1DTUA 1FNAA 1B2WL 3L5WB 5EZLA 4OCYL 4TKWA 3MLVL 3Q2VA 4PD4J 2YGOA 2Q8AL 1GIGH 5I15H 4PRHB 3NH7H 1IKFL 3QZMA 2GTWA 3WNIA 1XF2B 4GAJL 5KN5B 3QIUD 3MROB 5JXEC 4NXKA 2P5ED 5C0GB 5CJOL 4Q89A 4NHUA 4XX1G 4HFWB 2KPNA 4LPYA 3R7RA 2OMWA 2JCCF 4BA0A 2YA0A 4EN2A 5F9DC 4F7CA 2HT4C 4JQVC 5HGDA 4XNDA 4KMQA 4JB9L 1AQ8A 5ADOH 4EZKA 3QIUB 5FO9A 2P5EB 3MKGA 4NC1E 3ISWA 1KTCA 5T5FH 3ECBA 2GCYA 3FB5B 4PJEF 1B4LA 8FABA 3APCA 4M62H 4Z3EA 4RAVB 2P80A 1NSNL 3UBFA 1NGWB 2O72A 4MFHA 2Z92A 3IETA 1RUML 1DVSA 2CGRL 25C8H 1PSKL 2B1HL 5F1NB 4OFDA 1YEEL 4FQLH 5TK2A 4BSWA 5F8RC 3KBEA 4U1MA 2WVUA 2NNAB 2DM2A 1T5WA 4JFFA 4M8UA 1HHIB 2Q6WB 2D0GA 1ZIBA 4IKJA 3HI6H 2FX9H 1QR1B 3D30A 3N43B 5JORB 1NUGA 4UBDD 3G5YB 3IDNB 3M1BB 1LE5B 5KSAB 3KPTA 1L7TL 1SFHA 2YEZB 3HS0C 4MWFA 4QCIB 4YMPA 2G5UA 3BQUC 3GNML 2ERJC 1BX2B 1WEJL 4LSQH 1A8JH 1CD9B 1JK9A 4YO0B 3SOBH 2F1BA 4W9HC 4HC1H 1LO5B 1BQ5A 3F7VA 2ZWNA 1PS3A 4G1EA 4HPHA 4OCWH 3VSUA 1AGCA 1PGRB 3HG1E 4MA1C 3NEXA 5AQ0A 1CZ8L 4MJ6B 4QHMA 1WT5A 3ALXA 3T8XB 5E1QA 4KAQH 1N2RA 2WUCH 5F0PB 5AVRB 4P5SA 3BT2L 1UB5B 2HA1A 4N6RA 4LNVA 1MNUL 1PDKB 4H8PA 1G9MH 1SMOA 3IRZA 4TSAH 3OR7A 1GY1A 4M5ZH 4PP2B 4XN9A 2GUOB 4NN7C 2APVA 3LEVH 4Z7VA 3IMUA 3ROLB 1OD7A 1U2HA 4YFEA 4HIIA 3DX7A 1K4DB 1U4FA 4JZNB 4MRCA 3HB3D 5LVEA 3LQAH 1AVAA 1A0QL 4NQEE 2XYCA 3CC1A 3LJ3A 2KKQA 5F88A 4XX5A 2NDFA 3V7AE 3II3A 1YA5A 4ESKA 4ZPVB 3HB3B 3MRMB 5DD3H 2G2RB 3NIDB 1DFXA 4G9DB 4PUBL 4U7KA 4QHLA 2VC2H 2PW2A 4JJHA 4X5XB 5E70A 3VNZA 1P0SE 4R3SB 1O5DT 1YQVH 4MD0B 1VKXB 4L2LA 1BF8A 3TEZA 3KPMB 1ZHLB 1CYGA 3MBWB 4GRMA 4ZUTA 3NTCH 3QIUC 5EZOH 3CFEA 2X09A 4YDIL 2ZAHA 4P4KB 3GSOA 4YOKA 3ZYOA 3S34H 2EVFA 1BQSA 1LEGA 1F2QA 1HL8A 2AK4E 3TC9A 5IHUL 1DUZA 1G6RL 3FU8A 5JPMA 4P9ML 1FL3A 1OF2B 3A4EA 4X9YA 4Y5YA 3V0HA 1WIPA 3QHTC 4OD3L 1AGFB 2H0PA 3FH8A 4KDTC 2VSCA 4CA4A 3VDBA 4YZWA 4XT1C 4XMPL 2GT9B 1I1YA 4H88L 4RA0C 4HV8A 2WIIB 4IRJB 3D0VA 5HPOA 4PJFB 1T0NB 2R15A 1OAUH 4QT5A 2Y3NA 1OAKL 4L4JA 1CFVH 3IFOB 1TF4A 1E8YA 4BK5A 4AM0Q 1ZKAA 3VFNB 3U0TB 4N8CH 3PJNA 2OYLA 2A9ML 3SGDI 5KSAC 4YHIB 1Y0LA 1RUQH 2GFBA 5GZOC 3O0LA 1N8ZB 1KGIA 1L9SA 1BFTA 3CN1A 3GJEB 4Y16D 3QRGH 4UNIA 5AWNH 1SHMA 2ZP0T 4P99A 1KIPA 5KVDH 1UYWL 2Z1KA 3L3IA 