5LLIC

Pvhl:elob:eloc in complex with vh298
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
141
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Potent and selective chemical probe of hypoxic signalling downstream of HIF-alpha hydroxylation via VHL inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 31
structure length 141
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2016-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 5lliC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 5lliC01
4W9CC 1LM8V 4W9FC 3ZRCC 4W9KC 4B9KC 4W9JC 4AWJC 4W9GC 1LQBC 3ZTCC 1VCBC 3ZUNC 4W9EC 4W9LC 3ZTDC 4W9DC 4B95C 4BKSC 4WQOA 4AJYV 4W9HC 3ZRFC 4W9IC 5LLIC 4BKTC
chains in the Genus database with same CATH superfamily
3WFEL 3FT2A 2DH3A 4GEIA 4ZAKC 4ZFOL 2V2WA 3L95B 2DKSA 3QDJD 1BJ1J 1EUTA 1QLRA 2NXZB 5BV7B 3ELAT 2ICES 4KKAD 4L2YA 2CO6B 2GTWB 4MCNA 2ED6A 2ZXAA 3S2CA 4LSTH 2X89D 4XPBL 4APXB 5D9SB 1DBAH 1XIWB 3BCDA 4Z23A 2NYYC 3BGAA 2VDPB 3P9WB 4JHZA 4TUJB 1G7LB 1S9XB 4ZO9A 5T3ZH 1OAUH 3Q9QA 1CN4A 2CJSA 2VDML 2ZUUA 4I7ZC 4XBPA 5AB1A 1SQ2N 3KYNB 3VWKD 5AW6B 4BSVB 1I85C 1NKGA 5HGDA 4PRHD 5JA8B 4TN9A 5IREA 1CTOA 3RKDC 4O02L 3C60D 2NZ1A 3APFA 2D03H 3EDEA 3L4ZA 3ZKXC 3P4OA 2G5RA 3WUWG 4R7DB 2NNXA 5JTWA 5HDQL 5E9DA 5DZJA 1PSKH 2FT6A 4JQIL 4CMMB 3QO1B 3PNRB 3AG3B 3MO1A 4QHUB 2FWLB 2SEBB 2A74B 2ZP9A 9CGTA 3T8MA 3FOLA 4DGIH 5JXAL 3WLBB 4NC1C 1EHXA 4XX5A 1ROWA 4CRPA 4PWIA 3QNXA 1IVTA 3ALXA 2XIBA 4GG6B 4G9FA 4H2AA 3BZ5A 4G1MA 3V10A 1KF9B 3R7QA 1OHQA 4GKNA 5D4IA 5SWQB 3MV8E 3LEYL 1OE1A 2QFPA 1BMGA 2L7EA 2PYFB 3IDNB 3QXDB 4YHPB 3PV7A 3H85A 4PR5A 1KN4H 2Q6WA 1IFHL 2F8IA 2MNWA 3VFWA 3H7LA 3EYOA 5IG7B 5I16B 4HAFA 1JNLH 3LRHA 3HUJF 4Z7VF 1RZGA 1M71A 3FB6B 2YAFA 4G6AD 5KOVC 1BQUA 4FXTA 2P5ED 3SE3A 3IE4A 1EMTH 1NGZA 5F0JB 4NZJA 3FRPA 4JE4B 2WSKA 4E41D 1BFSA 3EYVA 2FO8A 1F90H 1E9OA 5HHVL 2F5AH 4H2CA 2FBJH 3DSFL 4JPWH 1XHHA 2P5WA 4KPHH 3V6BR 3VQ2C 1FV1B 3MGTB 5EU5B 3DHMA 3HG1D 1XMEB 3I02B 5C08E 4RAUB 5JQ6H 2R1XB 1BD2E 3T6WA 5D6CA 1FVCA 4OCXH 1MI5D 1CFQA 5CP7B 3V0AC 2VCOA 1QPPA 4PRBB 2V8LA 2IF7A 4HW6A 4H25A 5JHBA 1HT6A 4TSAH 1QHOA 2YEZA 1S7TB 5IJVA 1NC4B 1L7IH 4XE0A 5C8JB 4PJXB 3ZR6A 1EEYA 3VFVB 5HHXH 3KPRD 1LDSA 4XOCA 1FI8C 3G9VA 3QG6A 2ZKMX 2PCPA 3TVMD 1FA4A 1KELL 4YEEA 2Z93A 3GT6A 4X9FA 4JQVC 1F1GA 1YMME 4R96A 3FQ2A 2W9EL 1QTYT 4GT0A 1QTSA 4K3GA 4NKOB 4WI9A 4ZDHA 3QNYB 2GVYA 1JCVA 1N7ML 3V52H 1OAZH 3ENEA 1P5UB 1SQMA 3D4YA 2OK0L 4M7LH 4PGBB 2AQQA 1F4AA 3CPLB 3OKDA 1DHKA 3QVAA 2KQNA 2QKIC 2EYRA 4XWOD 3HC4L 3SO5A 3K80A 3ARED 4M9OA 2VKWA 3NCWA 4IOIA 4HZLB 5F9WC 3GTNA 1B4JH 4RMSA 2WW8A 1A3RH 5EEYA 3PWPB 3TOPA 3GMRB 4N68A 4PJFE 3ZYZA 1OARL 3MJ8B 3FFCB 3AU0A 3SDXF 1LEKB 3A6OA 2AAAA 3MTRA 4XC3H 4PH8A 3BQUC 1J8HA 4AZUA 1KLGB 2TAAA 2XWBA 4HWNA 5IB5B 4IKNA 4O2EA 3AU1A 1F18A 1DQQA 3QCUH 4MCYB 3NIFF 1UT2A 1IAKB 5HI5D 2EE6A 3IGLA 1DUYA 1K5NA 3QDMD 5C0GB 1RIVL 1IAII 5H2BA 4DGWC 2MHAB 3SE4A 4AVIA 2VITB 1SEQH 2FJGB 3LQAH 3QUKB 3QJHA 4NYLB 5ID1A 4NZUH 1UFGA 4GAYB 5SX4H 4NSKB 4ZYKA 1QFWI 1FNSL 3QWNA 3C2AH 4LNVA 5GJTH 3FT4B 2GI7A 4J5VA 3ZY7A 4RMVA 2DQ6A 3QIWA 5D7EA 2D7TH 2VAAB 4FZEH 1IQWL 5D2LA 3QZMA 3MCG1 3BGMA 3RX7A 5LNGA 5MERA 5GS1C 1AZCA 2G4GA 3ILPA 2Q8BH 3WLWC 5JHLA 1AKPA 3KHOA 1AO7B 4X0NA 4MQSB 4G6MH 1Z9SA 5AAMC 4HIQA 2WGNB 4H8PA 5CIPH 1W8OA 3DIVA 4X4MA 1QPXA 1C5BL 3U7YL 2NY0C 4GO9A 3U1QA 2Y06H 4JFEE 1FO0A 3EGSB 3FU7B 4XNYH 4R0LA 4QY8B 2P8PB 4AIXA 3MGOA 4P46A 2C9QA 4OGAD 2AJZB 5GGVY 5C2BL 2N7SA 4X4XA 3SDDD 4ONGH 1U8PA 4GKZA 4ZMTA 2V5MA 3IFOB 1MAMH 4A2DA 3KWVA 5JPMB 2VDNH 4YXLH 1E50A 5FWQA 2DBLL 4FQ1H 5ESAB 3ZHDA 1NEPA 4RGOL 1ONQB 4WHTA 3J2PA 5HSFA 5A7EA 1MDAA 2DZEA 3LRLA 4KXAA 4HEMA 1YCSA 3RWFB 4JE0A 3UZVA 3GS4A 3ZQ9A 5HHPB 1Q9WA 4J3WA 1CU4H 1JAEA 1FN4A 2WZ6A 1IAIH 1I7ZB 2N1TE 2BJMH 3PAUA 4QRQB 1HHGA 3HLKA 4YDLB 3LH2H 2MQ3A 5KVFE 1IAOA 1Q94B 1QI3A 4X0KB 1HQ4B 2BS71 2A73B 4QTIH 1T83C 3TEUA 4Y2OB 1L3WA 