5LLIC

Pvhl:elob:eloc in complex with vh298
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
141
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Potent and selective chemical probe of hypoxic signalling downstream of HIF-alpha hydroxylation via VHL inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 31
structure length 141
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2016-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 5lliC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 5lliC01
4W9DC 4AJYV 1VCBC 4W9EC 4W9GC 5LLIC 4B95C 4W9HC 3ZRCC 4BKTC 4W9CC 4W9IC 4BKSC 4W9LC 1LM8V 4WQOA 4W9KC 4W9JC 3ZTDC 3ZUNC 4W9FC 3ZTCC 4B9KC 1LQBC 3ZRFC 4AWJC
chains in the Genus database with same CATH superfamily
3V4PA 1G7QB 4P4RB 1HHHA 4FABL 2CD0A 1NPUA 2BIHA 2I07B 4A6YB 3D07A 5FYKL 1NPNA 1C8QA 2BP3A 1XCQB 2A6JB 5KG9A 2XWRA 5A7BA 5AZEL 3WN5C 4ZQKB 5FOJA 4WZ9A 3SKJH 4JCLA 2XOTA 4F7TA 4X6CA 1PZ5B 2W92A 3DOSB 3NA9L 3POCA 3NSXA 4U05A 3FQ1A 3MRQB 3OAUH 3SPVB 5EO9B 4KJPC 2HCZX 2B2XL 1RULH 2PO6B 1PDKA 43CAB 1ZDSA 3ELQA 4UTAH 2YAOA 4OUUB 2FWLB 1OT4A 1ADWA 4EEEA 1JG9A 1J9SA 3F62A 3X2QB 4KZEH 4G7YH 3TIDB 1IGTA 3RJQB 1CXFA 1XAUA 4ZOBA 5IW3A 3GI8H 5HHPA 1LO5B 1GVIA 1GGBL 1W8EA 1EHKB 2DEWX 3H9YA 4N8VB 4YHIA 3KH4A 4JFEA 4OSUH 3BKYH 2GC4C 4E9RA 3HI1B 4U31A 3LVTA 4XHQA 3PNWB 4P5TB 4OJEH 1SGKA 1NC2D 2CCWA 3U4AA 3UAJD 3L2MA 4GQZA 4N2MA 1JVLA 1R3JA 4PIRF 2CBTA 3MODL 3IF1A 3F7KA 1SJHA 1T1YA 3QHZL 3B56A 4RDQG 5EC1A 2V2TA 2IANE 4G8EA 3T0WA 4JX0A 1CMOA 3BDXA 2G9HB 1RJZB 3KPRB 3PFQA 4LLQA 2BM3A 1BX2A 4H26A 2LTQB 1QQDB 2AJZB 3FUKA 4NPYB 4QDGA 4ZD3H 1A7QL 1MRFH 5DJCA 4ZW7A 3T0ED 4JHUA 5DLLA 4K7PX 3H8NA 3ES6B 3N91A 1LE5A 3CZFB 4CVZB 4JQIH 3A67H 2DLIA 3LN4B 1YN6A 4WI8A 1HT6A 2X12A 1JDCA 2J1YA 5TPWH 3UPCA 5F3BB 1YC8A 3L9YA 2CR3A 1A3ZA 2J6EA 4KAQL 4WU7A 2JMRA 3HC3L 4FOMA 4NS0A 5ISZA 1E3ZA 5HYEA 4R26H 4GW5B 2OMBA 3KXFE 1YY8A 3CHQA 2ADJB 3H3KA 3Q01A 4NNXA 4DPRA 4XZUB 1QLFA 3F12A 3LKSA 3MV9E 4Z3FA 4X42A 1G7QA 2G75A 4UOW1 5GGTA 5IHUH 1NZRA 3WNPA 3EJUA 3L3DB 2OJZH 1WC7B 4LHUA 1M7XA 3VQMA 2NY6B 3ML8A 2ZZUT 1F4WL 1BMWA 3PP4H 1NEUA 1IEBB 5E4EB 3CDZB 3QEQD 2J88H 3UYRH 4GXFA 5TFSL 4K3DL 3O41A 3RKPA 1T3FA 5BOPA 1XBDA 1OT2A 1NBYA 1BM3H 4F5CE 2WUCH 3BH8A 2VN7A 1F2XK 4YOKA 1FUNA 3OKEB 1R0AL 1DVXA 4TKWA 1JNNH 4PYGA 5AW0B 4FLQA 1PLAA 4AGQA 4UBDC 2JV6A 4V2BA 4CILA 2C7UA 1RL1A 2OM5A 4MD0A 5C0ND 3QIBA 3MLSL 1ICTA 4K94L 1SXZA 4FCAA 3RWDA 5F3HA 4GO9A 2ADFH 3TESA 3MN8A 1OB1B 1S7QB 2V5YA 3S5LA 1QSVA 3HRZC 3IXAA 5IQOA 1CVSC 4ZTEA 3BLKA 3V6ZB 3BDYL 1F42A 3VXUB 4XOEA 1NFDB 5AAWA 4WSGA 1ACZA 2RA1A 3VXRD 5DC4B 3IMTA 4X6DB 5FEBA 3M46A 4MXWL 3PNWA 1SVCP 1OTSC 1XIWA 2YGNA 5T1DL 1AY1H 5KYXB 1IBDA 5EORH 5CD5D 1X5XA 4L4JA 3VD4A 5L4MA 5KVDL 2B4CC 1SRDA 1GGCL 3FO0L 5D7JD 4YIQB 1AE6H 5B1CA 2OCCB 2C9AA 1L6XA 1BJMA 2ATKA 1DJYA 2GJRA 1CYGA 3K0YA 1U36A 1QD0A 1RJZA 2G9HA 5D96B 1A4JB 2PYFB 1UHVA 2HRPL 3BQUC 3P30H 5C0RL 3TA3A 1DVZA 3WNMA 2BIQA 4FQXD 5HI4D 1KUMA 1J11A 1G7PB 4PHZA 3PWNA 1SDYA 4UT9H 3JUZA 4KTGA 4E9YA 5ESVA 4N8VG 4OAWB 1IAKB 4GW5A 1OW0C 4FQHA 2ADJA 4XCFL 2AI0H 2O6CA 4S1RL 4Y2DD 5E8PB 3B34A 1FGVH 2PETA 2R1YA 4D2NA 5BNXD 3WY3A 5JXED 5J1SC 2P44B 1BYNA 2OZ4L 3OPUA 4QYAA 4DGVL 3UP1A 2NY3B 2K4AA 2XXGA 2R2EA 3PGCB 2DMHA 2XVBA 4U4BA 4F8TA 3K74B 1EGJA 1QZNA 4ZMYA 1I8AA 1EAPB 4M56A 4JGHA 3PXLA 3GSRB 1QTPA 1XSJA 4G1EA 3VGHA 4M3JA 4BQCA 3BZ4B 4ORGB 3JTSB 3FO9B 3QDMB 1X5YA 2PTTA 1J48A 2GFBA 1K4DA 2HH0L 4GMSL 4K71B 3VFGH 4JHVA 3BD5A 2K8QA 4R0LA 2R2BB 1W80A 2OV0A 4QEGA 3VACA 2EECA 1BVNT 2BHFA 3M8OH 2DJ4A 4TVPL 1G7IB 5E6ZA 4UNVA 5JW5B 3MUJA 4K5LA 4MBOA 5LBVA 1ND0A 4F2ME 1XR8B 5LQBH 1LEKA 2D9QB 2ZOOA 1RCYA 5HGAB 4CU8A 3W82A 2QSVA 2C9XA 4FABH 2IBZX 1PZ2A 4G8GA 4WCYL 1IBGL 5FYKH 2IMMA 4KXZI 3UAJC 1S7QA 1UZ6E 3GC3A 4UV7H 5HHQA 4EZLA 2Y36L 3O3AB 4KDTA 2O5YL 4LT7A 3ATFA 1BIIB 5H4YA 3PUUA 3H2PA 3QCTL 3WIAA 2QHRL 1NFDA 1BMZA 2GC7C 5GRJH 1FNGB 1IBBA 3NA9H 5I1DA 2XIDA 2C7FA 4WO4C 2IAMB 3WY1A 3QFJB 1OSPH 2E56A 5EU3A 3T0EC 4OCSH 2LFEA 3IGAB 4IRZA 2H0FA 4HUXA 2IPTL 3U82B 3GHBH 4TTDD 5JHDD 4N1EA 1M3JA 3S36X 3VXPA 4PAZA 3O4LA 1HYRC 4ZAKC 1A4JA 5IESH 3OLEA 3WY4A 2WCGA 4RZKA 2V7NA 3BMWA 1GGBH 2XV0A 4WFFD 4HAFA 3Q8BA 4H5SA 1V8HA 5CJXA 1BJ1J 5SV3A 5KVFE 4KX8A 2VSMB 4N1CA 5HJ3B 5J1TC 4GRWF 4G71B 1G7PA 4KUZL 4NCDA 5KN5A 5ECJE 1U8JB 1UG9A 5MEOA 3B7SA 5EBLA 5JPMB 3QQNA 4KZDL 5E6ID 4M61A 5PCYA 3MODH 1JAEA 2BVUA 1E2ZA 4UB0H 2IC2A 1ACYL 1UH3A 5D7KD 1ADQL 2GJ6E 2X2IA 3GNML 3KJ4B 2EKSB 2WWOA 3C2AL 1SY6H 4OFPA 1X5FA 2ED9A 4K5PA 1VFOA 3PDOA 3Q8FA 4GXUN 1CCZA 3C5ZB 1A7QH 2X3CA 5IMLA 3JZYA 3V7MA 4ZZKA 1QSFA 1NJ9A 3ZDXE 1AHWA 3HN5A 4PLKD 1X5JA 2DQUH 1MVFA 3HBZA 5IF0B 5F7LB 3JTSA 3VFWB 3RVTD 3S5YA 2E9IA 3B9EA 3OAZH 3HC3H 2VZTA 2QEJA 1GZQA 2DQMA 2K3HA 3B7YA 4JRXB 3CZJA 1PKQA 3IDIB 2FX8H 4IKLA 3D69B 4BJLA 3UMTA 3L4VA 3WAKA 3EO1B 4P9ML 2AERT 4HUUB 4Y4HB 5C0NC 4IJ3B 2LLLA 4QRAA 2VR6A 3CFDA 3INUH 2XKNB 1XF2A 5K9OA 2X1QA 3D6GA 3MLWL 1G7IA 1JUFB 1HQ4A 2CK0H 3IDNA 3SODB 5IHZB 5GRVK 1DDHB 2MJWA 5HGDB 4L1LA 1W72B 1T0PB 3GS4A 1G7LA 