4X7CC 3JTSB 4XP4L 1TU2A 1RZKH 3T8MA 4E5XG 1RUKH 4Y16B 2X40A 1GZQB 5GGSB 4X7EC 1WTGT 3QDHA 3AS1A 3TWYA 1G9EA 3IE4A 5HYQB 5ESAB 1RIVH 3APNA 2DYPD 4Z7WF 3U36A 4MJID 1AQDA 1L9PA 2CK2A 3DO3A 3MAWA 4FG4A 3WY4A 1F90H 1YEKH 2JB6A 3ARXA 3MLTA 2VZSA 4PRNB 4XAKD 1D2OA 1R3JB 1MQKH 3H7BA 4LP8A 4N87A 4P48A 4HUWB 4ERSH 2DYPB 5H2BB 4MJIB 4G8IA 2IH9A 4LSUH 2BP5M 3AWGA 1OAYH 4QEGA 2YGPA 2R1WA 1UM4L 4K7FB 4U2YA 1W0WA 2FQEA 2KI6A 2F53E 1OTTC 3GMQB 3HB3C 3M17B 4FEMA 3O41B 2JTDA 2Y2YA 2OZNA 2XBTA 4LXFA 2H7WA 3DGCR 3B9KA 1XH2A 1MFNA 1I8IB 1C5BL 3HHSA 1P4LB 1NAMB 4PRPA 4MXWH 5BRPA 3BEWB 3HG1D 2G75A 5KVDE 1NAKH 2BWDA 1SRDA 2GQHA 5MHSD 5GGTH 4GB9A 3NJIA 4KTDL 3LKPA 3AGWA 5TF0A 1CI5A 4P4KC 3DWTA 4OBSA 1MCWM 2AQPA 3HG1B 3V6ZA 3MBEB 3QWOB 2NUPA 4G6KH 1T5XA 4B0MB 4DT2A 2B3RA 4RIRA 1UT9A 2F08A 3HS9A 4L48A 4L2YA 2MFNA 4QGYA 5HGAA 5I71B 1IAOA 4G82A 3TF7C 1PX4A 3EYFB 2EC9U 1SNRA 3OKMA 1P7BA 5DJ2B 2D0HA 2VUYA 3S96A 3G08A 3MYJA 4XPGL 8PAZA 1LO2H 3BLBA 5ERWA 3REVB 5FGCE 2R8SL 3GMOA 3ME0A 4IRJC 5L0QB 1CK0L 4NZUL 3FC8A 4JFZL 4UUJB 4ONFH 1TTRA 5E7FA 3WEMA 3EO9L 2X6BA 4GO6B 1OARH 1JCVA 1IQDA 5FK9B 1EWHA 2HXAA 4ELKA 3ULVH 1OT1A 3VFUA 5C3LD 3L1OH 4CBZA 1T89A 3MGTB 3MRNA 4NRYA 4WW2F 4TL4A 2NQDA 4I0PA 2DBLH 4Y5XB 5MERA 1KIRB 3KM2A 1T2XA 5TTRA 1KB5B 4OY9A 3VI3F 2Q8BL 1Q0YL 5J3HD 2FBJL 1TZHB 1DANU 5JIIA 1WWWX 3BXNB 1MPAL 3HC4H 1I7RB 4JRWA 2V8LA 4G70B 3BH9A 2VDPH 4IIQB 4JFPB 5E6ZA 2O6DA 2WVVB 3BAYA 1A6VL 4Y16C 4YSPA 3WKQA 5C97A 4NO0D 5I76A 2YKKA 3IU3A 3N1MC 4HAKA 4WSJA 3AMKA 3MODL 4U4BA 2EKJA 1YMMA 3HLAA 1MIML 2GSGB 3QEGH 4OI8A 3IDGA 2PNDA 3DDGA 2YUVA 2J6EA 5GZNA 2X7LB 3BW9A 3LPWA 4NO0B 3KPSB 4DUVA 2OKMA 4NENB 3K2IA 5SWSE 4AGPA 2B77A 2CCLA 4L4TA 4E0RB 3A67H 4FP8L 5C0EA 2IXQA 3RWFA 3V5KB 3QBTB 3CMGA 4U3SA 2J73A 4P8QA 4JFUA 1XX9C 1C08A 2AJSL 3ULVE 1EDHA 3KM1A 1DN0B 1WYJA 2ZNXA 2O61A 2FX7L 5E8OB 1HEJC 4ADIA 2F7IA 5HHPA 3O6ML 5HGHA 3WFBH 4BJLA 3Q9QA 3CSPA 4FXTA 4FZEH 4LLDA 1ADQH 2GYSA 4PYHA 3IJ9A 5DVKA 5B21A 3LHPH 4NFDA 5FR3A 4ABUA 1Q9KB 4DEPB 1S9KC 3EYVB 2VZTA 3A47A 12E8L 4QRAA 3TO2B 1FVEB 3DOHA 5JOFB 1ANUA 2IAND 4P4RB 3H2QA 5JXAL 2VXUH 5HDBF 4W4NA 3OMIB 2GTZA 3QARA 5IQMA 3SB3A 2XRAH 1HESA 5TE4L 3MOBL 2W1NA 1JZ6A 5ILTH 