3LQZB 4DVBA 4PRID 2Y36H 4XODA 3MREB 3V9CA 3A23A 4OLUH 1I7TA 4N2CA 1MFCH 1JPFB 1V3MA 5CLZA 4WEBH 7FABH 2GFBA 5E6IA 2YN3A 5EHFA 5CFAA 1HILA 1CGWA 4OCWH 5C0NC 2LU5A 1A1MA 4JN2B 2FD6L 5F96H 2KMWA 3OV6A 4BGLA 4I9WD 3IFNL 4HFUH 1KCWA 4XAKD 1M7IB 4FCAA 1ETB1 3BLBA 1U8CB 2B9AA 1IBGH 2XIDA 4ZRGA 2XV0A 3QBTB 3MDJA 3R7RA 4XTRC 3TNMB 4EE2A 1I9JL 3RGVC 4RH4A 3V0WH 4QRTA 3HPLA 5HJ3B 2LE9A 4JRFA 1TJHL 4IMKC 4PIRF 2WLNA 5GRVL 1IGJA 3MROB 4NQDD 5I30H 1BIIA 4YL4A 3B2UD 2O93L 5KYYA 3BSGA 3T4YB 1VSCA 5FECB 1IVLA 4NQVA 4PRHB 5MENE 3EJRA 5IMKB 2YXVA 3C60B 4WU7A 4FTDA 5HJGA 4GRMA 3T1FA 5IEKB 1RVFH 4XMUA 3OGCB 5DUML 3MXVH 2YWZA 4M43H 4UNUA 4Y16D 5BQDA 2EDYA 4Z7NE 4XNZC 4E68A 2OMWA 4TUOA 2IBGA 3ULUH 3HUJB 2D3LA 4Z7VB 4BZ2L 5C6WH 1R3JA 3SE8L 1JWUA 1D7DA 4S0HA 4NN5B 4IRSC 1Q9KB 4NUPA 1PD0A 3ROOA 2QR0A 4B9GA 1KJ3L 2WQSA 4S11A 3JWNC 2Q10A 4S1RH 1UOVA 1F1DA 4NIKB 4LEEA 1USQA 2PP7A 2CDFA 2Z92B 3EFOA 2A9ML 3L3GA 3CQPA 5EBLB 3RVXC 1GS8A 4FN0A 2LU7A 4PMEA 3TCTA 4PREB 4PHZA 3VFSA 1NMBH 2KQMA 3AWFA 3QIUA 3QGVA 4OF7A 1CFSB 3L4UA 3PWPE 4MA1B 2G5BA 5F7YC 2ZOWA 2H26A 3FFCE 1JZHA 1YPZF 1MCEA 3FHQA 3OKYA 4NN7B 3W82A 3FQ4A 4I85A 1IBZA 4PIBA 2Z91B 4OCLC 4X98A 1IEAB 1DBKH 4EPSA 1S9VB 2VSMB 4MMYA 3GTVA 2OJEA 3HB3C 2P5EB 1W0WA 1IC4H 2PUQT 4KAQL 1D5XA 4LPUA 4ZSOA 5SV3A 5G55A 2W5PA 2EH8L 4XNUL 4E41B 4Z7OF 5IOPB 1DVTA 4RFNB 3AQXA 3MLTB 4HPYH 5CD5C 5J3HC 3UCQA 3BXNB 4XGZB 1M7DA 5TFSH 1MRFL 1U33A 1QG3A 3C9NA 3HG1B 2CBQA 5DD6B 4ENEC 5K5YA 3B83A 4YK4B 4AYSA 1FLRH 2BMKB 1KTRL 1Q9OA 3M46A 2BC4A 2KLSA 1A14H 2ICWA 2BHZA 3MCYA 3VFGH 1PD6A 4U6XB 1NFKA 1AO7E 4HCRA 2F74B 3D85A 4HLZG 3AXHA 4UIMA 5K9KB 1B0GB 2UZYA 4UV4L 3O81A 1KC5H 4H88H 1BQKA 3ZZLA 4GP4B 3SDXB 2Z8SA 2J3SA 4N2FA 3KPRB 4YHML 2L4OA 4Q14A 3QEQE 4PRPA 4UILH 1TVDA 3TVMB 2JQMA 2UVEA 1OP4A 4YFLI 2TSAA 1I8MB 2E9BA 3JV4B 4PJGA 2G75B 1A9EB 2XKNB 2OSWA 1GYAA 1QHPA 1SDAB 3FFDB 2NCMA 3PUCA 4NCC1 1R34A 2C9UA 1FPTL 2AV7B 1FYTD 4FFYL 4B7IA 4KX7A 1J12A 3OM3B 4FXGC 1OPGH 5AQ0A 1T1XB 4MNGA 2NT0A 3M17A 4L0ZA 3U0TA 5LGHL 1GC1C 3AREB 4PUBH 1PG7L 1AZBA 2IPUK 3AS0A 4G11A 2ZUQB 3IDYB 1HYSC 4QHMA 3LZRA 1C12B 5LCVA 1IFGA 1UZ8B 5D1XB 5DYOA 1R33A 4UQIM 1ZHBB 5KYWA 3VWKC 4ZUSA 1VESA 5PAZA 3BN9C 2E5EA 4KK9C 1A1OB 3G9AB 3S3JA 4LF3A 4JFOB 2ZP0T 3P4MA 3CZSA 3U46A 1AFVL 2D7NA 4CKVX 4ZXBD 3S88H 3PP3K 3I3EA 2PF6A 2VDRH 4JM2C 3DHPA 1XGTA 3PCYA 1GIGH 4W4OA 4HOZA 4Z1PA 1HHIB 3T4AA 1UD3A 3SDAA 4Z3HA 2J6EH 2EXYD 4H1LA 3ATAA 2FECI 5DJYA 2GSIA 3JTTB 3T71A 3TC9A 3B3IA 1AGDA 1F6AA 3GKWH 1LK2B 2IBBA 3QDMB 4YGAB 5ADPH 4U0QB 2VISA 3QPQC 4G1EB 4NP4H 3FMGL 4TVUA 2CJUH 3HNTH 3QDJE 4GRWH 1F6LL 4NNXB 3LKSB 4Z95H 1IM9D 2OR9H 4ANUA 1XEUA 1AKJA 2YPLA 4AY0A 3EO1A 1JNHA 1FVDB 2XG5B 5I8EA 4FFWC 1FAIH 3NJXA 3EYFB 1A6AB 5A16A 3OR7A 3H9ZA 1Z2KA 4F9PA 1MCWW 5EU7E 2RA1A 3VFTB 1LDPH 3MRQA 5CR1A 5CJ5A 2D9CA 5D1QD 3GMNB 5HI4C 4JPVL 3VG9B 3SGDH 2QGEA 4JG1H 5C0JA 2QPFA 4P23A 3UC0L 2HH0H 3GQFA 4FDWA 1TQWA 4XCFH 3HI5L 1NQBA 1FGNH 5HY9A 1GC1L 4PRHE 3X14B 1XX9C 3ZT6A 1SM3H 3WSQL 4QUOA 3ES6A 2YZ8A 2NR6C 3SDDB 1F3DH 5FA4A 1OB0A 2XWEA 3BVWA 2CGZA 3G6AA 3MHZA 5DHEA 4ONFL 1WUNT 3RWCB 2JI1A 3BMVA 3HUJE 5DFVC 1R5IB 3VXUD 3EJPA 3CXHJ 2AJ3B 1MJJB 2X4QB 2R23A 1AR1D 4DFHA 1SFHA 2NY2B 4HWBL 1JZFA 3FN3A 2BXYA 4KVNH 3CZFA 1E4KA 3QJTB 1ZV5A 2IXQA 2RACA 5CLYA 1F42A 4GIOA 4U6YB 3RNKA 3S3BB 2AXHA 4HAGA 3GUTA 2DQGL 3MLSH 3KYKL 1R4XA 2H3KA 5JIPA 4V1DE 3DNKA 2QSTA 2CU9A 1AD0B 3SY0A 1GY2A 2V2XA 3UGEA 4KI5D 3LZLA 4UT7H 5LXGL 4X7SL 4KH2A 5DUPL 4RNRA 3ZRFC 3T0DA 5LLIC 5AENA 1CYWA 4PHXA 5TE6L 1WAAF 2DYPA 1U58B 3FTXA 4HHWA 5A6MA 3BE1H 4MMZA 4FQ2L 5T33H 2CLVB 4HK3J 3MLRH 2HCZX 1U91B 2VERN 4Y8AA 3GZOA 4K5MA 4L1LA 4PJEA 2VLKD 4MB3A 5F21B 3V4LA 5F72S 1RP8A 2XYBA 3NJFA 2HKHL 3TV3L 2XA8H 3B9AA 2I25N 1S7UA 4E41E 2BVPB 4D7PA 3IDMB 2X4OA 3RTQA 5IFAL 1CDGA 2B1HH 4MQTB 3HZYB 2LU4A 2DQUL 4Q89A 3FSWA 2OJZL 1DBJH 3PWNB 1UUSA 3HG1E 4HXAH 1QABA 2PWGA 3FT0A 3CXHK 3O2VH 3SYAA 2AXGB 