2AMUA 3ZZQA 1MSPA 3BEWB 3PDGA 1P9MC 1KIPB 2BCKA 2RB8A 3SKOA 4JS7A 4AYID 5CD5C 1D7FA 3TBVB 5HYJA 1EO7A 3AQZA 1F4WH 4HS3A 2OR9L 1P6AB 2Q86A 3V0EA 4J23A 2BSSA 3Q2CA 4NZRL 4QOKB 3UBXA 3LSOB 4K3DH 2IAMA 1KFGA 3VNYA 1ZLUK 3ZDYB 2NUPB 2P45B 3AGWA 2P8MB 3C6SA 4R5VA 4PGZA 2ITFA 1R0AH 3N55A 3WKNA 1PEWA 2XN1A 4EUPB 3HKZA 2H3KA 5T5FL 1WA0X 3RUGA 3MFGB 4NN7B 3SCMD 3GHPA 4FKHA 3L5JA 3W0WE 2WXHA 4HWZB 4C58B 4TUKL 3R4DA 4DOHE 4WV1B 2ZYSA 2MPAL 4PFEA 4F1SA 3WCYA 4Z3EA 5MERA 2BMKB 1B90A 1XL6A 2Y7SA 4I8DA 1CGXA 3BDYH 4YSTA 4QRRA 2UV3A 4QJ3B 1Q0XL 4Y2DC 4YBLC 2Y25A 2IAND 2CKBB 2Y7QA 1UYWL 3CFKA 4BHUI 4QXVA 5JXEC 4F93B 3QRGL 5I8EB 4QO1A 3CMGA 2ITCA 3NJFA 4XMLL 1L9RA 3JV4B 5AOJA 2BOCA 4BRVA 5KVDH 1KGXA 4M5ZL 2PWEA 1GGCH 1T1XB 4Y4KD 3RA7L 3ILPA 1MI5B 5KVEE 4RBPH 4HJJH 3O4OB 3DNKA 4GT7A 2VE6B 1UENA 1NPJA 1U8PB 2XUWA 5BXFA 5CFAA 3VMNA 1MJJA 3N85L 1BOGB 1W16A 3BVUA 2HRPH 3GSNH 1NIEA 1B4TA 3JBG7 3O45A 4K23H 1XQ4A 2VAAB 5KW9L 3KXFD 3TFKC 1L7TL 3WENA 2F7OA 1MWAA 5EN2A 1NAMB 2EE0A 5C08B 4LSTL 3UO8B 1T2QH 4PV9B 4HS8L 1MY7A 3AU1B 2J2ZA 3QA3B 3MV9D 4I13B 4LPVA 4PRPA 1L6ZA 4PLNC 1QEXA 2WOYA 5DJAB 2E6PA 4A7TA 4GUPA 3IDIA 2NNRA 2JCWA 1CT8A 1EHXA 4XCFH 1DVTA 1MFDL 1UQSB 4N26A 4RFNC 4S1RH 1MFNA 2G2RA 2XKNA 3G04B 5DUBB 3K8LA 3NPZB 5AQ0A 4NP4L 5I6MA 2ZG3A 1ORSB 1I3UA 2OZ4H 2WW8A 3RL1B 4F37K 4XCNA 3LNDA 4FRWA 3NJIA 4JR9H 1OAQH 3T4YB 1QUNA 4DGUA 5KBPA 3K6SB 3BLBA 5ADOL 4OZFB 4Y9FA 3AT0A 4LEOB 2PPAA 3WE6B 1GC1L 3EBIA 2H32A 5F7BA 3TZVD 5DJ6B 2HLEB 2EE2A 4X5XB 4IOSA 5I1CH 3FUJA 1TJIH 1B4JL 5SX5H 2XLLA 3FU8A 3DBXB 3HG0A 3QB7C 1OM3L 4TTDC 3X11B 1C16A 3HBQA 2NY2D 3KYKL 1NMBH 1DQTA 5DO8A 2MWCA 3E8VA 3V52H 3S9DB 2NUPA 2BNRB 1DVFD 1U2YA 1U42A 4TVPH 1WWBX 2BSTB 1QFWH 2EYTA 1N5AB 3BAJA 1LO3H 3WHE1 2OX5A 4GINA 4QHNB 1LP9A 3NABH 4JJHA 4MQTB 4ZW5A 1YLBB 3FQ4A 5GS0L 3JWNE 2CO4A 1IBGH 4Y8DC 4HWZA 5C6TH 1CDUA 1FNEA 1JZHA 3LKNB 1G5GA 2Y36H 4E9QA 4XO4A 4B6ZA 1DQIA 4N2LA 4JRFA 3QCTH 2CCLA 2BY1A 3UGXA 1TJHL 4BM7A 3BKMH 2IEPA 4XR8C 4YGVA 3MUZ1 1PLGH 1LO0L 4N20A 3VI3A 5HY9B 2YPLA 4G59C 4L5FL 4NT6B 1NDTA 2H8PA 2JKLA 1BFOB 4KUCD 5C3LD 3D08A 1F00I 1T1XA 2X2YA 3ZHFA 1MI5A 4GYBA 4PLKC 5C0DA 1S7UA 5K59E 4HIEA 5BO0D 4HCFA 4HGMA 1FO0A 3RVTC 5HPOA 5T33L 1U8PA 3TBWA 4MMZC 3KCPB 4NHUA 5CWSB 4AEHL 3TEYA 2EO1A 2ID5A 3TF4A 3O0RH 3PWLB 1T04A 3N41F 5DUML 3ZTEA 2DJMA 5EIVA 4M5YH 4R3SB 1W0VB 3F85A 3LIUA 4I9WE 4OLUL 5GPRA 4AXWA 3ZXAC 3TCLA 5DVOA 4MTMA 3FMGL 3EADA 5ALCL 1J05A 4JM4H 2X70A 1EDQA 3BD4A 1PY0A 4YBQC 4KZDH 3T4AA 1CL7I 1IGFH 1JNHB 3UPRB 1HK6A 3K8KA 3G04A 4H8UA 4JE0A 3DX9A 4WENB 4HPOH 4OZHF 3FFDB 5DK0B 5C9KA 3L7EB 1IIKA 4XPBL 5AKSA 4PGJA 4MA3A 3I3DA 3VSQA 3NJGA 1EFXD 4C4KO 2BXZA 3D87B 3GJFB 3DVGA 3WE6A 4ELMF 1BW8A 5FA3A 3D3VE 4AV5A 1OE1A 1ZJBA 2VIRB 3JWDL 1WF5A 1ERNA 3TT1H 2JKIS 2AKRB 3BZEB 1CU4H 4LIQL 5FPIA 1CFQA 3NSCA 3OQRA 3GBML 5DJ0A 5DZOA 3TU6A 1SF3A 4MX7A 3X11A 5IEKB 4M62L 3HUJA 4P9MH 4C4UA 4POUB 5CN1A 4IBTA 3DK2A 4Y16B 3MRBA 4P59L 2YA2A 4LSSL 4N6RA 3MLWH 3GMLA 1ZGLB 2QKIA 1N5AA 1JPSL 3Q9QA 3G9VA 5EBMB 3VXSE 5IROD 4JKWA 4NENB 1IMHC 4TNVF 1IC5H 3V0HA 3ME0B 4BBWA 1J0KA 1XGUB 3CC5B 4JRLA 5GRVL 4FEIA 3H9ZA 4RGND 1D5MB 2W9LA 5ILTL 3MRIA 4GG8B 1QLEB 2OXGB 2GCYB 2Q6WB 1R24B 3SYQA 4DW2L 1OARL 1TTCA 5KYYA 4JN2B 2ZXGA 1I9IL 4Y4KC 2OR9H 2B08A 3BP6B 4NQEE 2CHXA 4LLYB 2ZOUA 4OZFG 3C5JB 5BQDA 2VDQB 3E3QE 3U9PL 2P7TA 4G6FB 2WPGA 3BP4B 4HKXA 4YZFF 3WS6A 3JVFC 3GZPA 3VXTB 1SJEB 3P11L 5HY9A 1A7PH 3O6FD 4ZW6A 4YPJA 5K93A 4GG6F 1ORQA 4NT6A 2EEXA 2E9WA 4IRSD 2WO3B 3NSDA 4PJ5B 1B4LA 4F7PA 5EIIA 3IBEA 1WSST 3LVEA 1P7QD 1PSKH 2WBJA 1M42A 5T5FH 4BFJA 2XZAL 3SN6N 2Y23A 4L3AA 1NMAL 1JOIA 1NUGA 3ZMNA 1EFQA 1DTUA 1OTTD 2MPAH 2OQJB 2VLRB 3QPQD 5HHOE 4Z3GA 3CVBA 1QWUA 1BQSA 2G0KA 3QWRD 1RHHA 1S7RB 4KGJA 2GJ6D 3PGFL 3UAFA 5DF0A 3H55A 3RIFF 3T3MF 2VABB 2MCG1 3VI4B 5IB1B 1U8OB 4FTVB 5KSAA 2I7SA 3AS3A 4G8AC 4XMLH 2N0KA 2JB5L 2XV2A 3TEWA 1ZV9A 2YXMA 2F08A 3QW9A 1JNHA 3TZVC 4W9FC 3CPUA 1HU8A 4RIRA 2GI7A 3WXWL 5IB3A 2OMWA 5DK0A 3N85H 1T5XA 1KJ2A 5J9PB 3TJEL 2XVKA 1BF2A 1F58L 4CGUB 1TTUA 5E9DE 5D1QB 3L3OC 1A5FL 2NY2C 4AVKA 2VYRE 5CLZA 5KW9H 4HEPA 2PW2B 3IDGB 2CR0A 2O5XL 3MTRA 2V9RA 1DVFC 1VFUA 2E74C 2X3BA 2FUTA 3BWAB 1I8LC 4H44C 4B41A 1S3KL 4LSTH 4P23D 4J2XA 1QA9A 4HS8H 4P3DB 3QULA 1TETH 3J07A 3BZEA 1MOEA 2XQYK 3UYPB 2FIKB 5FCSH 5KBMA 5HYQB 2JLLA 2Q3AA 5L6YL 3ARBA 1ZGLP 1MFDH 3C8KA 2ADIA 4Y19A 5C0JB 2Y7LA 2CDFB 2WNXA 5EN3A 1P4LA 4TXVB 3VE0B 5I2IB 4NP4H 5F0LB 5FFGA 4OR1A 3SB3A 2X6CA 4WGWB 1QNZH 4OT1H 3CE1A 2WXKA 3O2VH 5AW4B 5BZDA 2C3VA 2NPLX 3PY9A 1XGUA 1RZ8B 2Y5TA 4DUXA 4IHOA 4Y5XA 2QT6A 5I6KA 4J3OD 3FYIB 4Z1PA 2A4ZA 1S9KC 3STBA 4GG8A 2FBJH 3OMNB 1X5KA 2X4UB 1N3NA 4I3RH 4HLZH 2QZQA 2ZUQC 4FJ6A 4P2OB 1RZKL 7TAAA 2IF7A 4HEPG 2CRIA 1UC6A 2HT2D 3GGWB 4KK6C 5I5RA 3AQYA 3BP4A 3MLVL 2VAJA 2W9EL 3W0WD 4CU6A 3E9UA 3QDGA 4N90E 5E1GA 3ZMRA 4S0HA 2F1BA 3SDYH 1AZBA 2AV1B 3E2HB 2Y69B 5F9WC 1RUAL 5HDWA 4ZMOA 1D2PA 2V9UA 2WBKA 3QEHB 2R69H 3Q5YA 3SDXA 5GS0H 3P73B 5DEGB 4XPAL 2VLRA 5CR8A 3MOQA 1IAMA 2XZCL 3HAEB 4BCYA 4ZUSB 1B9ZA 2YGQA 5KVGE 1S7RA 