3MBEC 1GKEA 2IPTL 5I71C 2OW6A 3E6FA 2V4LA 1VGKA 2H3KA 2IANB 1AFVH 4JM0A 5CKAA 4IBVA 1ULVA 3B2VL 4UQIM 5D72H 4LEEA 4DP4X 1AQHA 4PG9B 1NCOA 1B3JA 1TKWA 1TIUA 3Q44A 3RQ3A 3II2A 2P5PA 3BZ5A 4XXDA 3O4LA 1AC6A 4Z7NF 1ETJA 5AAWA 3PS6A 1NIEA 3PXHA 3RG1C 2B14A 5G5DB 2XFXA 4BZYA 5I6OA 2C5DC 5L0QC 2LW3A 4F7PB 3K74B 3EH5B 4DGVH 1ONQB 1VFBA 4GXFA 4WI0B 5EU7E 4AG4H 4WY7H 1PZ5B 4H5SB 1OP9A 4RFOL 4NZTH 1H8NA 1YEFL 2V17H 4G6MH 4UU9A 1XGTA 3O2DA 3HR6A 5D8JL 3R7QA 4B6ZA 5IQ9B 1F4HA 3NIFE 3D2TA 1CLOL 1QYGL 5LCVH 4N0FB 3CFQA 3N41B 2WTRA 3SN6N 4Y5XC 2PPAA 3ARWA 4X2UA 1NGYA 4JKNA 2F7PA 3CSGA 5FO2A 3P4NB 3B5TA 2IV9A 5H94B 5FA4B 5D6DA 2V33A 2R59A 4P59H 2L7EA 4IIQC 1K9TA 2A6KA 4OJFL 5K33A 4B9CA 1G84A 4EUPG 3AB0B 5DK2A 4YSDA 4B53A 4HS3A 4CKQA 1BFVH 3L17A 3QHFL 2ADGB 4N8VG 1JPTH 1AXSB 5J3HC 2VXTH 4YDJB 1Q9OB 3PHSA 3IDXH 4OFVA 4HGWA 1FV1A 3Q8EA 1SUJA 3QE5A 4HP5A 2HFTA 3CFIC 2IV8A 4JO4H 1N4XH 3OAUL 2X0VA 2GSIB 1AANA 1MWAH 4XNZB 3VGEA 4NS0A 5IVXB 2CO3A 2ZUQB 3L3JB 4OIFA 5A16B 2VRAA 5ALBL 3R06B 1EERB 1DFBH 1TR7A 3CDGB 2CRMA 3MU3A 1S8DB 5L4IA 1BXUA 3F01A 4XNUH 4KI5E 3U46A 1INDL 4H8VA 3E7JA 2W0FA 2XWTA 3HPLA 1WAPA 4DEPC 1VENA 1OSYA 3EOBA 1U2CA 4LHUD 5L2KD 2L8AA 2R0LH 3EKCA 4N26A 4Q9CA 4FA8A 4R97B 3LSOB 4RRPA 4EBQH 1EXGA 3IJYB 2GC7C 5FM5M 1OY3B 4BKLB 1Z0NA 1OGAE 4KQ4H 2C1PB 2ALWA 2R29A 4LHUB 5L2KB 1BM7A 4AH2A 2R0KH 4PB9H 2YA2A 4X7SL 1A4BA 4IMLB 2WLLA 4M3HA 4OZFH 4X6CE 4NP4H 1TYJA 2EYTA 3BRDA 4MXQD 1BZEA 1JHTB 5F3HB 5LNEA 2O4EA 2OTWB 1JWSB 2E6PA 3MLZL 2Q20A 5IB5B 3VAEA 2WXRA 1U8MB 3BUYA 3M1OA 1YSOA 4PAZA 4S1DD 2HX9A 3H9ZA 5GQBA 3ECWA 1UACH 3RWGB 5JQHC 3OKOB 5T1KD 3DKHA 2BINA 3O45A 4MNQA 4GW4B 4OGYH 1PCSA 1AQKL 2PTTB 2I69A 5AG9A 2MEJB 4ELMF 4YHZL 2Y0SA 1OAQH 2J8UA 2V7HB 4HUUA 4WHTB 4KO9A 2F5AL 3RKPA 2QFPA 4G8EA 3L4YA 1YNKH 5EOCH 5AW2B 5BV7B 1A3RL 3N42B 2BOLA 3D4GA 3GI9L 4XR8C 3SBWC 1TYRA 4HBCL 3KPNA 4FABL 3OG6B 5KG9B 3GMMA 4KO6A 2CR0A 4HJSA 3V9FA 1GW0A 4O02B 4TLSA 4PWJA 2NUTB 1NZRA 3GBNL 3HMXH 4YIQA 3UDWA 1ZA3B 2EKSB 3P3SA 1QLRB 3WJMB 5CJ8A 3AB0C 1AGEB 1A9EB 3ZDYF 1FG2A 3GMLB 4W70A 5C9JA 4AQOA 3PLYA 1U8CA 3BVVA 1RJLB 2HG5A 3ATFA 4JKPL 3N0PB 4XNXL 2X88A 1QFPA 1UWXK 2A73A 4YGVA 4QRPA 1S46A 3GLEA 4LIQE 3H3BC 