3FT1A 1JD7A 4EDXB 1WZMA 4NQDB 2FJFA 1MI5E 1UKQA 4K9EC 1FZOB 4LCCA 1R24A 3H4HA 4KI5F 4U1JB 1E6JL 1MVUA 2DLTA 3CU7A 4PJHA 3IF1A 4HALA 1L9MA 2B0SL 5EEXA 1MCOL 1A6UL 4WHYG 4MD5B 1UACH 3BAKA 4G8IA 3CZGA 4WV1A 1YPZB 3VXMA 4Y16B 4IBVA 2WIIA 2XX0A 4CU8A 1BP3B 4PWKA 3ZJAA 4LPVA 2F08A 2FTAA 2IGTA 3ZPDA 1D6VH 1S3KL 3RWJB 1XV8A 3BUIA 3NIFE 1H15B 4ODVH 4DFIA 3IDIB 4LRIA 4NQXB 5CSBA 5DWUH 2V8MA 2AVFA 3C5ZD 4Z7OB 1I8LC 4KBPA 2BVQB 3VE0B 4E0RA 1N8OE 4X4YA 1MVYA 5CP3H 4X5XA 5DC9B 3MRPA 1OVZA 4UI2A 4RFOL 1SGKA 4AT6A 3FZUD 2C3WA 3L48A 4CADB 4XN9A 3RDTA 1KCBA 2LABA 2ENQA 3MRJB 5J56B 3WS3B 4X6DA 1NMCB 1G9EA 3OZ9H 1K9TA 1QVOA 2VSDA 1JGVL 1L0PA 4R8WH 5GS2D 2Q7AA 1E42A 3H7BB 1M9SA 3QQ9C 2EYSA 2Z31B 3BWSA 3DETC 1B4LA 4I0PD 4BA0A 1FBIL 3IJ7A 3O11B 2FX8L 2O5ZH 1NWOA 1QMUA 2J5LB 3WE6B 3QUZD 1KXHA 3CZEA 2IAMA 2Y07H 1TZHA 3CZUB 3FQXA 1AXSA 4FEMA 4JHAH 5CGBA 4ABUA 4PJ9C 2X2YA 1BA9A 3O6LH 3R06A 3UO1L 1SY6A 1S9YA 2ZX9A 4R3SB 4AYID 3I3BA 4WI4A 3V0DA 1KB5B 1R17A 4EOWL 1SLUA 4HWEH 4ZI8A 4MJ6B 2HUHA 1AIFB 5AVWB 4IRJD 3NDZE 4PV1C 2EEDA 1ZT1B 4U3XA 5BW7C 5CJXC 2WWOA 3TIDA 1YEHH 3BKML 2DQJL 1KTLB 4QPEA 1K8DA 3MNVB 3OQ3B 4NQEA 1C1EL 5I8KH 1OTSD 2BRQA 5EN3A 1AMXA 4GUPB 5KBNC 5HJDA 3NJIA 3GJFB 4AE1A 4OD3H 3B7RL 1J0HA 4OFYA 3S4SB 43C9B 3NJNA 3ZIMA 4PJ8A 3FB7B 1AGEB 4UMGA 3CSYB 4QRRA 4G83A 1BLNB 1ODAA 4ISVA 1YN6B 4L1SA 1MDTA 3W3BA 1BZ8A 3FFOA 4KFZC 2QQNL 5E95B 1TJMA 3D9AL 1Y6MR 4WSJA 1NJ9B 5DTFB 4WDIA 4WKZB 1RMFL 3ZSSA 5E4EC 4IYKA 3B6SA 5AW1B 3APDA 4TMPA 2X9XA 1MHPH 4DW2H 4DN3H 4N1EA 4WNSA 5FKAB 3MRNA 1CGTA 1XGRB 2CKBA 5IVNA 1CG9B 4GXUM 3IJEA 3OLEA 5SWSE 2PO6A 4A6YB 4OI9A 2XZCH 4XP9H 5JXEC 3WDIA 3W38A 1TTGA 3BKCH 2NPLX 5I5IA 5B1BB 5K9OA 1H9VA 2FYYA 1LD9B 1BBJA 3OSVA 4I48A 4M29A 2IO5A 3Q06A 5L4IA 3DGDA 2JKXA 3CC5A 3Q01A 2OBGA 3NTCL 5IMLB 4DERA 3LV3B 3K5SA 2FB4H 1KBWA 4MWFB 4BE6A 3ARBA 2WQXA 2WXRA 1ZVHA 1ECZA 1JIBA 4R4NC 1REIA 4WO4C 4Y4KC 1LE9B 3EUUA 4ZXBB 2PKDA 2RAMA 4PRIE 4IEFB 4L8SA 4ZFGL 5J4MA 2DJMA 2OP4L 5FGBA 5HHMB 2UWEA 5FO8B 2AEIT 3VRJB 1CCZA 2B1AL 4IOFC 2G2NA 4ORZC 4P48A 2ODIA 4DQAA 1QKZH 5JORB 1LO5B 4JL1A 1R3IH 2WN2A 2UZXA 3V0FA 4DP9X 2B2XH 35C8H 1E4JA 4AGMA 1U92B 4I9WE 3QUXA 1IM9B 4XAKE 4DO5A 1BAWA 3QULA 5EA0L 3SKMB 3F58L 2R27A 4X5QA 1HE7A 4JO2L 4G3YH 1TVBB 5HYSA 5IQLA 1RURL 2X6BA 3OJMB 1LO3H 2IGFH 3VGEA 4PM1A 3SCMC 5F6IB 3IS1X 2IDFA 5D1QB 1JK8A 1EV2E 2O6EA 1R0AL 3INUL 2JI2A 1JYXA 3DARA 5CUSL 1R3KB 1CTNA 1MHCB 4H0LC 4C56D 1YAZA 1EZVY 1KGCD 3NCXA 3GYRA 1OW0C 2IQ9L 3JV6A 3O2DA 3V95A 1NINA 2X70B 2E7LC 2JCCE 1HNGA 1VA9A 1YPZE 4P2QD 4A67A 4TQIA 2JJUA 1GSMA 5H35A 4ILDA 1FVEA 3SBPA 2WVVA 4OQTL 5GRUH 2CIIA 1GYVA 2KBGA 5I0VA 3DIDA 5ABZA 1MWOA 3O6FA 4JG9A 3EBAA 4R5VA 4BKSC 1RLWA 3GS7A 3Q2CA 1AR1B 1U95A 1QBLL 3AROA 1I4FB 2O61B 5D2NB 4Z7OE 4LXFA 1S7VA 3DXAA 4DKAA 1HCFX 1N59B 1E8YA 5I8OH 4HQQH 4A04A 1S7SB 1PLBA 2BXZA 3JWNG 5CN2A 2OSXA 3BEVA 1GZPA 2CRYA 3SDCC 5E4OA 4BA8A 1WBYA 5EF3A 3TWCH 1I1YB 2JK5B 1SJMA 4X83A 1H19A 5FOJA 3HC3L 2P1YA 1TTRA 2ZNXA 4MYWB 4F7PA 4OGYL 4JY6B 4WGWB 4RA0C 3KPOA 1VFBB 3OXRA 4PB0H 1NM4A 2Y22A 3ULSA 4I3SL 1VEMA 3EOBB 1J05B 3L2LA 4K23L 4U3SB 2DBJA 3MUY1 5DDHA 3HZVB 4KMTH 5ESVA 4AEIL 3GXIA 2G0KA 4UWQB 1H9DA 3QWOB 4MRCA 4X50A 5L2KA 3BT0A 1L7TL 5EZJB 3MJ9A 4R26L 4JCMA 4AQ8C 2ZPKL 4C4UA 2F15A 4JKNA 1ZA6A 1BVNP 2H0FA 2VLKB 3DX7A 4JPKH 5KBDA 1T3FA 2N59A 1NL0L 5DS8A 3FCBA 3MRDB 4LL1A 3V5DB 1U93B 4EQ3A 1DANU 4JJOA 4GLRI 2AI0L 1FNEA 1B2WL 4PFEA 4RGMB 1JK9A 1AANA 2EDKA 4PG2A 4H44C 4DPCX 4K2UL 1A6PA 4YDKH 3WMQA 2X53A 3FUJA 4DPAX 1XH3A 5GHWL 2H0JA 3Q6FA 4MZ2A 2V2TB 3EADA 4HF5L 4K55A 2O6PA 3MRRB 1CL7H 5ECJE 4AG4L 1AQDB 2JTDA 4Y5VB 4GQPH 5ICZA 4P2OD 3CH1A 4H0HB 7PAZA 4JPIA 3CFNA 5L2JA 1EJ6A 15C8L 2N7AA 4U2YA 4TNWF 1JOIA 1UM6H 3DX0A 5E8OB 2HT2D 3WKYA 3LXUX 1UVQB 5LWYL 1WDAA 3TPUA 2DEXX 1J7VR 3C5JA 3BPOB 2W81C 1QWUA 1AQMA 5IHLB 2R0LL 4NBZB 1Q1JH 4WEEA 3WFHA 4MJIE 4BQ8A 3RBGA 2DMBA 1QUPA 2CJ3A 3MJ9H 1K85A 