4YGAB 2PTVA 1UM6L 3TO4D 1KWKA 1J8RA 2NY5C 1U8CB 4PG2A 4YN3A 1MRCL 2VABA 2VR7A 1C08A 3P3TA 3B5HA 4XOBA 3VI4A 2FR4A 5D9SA 4PJ9D 1Q72L 2MQ3A 4MAYD 4OZHB 3TWCL 2V37A 2VH5H 3HNVL 1R5WB 3KL0A 2CGZA 1T89A 2ZCKL 1CPUA 2FJHB 3DJSA 4YK4B 3I9GL 1LHZA 3S37L 5JIQA 3P9LA 4AEHH 2C9PA 2NY4D 4OLZH 4L8CA 4X7TA 2Z91B 4ECNA 5DUMH 3T2NL 1Y1UA 3GBNL 2C3GA 2WCPA 4X0NA 5EBWB 1AAJA 4FFZL 1TKWA 5BZXA 4MASA 4OLUH 4RISL 3FN0L 4L3EB 2P42B 1T20B 4RFOL 4MJ4A 5FOBA 5ALCH 5IROC 1MHHB 2K70A 2FIKA 3H6JA 3UYPA 5T1MB 3VAEA 2XWJA 3EHBC 4IKNA 4P9HC 5HYQA 1KTJA 1XFPA 4NBYB 3AREB 3BP7B 3F8UB 1K3IA 5C0JA 1FFNB 5EU5B 4WRLA 3L5IA 3MRJB 4FHJA 5HI5C 1YEDB 2WLIA 2J3SA 1IGYB 2YGPA 4GRMA 4HD5A 4XPBH 1JYXA 2XG4B 1O75A 1Y07A 1A1OB 2XPYA 3HE6A 2VRQA 2DLFL 1F56A 4K9EL 3NACH 5DQJA 2V8LA 3T8XB 4FG0A 2G2NA 5ENWB 2OKMA 3W9EB 4IRSC 3WHXA 3GXDA 1MQ8A 3KWXA 2IADB 3RFZB 1EHAA 4YHYC 3ZYJA 4OM1L 4GG6B 4JFXB 4LIQH 1JVOA 2W80C 3ECVA 1U8KB 5CJOL 3F05A 1P0SE 2JKNA 3PWPB 5GS3A 4JNXA 4GP5B 2GHZA 4P59H 3SPGA 3QPQC 2K6WA 3FU0A 2AV7A 1JPSH 2I24N 3V0WL 3FU3A 1AI1L 5K9QG 1XCTB 2DDQL 1W91A 3GMMA 4ATTA 3OC8A 4M8QB 1MN4A 1FFRA 2RTTA 2VRAA 3CG8A 3T3MB 1NQBA 2W07B 4DW2H 1OARH 1ZHKB 3RZCD 2O5NA 3DBSA 4GRLA 2QQKL 1L9SA 2A0LD 3O2DL 5ANMA 4YHKL 2RHEA 3M1BB 5HHNA 2FLBT 3U9PH 5AOKA 5I18L 1F6AA 3VXUE 2O6DA 2P5PA 5DFTA 4DVBB 3NYKA 5AD0B 4HBCL 3CIQA 4IMKC 3VRIB 1R5WA 1CWVA 2ZCZA 3H4HA 1ZLUH 3GIZH 3NCCB 2W88A 4I9WD 3D85A 1OCCB 5GRWA 3VDAA 1SMDA 1SMAA 5C0AB 3AT8A 3EYQD 3QO0B 3S2CA 1YDPB 1WEJH 1MCWW 2UX7A 5CZRA 1T22B 2HX8A 2Z4TA 1KXTA 1N26A 4NDMB 3B2VL 4AJWA 4F2EA 4HFUL 5EBWA 3U7WL 1P1ZB 3L95A 5JO5B 1QHQA 4YLBA 3MNZB 5TF1L 2D7TL 4RRPA 2FQGA 3TEXA 2QKSA 3WO3B 5J57B 2W59A 3HAEG 3QUKB 4CVWA 1N0XL 3UH8A 4QPEA 4U1JB 2JB5H 3DYOA 1LNUB 5TJWK 4JE4B 4IOFD 4UM9B 4G42A 2EDYA 2VLJB 5E4AA 3IJEA 4H20L 4RMSA 3D3VD 3ELAT 1IC7L 3MJ9L 2IBBA 4KJYB 2OL3L 1Q94B 3PXHA 3WXWH 5E1AA 1TU2A 1JHTA 5JZ7D 1FYTA 3MVSA 4BFIB 1F58H 3APMA 4QF1B 2VQUA 3IGFA 3PAUA 3UJTH 3BJLA 3FS9A 2WUBL 1A5FH 3IMRA 5C07B 4B5EA 3CPLA 3EZ8A 5J11B 4L37A 4XMUA 5J6GB 4V1DA 4WEBL 1OZTG 1S3KH 4XXDA 5FW8A 3GMPA 5AZ2L 3AG3B 4FKKA 3LEVL 2NUTB 3ET9F 5EZJB 3VXSD 1HAWA 5AUMB 3PJSB 5L6YH 5E5UB 3MV8B 4RGMC 3GBLA 3I9PA 4JAMB 4YHOL 1X3DA 2OW6A 4TPRH 1KEGL 5AWNL 4B9IA 4RMTA 2E7BA 2R23A 4UOZA 3U6XS 2RALA 4NQED 1DCLA 2Y06L 5E94A 1SDDB 3VMPA 3QYNA 1KIQB 1Z3GL 2A4CA 2F68X 2EZ0D 4HPYL 5E2JA 1S9YB 3STZA 3WFBH 2IJ0C 2N1KA 3QR1A 4M8QA 4PWEA 3ENEA 3SEPA 4PJ9C 4MAYC 2WZPA 4OZGE 4KI1A 3LRMA 1K5WA 2GSMB 3NFNB 1CFVL 3JTBA 2NR6A 4M1GL 3MLVH 4BQ6A 5JTWA 2W9EH 2NY4C 2C5DC 3WFHB 1I9JL 4MHHG 3T77A 2DI7A 2YPKA 4N2FA 1OLLA 2ZWSA 4AZ8B 4FNPA 5HHOD 2VT0A 1GTNA 1J0HA 3HS9A 4Z7VA 4JG5A 4PJ7B 4HKBB 5T3ZH 1RIVL 1GYVA 5E4IA 1BSIA 1YDPA 2KPWA 1DQMH 1PEZA 4LCWE 4YE4L 1T22A 1F3DJ 2NSQA 4XPAH 1BVLB 3C08L 3NIDF 4GW4A 2XZCH 2VDOL 5JA8B 1M7DB 3HZMB 3MUGB 4B50A 2CAKA 1KMGA 1UM6H 3GSUB 2ZD0A 1YMHB 4DESA 5C0GB 4X0KB 2DLHA 4DO4A 2ZX9A 4N0FA 4J39A 1VF5C 1MRCH 4Z6AT 1FHGA 2E7LA 1EZLA 5CMAA 1CQKA 3I75B 5E9DD 3DTDA 3QG7L 1MFCL 4P99A 2HKHL 3V6OE 1OGAB 5IMKA 2ZCKH 1U95A 3N1MC 5E6RB 5IOPA 4KRMB 1D5XB 3LXCA 4KV5F 1AS7A 1R5VB 1P7KB 4KJYA 4XXWC 3S37H 1ZTXH 2ZYRA 2EVJA 1HFUA 3GB7A 3OKOB 2HYMA 2Y72A 2PXYB 1FN4B 3T2NH 3GBNH 3OAWA 4PJIA 3W57A 5EF3A 2BZ7A 3JWNC 3OZ9H 4KQ4H 4S1SH 5D6CB 3TNNA 2D0HA 4Z7QB 5KOMC 1IAOB 5J6GA 4ODHL 4DO6A 1BQHB 3FN0H 2J21A 1D9KC 2P5EE 5EZOH 4CMHC 4F7KA 5HHME 5DJXA 3QC5X 4YL4A 3GJEB 4XB3A 4NZUH 3ARDD 3WJJA 3DA0A 3QUGA 2DMGA 4NFCA 2ZPKL 3TA4D 3F00A 4G9DA 3VX0A 1KYAA 1ZHNB 3MPCA 4JRXE 2FBRA 2YKLL 3O8XA 1PG7W 3RZCC 2YFOA 3RNQA 3NT0A 2AK4E 1ZV2A 3L5HA 1I85C 4YDIH 3BVDB 4P4KB 5TDOB 4DTGL 8FABA 1A9EB 4XX5A 2PTUA 1KIQA 1DVSA 2DLFH 4S0TD 4TULL 1OPOA 1HKLL 1KCRL 2EEAA 3L4ZA 1CGUA 4N90D 3D05A 5HHVL 2A5UA 2K45A 4OM1H 4DKDC 3LOWA 1UWGL 1CDHA 3FUHA 3N44F 3CFBB 2BZCA 4NBXB 2PO6D 1UD8A 1TEYA 1M7IB 1P84J 1EJFA 2H45A 4QRBA 3WFHA 4EJ1C 4PJGE 3WS3B 1MFAH 1WITA 3KWWB 1WZLA 1UVQA 32C2B 4QOKE 3AFLA 4D3CH 3CN0A 4OM0H 1EO5A 1XX9C 4Z8FH 2CUAA 3V0WH 2IDFA 1WFMA 1AI1H 1WAAF 4KRLB 2H0EA 2ATPA 2ZOLB 1WZKA 2DDQH 4FFYL 4HJ0D 1QBLH 4PJ7A 2XN9B 2W9DH 5BV7L 1SQMA 3FHQA 1ZTMA 2ITEA 4YAQB 3GQFA 1E67A 3O0LA 2OMVB 4KVNL 3O11B 4IOFC 5E03A 4RWHA 4AIEA 4PJ8B 4H88H 2QQKH 1QSZA 3O2DH 5BOZG 2UXVA 5CCGE 3RG1C 2WXNA 4KJQD 3C87A 1Q9KB 5I18H 1I7UA 5JZ7C 1NOLA 3LDBC 1UH2A 5F7EL 4UQIM 4HKJB 3QHFL 1HZLA 3GO1L 5FUZL 4NO2A 4KPHH 1A6ZB 4WEUD 2A1WL 4RWYL 2HVKB 3S35L 3U0TA 1DSFL 2VDPL 3W38A 3NDYE 5FWQA 3SIKA 5I1LB 2HVJA 2CRZA 3B2VH 1A6TB 3OKOA 5DJDB 2PXYA 5CJ8A 4PD4J 2W0PA 1GKOA 1YJDH 4NKIH 3U7WH 1YQ2A 1V3JA 1ZT1B 3AUVA 5AOIA 2L7JA 2B77A 1BQHA 2GHWB 2D7TH 3MLUL 4KOBA 1A1NB 1FVEB 3S3SA 3BPLC 3GJEA 1N0XH 2C9RA 3MR9B 4UWQB 1XZ0B 5FM8A 1RK0A 4V33A 1G4MA 1SJVA 2C9SA 3LNHA 1KPUA 1Z9NA 2QV4A 5GGQL 3QGVA 4H20H 1F3JA 4A2MA 1IC7H 3B8SA 2OL3H 4NSKB 2A9DA 3NUKA 4JHWL 2Y07L 5B7FA 1T0NA 1YG9A 1IAIL 3VG0H 1LO4H 3PL6D 2CLVB 4JREC 1KLUA 3FB8A 1WIOA 4ZMLA 2WUBH 3U0PB 3UX9B 5F1IA 3MFFA 4FEMA 3RVWD 1XF4B 5DMGC 4WEBH 3IE9A 3HB3D 2C1OA 1VACA 2XWTB 4P5KA 3NCJL 3QEGL 1S8DB 5CD3B 4UQ2B 