5EFIA 3WXWH 4NQDE 4HJJL 2W5PA 2AS5M 3LRLA 3UP6A 3HJ0A 1DO6A 1A25A 1RU9H 4XNZC 3V4VA 3ZE2B 4XO8A 1N7MH 2ZUQC 4LSSL 5FW7A 5C9KA 3RU8H 3R0NA 5IHZA 3QH3A 3SQRA 3QAQA 3HNTH 5E7BA 2APSA 2R2BB 3QS3A 3VGGA 4LPXA 4OM1H 1WC7A 3GS4A 3TN0A 3D0AA 1ZT7A 3GZOA 2XFGB 2P5WD 3H0TB 3ULUD 2C9XA 1KIUA 1KPUA 4CVXB 3KLAB 3UAEA 5BXFA 1WCBB 5CSZA 1CGUA 1DJHA 3KWTA 5KYYB 2V9UA 3DV4A 3L2LA 3MREB 5DJ8B 2P5WB 4R97C 3ZDZB 2EINB 3G04B 3IE9A 3WY1A 1XEDA 3KEDA 5AZEL 1EZVX 3QQ3A 2C9UA 3KEHA 3OPUA 4N28A 2DQHL 2NMSA 4Z3JA 4DKEH 2OX5B 2ZXGA 1YEDA 3CX5K 4KO5A 3FF7A 5DHMC 5CAYB 4A6YH 3P9MA 2I24N 2F74A 2YD2A 3MCKB 1XVSA 3O3BB 1KXTA 2VDRH 4MLIA 4GPVA 2P49B 3LRSB 5JDJA 3NJHA 4AOFA 4BEIA 5JUEH 3QDJD 5DYFA 3B56A 2X4SA 2J55A 3ZGIA 4MXQC 4NO2B 3VWJA 2BNQD 1T04A 4FTDA 4OIAA 5AW4B 3CX2A 5IFHL 2G9HB 3QCTH 2Z6FA 4NKOB 4LARL 4XPFH 3SBRA 3QDJB 1I75A 4F58H 1SDDA 1O75A 4S1DC 5F6HJ 2MHAA 2X89D 1PCXA 2P1YA 4GAGL 4OCYH 1E5YA 1Y07A 2BNQB 5TDNB 4M8QB 3SCMD 5DWPA 3MLVH 4Z7UB 4D94A 5EC1A 2F5BH 4MTMA 5BV7C 4MQSB 1BBJA 3CVHA 3FUEA 4XVSL 4X6DA 4GAAA 1U8PB 4GAJH 1NOAA 4GIPD 1MHEB 5EN2A 1CLZL 3GBDA 3LHAA 4L37A 5CJOH 3W11D 3SCMB 1XTMA 1CLYL 1EJOL 1HH6B 2NY6D 1N18A 5BZWA 3GSNL 4XN1A 1UD5A 4JB9H 1QATA 3QDGE 1EHNA 5ID0A 4W9DC 3EH4B 4UT9H 2JCCB 4X9GA 2NY6B 4GQQA 4L9LB 4TV3A 4XVTL 3OJDA 1DZ0A 2XWCA 5EU5B 2GITA 2WO4A 5E8PB 4AYSA 1MFMA 1SDAB 3EH2A 4I0KA 1X7TA 1PSKH 1JD7A 4JPQA 3JV4B 1YEEH 4XNYH 4KHTL 5HGGS 3H9SA 3MLWH 4GG8A 2N7SA 2ZAGA 3FQYA 2PXYA 1KJ3L 5JW4R 3MBXL 5EDXA 4U1SA 5IV2B 4YDVA 1YEIL 3HG0A 5K9QG 5AOJA 1K3ZA 3ARFD 1DHKA 1UM5H 2X70B 2HRHA 2EDMA 2WINB 3I75A 1RPKA 1L7TH 3F84A 3N85L 3AXLA 4ODUB 2VL4A 3GS7A 4GG6E 1WEJH 2WANA 1T20A 3ULUC 3OX8B 5CSBA 3ARFB 3TNNA 2O1AA 3HUJA 3ULSB 5AD0B 3P1VA 1CZ8H 1BAWA 2C9PA 4G9FA 1VJSA 4KITB 4UQ9A 4DKTA 2WTOA 1IGIL 1MI5E 1UD3A 2W80C 4Z0BH 3BT2H 4MA7H 1K8IA 4JL2A 1F97A 1MNUH 1YECH 2J56A 2VITB 4JDZA 1M6OA 4MLSA 1OVZA 5FUOL 4NQDD 2XT1B 3MHZA 4Q0XL 2DEWX 2K3TA 2EXWD 4PJ9A 3RYMA 5E94A 3TA4D 2R4SL 4IRZL 1SQMA 4LSVH 1PZCA 2ZXAA 1J9TA 5F7WC 1EGJL 4NUGL 4D0BA 1MHCB 1A0QH 5KJ4A 5AKSA 3VXSA 2ZWKA 2DV6A 1E9PB 4J28A 4QXWA 1D7DA 3ZPDA 1KLGA 5FIEA 3D7PA 5C0FA 2WO3B 3HOGA 3TURA 4FFYA 1LK3L 3VXMB 3VRIB 1MRCL 2XC8A 3BRFA 