2JKLA 2DMCA 1JFQL 3MLWL 3C5ZB 2QPSA 3IMUA 4UM9D 2GBUA 4RAVB 1FYTE 4UTBL 4AEHL 1DYZA 2PXYD 5IGXH 1Z0NA 2VDKH 4JR9H 1CFNA 4DAGL 3POCA 1GGIL 2MCMA 5C0IB 3WU1A 5E5UB 1PLCA 3ZDYE 4UT6L 3FN9A 3Q44A 3HW7A 4MAUH 1YDPB 4XMPL 1HU8A 3QWQB 5ICYA 1KXVC 1RK1B 3WXVH 4KKBD 3F04A 5IOKA 2JFCA 3K91A 5T1MB 1FG9C 1RJLB 4LP4A 4XB7A 3DVNB 4GLRH 4WTXA 4I0PB 1OP3H 3AY2A 3F7VB 4BSWB 3ORJA 1IKNC 5A2LH 5KSBA 3FTWA 3VXQA 1GL4B 5G4OA 1EAPA 4Z6AT 1A4AA 5LJYH 3GLZA 4PVNA 4TUKL 3QUZB 3IMWA 1PPIA 5C0EB 2EDBA 1G9NH 1JJUA 3G6DL 4W9ZA 4WY7L 3MX0A 4S1DD 3FO0H 5T5FL 1HINL 1QSEA 3TZVA 2FGWL 1ZLDA 2Q5BA 2AQSA 5CILH 2ZOKB 3I9GL 4LLVB 5IW3A 3KPLB 5GISL 2D3NA 4IRJB 4MDIB 2G3NA 4N9GB 4UQCA 5FYJU 3UTSB 1UYWH 1X7SA 3B56A 3KBEA 4WWKC 2AEPL 4KMLB 1JXFA 2CHXA 1G0XA 3LIZA 1T1ZB 3OHXC 4LNRA 3NFSL 3EF7A 2H32B 5F89A 4WNJA 1Q72L 1HKLL 4EBQH 2IFFL 3GSXA 3P02A 2EADA 3HC2A 4DPBX 2C3GA 4IM8A 3LNDA 1UA6L 3O4OC 5DVMA 1ETZA 2ZG1A 2H6PA 3QNFA 1AHWA 5M95B 5DUJA 1FFOA 2ZOLA 1N2RB 1SBSH 4XN7A 2PMZA 1P4LB 4BFRA 4FTVA 1PZ5A 4ZBJA 3BGFC 2BOCA 2OTPA 4ANKA 1AJ7L 1S8DB 3CFBA 2KC0A 3K4AA 4AEEA 5I76B 4HIXL 3N42B 3LEXB 3DV6A 4HZ1A 3BUBA 2F9BT 4NUGH 1OM3H 5EU4B 2UZIH 4F1ZA 5CBEA 5AWNL 3VXUE 4OI8A 1ACCA 3MR9A 3FONA 5B3SB 2N01B 2ZUWA 1UOKA 2LTQB 4MS8C 1JHLL 3K2UL 3U2JA 2ZF8A 1CIDA 3PLYA 3RWEB 3BP5A 1A2YB 3V0EA 2A77L 4FG6D 12E8H 1YZZA 3VGGA 4MZIA 4XO8A 4ZMZA 1RHHA 4YOKA 2EDMA 5F93C 2CM5A 4G8FA 4N90D 4GT7A 2BWQA 3K4DA 4GMSH 3EHBD 4ZUWA 1BWWA 1D9KA 3S96A 4OCYH 4PTTB 4PLJC 1ADQL 1QR1A 2IOMA 3WD5H 1KXQA 3MRFA 1ZTXE 2DOCA 3ARUA 3DURB 1TMCB 1ACYL 2FT8A 4FYQA 4N24A 5IQ9A 3ZTCC 1YJDH 1I3GH 2Y7MA 1QASA 2HMIC 3U6XA 1N6VA 1QEWA 1TQBC 5DRNA 2EZ0C 3KLQA 3HMXA 3QQ3A 2CUAA 3T04D 5I1DB 3GJFK 1UA3A 4LL9A 3BZFB 3LN4A 4YR6B 5E8EB 2CR0A 4P5RA 5B38G 1DQTA 5K9QI 2W9DL 1CI3M 4RMWA 4AOFA 4DHLA 1HHJA 3G5VA 3VFPB 3MUZ1 1SXNA 3LRSA 4P57B 3FU9A 1YEKH 4F57H 5E94A 2VLKE 2YFOA 1KNOA 5G4NA 5IW1B 2YOAA 4EXPX 1AS8A 4JZJB 2YSTA 4TVPD 3HRZC 5F6HI 5D7IA 4A7QA 4W81A 3N0PB 5IIEB 4ZUTB 1MW1A 5IFHL 4RX4A 1JWMA 5DZLA 2DLFH 3SKOA 1CLYH 1OALA 4XZUB 7PCYA 1E6OH 2UVFA 3OZKA 5KSUB 2E8ZA 5EIIA 1FQ9C 5E9DD 3MUJA 3WO4C 1UJ3C 5BOPA 3AXIA 1BAGA 1NAKL 2VAJA 3ARFA 3E6FA 4WENB 2Q3AA 1WEJL 5D8JH 4C56B 5JW5B 2EO7A 4XI5D 3BYYA 1VEPA 3KGUA 1FYHB 4O5LH 3WEXA 4YWGL 5D1ZA 4P2QB 5AAPA 2XWCA 2XTSA 2FATH 5D7LA 2APVA 4CGUB 5FUCC 3CN0A 3U82B 3FUMA 4LIQL 3TT1H 4G9FD 4L4TB 4OM1L 2NYZA 3REWA 4Q8BA 3O3DB 3HR6A 1G1CA 2XQYG 1P7QA 3W39B 1KPVB 3U9PL 1FL5B 4WI2A 1P5VB 4LVHC 4FFZA 5GQBA 1S3RA 3D6GA 4KKNA 4ANVA 2OL3A 3LKPB 1MH5B 2W65B 5CEZD 4ZUUB 4BFIB 2Z1PA 1SEBA 2CZNA 3NCMA 5FM8A 1X9RA 5DJDB 2AXJA 3TURA 3INOA 4Y88A 4ZMOA 1ES0A 4NNYA 4ZS7L 1II4E 3PRZA 2X3AA 3DYMA 4LKXA 1X7QB 4KJWC 5IVXA 3QAQA 2HVBA 2PP9A 5MP6H 5LAXA 4ELDA 4FQCL 3VVWA 3S8WA 2XVLA 1OTTC 1ID2A 1U2YA 5TF1L 2P5WD 5CJOH 4PBVC 1I3VA 1CIUA 2VQ1B 3S34L 1B9KA 1HDMA 3L3OA 3BO8B 1IAMA 3ZE0F 3BZEA 4P3WA 1GRWA 3KPNA 4E5XB 2WLIB 1QLEH 4IK7A 1L0YA 1RZJL 4FQXC 5KS9A 2B20A 2VLJA 2F19L 3IDXH 4P5TA 1MIMH 2DN7A 3W9EA 3TBWB 4IDJL 3WBDA 4QRPA 2ITDA 4HV8A 3IM1A 1L5GA 2HTKC 3DUHA 4YHOL 4F7CA 5FGCB 5E6ZA 2AQ1A 2NY4D 3PJSB 2YXMA 2IH1B 2Q3XA 4HUWB 4L9DA 3FU5A 1NDGA 1OGSA 2V5TA 5GGSA 1AS7A 3L2NA 4JY4A 1DSWA 2JKSA 4PVBA 4HIJB 1XD1A 3V4VH 2FIKA 4EQ2A 1TEYA 2ZZUT 4UZSA 1RV6X 4JAMB 4R97B 2K3HA 4KUZH 4UDTA 1KWKA 2PTTB 3UTTA 1MWAA 5I23A 1NEZA 2P5PA 4X80L 1KPRB 5HHQA 1VGKA 1PAZA 3IK2A 4P2OB 2YBRA 3TO4A 2W0LA 3NSYA 4OBRA 4UOZA 1LK3L 1ZT4B 5HYQB 1R3LB 1MJ7L 4MBRA 1GH7A 4D9LH 4N8UA 2Q8AH 1WBXB 4AM0A 2P7TB 3TA4D 3MMEA 2JLLA 2WBXA 5I1HH 3FQTB 4HJGA 4N0UA 5TQ0L 1TZOA 1MXDA 2QPUA 5EO0A 1QBMH 1MFEH 4JFXA 4EUPA 1B3JA 1T1WA 4Q6IB 4UM9B 2JKRM 3VGDA 4I8DA 1CO1A 3QJXA 2PXYB 5F7EL 1SOQA 1J8HD 2CIKB 1KLFB 3Q1SH 2WAHA 5E8DH 4Z0XB 3QZWG 1OSZA 4EDWH 3NYKA 5F0PB 3V6OE 1UOLA 1W80A 2UY7B 3L5WB 3QFJB 5AW3B 3WTSA 4DGVH 4JFPB 1XF3B 4XWGH 1U8OB 2QV2A 3C2SA 4YE4L 5L88H 1MREL 1J5DA 4GSDL 3U4BL 3GF8A 2R0WL 3HZKB 2Y1VA 