3TTYA 4H25B 4PJBA 4BCXA 2QADB 4J4PD 2LAAA 3BKCL 4YVNA 4XH2B 4NN6C 3VQ2C 4EN3A 3AT9A 5JIMA 5HPMA 1Z5LB 1KG0A 4YHOH 4DCQB 3EO0B 1BQHG 3GTTA 4RMQA 2KDGA 4UNIA 5I28A 1AIFB 1KEGH 5AWNH 5H2BB 2E7HA 1ZE3H 1AD0B 4GO8A 3RVVD 1S6NA 3VQ1C 1AIZA 1T0MB 3NIDB 1AH1A 2JNZA 4MQ7A 2JKRM 5K9QI 1WA1X 3ZKMC 5F88B 2ICEB 1Z3GH 4EI0A 3L4TA 3MGAA 4XC3L 4ZS6C 2P49B 4JVWA 3FB7B 5FO9B 4YAQA 3VXUD 3U46A 1YAIA 2APTA 3BUYB 1BLNB 5E9AA 4AT6B 1A9BB 3M07A 2Q8AH 4KY1L 1PJWA 2GUYA 4JFPB 4PB9L 2GEEA 4GRWE 3SE8H 3UTTB 1AD9A 1MEXL 2QVFB 4PWIA 1CFVH 1M6UA 4BZ1H 5L4JA 1SDAB 4NPKA 5IVZB 3UIZA 1AZCA 2EVFA 5GZOD 2E9GA 3QEUB 4ODSL 4NUPA 2Q2EB 1I9JH 4J1UB 3LNGA 4BK4A 4YXKH 3CDCA 1D3CA 3U36A 1VEMA 1HL8A 1NCCL 4A7VA 3VDBA 1DN0B 4G7VL 3TBTB 3KCWA 1IKNA 4UYPA 4AY0A 2WLHA 5BJTA 2FYVA 2OTWA 2YKKA 2XWBB 4YE4H 1ZWIA 2CHDA 2HVKA 3FUMA 2W0KA 4L1SA 2VMFA 5IQ7L 1UB6B 3ARDC 4AGMA 4AW4A 4XVOA 1HI6A 3C08H 2UY7B 2QVMA 4MCYB 5AVVB 2VDOH 2EDMA 2RFXB 1NM9A 4PRAA 3G9AB 1J1PL 2BVOB 3MYJB 4XX1E 3FB6B 1FVEA 4UTAA 1GC1C 3A21A 3CQPA 1AGFB 4MMXA 4WKZB 5DMKA 2X7LB 1ETJA 1OP5H 1MFCH 1Y18B 5CBEB 2CMRL 4O58H 2NZIA 4X6BB 2AXHA 3L81A 2NSXA 4PV8B 5BQ7B 4JY5L 2NY3D 4JDZA 3SE9H 4TOYL 4HFWA 3BO8A 3HMWL 4U6VL 5DVPA 4U6HA 1INEH 2I5YH 3K3QA 1K9TA 5CN3A 3SQBA 1AHMA 3MO1B 5IGXL 1AMXA 2EYRA 3BLPX 5I16B 1AGDB 3H7BB 4KX7A 3KVPA 4NQUA 4JK0D 1FH2A 1E2VA 2DMKA 1QKZH 1VEOA 3N44B 2FEDD 3RHWK 5GHWL 5EU6A 4FCHA 3EG9A 3MNWA 1D5BB 4WHTA 1A1MB 2YMOA 4H25A 4IGBB 5F9JA 1HEZB 1Z5HA 4HJ0C 2F74B 2ZPKH 4JL2A 2R0WH 3HG1A 1IILE 1RXLA 3HE7B 2V5SA 4Z77A 1OO2A 2A6DB 3DX7B 3UIYA 4JQIA 1IZJA 3DYMA 2HP4A 1RV6X 4WW2F 1N6QL 2YAFA 3NSJA 4DTGH 4KJQC 4ZO6A 5F88A 3QQ9D 3MMEA 5CLXA 4TULH 5I74B 1KCRH 4KDWA 5F6IB 1T5WB 1U2CA 3SDDA 3SOBL 4BXVA 3BUYA 4NRXB 3U4BL 4PCTA 1G84A 5HHVH 5AYQA 1AGEB 1GPOH 3C6EA 3VA2C 3DK0A 2VDRB 5EO0A 4N24A 3MRPA 3DV4B 3N0AA 2YAEA 3EOAA 3CFIC 1UWGH 3NCYP 1W6LA 3FB5A 4MGXA 4LCWD 4AH2A 3QUZB 4JO8A 2A83A 3BYTA 4MHHI 1NDMB 1IE4A 1CYXA 1M3IA 2KLRA 4KVCH 3VFUA 5C2UB 4KKAD 4RMWA 4A7UA 2CIIA 4PJ5E 4XVTL 1E4HA 4X5WA 5BV7H 1MH5A 2VR3A 2AXFA 3EJSA 4D0BA 5L2KB 1EPFA 1N0LB 1GJWA 1UB6A 4NZ8A 4O02L 1H15B 4FAAB 4HJEA 1SOSA 4Y4FC 4KVNH 2YJQA 4N22A 2V9QA 1SEBB 4OLWH 4BFRA 5I8OH 4UDTA 2XBDA 2A9AA 3I6GA 3OXRA 5CCKL 4TQIA 4UAOB 3EH1A 4HIJB 2R8SL 3ECWA 1AXTL 2NYZA 5F7EH 5DD3L 3PL6C 1AGFA 3K91A 2X6VA 2ZKMX 3CNKA 3QHFH 3ARFD 3JWDC 1ILSA 3ZT7A 3GO1H 3NZHH 4QCIB 4X6BA 3VFPB 2QFRA 3L4YA 4FTVE 4LLWB 3FTUA 3HB3C 2A1WH 2YXWA 4OKVB 3O3EA 5CP7A 4YSPA 1C7SA 3VFMB 2P5ED 5D1ZB 5HHMD 5EO1B 5DI8A 4J4PC 3MO1A 3C09B 5A2FA 1XGTB 5JORB 5I16A 5JDSA 1AGDA 2GJZA 4BFBD 4OCWH 5AL8A 1DJHA 3IDJA 1JFQH 4JRXD 4FFTA 4Q2ZB 5D1QE 3L4CA 3MLUH 3R19A 4P2RB 4JY6A 4HWEL 2HFFB 3RB7A 3RVVC 4Y4HD 3T65B 4AKOA 5DTFA 5KEZA 1C1EH 2AK4D 4RZCB 2F53A 3KWTA 4F57L 1SZNA 2F74A 1X5ZA 3LZQA 4L05A 4EI6A 4TF4A 5E70A 1KYUA 5F7HA 2ZKYA 5AAPA 2VR4A 1GY2A 2ZUXA 1J8HE 5GGQH 3WTWA 1E6OL 2CUMA 4L9DA 2YXFA 3FQUA 4JHWH 2P5WB 3B6SA 3NSYA 1RZIB 4M00A 2BVPB 1KTKE 3V5HA 2D4FA 4OH2A 4PRHA 4UT9A 1RQ5A 4G83A 3PQYA 5GZOC 2YD3A 2H9GB 4Y5VC 4NRXA 4PJXA 5GGUA 1KY6A 1QSEE 4Y2OB 1QRNA 4QOKD 2VDKH 1HIMH 3NCJH 4MA7H 3A3YB 2EDJA 3IJYB 4YHLH 3TGXA 1GSKA 1RZ7H 2R7EA 4IBSA 4ZS7H 3S36L 4IBVA 1D6EB 4PY7B 4M6NL 3ZVVA 4FG6D 2IFFH 3P0YL 4FXTA 1FZKB 1CXKA 3GLAA 4GS7C 1FIGH 2XDHA 3BDBA 3VD5A 1AXSB 5D7LE 3D39B 2XCMC 5IB4A 1KN4H 3KMDA 2NY1B 3MBEB 3WELA 3MOAH 3VTTA 3VGDA 3OVUB 1LXMA 3AVEA 4XC3H 2XTLA 3OKDB 1RIHH 3V95A 1WFUA 3V8OA 4NRYA 1H15A 4EN2A 3FRPA 1TT6A 1L3WA 5I1KH 3LQMA 1QTYT 4PB9H 4P46D 2B14A 3QP3A 5ACZA 3C2SA 3NN8A 1CICB 3B9AA 3ZT6A 4HIJA 3UC0L 1Z9SA 4BK8A 3X13B 1JV5B 3DJRA 4KHTL 4OGXL 3G5ZB 3AY4C 1FV1A 1NCCH 2Z93A 1WUZA 1JGLL 1G1CA 4K71C 5BS0E 1I7RB 3CZEA 3THMH 5ESAB 3BPCB 2FEDC 4UU9B 5FKPA 1B0GA 5SWSB 1H6FA 1FCCA 1F4YH 2X0VA 4OD1H 3ZE1B 3MACL 3N1QC 5DYOA 5IQ7H 4QHUB 5FO7B 3I2CL 3EKCA 2H2SD 2EEDA 3GSOA 5JORA 1UKTA 4ELME 3ZBMA 1P84K 3GXFA 3ASNB 4BYHA 2V17L 4ZXBA 1JZ7A 2X4RB 4BKTC 4Q2ZA 1J1PH 1X9LA 1YYCA 4NM4L 3SE4A 4NKOA 5I9QB 1YMMA 1A2YA 3KYNA 4Z3JA 4HIQA 1BF8A 4TRPL 3QQ9C 3NGBB 2DQGL 4RVBA 4JY4A 4WW2B 3SD2A 2I25N 3RWJA 4POYA 2DQHH 3UYOD 3UGEA 1DQDH 4YS4A 4JGJA 4PM1A 1RZKC 3RDTD 4CKVX 1KZYA 1W9XA 2R2CA 1CFSB 4TOYH 4MWFA 3U9UB 3PP3K 3HMWH 1USQA 3ZKQD 3HG5A 4YDVB 2BY2A 4DUWA 3DKHA 3CFMA 4P5RA 4Z0XB 4GW1A 1G6RB 5KSVB 5IIEA 4UIKH 3ALXA 4LCUB 4PGCB 4S1DD 4G5ZL 4N9GA 3K6DA 5GHWH 3VWKC 4AGOA 3OR6B 5A1AA 3IJYA 2NYYD 5GSRB 1HCVA 1U9KA 4GBXB 3V4PL 1F4XL 2VISA 1KGUA 4LU5H 1V7ML 1SY6A 2P26A 4W4OC 1NLBH 1L0QA 2YJLA 4EMZA 1FPTL 3OHXB 4G9FA 5C09E 3BWZA 4NNYA 4UOJA 5E8EB 4OGQC 5C7ZA 3RWIB 3QQ4B 1ZAGA 4K0OA 3P1VA 3MRFB 1Q9WA 4Z7UA 3CSFA 2B59B 4HEMA 4J3OH 4HT1L 4K3JL 4NI6A 4PW9A 3MBEA 4U1HA 4UM8B 5AYUH 2CDGA 1MUJB 2HJFB 2IAAC 3ZPDA 4OIIH 5DA4A 3ESPA 4YXHL 2HLFC 3SOBH 3HVDA 3RZWA 1MW3A 3ARFC 1PD1A 3QDJB 4GQ9H 4KO9A 2GT9A 1YEFL 1QOKA 2R4RL 3H42L 1S2EA 2VRKA 1ZLVK 1DANU 1THAA 1UOKA 5D8JH 3T3ME 5C7XH 3S98A 4IK7A 3NPSB 1HS6A 2BSBA 4A37A 1EJOL 2IO5A 1EJ8A 4FXKC 1B88A 4ADGA 1YUHB 3ZRCC 4GMTH 1NMCC 3TN0D 5MEQB 4PS8A 3HPLA 1AGBB 3FQXA 3U2JA 2XV3A 