2RHEA 3NYKA 3I9GL 1AIFA 4YL4A 1NJ9B 3OB0H 2MQGA 4N2BA 3SCMC 4K8RL 4Q2ZB 4JHZA 3MLSL 4NRXB 5GS1B 1UWFA 4PJIE 1IGTB 4Q6IB 2GJ6E 5D2NA 3ZKND 4WUKH 4LCUA 3CH1A 4KO7A 3DX6B 5E8NA 4D8OA 4CVUA 1JK8A 1TG8A 1U9KA 2HJLA 3G5ZA 3A24A 3IDMA 4N2AA 3W11C 4G5ZH 2CBOA 4EOWL 3U0WH 2NY6C 1OTSD 5CP7B 2X87A 4L9LC 2YOCA 1Y18B 4P9MH 4UT6H 4ODTL 1NLBL 4XGZA 3IWVA 5DQ9A 3DVIA 4GW5B 2F9BT 4UNUA 1J1XL 4XE5B 4MDJB 3KVDD 3DHPA 2HN7A 4I5BB 5SX4I 3U7YH 1FZOB 3BMVA 3TJPA 1HWGB 3FOLB 2ZONA 1FO0L 4R7XA 4BFJA 5ABZA 4H88H 4KZCA 3B9DA 3BKMH 4Y7MA 5F9WB 4N0UE 3RVXD 4U0QB 2KQMA 2AJXH 3WAJA 2Z8VC 1AQMA 1OAKH 3EO0A 5ICXB 4OAWA 3BUPA 3GIVA 4OQTH 3OQRA 3SKMB 3U6XS 4BWTA 5GGUA 3VTMA 4FKEA 2A9MH 4XN4A 5FGBA 4CNIB 4A7VA 5EH1A 1URZA 2NY0D 2NNFA 3EDFA 1W0VA 3L4UA 3VJ6A 2CUMA 3ARFC 2C3HA 5DZPA 3WTYA 3TEYA 4XP4H 3BUIA 1ZSDB 2R2HA 2R2CA 2NY0B 3ZHNA 5EEUA 4HULB 1G5AA 1M7UA 3LS5L 2ESVE 1TJXA 2DKMA 3V0DA 1HSBA 2BS71 3K8KA 2V5TA 2A1WH 1OM9A 1RK1B 3UC2A 2IH1A 4RISL 1JZEA 3BKCL 2VLRB 3CH8A 4PB0L 4X5QA 2K8QA 1U42A 2RJMA 3B2DC 1G7IB 1J0IA 5EZIH 4R84A 1XSOA 2EXWC 3CXDL 4N2FA 4F8TA 1MAML 2FATL 3TNMB 3PWJA 2QSTA 4IBWA 1Q94A 1SYSA 1UM4H 1VESA 4P23A 5E9DA 3WFDL 3HKZA 4TTDD 3GSQA 1GGCL 4N2OA 2WXIA 4XAWH 1TCRB 3D0LA 4KVCL 2OM5A 4OVVA 4QRSB 5EIIG 1II4E 3PV7A 1TXKA 4MNGE 2FWUA 3S4SG 1WSST 1JYNA 2B3IA 2D7QA 2X4NB 1FFPA 4TOYH 1IBZA 1QHPA 1U2YA 5B7EA 5GS1C 2FIKB 5HYJD 3WFEL 2ZXEB 4Q6IC 1DBKL 4OZGB 5JOEA 2OR9L 4AC2A 3UCRA 3Q2WA 2ZKMX 3D08A 3PWLB 4PIRF 4PY7B 4TSBL 5TGBA 2Q7NA 1LILA 1V7NH 3RIFK 4HZLB 2FEDC 5HYJB 2G4EA 2XN0A 4HWBL 4OLEA 4YGAB 3ZKNC 4BH7A 1BAGA 1NIBA 1YJDL 5DUBA 2XBZA 1H6FA 3AUWB 1KF9B 4L8DB 2VN6A 5F7HA 5KBPA 3ARGA 1OTSC 4J12A 4RNRB 5K1JA 1JJUA 1WK0A 5AUMA 3MJ9A 4AVIA 4GP8B 1IAKA 4JCLA 5AVWB 4Y1AD 3GK8L 4AIEA 2K6YA 2WNXA 5BUGA 3F2LA 1IO4C 4QOKE 5ELIA 3S7GA 1CK0H 4QKXB 5F9WC 4NZUH 3IMSA 2Y1VA 1M56B 4JFZH 1KBPA 2YD9A 2VABB 3PGFH 4JY4B 5ITBH 3N6YA 1J11A 4Y1AB 4P49A 1L9OA 3MX0A 3TLRA 4PRDB 4PEEA 3BT0A 3RVXC 3ZLQC 1FAIL 5D5ME 2PW1B 4O00A 2V3FA 3FUDA 3OWRA 4P46D 4OIIL 3VGAB 4ATWA 4R96B 4CSPA 4C57C 4X4XB 2D8KA 3V0VB 2LR4A 2Q8BH 1Q0YH 2Y1YA 4PJDA 3L45A 5CBEB 3NCYS 3LCYA 1QSFE 2NY0C 5F93C 2C9VA 5BOPA 3QG7L 3DX0A 1A6VH 4KXAA 3ZU8A 1MJ7L 