4IJ3C 4G6KL 1CPUA 1MWAH 1O5DT 4EZKA 3D09A 2PNDA 2WLJA 1U2HA 2WQVA 4NUJA 2Z7UA 1WO2A 3QIWD 3M88A 4ZS6C 5BRZA 2WZPA 4KKLC 3KLHD 1S5IL 2A1WH 5MI0C 2V7HA 1CDUA 5C3LD 2BSSB 4HISA 4ELKA 3EJTA 1NGXA 3EGXB 2WZ0A 2LFGA 4B95C 4G6FD 1DLFL 2C1PA 4K3JH 2VXSL 1WISA 3K6FA 1A4KB 3VW3L 3W2DL 3C5SB 2MIZA 4CW1B 4YVUA 5BQ7A 1FFQA 2WN3A 4P3DA 4PWHA 2HPOA 3KBHE 2QTEA 4EUPH 5T3XL 3UACA 4P46D 4P3CH 4Y1AA 5DMIL 2XKUA 4BFNA 1D5BB 4MAYA 4Z77A 2ADJB 1YECL 5FV1L 4GRLA 2CKNA 5IR1B 3V6FA 5INDB 4G80B 1V54B 1UURA 1PYWB 3PG2A 4LPXA 3X12A 2IDCA 3UAFA 3KPMA 1T0NA 3CC1A 3P77A 1F97A 2GIXA 2VJ0A 5DGQA 3NRQA 1XQ4A 3PJLA 4WUKL 5D2LF 4HJ0D 3EJQA 2RFXB 3MRHB 3OJDB 1NKOA 1KGCE 3ML8A 4C56E 5KVEL 5CEYA 4X9HA 4KK5C 3OKMA 2OPCA 4ZMNA 4P2QE 4L37A 1NCHA 4BK4A 3RVWD 5CHNA 2B5IC 1LP9E 2X4UB 4MDJB 3P30L 1CFTB 2WXQA 4LVNB 1NDMA 1HEZB 1NKRA 3I6SA 5T1LA 4UDUB 3BW9B 3K74B 3IPFA 4M8VA 4HZAA 4CILA 4NZTL 1P1VA 1PS3A 2JQZA 1LE5B 2R1YA 1A7RL 4N5ED 2OV0A 5IW6B 2EVHA 3WKMH 2A4CA 4I0KA 3ULUD 1MFVA 2A6DB 4RDQG 4HUCA 4QKTA 1N26A 5ESQB 1AQKH 5E6ID 3NUKA 4GXFA 1HCYA 5AYUH 5E9NA 4ZTPH 2AC0A 1A8JH 5B39A 4BCXA 1KZQA 1UKTA 3FT2B 1SF3A 3II3A 2V2WB 2NW2B 5C0AB 2XTJD 1J1OH 1JUFA 3FF8A 5I6XC 2E6JA 2GI0A 1QLRB 3VB9A 4ZFZA 4ABWA 2VABA 1SOSA 2P49B 3UZQB 2DIJA 5DQ9A 2QBWA 1YQ2A 4R84A 1HS6A 1SXZA 2UXVA 4OIFA 1NCGA 1MFUA 4GH7B 4HG4J 3OKOA 4G8GA 3OR6B 1YEJH 3J07A 1PLAA 3TH2T 1U4EA 3B9KA 2X40A 3PDDA 2AEQH 5HGDB 1MCHA 1JZ4A 2NXZC 1RUML 2D0HA 5DEZA 3VFMA 2ZYSA 5FGCE 3GXNA 2ZXCA 2GJ6A 1HK6A 1OT1A 4MBOA 1CGVA 3FU8A 1WWCA 4XBEH 1WYJA 3MNMA 3ZKNC 4PP1C 3SE9L 1SXSA 1XIWC 3U1PA 5JUEH 4KRPD 4X9BA 1SXBA 4Z3IA 1UWXK 1P7KA 2ZSVA 4YQXL 3ARDC 3EH2A 3BRDA 4OT1L 3D50A 3N85L 4EEEA 3QJSB 4MJ2A 2Y6SD 1DQIA 3MO1B 2VMEA 1KCUL 4HJJL 1CXHA 1NCNA 3MV01 1UEYA 3FOLB 4YHYB 1RPUA 1D2PA 4WSGA 3VXSA 3WFCH 3TTSA 1FFNA 3QNXB 4J3OC 5CR8A 3ZE0B 1J1XL 1M2OA 3KGSA 4RZKA 4B3VA 4G9FB 3HNVL 2AGJL 3WNNA 2B3IA 3RA7H 4G1MB 1LXMA 4JRWA 2VQTA 4LLDA 4D7BA 3P73A 4FMFA 3A22A 3QIUD 4GKNB 3K6IA 1T1YA 1BZQK 5IF0A 3ESVF 4WWID 3E38A 3NZUA 2A74C 3HE6A 5TK4A 4BJLA 2Q6WB 4X8XA 3VFWB 2ZOTA 5BZDA 3EYOB 3H3PL 5B39G 2E75C 1M71B 3KGTA 1OM9A 1JNNH 1VZGA 5IY5B 1NGZB 4I3GA 3U7WL 1WBZA 3FRPB 1JGEA 2DEYX 3EYVB 5DQDH 5ICXA 1CURA 2IGLA 4YDIH 4HC1A 3T2OA 3NCCB 4BV1A 5HPMA 1E9OB 5EV7A 1CJYA 2P5WB 2WZAA 5C07E 3ZKQD 4NNPH 1J8KA 5TPWL 5F7NC 4LHUA 1IL1A 3FT3A 1MUJA 1I1FA 4B97A 3QFDB 2ORBH 3HBGA 1FVCB 3BWZA 4PVLA 4UV7L 1CFQB 5D6CB 1GHFL 2VDPL 5IEHA 4MX7A 4H25B 3GB7B 1JZ8A 2ED7A 2YEZB 1DSFL 3D85D 2YEQA 5IJVB 1FH5L 4OF0A 4ODXA 4UTCA 4H4NA 1BZ7A 3I2CL 1EEYB 2DAVA 2AJXL 2NY4B 3FO2A 4LLUA 1Z6JT 4QTFA 1LQSR 4FKKA 4AJYV 3QG6B 4PRPD 5EC1A 1TR7A 2R9HD 2Z93B 1S9KC 3O45B 2F7IA 1UQSB 2B3RA 3WJJC 4R96B 1UM4L 1A7PL 2AS5M 1EFXA 1UGKA 5AW9B 2B4CC 5GZNA 4ZDHB 4MA3A 1ANUA 2UXTA 1W6WA 2OMUA 1EDQA 5BOJA 1QFUL 5BXFA 4B6ZA 2WQRA 1YO4A 2MCG1 2ITCA 1I31A 4HHAA 4L4VA 1CDYA 2G60L 3OKDB 2VDLB 2EYRB 4P06A 4HC1H 2MTAA 1MY7A 2ZTBA 4TVSa 1J87A 1N3NA 3LXBA 3DROA 2OW7A 5I6OA 4XOEA 4NGHH 2YZ1A 2EEFA 4GEJA 3L4YA 4CBPA 1LM8V 5AFAA 4MLSA 4H8WH 1OT4A 3CSTA 2ZX8A 4N0FA 4P4RA 2GUOB 5JA9A 4M5YL 1PDKA 1DBAL 3LYRA 1J8HB 1P5UC 4FQHA 4TNWK 4K7PY 1W15A 4K3DH 2AXFA 2XWBB 4TQ8A 5FIEA 2PCYA 3PWVB 1TCRA 3P2BA 3AU1B 5T3ZL 3DUUA 1OAUL 3ETBF 1DQQB 4PJGF 3SDAD 4JVPA 3UP1A 3RVVD 1MFDH 4ZUVA 5CNHA 3S36H 2W8CA 1O9WA 1DUYB 1K5NB 2OTWA 3DJZA 4QHPA 1ACXA 4N90E 3QP3A 5JPNB 5B7EA 1M3IA 3QJHB 1I9IH 1FNAA 5ID1B 5IM7A 4MJJA 4Z8FH 3ZRCC 4ZYKB 3EDKA 4IRZL 2QQLH 1KFAH 2G5UA 4V2CB 5I24A 4G43B 1AKJD 2YPLD 3BPCA 3QIWB 2VUOA 3QJZA 5D2LB 3BGMB 1A7NH 1NANI 1Q4NX 3EJJX 3MUGA 3ILPB 3L54A 3QCVL 3O4LA 5EOCJ 3BDBA 2B4CL 1Q0XL 3TBTA 1Z9SB 1AOHA 3CVDA 5KWYC 4DGIL 2WNKA 2VO5A 3QHFH 3VH8A 1E67A 3B7YA 3WDHA 3IMBA 4DK3A 1LO0H 4P23D 1FO0B 4K3HA 4R0LB 3C8KA 2PWDA 3B2PA 4TVPE 2EKSA 5JW4N 3MGOB 4P46B 1SN2A 2FWOA 3GTTA 3NJVA 5LN8A 3OAZH 3F6JA 4A1RA 4EVNB 1RZKH 3KL5A 4X4XB 3PIQA 5IUSA 2J1YA 1FDLL 4O4YH 4YUEH 3EJYD 