5ESAA 2ZONA 5GGSB 3BPCA 4QT5B 1ET7A 1RP8A 2AGJH 2ROYA 4XVTH 5F6HI 4B97A 4JGNA 5SWSA 5F8RC 5KVEH 4JRYB 5C0AE 4NNPL 4D9LL 1CVRA 1F3RB 2MSPA 5FA4A 43C9B 3GSVA 1G7JA 1OE3A 3ZDZF 1C5CL 5CCKH 3K71A 2P8PA 1DQJB 1HINL 3MJGX 4L4VB 3HC0A 4X9IA 5EIQA 5EU7E 4QXTB 2R8SH 4K9EC 4R9HA 2WMPA 2OYKA 4YSEA 1AXTH 2JELL 1BZ7B 1LWRA 3GRGA 1XL4A 4XWGL 1PZUB 3SKMB 3J8F7 1D7CA 2I26N 3I85A 1IM9B 2ENSA 2YA0A 5KSUB 4Y7MA 5K39A 3G08A 1FFQA 3VU2A 2WJ7A 4HHGA 2J6EL 2VLJE 3DROB 3Q5OA 4YDVA 3V0FA 4ZNEA 3C8HA 2J71A 4Z7WA 4P05A 4FG6C 1WDAA 4F7CB 4ZK8A 5I8CA 2VW6A 5JPNB 4KNQA 2PYEA 1VRSA 2FX9H 1GOFA 4PGBA 2X9WA 4TQEL 1JYVA 4HWEH 2X89D 1I8KA 4MVBD 4W9LC 3E6HB 4GBXA 2E27L 1U8LA 1BZOA 4F57H 4Q58C 3BVNB 5JMRA 4GI6A 4ODVH 5IB5A 3FOLA 4BKLB 2WQSA 1PAZA 2XFXA 4LEXL 3TPKA 3GSNA 3CFTA 3HFML 3OSKA 2X53A 2XV6B 3MV8E 4YDJB 1JPFB 7PCYA 5GSVA 4BE5A 4P46C 1MJ8H 2B59A 4UM8A 1NM4A 4ACPA 5F96H 1MUJA 1WCBB 1ZSDB 3UEZA 3RNKB 2UZPA 3TASA 5I0VA 1AVAA 1SN5A 4PP1D 3ZHKA 3DO7B 2VITB 2ZF9A 4HHWA 3KYMA 4OV6F 1GGTA 2PN5A 5ABDE 3CDGB 1N8OE 1EXUA 2XICA 1PZAA 4ICWA 5LG1A 3L2LA 2X3AA 1YNTB 1IO4C 3DHPA 3PV6A 3KLSA 3DPDA 4M6NH 4PJ5D 3TVMD 3CBKB 3P0YH 1XMEB 4FXLA 1QWHA 2OZ4A 3W56A 4G1MB 4LCYA 3VB8A 4NOBA 2H2SC 4KK8D 2X4SB 3D0VB 1BD2A 5L88L 2CXKA 4I85A 1I1RA 1FFOB 4I88A 1MIEL 4PS7A 1KJMB 1L9MA 4MNGA 4QT5A 2WB7A 1YPZE 4L9LA 2WINA 4PJFA 3CCHB 4Y1AE 2Z0BA 4XB7A 1TDQA 2PPDA 4ZTPL 4PVBA 1SM3H 6PCYA 3D30A 2AQPA 5I1HL 3S4SB 5LGJB 3N1PC 1R3HA 4GY4A 3J2PA 4X4ZA 5EEWA 5AB1A 4FTVD 1NKRA 3DIDA 3RDTC 2DWEA 4IJTA 1HCZA 4QXTA 3UC0H 5DJ8B 1ZS2A 4AQ8C 3RTQD 3PJLA 3T04D 4N28A 1K4CB 4KK9D 3GXPA 3HZKA 4J6IA 2XYBA 1IM9A 1JGLH 2ESVA 2DH3A 3SE3A 1CURA 2X2HA 4E5XB 3LRSB 3GTVA 5LGKA 2X41A 3DX4A 5D1QD 1DHKA 5I6LA 3DURB 3L3KB 2NYYC 3VGAB 3ZJAA 4Y8AA 1BZDA 4ZSOA 1KB9J 3IJHB 4F7CA 3ULVF 2RQ8A 2GBTA 1N7ML 1NGYB 1J9CT 4ETQB 1IL1A 1J8HD 3K2KA 4I9XA 3SGKC 4EAEA 3FQ2A 3FN3A 4UTBL 1IGJA 4KJWD 3PS6A 4HS6B 4NM4H 1VGEH 5KZCD 2D3LA 3NFPA 4WWKA 5AVUB 4LP5A 4QYOB 3SY0A 4TRPH 1IQDB 4X99B 4D0DB 2D7OA 1U8NB 2DQGH 4DT2A 4H40A 4OV5B 4BRJA 1JWUA 2LABA 1QSED 3DI2B 2QQNL 4ALAL 4QHPA 2CJ3A 1QWNA 1UA6L 3ARZA 5TK2A 3ZK0A 1JWMB 3WN5B 2UZXA 1FL3A 4QTHA 2EDEA 5KSBA 2DIEA 5DS2A 3B9KD 4X8XA 1NWPA 2BOBA 1CDGA 3TYFB 1XB6A 3CDGA 1ZD6A 2YRLA 4ZPVA 3TN0C 1ZHLA 5D7LD 2R1XB 4B9YA 4Q9QL 4NXSA 3ARXA 4WHYG 3PIQB 3VFOB 4DKAA 3GDCA 4DKEH 2Q87A 1JE6A 1CG9A 4ZDHA 3MCKA 1RUQL 4FI6A 2UXGA 1KCUL 4AQEA 2F6AA 3ABKB 3EYUH 3SBWC 2W38A 4MLSA 2TAAA 2Z1KA 3Q06A 2NW3B 3SYCA 3BEVA 3LQZA 5D93C 3FTZA 1I1YB 4K3JH 4ABUA 4ENZA 3T0AA 5LG6A 4MQSB 2ZAHA 1HC1A 4R4BA 2A6IA 4QAWA 4F91B 4LEBA 3ZDZB 5CS7A 1BBDL 4O2EB 5BUPA 2DAVA 3CCHA 3MRRB 5CIPH 4CUCA 1G9ML 1KTLA 1S9XA 4ONFL 1K8DA 1NGPH 2X1XR 2XN9E 2FIRT 1S7SA 2IALB 3FUDA 4WSKA 3W9DB 4YC2C 2R4RH 3H42H 4IRZL 1FZJA 5BS0D 2YGOA 1IT9L 1MXDA 1WISA 5C0BB 3Q44A 1ZIAA 3TEUA 4NQXA 4JFDB 5K9KB 4WVRA 3UO1L 3RURA 1EJOH 2DQFB 4AKPA 4N2KA 3MJ7A 3BFOA 3KLLA 4KKQA 4LPWA 4H8VA 4JFYA 2OSLB 2H3NA 4DZ8B 4OZIB 4G8FB 4W9HC 4E5XA 1A7OL 1MCSA 2BIMA 2OI9C 1U30A 3IFPB 1M2VB 4MVBC 4P2QB 4HJTA 3X17A 4WI2A 1OQOA 3E1F1 3OKLB 1D5ZB 3IJHA 5A16B 2H6OA 4LOEA 2EILB 3DMMC 3KPOA 4N87A 4ETQA 2CLZA 3TV3L 4UUJB 4ZI8A 3HPJA 5FF6A 4TUOB 3WIIL 5GS1C 3QQ3A 4F20A 4KKRA 5DD6B 3S4SG 4JFSA 2WYTA 5T5FA 4U1GC 3WEXA 4KI5F 4PP2A 1YC7A 4LF3B 3F65A 4D0DA 2W1NA 1BMGA 4Z7VF 4OV5A 1NL0L 4LHJB 3OMAB 3ZL1A 1FDLL 1K5NB 2BNUA 4HSQA 4M5TA 2IOIA 4DK3A 1CFBA 3S2AA 2XNAA 4XMTA 3LIZH 2VOTA 3QIUD 1ZA6B 2E6JA 4OLXH 4FERA 3MGTB 5F1NA 5LDUA 3ZTDC 3MNDA 1ETZB 1TQUA 2VO5A 3QJQB 3TVMC 5D7IB 3W5MA 1F18A 2Z65C 2WXJA 3VD7A 3G6DL 3QZMA 4E5XG 3VD2A 3Q6GH 2Q8BL 4JPIB 2Z8SA 5C09D 1R5IB 3EBAA 4TQEH 3MXWL 1GS6X 4BK5A 2ZNXA 1EDYA 1N4XH 2IVFC 2O4EA 1IX2A 4M7JH 2E27H 2Z4QB 1B6UA 2NX5E 4LKCB 3GMRB 4HK0B 2XFGB 4A6YH 2X4PA 5DC2A 4LBAA 2MNWA 1GMIA 4XP1L 3A24A 3P4LA 5E7FA 1T1ZA 2F7RA 3L9BA 5FUOH 1CZ8L 1UTDA 4JFQB 4PJIF 4ELKB 1F3DH 3FQTB 3MRCA 3NVQA 3ATAA 3HRZB 2NXYD 3FT3B 5JNYB 1RZQA 2D2OA 4XAWH 4LMQE 3GWJA 3WUWB 5D1XA 4U1MB 3RTQC 2DYPA 1CF8L 3H54A 3NIDE 3RWGA 1FWXA 4KK9C 1RAMA 3F04A 2WV3A 4G6JL 1UXSA 1WD8A 2IH8A 3W1ZA 5MENE 2V7HB 1AO7A 1MHEB 4NJ9L 4WGKA 3V6FA 5DJ2B 1KT2B 2G5BB 1ZT4A 4O2CB 3U1PA 3NG5A 5HYSA 3V9FA 5C0BA 4YQXL 1FH5L 3GEWB 3GXTA 4AK1A 4JFDA 2BFGA 2DYRB 5DQ9A 3FU6A 1A6AA 4XOCA 3QDHA 3UTTE 2Q10A 2VGLM 5KVGH 5DK3A 2FYYA 1NEZA 4RSYA 5C0CA 5C0AD 2OJEB 2R56H 1JXJA 1H5BA 3NOIA 5L88H 4RETB 4KGLA 4KV5E 5D5MF 3BQUB 1CL7H 1HNGA 5HHXL 4PVLA 3TS8A 5F89B 1M2VA 5CGYD 4P2QA 5CEYB 2WXFA 3MRNB 4IS6A 3A5VA 5FYLL 3CN4A 3BRGC 1MNUL 3N3EA 5I1HH 4NO0B 3MZTA 4Q97A 2F8VA 3WEMA 4QAMB 5K9JL 2JQAA 2UYLB 4KWUA 4U2YA 4ZFFA 3FQWB 3IDMB 1J0ZA 4PY8I 2JJSA 3N0PB 1P5UC 3NRPA 2AAAA 5DD6A 5B38A 3GJFK 4UM9D 2GIXA 2VLJD 3KBEA 2YMXL 2R69A 2AXGA 4FN0A 4C83B 5FDYA 4LEEA 3D4CA 3APFA 3B9KC 1HDMA 1MWAL 3FNKA 3VG9C 4PJHF 3WFZA 1MCRA 3MBXH 2X28A 1TQWA 5IEHB 1GKEA 1MJ7H 4I0PC 1FZOB 2JI2A 1NEZG 4FP8H 3QUYD 1ACXA 1FNHA 4JO5A 1GJUA 4NI3A 1TFPA 1KYOJ 2CIKA 3D48R 5D7IA 4BH8B 3NJXA 3ZTNL 3QNXB 4GP8B 4WJ5A 5L7XH 3P3SA 4UTBH 2FGWL 2VMCA 3MV8D 3CFNA 1TZOA 1HKFA 