3GZPA 2I07A 4PRAB 2OSWA 4RZKA 3CNKA 5LNGA 5J1AA 1N0XL 2ZCLL 2QR0B 2VR5A 3AY4A 1MIMH 5HHNB 2HWZH 1R3KA 3TIEA 4NQSB 2YN3A 2BVQA 3I84A 2G3NA 1UXLA 5CZRA 3HNSL 4BSVB 2APFA 4F91B 2FJFA 4FP8H 4FQXD 1JNNL 5KAQF 2N56A 4HXAL 4LAJH 3UEZA 3I3BA 5JA9A 3E1ZA 5CFAA 4RBPK 1FG9C 1WITA 4M4RB 4FG6D 4XOCA 1Z9SA 2AJSH 1R3LA 2EDJA 5I74B 4FQXB 4GUQA 2IBZY 1ZCRA 4E36A 4PWHA 2D3VA 2V2WA 3ECUA 3EHBD 2D31A 3LB6D 5JW4M 4OB5H 4J3OF 3PXLA 4KKNA 4OH2A 3O6MH 3SIKA 3QR1A 1XCXA 2HAZA 4KXCA 1KCSH 4JJOA 1IILE 1VADB 2EEBA 4TTDC 4LPCA 4KVPA 4POYA 4X99B 1ZDQA 1AGDB 1U95B 3EHBB 4JX0A 2VJ0A 2LT9A 3CTTA 4Y8DC 4GSXA 1O7SA 3OV6A 4QRRA 1YLBB 2ESVD 1D5MA 3V6OA 1EBAA 3AQXA 2JCWA 3ZR5A 5TE4H 2LTQB 5ACZA 1G1YA 1NMBH 5HDBB 4U6VH 3GMPA 3QK0A 2VM3A 1LO0H 1S7QA 1NIAA 2ESVB 3GF8A 5BO1L 1TO5A 1G6RB 2YPVA 3F58L 4HS6B 4YN3A 4W9FC 2OL3B 5I1EL 2YEQA 3B3IB 3SY6A 1M1XB 1F18A 2W9EL 4LCYA 5B38G 2VW7A 1DZBA 5BW7C 1CDGA 2WLKA 5FOJA 4D7PA 4MHHG 5D7IB 5KSBA 5FKAA 2BFGA 2YR3A 4Z7NB 1M2VA 5BOZG 4GKSA 2CMRL 2ITFA 2FZ3B 4F2FA 2FB4L 4RFOH 2MCPH 1BYNA 1TTGA 1YEFH 3KWVA 4LVNB 5T5FA 2Q76A 1AZVA 5ACLA 1CLOH 1CFQA 2OCCB 4IBYA 3CHPA 4DK5A 5CMAA 3VGAC 3QXDB 1IBBA 3D85D 3WKNA 4N3TA 1WUZA 4XXWA 5I2IB 4OCMC 3S88H 4U1JB 5ENWA 1SOQA 1P2CB 3SJVE 2OMUA 5JW3L 1T2JA 2XQYA 1RIHL 3BWUF 3PUCA 3W9DA 4ICXA 3D85B 3WTVA 5E4OA 3KWWA 5JO5B 2Y07H 1RCYA 4QTHB 1F86A 3QHFH 5D1XE 4U1LB 1RP9A 2X1PA 3ZL2A 5JZ7C 1I3GH 1K6QL 1EFXD 4BFNA 3H6AA 1UOWA 2BHFA 4X7TA 1IC5L 1ZHKB 4R7NA 3CZFA 3LRHA 1RMFL 1KGJA 3IJSB 1XR9A 2WLJA 5IMLB 4QO1B 1TJIL 4JPVL 3CU1A 4QOKD 1P1VA 1BZQK 3LPGA 1EFXB 1F6LL 2AXGB 2IJ0C 5AOZA 5ICYA 3UG4A 2YC1B 3AC0A 5ALBH 1W2KT 4JPKH 1F1GA 1QEWB 3QJTB 3RWJB 3W1ZA 4AYEC 2V8MA 2QKIA 4EJ1C 2JELL 5I74C 4FQXC 1G87A 4QOKB 3L3KA 5TQ0L 1HILB 2QLVB 3I6LD 1YHPA 3ZQ9A 5DEGB 1A6TA 3STLB 2UY6A 1MFBL 4R4FL 2YOAA 3FSVA 5I8CB 3CZEA 4FG6C 3QJFB 3WEXA 4G7YL 2AXHA 2BNRD 5HHOE 1HH9A 2JLPA 3VXRE 5DI8A 2WLZA 3LB6C 3EHBC 3UBXB 1E4XL 3Q3GB 2IQAA 2P42B 1RJZB 5F1OB 1ACYH 2DQUL 2NDGA 3LNDA 2ED7A 2BNRB 2LTQC 2JF1A 2VDQB 1XF4A 2VQ1B 4X7SH 3QUMH 4N2MA 4HS8H 4S10A 2HKHH 1KPRA 5IBTH 4GFTB 1G7JB 4I9WE 1G7PB 1NGZB 1UXSA 1ZS8B 2XG5A 2X2HA 1OTUD 4OLUL 5J9PA 2DLIA 2NTFB 2DMKA 2LVCA 1YY9D 1JZIA 5D71L 