2OKMA 4MFHA 4O02A 4K71B 1XSOA 3LS5L 2Q86A 1KN4L 1QQDA 5E9DE 3MBEA 3S5LG 2J1KA 1JNLL 3FN0L 4WHTB 2WUBL 4OZFA 4PGEA 4N8VA 5I1IH 4NBYB 4F7MA 2YGPA 3UZVB 1L9RA 5EIQA 1L0QA 1Q9WB 3UAJA 4DVRH 4AYDC 1ILUA 4JQIA 1ZD6A 1F90L 3ZE0E 1HHGB 4MLIA 4Y4FA 3KZ8A 3K7UA 1IAOB 3QZBA 2F5AL 5GGSY 2FBJL 5E56A 2IWFA 1J0IA 2JE8A 5JPMC 2AABL 4TLUA 5JQ6L 2HYMA 2X12A 2HT4C 2JKIS 1A21A 4P4KA 2ICWI 2JJSA 3VGHA 1W0YT 1J5IA 3GSRA 1K3ZA 1E9QA 1OAKH 4G72B 5E6IB 4HSQA 4JZNA 3VO0A 3VD9A 1HILB 1OV8A 2V3EA 3P9MA 4QRAA 3VI4E 2OLDA 2DYPD 1PX3A 1A1MB 5HHXL 2FDBP 1W91A 2VDMH 4YDLC 3IMSA 2FBRA 5DWPA 3EYQD 4PG9A 4D9RD 1PQZB 4RQQA 1R3HA 5JO5A 3PWJB 5E6RB 4LEXH 1WA0X 3RTQD 1HNYA 4BH7A 1H5BA 3MV8A 2P5WE 1DQDH 2QHLA 1BZ9A 3FTGA 2MNJB 3V52L 5MEOA 4OGQC 1K6QH 4QRTB 3HPLB 5A2FA 5F0MB 3ZDXF 1IGJB 5HDQH 2X1PA 5MENA 1BIIB 5IB2A 5KYYB 4NQVB 2XZAL 1RUQH 1RUPH 2VN6A 5DS2A 4KXDA 1PJWA 2WP3O 4HIHA 4WU7B 5JXAH 4GRMB 4KKAC 5AVZB 5FOBA 3PAZA 3ZGIA 3ULVH 2AMUA 3UBXG 3HA0A 1A3RL 3VXMD 1CMOA 3NSFA 4JO8A 2Z9TA 4DZBA 2OMWB 4U1HA 4KRPB 4TUOB 4XC3L 1AR2A 4KK6D 4PJEF 5FM5M 2MEJB 2VW4A 2F2HA 1R3JB 1BD2A 3MRIB 1O7SA 1JWUB 1N68A 3QIBA 3RPIB 2UUDK 3EJZD 1BOYA 3LEYH 3VRLF 4G42A 5DC2A 2RQ8A 2ROYA 3QCUL 3RKPA 3N1MC 4OZFG 2QR0B 3ROOB 2K3TA 4YSPA 4GSRA 4UMSA 1IFHH 1E3XA 2QGCA 3C60C 5ETUA 2J12B 3KW8A 4DGYH 2QVFB 3P4LA 4WJKB 2CDFB 4WTQA 3REVA 2ZCKL 3LQAL 3IBEA 2EIEA 3EFOB 3L3GB 3FBQA 4NZUL 3WKNA 3RDTD 2NW3A 5GJTL 1L4IA 3VFSB 3IB4A 2QQKL 3QUMH 4AW7A 5HVFB 4PJHF 1PIFA 3QIUB 4FULA 1EHLH 5GRZA 4FZEL 4XCYA 1WS7A 2DYRB 2G5BB 2H26B 1SXCA 5HHVH 4JRYD 2XY1A 3DSFH 1MG2C 2XN0A 4HWUA 4NN5C 3VFRB 3A24A 2PPEA 3NQIA 3VD0A 1JHTA 4Z7IA 1JE6A 4HA1A 2IAMD 3W11D 4X98B 1MFMA 4U4IA 2FZ3B 3PJNA 4MMYB 5I6PA 5DHVH 3GRWA 4GIAA 1IZKA 1BM3L 2OJEB 4L8CA 2DQTH 4B9IA 1W0WB 2Y06L 4XNYL 1DJGA 1JF5A 3T3PF 5HPOA 1D5XB 2JMRA 4ZSOB 1OPOA 2X3CA 1WG3A 1UT1A 4LQFL 3VDAA 4WW2A 1IJ9A 5JOFA 2XDHA 4FHKA 3SPJA 2YUVA 4MA1C 1M7DB 4FI8A 4AZ8A 3C9NB 1PEZA 3GZQA 2VLLA 4W9FC 1IGCL 2DKMA 4JHUA 4NN7C 1A3QA 3WXWL 1Q9OB 3N91A 4J3VA 3DIFA 5D2LE 4NQED 2W9EH 5ILTL 2BC4B 2HLFC 2AK1H 2DQHL 2NSQA 2ICWB 4X6DF 3S3DB 1N7MH 4OFYD 1Z0MA 2G30A 4PTUA 3GXFA 4G6AC 1J86A 2IANA 4FYRA 3D85B 4PJ8D 4UIMB 3FC8A 5DHXB 4QRRD 4BZ1A 1OGPA 2UZYB 2OK0H 3GHEH 1J1PH 3KJ4B 3FQWA 4F7EB 1HYRC 1IAIL 2WXPA 1NFDA 4RFNC 4UOW1 2BJML 1JS4A 4PRPB 3AZUA 4NO5B 5BRQA 1SN5A 3BFOA 3LH2L 2A6KA 2NDFA 4QTIL 1T7ZA 1F4WL 5JHAA 3PWLA 1QFWL 1YEIH 4YK4C 5AUMA 2Q87A 1JZ5A 4PJGB 2OCJA 3HMWL 2TRHA 4KK8D 1NBQA 5LBGA 3VD2A 2ZWLT 2Y36L 4KZEH 5E6UB 1OARH 2QKIA 1S46A 4OKVA 1MFCL 4HUVB 2YRPA 3L5XL 4WEBL 1WZ1H 2PO6D 1XBDA 2FK9A 1MELA 4MNGB 3M17B 4OLEA 3U0TB 1F56A 3F7KA 5F96L 3VD5A 1NCCH 5IVOA 3VMPA 2X28A 5I73B 4QHMB 5JQHC 5LG6A 1A4JB 5DYOB 3QHZL 3BQUA 4UYPA 5KYWB 2BY0A 1U8KA 4WHYH 4ZUSB 3ARBD 4OIIH 3EJUA 4YSRA 3N40F 4LF3B 1S7QA 5BO1H 1T2JA 2IMNA 3P4MB 2BHUA 3U46B 2CO7A 3K2IA 3V0WL 3H2PA 4NJ9L 1XGTB 2R83A 3RU8H 1Z9NA 4U1KA 1HESA 3T4AB 4XWOC 3SDAB 3AREC 4H1LB 3ULUE 5DJYB 2GSIB 2CO4A 1N0XL 5EORL 2ZUQC 1XD0A 1AGDB 1F6AB 1DO6A 1I1AB 3B3IB 3IDYC 4PW9A 1V05A 2IBZX 2VSKB 4NBXB 4DN4L 1A1NA 2ESVE 4X42A 2V9QA 3DUSB 5D1XC 1OOAA 1SYVA 3Q7JA 2L04A 4JCWA 5EWIH 4NRZA 2VISB 1C5BH 3U7YH 2XTJE 1A7QH 4M43L 3QUXD 1S78D 2XBTA 1Y6NR 3UO8B 1AKJB 2QVMA 2YPLB 1GYCA 3EO1B 3JSSA 5DJ8A 4BBWA 3KNBA 5I8EB 3QUYB 3ZX1A 4AJVA 5AAMA 4ES8A 4NM4L 5A16B 3OR7B 2OMYA 5HI5C 3ARWA 3NJLA 1QRKA 3MRQB 4NKQB 2V33A 4S1RL 3BOVA 4ODWA 3LY6A 3S37X 4P23B 1N70A 4AYMC 1T89A 3U4EA 2NMSA 3P54A 1UJTA 5DD0H 1UZGA 1U36A 1CYXA 1TETH 2UWEF 3QORA 3D33A 3ES6B 3UJJL 3FU0A 1DVFD 2YD0A 1FGVL 3BAIA 5FA4B 4GKLA 2E8YA 4OGXL 4PWEA 2OYMA 3LPGA 5H37G 3CDYA 3O6FD 1IV8A 2A6JA 1ZHKA 3MBWA 1RI8A 2R23B 3LEVL 3VG9C 3EG9A 1DBKL 3CLWA 1UCBH 2X4PA 3U30B 3CZFB 4S1QL 5DZ9A 2OSLB 2IXQB 5KANI 2J43A 1IC4L 3DXAD 1DN0A 3NCFB 4BZ2A 5AZUA 3RNKB 3ILQD 3GUTB 3CH8A 4HPYL 3SDDC 2FD6H 3K72A 4BGDA 3NH7L 4FHBD 5TFSL 4WI3A 3X13A 3ZDXB 1QSVA 1AXIB 1QZNA 3ZN6A 