4M1DH 2FL5B 5IUCA 3NCWA 2F5AL 4GFXA 1PY9A 2X87A 3BUIA 4QRPB 5EU4B 3VH8B 1W72L 3QUXD 5E1QA 3LZRA 4X4XA 5TE4H 1G7HB 4F58H 3G5VA 3QORD 1HXYB 3L6FB 3D2UA 5FK9A 1WAAE 1S4IA 4ALAH 1NC2B 1OP9A 3DIFA 1UA6H 1AGCB 2OMZB 3NJNA 1HXMB 3HRZA 3DRQA 5IW1B 3I50H 4ZUUB 1BIHA 4X4MA 1Q9OA 4DN3L 3AC0A 2GQHA 1R1CA 5BUGA 5E2WH 1ZV5A 3KPSA 3MLYH 4YK4C 1JCVA 1BZQK 1SVBA 3ARGC 2K8MA 2Y9RT 4WO4B 4XCCL 1KT2A 2YPVL 1U58A 3T0EB 1MCEA 4J3XA 3RQ3A 1INDH 5I30L 5JW4M 5AW6B 4ZRGA 2BZDA 1BFSA 1RUQH 5IWLA 5JMOC 4Y1AD 1KCUH 4U7KA 3LH2L 3B3IA 3CFQA 4JFZH 2NNCA 4G8GE 2WWKO 3RX5A 3RY4A 4N0UB 4ZAKB 3ECUA 2AJSL 1F6FB 3BQUA 5H35B 1GOHA 5EZPA 3HHMA 2CKBL 4FNTA 2YOCA 4W4NA 5C3IA 1ASOA 3GKWL 3U4EB 3KEHA 2BS9A 1BBDH 4BFKA 4JVPA 4CKQA 3MRNA 3ESVF 2KYIA 4GH7B 4TNFA 5AAMA 2JCCF 3TCXA 4Q52A 5E51A 4CC1A 1E65A 4CNIA 4FQ1L 3F7QA 4URTB 5LB1A 1U2HA 5L2KE 3II2A 5F3FA 5F6HJ 1N10A 2IGLA 3WUWG 3CHSA 3BAXA 4OFKA 2W65B 5DHYB 3QIUC 1ZLVH 3A6BL 4NO3A 1S7XB 4LLDB 2QVTA 5EEVA 12E8H 1U8QA 3NP3A 2FJSA 4C83A 3V10A 3O4LE 4YPGB 3RFZC 3NZSA 3QEQB 4R6UA 1N19A 2F58H 3EH4B 4F7EB 2JB6A 1KB3A 2PWHA 1G7MA 3VVWA 4AYGA 1A7OH 4QLRA 4W9GC 4XXCC 4OIBA 5AALA 3SDCA 4F3FA 4P3CL 5L9DH 1C8PA 5BZWB 5F1KC 1CI5A 4G3YH 2HTKD 5DGRA 5KAQF 2FX7L 1ECYA 3EYSL 2X4QA 4M6ML 4I1PA 2N59A 3FU7A 3OG4B 4RNRB 3ZR6A 3DRTB 4BH8A 1CLZL 3QIWB 1TVBB 2YEZA 3IN0A 3HLAB 3TV3H 5SX4I 2WQRA 2HPOA 2GSIA 5GIRB 4ZG1A 1J5HA 2W0FA 5DS8B 4P5SA 1SHWA 4RMRA 2NXYC 5I71C 1ZVSA 1S5HA 4LVHC 5DC9B 3VH8A 4EQ3A 4FNLH 4BSWA 3QI9C 1QFWI 4L8SA 2YUVA 5ICZA 1CR9H 2KBGA 4P4KD 2DKSA 1R4XA 4MYPA 4RX4D 2D7PA 4LLUA 4XCYB 3I9AA 5DRZB 1WZAA 5DYFA 5CLYA 2ZOTA 2V6HA 1KGCE 3UAJA 4APQC 4FA6A 2OMZA 2V3EA 2XX0A 1HXMA 5DD1L 1INQB 4WI7A 4HLJA 5I17A 1UCBL 2BJMH 2AJYH 4MLIA 2Q8BH 2VLME 3GT6A 5DWUL 4I0CC 1HJCA 1PKQE 1OZUA 1TO5A 1AFVL 3R0NA 4IRJD 5GJSL 2F54A 2X6AA 4GI9A 4P49A 5FCUL 5GS2H 1A4KB 1KYFA 5I5IA 2BY3A 2HJLA 3HJ0A 3QXTA 2DV6A 5EU7C 1IJ9A 2NQCA 1HSAA 2BOLA 4IHBA 1OB0A 5DEJA 1KB9K 5L8KB 1CZ8H 2XN9D 1B2WH 1DJGA 3VH8G 2Z8RA 1U8HB 5HYJE 4LDEB 3D39E 2E46A 2XA3A 1YN7B 1IEAB 3MRLA 2FNWA 4Y2DB 4JFFB 4RQQA 4YBLB 1CF8H 3O9WA 3AMKA 4PJAB 4ZOEA 3MQIA 4G6JH 3MA7B 2D0GA 2NLJA 4IU3B 1J5IA 5MP6H 3KG5A 3PABB 1FH5H 2W65A 2X10A 4DIXA 3G5YB 1BG9A 2CBPA 2FJFA 3QUYC 4PJHB 1IRAY 3EJPA 3RUGE 2BHYA 5GGRY 3BFWA 5DHXB 2Z9TA 3GSWB 4JZOA 2IDTA 5DURB 3T3PB 4WFHE 3QEQA 3VMOA 1GHFL 4XBMA 1PNDA 4J6RL 1E40A 1E8XA 2C1PB 1XD1A 4U1SA 1ZGLM 1LEGB 2BSEA 3L1OL 3F6IA 2FJGB 3O6KL 3PWJA 4TNVK 2DD8H 4K07A 4OKDA 3QUXC 3EO9L 5ERWB 4RNRA 1PNCA 3ASOB 4EKXA 1VGKB 3LKQB 5FYLE 5GZNA 4HPHA 2J20A 4YSUA 5ACLA 3QORC 2H2PD 3I6SA 4NQCB 2Z35A 3OJVC 2A9NL 1HQRA 1YA5A 4RFNB 4G43B 1WBYA 3BE1H 3RI5F 4WU5B 5FB8B 3IRCA 5BRQA 3ABLB 2VC2L 3NAAL 4MNHA 5ICXA 5T1LA 3DX6A 1G9HA 4CW1A 4OB5H 3VXRA 5F7FA 4YHZH 1KOAA 3RWCA 4N4YB 1UJ3A 1Y6KR 4YNYA 3VWJC 2L7UA 5IY5B 1REIA 3QDAA 5D7JA 3V0VB 3IU3B 4DETA 3O6ML 2ERJC 2NX5D 3ZTNH 2V0AA 2OMTB 3CVIL 5JHDB 4PN6A 2QADD 5J13C 1RLBA 2FGWH 3BZ5A 2HFGL 2YXVA 1SLUA 2UWEA 4EKJA 1A4CA 3QBTB 4LHUD 5JR1L 1W72H 1RMFH 4CJ0A 2J5LC 3PU7A 1FSKC 4FULA 4FQXA 1KLGA 2XETA 2KERA 4CN4A 3HG3A 4I2XA 1QLEL 1AACA 1M71B 2A38A 2E7CA 5CINL 3V4UL 5MEND 4TNGA 4TSCL 1YEWA 4LASL 2RQEA 2C26A 2WO2B 4NHCL 2VL5A 3ZKNC 1QATA 2VDQL 4ZX5A 2CG9X 1RUKH 1HSBA 3KYAA 3UTTD 3UZQA 1JNJA 1HTYA 2FWOA 2W60A 3C9NB 1JCKA 5JXEA 4UYQA 1RFDL 3QIBD 3IDXH 3OJDA 4IU3A 1CGTA 4BUGA 2YPVH 4MJIB 4EUPH 5B1JA 2BP5M 4NWUL 2R83A 1S7TA 4GIOA 4MNQB 1KFAH 1XH1A 3G5YA 4JVUA 3UDWC 5KVMC 2NNFA 2HTKC 3QXDB 4PVNA 5HJGA 1NANH 1LP9E 3IM1A 4TS6A 4OI7A 3CDFA 4MMZB 3FQYA 2YRZA 3D0AA 2BP0A 5HGGS 2K78A 3EYOB 4TSBL 2VQTA 1O7SA 2AJSH 3LEXA 5DD0H 1XTMA 4KQ3L 2CKBH 1DEEA 2NZ9D 3BMVA 2DKMA 1LEGA 3CWGA 4EDWL 3WD5H 5ERWA 4B9PA 3K7UA 3C75A 1U0QA 4OD3L 4XOAA 4FQ1H 2IPKB 1TEFA 2OR7A 1IFRA 2ZXBA 5DT1L 4JRYE 5F7DB 2R0KH 4O4YL 3LS5H 3TA3D 3A6BH 1WH0A 2DMCA 5EOTB 3VTAA 5FB8A 5I1GL 2CO1A 3HS0C 1IVLA 3U1QA 4U6XB 5M94B 2QSQA 4H8WL 3GK8L 3AY2A 4P57B 4RAUB 5A2KH 3LRHA 5I66A 4JFHE 1VESA 4XVSL 4ZUWA 5E8DL 3W39A 1NAMH 3K72A 4IRJC 1DBML 1NUFA 2IPUG 2ZX8A 5FR3A 3O2DA 2FX7H 3EYSH 1HXKA 2ICCA 4M6MH 5I8KH 4R96A 3V0VA 2XIBA 2IH1A 1CLZH 2CO6B 2NZ1A 4AGNA 1ZEAH 4ZUTB 2OMTA 3OR7A 1TQSA 5CEZL 4IGBD 4PREB 4Z0BH 3UCQA 5IFAL 1OWWA 4PEEA 3M7FB 5E2UL 4JG1L 2WYIA 3ARTA 4LB8A 4WW1A 2BP8B 3HE7D 1UWEL 2BO0A 3AADB 4PB0L 1MLCA 4IBYA 1BZ9A 2J57A 3DTXB 4BFEA 4ZMWA 4OZFH 2ICES 2JI3A 4LSDA 3TNMA 4W6YB 2IANB 4JKKA 3P4OB 3SPHA 1KPRA 3FQRB 5FGCB 3V4VH 3X3FL 1MFVA 2DICA 1YRKA 2F18A 4HG4J 1YYML 3UZVB 3EDEA 1MG2C 2ZWKA 1NCWH 5E6IA 5E0QA 2V2WA 5D7EA 1IGCL 4Y4KB 2EAEA 2Y1VA 4LSRH 1NFKA 1MCFA 3IPBA 2HPTA 3EGXA 3NEEA 4KH2A 2XQBH 4PJDA 3SDAA 1H8OA 3NCYS 2Y6SC 2H3XC 3HUJE 5GJSH 4MZIA 1V27A 4G8GD 5FCUH 5FM5M 1KTBA 1XGPB 3MLTB 3PJNA 2OL3A 1LE9A 5C0EA 4HYTB 1RJYA 3CHPA 3QXDA 4RMBA 4AENA 4ATWA 4YJZL 3KPNA 1Y0LA 5DLMH 3MV9B 5CKGA 2WC7A 4PRDB 4HX1B 4HDIA 5L2KD 4A38A 4KNSA 4NN5C 2BPBA 1TITA 4POZD 4KHXL 1R3LB 3IAPA 2MQGA 2VR8A 4IIQA 5F1OB 1FL6A 5AW9B 3ZHDA 1RP9A 4PQXA 2CJTA 2XQYA 1XGQA 4XO8A 3O4LD 3QH3B 3AMLA 1FAIH 3M17B 1P2CB 2C9VA 4JFWA 3BH9B 