1X4YA 2EVJA 1QFUH 5F7LB 3S37H 1TLKA 1TVDA 1KWKA 4B3VA 1O7DC 3HVNA 2BNUB 1URIA 2ZG2A 2AFNA 1AQKH 3DRTA 4M7KH 3DXAE 5EPMB 1V54B 3L3GA 4YHZH 1QO3A 1K2DB 1YZZA 1M71A 3QNZA 4HJ0D 4LVNC 5CHNB 3S35H 4EDXA 2F5AH 1ZLVK 4WLCA 2FL5B 5DVNA 1U92B 1LWHA 2Z1PA 3CLEL 3EW3B 2WCGA 1B6DA 2JVUA 3GI9H 5GRWA 4B41A 4UQ2B 3F3HA 4HBCH 4XVJH 2ORBH 4FABH 1ECZA 3BO8A 4DZ8B 1DQJB 5CJBA 4YBHA 2J1YA 4J4PC 3ZZ1A 1ODAA 1ZE3C 2R0WL 3GBNH 3UJJL 3M7FB 4NJ9L 1WS7A 1SEQH 3CU7A 4NZFA 1DQTA 1X5YA 1ZWIA 2D2CC 2C1OB 3O2VL 4M4PA 4XMKH 3KNBA 3RX7A 5I8EA 2YAOA 1JXFA 4JKPH 4AK2A 2OR7A 2LU3A 3ZDYB 3SE8L 3T3PB 3MRIB 1GTNA 2AHIA 4BK4A 5CWSA 2OMZA 1R5VA 2VLMD 5DLML 1VRSA 2R56H 3D25B 4AMKL 3NK3A 4UMSA 3JTTB 4LSSH 4TPRL 5FYJL 5CEYA 3DJ9A 3MR9B 4CU8A 3CQQA 4G8FA 4GKOA 5BS0E 3HMWL 4HCRL 1XAKA 1FZJA 1JUFB 4JKWA 4OUUB 1SBSL 4LCIH 2RAMA 4CU7A 5GSVB 1JXDA 2DLFH 3GRWA 4X6BB 2H47C 1E90A 2OV0A 1N5AB 4RDQG 1XGQB 3UGXA 4F27A 2CG9X 1KTLB 2BZCA 3OLIA 4N25A 3BD5A 3B34A 3DSFL 2IFFL 4FFWC 1XH0A 4OZIF 4JBSA 5TD4A 1JPEA 2COQA 1ZS2A 1LE9B 1KBWA 1LVEA 4WI6A 1ED3B 5H35B 5HGBB 1SF5A 1BVOA 2V2TB 4OT1L 3ZK0A 1GXEA 1W8NA 1L5GB 1RJYB 5C0AB 1A4KB 3L08A 2H6OA 4NZJA 4HF5H 1AMXA 1EDQA 2GJZB 1MG2C 3L5XL 3QYCA 1E5UI 1JP5A 3AWFA 1TJHL 2HT2D 2LV4A 1JHLH 3QEQD 3DI2B 4LDLB 4N2LA 3C5JB 3P02A 4QKTA 4QI3A 4FQCL 1UA6L 2J2ZB 2YKLH 4R7VA 3W39A 2VQ4A 2X4OA 3I6KA 3BKYL 1JG9A 4RRPM 3I6GA 4PTTB 3QEQB 4LARH 3F04A 3KLQA 1YY9C 4QJ3B 1VSCA 3MJ8A 3OLEA 2O5XL 1QW8A 1Z9PA 2IDCA 1NANI 1U8NB 3TBSA 1C16A 1U93A 4XP5L 1ZIAA 5DS8B 2ICEA 2WZ6A 4RGND 2ID5A 1PQZA 4S2SA 2ISDA 2CJ3A 3KZ8A 2RBLA 3JWNG 3KPOB 3UTQB 4N20A 2VQUA 4H7VA 3V0GA 3VXRD 4HJ0C 1QLFB 4IYKA 4P5KB 5F97E 1EJOH 2Z35A 4RGNB 3GSNH 3RWEB 1RZJL 1NC2A 5EDSA 5L8JB 5A6IA 4TNFA 3VYOA 2FWOA 5EORL 4MMZB 1PKQB 5MEPB 4JRYA 4Y2DD 3FHQA 4BRVA 4C8XA 3T0EB 4OZHB 4E41A 4NKDA 4BFIA 4KTGA 2XG4B 3GBEA 3RNKB 4PJHA 4ODWA 4Y2DB 1E28A 1ZJAA 5G4OA 5ISZE 4P2RE 3EJSA 4I85A 3PNRB 2XN1A 3L95A 3OWEA 4I4WA 3LIZA 5C1MB 4IQHA 1V3JA 4Z23A 4BZ2L 1KJ3H 1YMHA 4UQDA 1HI6A 3P9LB 1IVTA 1YEIH 4JO1L 3FRUA 3FO9B 4J3OG 3TFBA 3MRDA 4M7LT 4HIXL 2UY7A 1AHKA 2VDMB 4U6HB 1R75A 3UOAB 1UVQA 4NBYB 2Y7SA 7PAZA 3PP4L 1AKPA 5DHVB 4AENA 5TFSL 1DBJL 2YFNA 4PBVC 3H3PL 4RZCB 