5L8LB 3IFNH 4W1TA 3RZCA 3SY0B 4JK0D 1JBJA 1FLRL 4PWJA 5KOMC 2FL5A 2V2XB 4BCYA 5I74B 1QBBA 3ATEA 2NY2C 4I1RA 4M1DL 2WLZA 1GR7A 1AGCA 4RNRB 2VB5A 3CPUA 5FYKD 3B7SA 2BSEA 4KJYA 4DEPB 1SJHA 2AVGA 1GAFL 4NM8L 5IB4A 5L2KD 3ZHKA 2DYPB 1KC5L 1LWRA 4Y5XB 4P2AA 2E56A 4MMZB 2M1KA 3LKQA 4L9LA 4KXBA 2LAAA 3BVXA 1E0OB 4PJEB 4UILL 2DLEA 5DO2D 8PAZA 3SGKA 4ZSOE 1CWVA 4UQ9A 3ZLQC 2E9IA 1S7UB 2EQDA 1HL8A 4O2FA 4WRLA 3F7YA 3U83A 3CIAA 1IKFL 1ZDQA 2X4OB 5B1JA 3RTQB 9PCYA 4R7NB 4PYGA 1L0XA 4EN2A 4MDRA 3WL9A 3DRQB 4H20L 3TEWA 4ATTA 1OD7A 2X9YA 3SE8H 4QJ4B 4LCCB 4OB5H 4ODBD 1A4CA 3QO0A 2IPUG 2BZCA 4UT9L 3BEWA 1MVUB 2YD2A 4JFFB 4KTDH 4PJHB 4NZ8A 3IF1B 4NHUA 5AVXB 1SN0A 1NIAA 4G8IB 1EXGA 2OMZA 1T66D 2EDDA 3VFOB 4P99A 4PW4A 3VXMB 3WKQA 2WIIB 4E9VA 5K1NA 1XXFC 3BAXA 1WWBX 4HCFA 5F9AC 4N3TA 4YHKH 4IRSA 1I8AA 1WIUA 3ABGA 3BH9A 4PJGE 3S88L 2VDQB 3R19A 2VDRL 3OXSB 4R90L 1GIGL 3T3PB 4XX1E 4KO5A 4LBEA 4EZJA 3QE5A 3B2UC 4U6HA 3VCLA 3RWIA 2KERA 3GKWL 3DTDA 4J23A 3DDGA 4X5XB 1GCYA 3RX9A 3MRPB 4LSSL 1TOXA 3M1BA 1ZPLA 2A9DA 4R5XA 3ISRA 5EO9A 1G7JA 4JHBA 3PYCA 4Y16C 4AT6B 5JOPE 1MCRA 1H8OA 3QEQA 4PCTA 3ZU8A 2CJUL 3B34A 4Z95L 3RDTB 5GS0D 3L5HA 3K6DA 4XNUH 1ZLWH 2CK0L 4X6DB 5FF6B 4D94A 3FSVA 1CE6A 2VDOH 1QVOB 2BP0A 5EN2A 3SQBA 2I85A 2EYSB 3F3HA 1MRFH 2WQWA 3FF7A 2E9GA 2XICA 1MHEA 1TTFA 3N06B 4YSEA 2JJTA 2IAMB 2FEDD 3TBYA 1TZHB 5F9OH 5ENWA 5B4MC 1AXSB 4JHVA 3U48A 2O4EA 1G94A 1FC2D 4JG1L 1IGIH 3MV7A 2CBMA 2HH0L 3I9PA 3R06B 1S9YB 3TZVD 1FGNL 3AFLA 1SM3L 5FYJH 1QZ1A 4UV4H 1GPOH 3S8GB 1NMCC 3JWNH 4YHMH 4PEEA 3TIDB 4FHJA 1PBYA 1UTDA 5EZLA 2Z31C 1K8DB 2YPLE 2J5LC 4NQEB 4PSRA 1TQCB 3VU1A 3C6SA 4BK5A 5J1SC 3B37A 4PGCA 3QJFA 2ADIB 4C47A 3PHOB 1KB9K 4PJ8B 5D6DC 4QRRB 1FPTH 4KRNA 2FECL 4FFYH 4ISVB 4UAOB 5KSBF 1Q9LA 2Y6TE 4YLQT 2EC9U 1EK3A 4UU9B 4HDIA 2X6VA 4FTVD 1SLXA 3V0JA 1EJOL 2X2IA 4M8QA 3HZ3A 3B6SB 1SMAA 2Y72A 3GUFA 4J3SA 4PD4K 4PB9H 2EVFA 3UIYA 5CS7A 3OKNA 1ZAGA 1WS8A 1JF6A 1QLFA 3MRNB 2N0MA 5LGKA 2CKBB 4FD0A 3IJEB 5CGYC 4HWZA 3NFNB 5F2FA 1AFVH 1T2XA 2PR9A 1AGBA 4LU5H 5LXVA 1MCLA 1BDYA 5H8DA 5K9OB 3MRMA 2DM4A 2FYYB 5KSAA 1HXMA 1BBJB 3MLRL 4CU7A 4GB9A 2GSGA 2BNQA 5G2NA 4X7TA 1T7XA 4LVEA 3ARBB 3KE0A 4HWBA 2WMPA 4AYFA 1KGWA 1M9WA 7TAAA 3UBHA 1D9KD 1CBJA 3L9EA 3NJJA 3ZDXE 3FMGH 5FXCH 5HVWA 1HFUA 5TGBA 3TEYA 1OANA 4N8PA 3O2VL 3MRKA 4F9LC 3JV5A 1CFVH 5FLUA 3DVGA 4KO9A 4L8SB 5LBSL 1ZLVK 4HXBL 5I1GL 4OAWA 5CZXD 2UWEB 4PPTA 1P1ZA 5IP4A 1X9LA 1UZ6E 3K5RA 3PV6B 5KZCD 5HDWA 1V8HA 1DBBL 1URIA 3U36A 2JH2A 4MD4B 2AF2A 3UC0H 5CN3A 2GAZA 5A6LA 4PJEE 2EC8A 1UD8A 3TCXA 2UXGA 1GC1H 3QULB 4Q2ZA 3RHWK 1ZHNA 3H0TA 1WAPA 4V1DA 4G82A 4ZXBC 1P6WA 1D6VL 1SJEA 4ODVL 1DVZA 1T22A 4RX4D 2YGQA 4JX0A 5FYLD 2EXYC 4OVUA 4TQEH 5DWUL 4LZKA 1E43A 4ONFH 1Y1DA 5ACZA 4FJ6A 3O41A 4FEIA 1JK8B 3RY6C 1OF0A 1NM9A 2F53A 2YN5A 3HPJA 3IRPX 3Q8AA 4PRDA 5MHSD 4P05A 4PI2A 4NO0A 1JZ7A 3IDJA 1BX2A 1G5AA 4LEOA 3BSZA 4GW1A 3ARFD 2Q7YB 3LN9A 2BSRA 3VWJA 4PJHE 3CMOL 3RY4A 2X9ZA 5AZ2H 3JV6B 1RD6A 1N9PA 4LASH 4J2XA 4Q9RL 4PY7A 3VFUA 3EXLA 5AB9A 4PJ7B 5D1ZD 2QFRA 5KUMA 5D7LD 4QXWA 4R8WL 1WWAX 4HYTB 4OFDA 2WVVB 3SYQA 5J06A 1W2KT 4Y8DC 1CLVA 1BGXH 3O6FB 5F6IC 4N8CL 5KAQF 3V79C 5D1QC 1NGPL 2Y07L 4Z3JA 1U95B 3T3PE 1P7QD 2FSEA 5D7IF 4JHAL 5LXGH 3U9UA 4QRBA 1AI1H 1S7VB 3DXAB 3O6LL 2QPDB 3FB8A 4U31A 4DT2A 4HGKC 5TE6H 2VZ1A 4X8GA 1GZPB 1CFBA 2V7NA 3T08A 4FQ2H 1WBYB 4HEPG 1YEHL 1B6UA 3N1FC 2HP4A 3V4UH 3D7PA 1PX4A 1S7XA 3DMMA 1GJIA 2HKHH 4JDTL 3TV3H 4JJ5A 4F7PB 4HULB 4X6DE 5H94A 3KPOB 2XWTA 4IKJA 4OIBA 3OL2A 3ULSB 4C54A 1AR1C 3VD3A 3ABMB 1PGRB 3TEXA 3DX6A 4IHOA 4JRYE 2DQUH 5FW8A 4OD3L 3V0GA 5DDHB 2OJZH 3OPUA 5D2NC 2Y1ZA 2D7QA 3S35X 5KVGL 3SEPA 4RGNB 4OZHE 1QAWA 5L2KB 1ED3A 4NO3A 1ZA6B 1CD0A 4KKQA 2VLJD 4P5TD 3DX7B 2WHVA 1RK7A 1E6JH 2ZYHA 1T3FB 4K0OA 4K8RC 1U8NB 1I8UA 4UIKH 4QRPD 4X5PA 5DS8B 3NCJH 1MCOH 5DGRA 2I07A 3IGFA 3L5IA 1K8IA 1NA8A 2EUXA 5E1GA 1FNEB 4KI5C 4GI6A 4HUNB 3EYUL 