1HH6B 4TVUA 1QPXA 2A99A 2FHBA 4AIZB 3IJSA 5IW6A 4N2CA 3TZVB 2IH3B 3ZO0A 2DQJH 1AMYA 2Z92A 2V2XA 3IFLL 4U6XA 3V0AC 4LCCA 2AFNA 4IBQA 3D51A 4RAUA 5D1ZD 2HFEA 4Q7DA 4FZ8H 2E5EA 4PY8J 1Q8MA 2QADC 1GHFH 1H6EA 1QTSA 2AQ1A 2NY2B 3L3OB 3ZQWA 3D12B 4F33A 3QXAA 5DVKA 5A2JH 4JQVA 4APXB 1DVFB 3L1OH 9PCYA 4OLVL 4BZ1A 2GK0A 3EO9H 3KPQA 5DHEA 1FJ1A 1XH2A 3DGDA 1E4XL 3VCLA 2ZQKA 2EUZA 4ISVB 4ZUTA 3X3GL 3SCMA 3MNMA 3VFSB 4AM0A 1NCAL 1BVZA 1K72A 5I6NA 2AJ3A 1Y6NR 1KGCD 4WDIB 5INDB 1PF3A 3NAAH 1UZGA 4PW3A 5LXGH 1CBVL 2YSSA 3IKCB 3GJFH 3TYGH 2IANA 3RGVA 4PLOB 2VLMD 3RYMA 2YEVB 4WUUA 2YD0A 2VDMB 5GRZA 1MWOA 5DQDL 4K7PY 2WWNA 1GOGA 1SJMA 3BGMB 3QIBC 3U25A 1DUYB 1XV8A 3H9SB 1CLVA 3P02A 2F8OA 4PG9A 4L3CB 5DD5H 2ZUQB 4U0QB 2P4AB 3CVIH 2XBTA 2BSDA 5AAWC 1ETB1 4OW6A 5TQ0L 1GXEA 3BUBA 2MOQA 1LQSR 5MEPB 1XIWC 1MPAL 2GTWB 5AW1B 5F9WB 3EGSA 3TBSB 3OHMB 3RRQA 1FLRL 5HYJD 1DFXA 4WIQA 1J5CA 3KXFA 3D39D 1ACCA 2NZ9C 3DXAB 3KH3A 4WI0B 5DWPA 1SVZA 2MNUA 4CL7A 1YEGL 1QLEH 1R3KB 1UXWA 4JZNB 4MJ6B 5CINH 3ZL4L 3MV9A 4KZCA 2ATAA 4M4RB 5DJYA 4I48B 3Q9PA 1KGJA 4HX1A 4IIZA 4LASH 4PRDA 4TSCH 4Z7WF 1KZQA 4HJIA 3UXFA 3P3YA 4J3TA 4IKIA 5AB9A 2VDQH 2X6BA 3HFFA 3BIKB 3TA3C 5T3XE 1LEIB 1S9VA 5LBSH 2CO2A 2P24B 2Q76B 1OP4A 35C8H 1QFPA 4L48A 1CICD 3KGTA 4N8CL 3ZDZE 2WSDA 2MHAA 1RFDH 3CVHB 1GCYA 4MDIB 1A65A 4L0ZA 3QDGE 1MRDL 4WFHD 3REWA 1EFXB 4ZFZA 4AMXA 2WKLA 3BH9A 2X1WL 2VUKA 3V9CA 5INCA 2NY0D 4NWUH 1HH9B 1F2QA 2CM6A 3A4AA 1I3GL 4XPFH 1E6JL 3TZVA 3C5SB 5IK3A 2CRYA 1UACL 3WFDH 2OMXB 2FE0A 3CFEA 1N67A 2AJVH 2O61A 3PHQA 4ODXA 4KQ3H 2VDKB 2XVGA 4ZFGL 3L4WA 4M9OA 1IZKA 4LSQH 3RWFB 1YEHL 1RPQA 1ED3B 1RVFL 4N1HB 5IHHA 1JXFA 1I8LA 3WL9A 4BZ2A 2CGRL 5EEZA 4OD3H 3ECBA 1UZ8B 3EHBB 3VFRB 2AQSA 2UXTA 3W11C 1BEYL 2C8NA 3N42F 4GAYB 5DT1H 4R0LC 1T6BX 4AQ1A 4KO7A 4F9PA 3US0A 4RESB 5JXAL 2ZXDA 1BYPA 1TFHA 3O6LL 2BC4A 3T08A 3HHRB 5ESQB 4TQHA 2CO7B 5EFIB 2ZJSH 3S96B 4AC4A 3GUTA 3LQAL 3Q2VA 4NJAH 2ZP8A 1BWMA 4NQVA 1NH6A 3D4GA 1TZAA 3SQRA 3WSQH 1T2XA 3RJOA 1ZY9A 4FI8A 4G6AD 2EIJB 1KLFB 3FSZA 1BDYA 2XN2A 4YDKH 2AJXH 4ZUVA 4IRSB 4OF7A 1HOCB 4N2DA 4KDTC 2VM9A 4YHYB 1P7QB 1SOKA 2RD0A 4R7DA 2WWMD 1I1FB 4TYUA 5H94B 3LKRA 4XNUL 5J5EA 5CEZH 6TAAA 3GEFA 2GY5A 3HG2A 5IFAH 2WNGA 3MC0A 4JG1H 2CZNA 4P5MB 5CM1A 1A0QL 1G9MC 3TPUA 3AZUA 4BFFA 4PRIE 1UWEH 3RAJL 3TBSA 2DOCA 4J8RA 1MFEL 4POZC 3U7AA 2HX7A 3RX7A 1KBKA 1P6FA 2WIMA 1FRGH 2Z7YA 5IMMB 3P4MB 3RL2A 1KSRA 4Z5RA 4ZZFA 2LHAA 4I5BA 4M4RA 3G6AA 4I48A 4K8RD 1YYMH 1SLXA 1YQVL 1V3KA 3EOBA 3S0PA 4JG0L 4F8NA 3GF8A 1G4RA 4LXFA 4GSXA 2YAQA 2QJDA 1E4WL 5CJXC 2QMKA 3EUDA 2N0MA 4YHNB 3G7TA 1BGXL 3MRMA 4PBDA 1GYCA 3RWHB 5TE7L 5EPMA 2XJLA 1JP5A 1JHKL 3JVGC 2IQAB 2WNWA 1TUPA 1A3LL 3S37X 5I24A 4GUOA 4IOIB 3SJVA 1RJLA 3QNYB 3C5SA 3STLB 1E27B 3BUQA 4HIXL 2H0JA 3AWGA 2UY6A 4OFQA 4JZJA 5KBDA 2XBZA 3D25A 4OZ4B 3HAEH 2WQUA 4PCSA 5B3SB 5D6DA 2J6WA 4F2MA 2W95A 5JQHC 4JO3H 1JZJA 4TL5A 2KLSA 1TLMA 4JRYD 5B7EA 4FHBD 1ZKAA 4HK3J 3X14A 5DZJA 1A4BA 1AHWC 5E2TH 1I7TB 4G6ML 2X4TB 3ULVE 2Q7AA 1UT1A 2IDUA 5IROA 4IKKA 1ZXQA 2H7WA 2WTRB 5M7QA 1UZ8A 3TO2B 2AXJA 3GXIA 3K2IA 1BFVL 2WCSA 4RGOL 4N0CC 1LK2A 4JFHD 3FONB 4YO0B 4XMZA 4P06A 4PCYA 5E99H 4JUSA 3RVXD 4UZUA 4ZW3A 3UADA 4PTUB 5I1EL 5CCJA 3II3A 5BPPA 5ESQA 5KS9F 4MCZA 4YFLF 3VB9A 4Q56A 2A73B 2KLTA 1RU9H 4F8LA 4ANXA 2DQDL 2E59A 2NXZC 3DX8B 4UMGA 1D5IL 2APSA 1KLFA 1XF3A 3O6FA 4O51B 4BDVA 4QRTB 2MCAA 4DOHB 2ZKXA 3OKYA 3HHSB 1F4HA 2WZAA 2LU3A 5J6HB 2IQ9L 1DLFH 4OVVA 4AE1A 2J7LA 5H94A 1TYEB 1BLIA 1WS8A 4XP4L 1P5VB 4RGMB 1KDIA 1RHFA 3JV6A 5E95B 2IGFH 1BG1A 5DMJB 4Y5YA 3W81A 3EFDL 1CLOL 4OJYA 3MJ8B 2D3JA 3TWYA 4H8PA 3P4NB 4JQXA 1U92A 3QWRA 4KMTH 5FGBA 1CBVH 1GMEA 1JVKA 3DGGB 1CFTB 4HOZA 3W5NA 2GJ6A 4QRPE 2EYSB 4JO1L 4PS4L 1PYWA 4DPAX 5DQDH 1UD2A 1DP0A 2DF3A 1GGIL 3VXOB 4PJ9B 3WV0A 4MAYB 5IMOA 1H0DB 5DEFB 3LH8A 4IDJL 3S8WA 2P8LA 2NY0C 1ZS8A 3IMSA 1RUMH 3L3IA 4ODUA 1E5YA 4PTTB 4A2GA 1NC4B 1DBBH 4U3SA 2LFGA 4OU3A 4NO5B 4UDUB 5TQ0H 2H0PA 2NY4B 5A40E 2SODB 1NGZA 5TH2A 3HN3A 4N25A 2AQQA 4HJSA 2IQAA 1QRKA 1FLRH 4Q6IA 3QWOA 2FJUB 4NQDA 4QHLA 4TL4A 4N2GA 4XP9H 1FVCA 4HJGB 4KK5D 2WN2A 4WY7L 4P23A 4I77L 5DRXA 3SGEH 3ZL4H 1NKGA 2ENJA 2YSTA 1SQ2N 1I8IA 3FC8A 4U1LB 2IG2L 4F7MB 4HKZA 2DQTL 4EXPX 3LKOA 4AEEA 4N0UE 1E42A 2GITA 2ZXWB 3FL7A 3N1FC 4HK3N 2OMUB 5DC0A 1SXNA 2DWDB 3C60A 4JGUA 5AOZA 5C6WH 2WTRA 1NLDH 3QNZB 4IMLA 2MKLC 1OHQA 4G6AC 3UTSB 2WANA 4WI9A 4AYMC 1JF1A 1I3GH 2YGVA 2NTFB 4YHML 1E6JH 4KI5E 4PTUA 2P3YA 4HG4K 5ID1B 2EVGA 4Z7VE 2X5PA 4N5ED 1FORH 1UACH 3P69A 3LX9A 2UVEA 1KBGH 2JTDA 1EUUA 1PS3A 2WWMC 2OYPA 5LLIC 1FZMB 1T7WA 3J27A 3MREB 4PRBB 5KSAD 2VLKE 3G5XA 4DQAA 4C56A 5IT2L 4B3VA 1ZANL 4NKDB 1YY9D 3W0WA 3JT0A 4DZBB 1YEHH 2Y0SA 3CMOL 3CZSA 3HG4A 3QXVA 4M48L 4WUKH 1RVFH 1I1CA 4FA7B 3LZLA 1D9KB 1X7TA 5IB2B 1SUJA 1I82A 2CGRH 4CMHB 4OCRL 1J1OH 5IHLB 3GI8L 3MRHB 4R7NB 3L7FB 4FQIH 1BAFH 1PX4A 2LT9A 3I6KA 2OA9A 5K1VA 2VUYA 4OSUL 3BKYL 5FECB 1CDYA 2W0LA 1OPGL 4PVMA 4ERSL 4KOCA 1BF5A 4Z95H 3FO2B 3RZCB 1Z9PA 3LQAH 5F7WC 3DGGA 2GSGB 1UD4A 3TO4A 3EF7A 1VERA 4J3OG 3DI3B 