2ARJB 3ASWA 3KPPA 1FFTB 3P9WB 3QDMA 1J9CT 1KCUH 4GT7A 5DRZA 1H3GA 4Y4FA 1Q72H 1P9MC 3QHZL 5GGVH 3FONA 1LD9B 4J8RB 2YAFA 4KY1H 3V52L 4YX2H 5D4JA 3RY4A 2DM3A 3DV6B 1K4CB 3T1WA 2DM7A 2CBPA 1RZFL 3FOMA 4OCLC 2FJHB 4JFEB 4PJAB 4RRPG 3O0RL 4X4ME 3U2JA 3QULB 1A6AA 3AG4B 1ADQA 3A23A 4WFHE 5C8JA 2R4SH 1EXUB 1I8KB 4IRZH 1WAAA 4YUEH 1UKTA 2PYEE 3WMSA 2HT2C 2EAEA 5CJXC 2B0SH 4IBTA 1ZGLP 4NUGH 4LRNL 5GJSL 5HTSA 3BRGC 5EN3A 1BVNP 2E9WA 4PHZA 3MO1A 1C5DA 3KLDA 4ZTPH 3DX9A 1EXHA 1KTRL 4D9RE 4MQ7A 2H41A 1LK3H 4PJXB 1CG9B 1MRCH 2QHLA 4DN4L 3V6BR 1ZLUH 5JDSB 2RCSH 5AG8A 4MA3B 5TE6L 1KACB 3L3HA 4K8RH 2JWYA 2WYZA 3FTSA 2RFXA 4TM9A 4WK4B 5IUSA 1LMIA 5JHDA 4D0CA 3TBVA 1QWUA 1S9VA 4RGNC 1FZMB 4XX1E 1D3CA 4K15A 2DBJA 1GPOL 1HXYB 3B2PA 5FLVA 4MMZC 3UTTA 4EOWH 3V5HA 1M7IB 1UGNA 2FJSA 3FFOA 3OZLA 5IQNA 2ZX7A 3VGFA 3T0EC 43C9B 4B50A 1JGDB 2ATPA 3OC8A 3D09A 3DX4A 4MXVE 1I4FB 3EJQA 3VG0L 2H1LM 4WFEE 4HUCA 5LCVA 1TQVA 1JWUA 3C8DA 3KGSA 3VMNA 2D7PA 4Y2DC 4KK6C 4LCWE 2X6MA 3WFHB 4FTVA 2CDFB 1NFDA 1N26A 1USQA 1FO0H 3HCVA 4XN2A 1OE2A 1OCWL 2DJMA 3W0WE 2VXQA 2AC0A 3GLZA 4A7GA 3T1FA 4GXVL 1AE6L 3U9WA 3TBYA 4YHLH 4UV4L 1Q9LB 5A2KH 4AK1A 1WA0X 4LPWA 3RILA 3DHJA 4AQ8A 1QASA 4F9PC 4FI7A 5DQDL 1NCDL 5I0YA 3HEIB 4TUOA 4I18A 3MTRA 4MB1A 2MCAA 1WIOA 3TA3D 1S7VA 3DROB 3GMRA 3SPHA 4NWUL 2YGNA 2FR4B 2OYMA 1A22B 1P5UB 1FNEA 1DQQA 4PI2A 1ZLEA 3P0YL 1MCDA 1MLBB 5GJTH 2QHRH 3WGUB 1E5AA 3UPCA 4X98A 4OJCA 1MWAA 4PRIE 4XNBA 3TA3B 3L6FA 3GXPA 3G5VB 4XB8A 1A3QA 2WXLA 1MCKA 1OSEA 5K59F 5T1LA 4JRXE 3LS5H 3OJMB 3CDCA 2NX5D 4LPUA 4PI0A 5D7LA 3T2QA 3VCLB 4I48A 4WNQB 2A9NL 2YK1L 4A7UA 4HH9A 1XO8A 5IWLC 4Z78B 4RISH 1UH4A 2CXGA 2NX5B 4PB0H 4ZMZA 4M7LL 1DJZA 5ISZD 3LQZB 4P3WA 4JS7A 2AV7A 3QXAA 5JR1H 1RFDL 4OKVB 4DFHA 4ZDHA 1N6QL 4R6UA 4A2GA 1YN6A 2XVGA 5GHWH 4AW4A 4A39A 3CXDH 4ZMPA 4PG2C 1OXYA 4WU7A 1MAMH 2FATH 1CPUA 3CZGA 5ALCL 1MH5A 5HHME 3RUGA 4EI5A 2GB2A 4O51A 3QR0A 5DZVA 3JVGA 4Z7IA 4ZUUA 1GGCH 3GINA 2VZ1A 4L4VE 3K0WA 4OZFA 3C6SA 4X8CA 1JWMB 3L7EA 4QHKI 5M95B 4DH2A 1Y6KR 3AY2A 1P5VB 5FUZH 5A3ID 3WFEH 2IAMA 2OR9H 4DEWA 5E8EA 3QEHA 2LVEA 4E9YA 1R3HA 2WVTA 3BN9D 1CF8H 1YNLL 2GY7B 5KANI 3NZ8A 1K8DB 2YQ2A 4N2IA 3PPSA 4HKXB 4S11A 1TJGH</