4PJIE 3TIEB 2ZT9C 1MREH 2ENYA 4XP6L 3HI5H 1PX3A 4PHXA 1E9QB 3ARBD 2PPFA 1TIUA 2ZP9A 1H0DA 1JMZA 3DUUB 5JHAA 1CD1B 3W2DH 1UKSA 4L4TA 3L5WB 5CJ5A 5I0DA 3HCVB 2JKJA 4U1IB 4FFWC 2WD0A 3HNTL 3M1CA 5SV4A 4XNUH 2LVEA 1MRFL 3T1FB 3FULA 5IV2A 5CBAA 4HP5A 3OAZK 1A0QH 4HGWB 3RAJH 1NTDA 3LRGA 3BP5A 2I32A 3FTGA 5F97E 5T3XD 3ZN6A 3MCLH 2AC0A 4XNMB 3K6OA 1FL5A 4ZX3A 5D5ME 3MRGB 4V2CB 4P8QA 1U4FA 3WN6A 1IKOP 2D31A 1YQVH 2J8UF 3RDJA 5LJYH 4RMUA 2XKUA 4JG0H 1P53A 5B7MA 1K2DB 2VXUH 1IC4H 25C8L 3KYOA 3PGDA 2LU7A 2G30A 2B5IC 3K2MC 2OMNA 3IDYC 5TE7H 3LDBB 4NZJA 2OJZL 3IE4A 1ZVNA 4JFFE 5KS9B 3DSNB 2Q7YB 1JHKH 1WZ1L 4K5NA 5KYWA 3T4AC 4IU2B 4L8DA 4ABWA 1OF2B 5ICYB 2R29L 4D0CA 1LYQA 3MX0B 3UYRL 1GY1A 3IVKB 4EDXB 5BW7C 2UUDH 3DPBA 1CTOA 1MCLA 1UT9A 3CZLA 4XXWA 1MCJA 4DP1X 4MSWB 2KUTA 4WAFA 5IR1A 3K5RA 1JGVH 3OTTA 3S97C 3VXSB 4PJHE 5CSZA 3EH3B 4PRBA 2X4NA 4W9EC 1J5DA 1FFPA 1JNNL 1U8IA 4MA8L 4WKXA 3MROB 3FH8A 4DZBA 1Q1JL 1U3JA 2Z8WC 1PZ3A 3OKMA 3H9HA 1QPPA 3ISRA 1M6OA 3B2DC 3HMXA 1J1XL 3BPLB 1EIBA 1SYSA 4RGOH 1OGTA 2DIJA 4JM2A 1EAJA 3DVNB 3QC6X 4Y9EA 2Q2LA 2EKJA 2APFA 1AS6A 1UOLA 5EWIH 3U6XA 3FTYA 3U48A 5I1EH 5FECA 3BVWA 5A6IA 1BA9A 1M05A 3L3GA 4M7LL 1TQBC 2V5RA 2HFTA 2E75C 3E8UL 4NQCE 3FO2A 4X4YB 2ITDB 1I8UA 2OSXA 2QKIC 4HH9B 4ICXA 3H56A 3AXLB 4JREB 4RBPK 1WJ3A 2EACA 1CN4A 3TURA 3C6LA 3FT2A 1D5IH 3O3DA 1AE6L 1PFOA 1Z9OA 3MV7B 3AU0A 2H41A 3TH4T 5JW4R 5L8JB 4L1TA 5HHOB 3TH2T 4PRID 4YSAA 4KXAA 4E0RB 2IQ9H 3VFVB 5IQNA 2YAHA 4HCIA 5E4OA 1W0WA 5JUEL 4BCZA 4KKLD 4KK5C 3ROOA 3JWNG 4NN6B 3F7RA 4W70A 3P30L 1SFHA 2HLAB 3H3BC 4HIHB 3MLXH 3HE6D 5D4IA 4GUQA 4QHKJ 3EFDH 1CLOH 1RZGB 2MPVA 3O81A 4PGEA 4PCKA 5E1IA 5CHNB 4ZT1A 5HSFA 2PCYA 3ATBA 1TSRA 1UM4H 4TM9A 3GBEA 3MV11 4FQPA 1HHIB 1OD9A 3NZ8B 4UT9L 5A6MA 3ETBF 5DUPL 2CA4A 4XNMA 3ETTA 4BEIA 2R2HB 2WBJC 3ULUL 1QR1A 2ZUVA 4JO1H 4PS4H 4PWKA 4Q14A 2GY7B 1JYWA 2DH2A 4NRZA 2AI0L 1DSYA 2VDRL 1I4FA 1E9PB 2QGCA 4JLRA 4IDJH 4TLTA 1GZHA 3AXIA 2EIBA 1OTSD 4CRPA 3TM6A 3ECQA 3C8DA 3AXHA 4PJBE 4PSRA 4GP4B 3D3VA 4KITB 1M9WA 4N5EC 2JCCE 2XRAL 5FDWA 2VXQH 3CDYA 3KLDA 4ZMNA 2CLRB 2XACC 5SX5K 2BK8A 5KSAC 2N01B 5JLZA 2Q7YA 1OAUH 2ZSVB 2BSRA 5CJQL 1X7QB 2YOAA 5TD4A 3ESNA 1YY9C 1MHPL 2ZXEB 3VFGL 5ICYA 4HUMB 2GG1A 4DP5X 4MJIE 4GRLD 4EDXA 5BVJA 1O0VA 1PZCA 1QLRA 3ABMB 3K2UL 3ULVD 4I18A 4MNQE 4LOUD 1UUSA 3OKKB 2D73A 3M8OL 3ARDB 3VXMB 5B39A 2IG2H 2Y24A 5DSCB 1E5UI 4FQQA 4MAUH 3M86A 1G9NH 3BHBB 4NO0D 4X80L 1DL7H 1GSMA 2WQ8A 4IKJA 1QFUL 3QZWB 4EVNB 3MROA 2ED8A 4F9LA 1ZHBA 3FOMB 2RR3A 3MJWA 3EJZC 1EVUA 4BHUA 4GNKB 3L17A 4NQEA 3RE0A 1Q9LB 2EDQA 4UV7L 2HWZH 2DL2A 4NQSA 3R06B 4BKSC 4OQ1A 4ODWA 5I73C 5EZLA 4YHMH 4IEFB 3ARBC 2PKDA 5GRJL 3BIBX 2QDWA 4HISA 3MBWA 3LRLA 3CFJA 2Y1ZA 2MCPL 4X4YA 5CIPA 4E41A 1NWOA 4FQCH 3WBDA 2ZCLL 1OSPL 1GGYA 1QHPA 3FQNA 4NUJB 4JANB 5C86A 4OCSL 4XN8A 5FHAL 5IT2H 1ZANH 4WJKB 4Y5XC 3CMOH 4M48H 4YR6A 2O1AA 1FNSH 3GHBL 1I8MA 4L18A 5HHOA 2CALA 2VDNB 4E0RA 5B39G 4OCRH 5IESL 2CJUH 4CBZA 3BISA 5DRWB 4QRPD 3B1UA 4OZGF 4ZX4A 4N8PA 1DE4B 5T1KB 3GHEL 4X6FA 1OPGH 2FSEA 5B1BB 3ZLQC 4ERSH 1NBZA 1F1AA 4IBUA 1G0DA 5IQ9A 4WNQA 4NGHL 2D7MA 5BRZB 1F90L 5I76B 3VUAA 2FWUA 3O3BA 5J6SA 4UB0L 1DO5A 2VKXA 3OV6A 4XP6H 4GKNA 1A6UL 5DHVB 1JGDB 3TFBA 3OBAA 5E9DA 2NNAA 2DPKA 4LLMA 1SY6L 5FGCE 3JWOH 4MB4A 5EU6E 1BECA 4WO4D 3UACA 3ZKXC 2JQZA 3JTTA 5C8JB 1HHGB 3HNTH 3JUYA 4MD5B 4TQPA 4U7MA 3WNJA 3TT1L 4PG2C 4ZMVA 5E00B 2J72A 1Z32X 5JHBA 1WG3A 2DQUL 1CQYA 4GSQA 1AZUA 2AMGA 3LIZA 2QPUA 3FW6A 3HLKA 3NJVA 4S1QL 5IVXA 4ZAKD 3A4FA 1T89C 1F11B 1K8IA 1P4UA 2FX8L 4HCRL 3GS0A 5F7AA 5I6PA 2ZP0T 5ID0A 4PUBH 3INUL 3LXBA 2OXHB 3PHSA 2WAHA 3CSPA 4H2AA 4Y4FB 2DEXX 2HN7A 4GKZB 4H8WC 5BOJA 4JPVL 2CK0L 2B0SH 4AYSA 4HMEA 4ZPTA 3QJVB 4PGDB 2BDNH 1DQKA 4F1ZA 4MYWB 4KI5D 4P4RA 25C8H 1JK8B 4BA8A 1TZGH 2YRBA 2O6EA 1VIWA 2I07A 3ZX1A 4LNRB 4A6YA 2EEBA 3PL6B 1Q9LA 1XCQA 2A6JA 1WZ1H 2VLKD 4XCEB 2DEYX 4OQTL 2WSPA 4UIMB 4AJ0A 4Z76B 4ZQKA 4Z7OF 2R29H 2D7QA 2K4WA 4IEFA 5IFJB 4Z23A 3HB3B 3S3CB 5IG7B 2GBAA 4QWWD 5I6OA 1KCSL 1PZ5A 3DOSA 3SOTA 4CADB 1PTZA 2EVIA 3MRQA 2E47A 4KKLC 5CU5A 3TP4A 3SPVA 5EO9A 5AW2B 1N64H 5H37G 4MA8H 3SD5A 3CN3A 2PO6A 1FVDB 3HE6C 1DVUA 43CAA 2F1AA 5EF2A 1Q1JH 2XZZA 3L48A 3QIWD 4NAMA 5C0IB 1JK9B 4HUWB 1C5DB 4OUUA 1GS8A 4FE9A 4PJEF 5FYJE 4BSJA 4DFIA 1J1XH 2IV8A 3TIDA 2UZIH 2VTFA 2YLKA 4NX0A 1R46A 1PVHA 1LO5A 1WAEA 3QZWG 5D71H 2FZ3B 4N8VA 5AB0A 3JYBA 2FECI 1M1SA 4RAVB 3GRWH 4JCWA 3HI1A 3QG6B 4M7LH 5I6XC 3E8UH 1JJUA 3QJHB 4P5TA 1G6RL 2A3TA 2DTSA 1J86A 4H0HB 4F2FA 3EZJB 5FM4A 3ERXA 4BA0A 4HZLB 1OK8A 2EDFA 4PJGF 1TPXC 1ZLSH 1MFBH 4Y5VB 4UI2A 3HZ3A 2WXMA 4HJJL 4J5VA 3K80A 4TLSA 5FS5A 4FYSA 4GI8A 4LOFA 3O8XD 3VA6A 3CZUB 3KPRA 5JUEH 3S8FB 1J8SA 2AQRA 3H9SE 5C8JA 1QQDA 2AJZA 2JI1A 3GSNL 4GRLC 2VXTH 4NPYA 4U1NB 2WIIB 4K23L 4MD5A 3T8VA 3S88L 3ULVC 3P2DA 5F7UA 4URKA 2CPCA 3DETD 3ES6A 3KPPB 4A67A 1EEYB 3CZFA 4LOUC 4CVZA 1TJXA 3CSYB 3LN4A 4GS7B 3DYPA 5F3BA 2VL4A 3CUPB 2ORBL 1T2QL 3KAAA 4PBVC 1QFWM 3GMOB 4PU2A 5DUPH 5BO4A 3REVB 1Z7JA 3ULUH 1GA2A 1S46A 2HG0A 4PJCF 4R4FL 2R1WB 3U6RB