4YBHA 1JK9B 3D51A 4M02A 5HHOE 1T5WA 4DN3L 3I6KA 3ZTNH 1P9MC 4Q74A 5ICUA 3J7HA 4TV3A 2QZ5A 3IKKA 4JFDA 5KYXA 3Q6FB 3CZLA 4QOKA 1V27A 5DI8A 4NQEE 2XZCL 4B7LA 3CV5A 5C6PB 4LKCA 5IVXF 2O1AA 1WLHA 3OPZL 3AMKA 4EO5A 4HKJA 1OQXA 3UTTD 2CG9X 1A6TA 5ICZB 1XGYH 1FNGA 3EAKA 4QRRE 4DP4X 4JPIB 3FSZA 3BISA 5L2JB 3IJ8A 3B9DA 4XO5A 3TO4D 4YS4A 3UJTH 3F6LA 3LDBB 4FABL 3UL4A 2R0KL 3HN5A 4HK0A 3BX7C 4RGMC 4RFOH 3C5JB 4KHXL 3SKJL 4JFQA 5KS9F 2CALA 4LCVA 4L8DA 1KTDA 3TBBA 3WFHB 1JYNA 3TFKD 1I8LA 1I9RL 1D7CA 1YUHA 2CHWA 2C9WA 1X5AA 5GRXG 2YK1L 1JGVH 4L18A 4AXWA 2WB7A 4IU3B 1DBML 1FZJA 2N56A 1FBIH 4FL4C 4Y5VC 3VD7A 4H40A 2FX8H 2QDVA 3QARA 3B5HA 5D7JA 1RPQA 4PBWD 1QKZL 1F58L 2I26N 1R3IL 2AQRA 3BAWA 4AGLA 4HS8H 1BXUA 1RUKH 4OV5A 2CDEA 3BPOC 4OJYA 4K9EH 5ICYB 3L1FA 4Y7OC 5E2UH 4JANA 2PWFA 2Y9RT 3AXLA 4K8RL 3IXAA 3CLFH 3Q9PA 2AV1A 1A3LH 2WK2A 1XMWA 3DC0A 2IMMA 5KSBB 4FGMA 4KY2A 3VXQB 3BKMH 1EAPB 1N67A 1WHOA 2IGFL 2Y1AA 2DQJH 1WTGT 1KDIA 4TXVB 5SWSA 2WZPD 5BRZD 1C1EH 4QR7A 2P44B 3QH3A 5DJCA 3UAAA 4Y5YA 3MX0B 2E3VA 3FZUC 2UWEE 3QHTC 1EEQA 1QSEB 5CJXA 4WQOA 1DL7L 5DURB 1ZT7A 1IILE 3C8HA 3WN5A 3O0LA 4BQ9A 5TE4H 2VR5A 3D9AH 4RETB 3F01A 4NB7A 1GS7A 5D1ZI 1WV7T 4I0PC 2NY3D 5E2JA 3DJSA 5DHYA 1ZV2A 4CJ1A 3VRIA 5GRUL 5LQBL 2UYLA 3QUZC 4LNRB 4XPAL 3FXIC 4Y1AD 5F89B 4PP2A 3L6FB 4F7TA 3GSXB 4MAYD 1ESOA 2UXFA 4FLHA 4J2QA 4GRLD 2BIIA 3OLGA 5IBUG 1BMWA 2H6PB 3ABKB 1AHWB 3KWWA 3G6JA 4FMKA 4IRJC 1FFOB 2ZOLB 3QRLA 4I13B 2GEQA 4FTVB 1PZ5B 3QDAA 1JVOA 3BT2L 4Y9CA 2PPAA 3NTCH 4G70B 4ANWA 1HI6A 2X1OA 1OTSC 3MYJA 1E3ZA 1JF1A 4K15A 4PB0L 2K78A 3ZE2F 1N5AA 3WAKA 2ZONA 4YSOA 3CUPA 3GBDA 3MU3A 4H13C 2BDNL 3E9TA 1A6ZA 1MCCA 2DQFA 3FONB 3MR9B 4PS4H 5I5MA 3HHMA 3N44F 4RIRA 1CICA 4P59H 3ARSA 5DHDA 3DXAE 4PI0A 2B1AH 1KJVA 1RHHB 5GGRB 2HAZA 3VTMA 1AY1H 1HCVA 1X44A 2JCCA 4ZUWB 3S96B 2R29A 2Z8VC 5DVNA 5CLXA 3ZOAA 1QR1B 1EDHA 4P9MH 1L9QA 4Q6YA 3MRFB 2B7DT 1CC3A 2Y5EA 4YDKL 1IBHA 2GSMB 2O5NA 5LDSA 4LEBA 4QRFA 4NS0A 3VFNA 3VG0L 2F8XC 2WWKO 5IK3A 1QEWB 2LTQC 2EXTA 3V6OC 5DRNB 2YMTA 2BIMA 3B9EA 1UT9A 4AVHA 3QQ3B 4ZNEE 1RURH 3BJLA 3CDGA 5FYKE 5LN4A 3LN4B 5KZCB 5L2KE 2F68X 3FUIA 5I71B 3UZEC 4XMXA 1HHJB 2WO2B 3G5VB 3LRSB 4G8GD 3QISA 5E94B 3OLDA 1WTLA 3B9KD 1J48A 1KNOB 4Z3TA 3P40A 2IOIA 5IB3B 1NGWA 3ZNGA 2C1OA 5C7ZA 4PJIA 5D7IB 4ZO6A 4AKQA 2FJHA 5CSZA 4NC0B 5HYJA 2DM2A 1JWMB 1ZVNA 1RXLA 2GJ6D 3DTXA 1OLZA 3N40P 3KR3H 4WLCA 1WD8A 4OQTH 1CE1L 1M1SA 1VCAA 2OXHA 5FFGA 3D18B 4RFEA 2ALWA 1H3GA 5IGXL 1RSYA 2VDKL 4JR9L 5EIIB 4A2GA 5LAPA 3E6FB 1GGCL 4OM0L 4I18A 1EEUA 4MAUL 3OLIA 1DJIA 2IH3A 3RI5F 3WMPA 3EF4A 3RZWA 4JZJC 3WEXB 5D1ZB 3WXVL 3VXSD 4WNQA 3PABA 4F5CA 5D7LB 3PGCA 1ZHLA 3WY2A 3ZW3A 5JIMA 2Z6FA 5I0ZA 5E2VL 3L3HA 5I5JA 1F4HA 3REWB 3VSQA 5ANMA 1P6AB 3RGBA 2RD0A 2YQ2A 3BZ4A 4OGYH 5MEPA 3D06A 4I3SH 4YEFA 2J25A 4DP8X 5EBMA 4K23H 4IHBA 3OAWA 3X11A 3QC6X 4L3FA 3FO0L 1DQKA 3FRUA 4Z7QE 4AEIH 1F11A 2OL3B 5FCSH 3HE6D 1TQVA 3BAJA 1ZV9A 2WBWB 1QNZH 4R26H 4Q0XL 4TM9A 2ZPKH 2GCYB 4QNPF 4CA4A 1QSZA 4NNYB 1O7DC 1G0DA 2VR6A 1JVLA 2DDQL 4WU5A 5IVXB 3RAJL 1NL0H 3DECA 4DJMA 4LPTA 2Q2LA 5LAXB 3D0LB 3QDGD 4MJIA 4DQOH 2J2ZA 5L9DH 2AI0H 1B2WH 1ZS8A 4HJ1A 5C9JA 3IRZA 5KBPA 4K2UH 1JHKL 3KVPA 3NBNA 1HDMB 3L3OB 5EB9A 4P5SA 5LBVA 5I28A 3BZEB 5GHWH 3AY4A 3KPNB 3SN6N 4CBZA 1EBAA 4LHUD 3UBGA 3ESMA 4HF5H 4OUUA 1E40A 5KS9B 4N25A 2VLJB 1UD6A 2XWJA 1SBSL 3NEXA 4P5TB 3X1GA 1JPSH 5E9AA 2GTQA 4AV5A 4P2YA 1BXXA 2ITDB 4QRPB 4HV8B 3GBLA 2BSDA 4GKSA 4H7VA 1L5GB 4F7CB 1IQDA 2QZQA 3EDFA 4XXWC 1G6RA 4DEWA 5T5FA 1NDGB 4WZ9A 1ZY9A 3L9BA 4JY4B 2VLMD 2KZBA 5T1DL 2NNRA 1K72A 2WZ5A 2UZIL 3TYGL 2FIKB 4XXCA 2VRAA 3JVGA 4YIQA 1EFXD 2I9TA 4UDTB 5IJCC 5GZND 3PFQA 1D6EA 3UTTB 2K6YA 4CMHB 2H47C 1NEZB 2ICEA 1BQSA 5HHQB 1VGKB 4IIZA 1WZLA 4HBCL 4UTBH 4AEHH 2YBRB 12E8L 3TO4B 2VM9A 3ABLB 3P9LA 4L4VD 4DAGH 1CD1B 2C5DC 4KDTC 1JZIA 4ZG1A 2BIQA 4UT6H 3UMNA 4FTVE 4OCYL 1ASOA 4PWGA 4AM0B 4YDNA 4MNQA 3WD5L 5F97E 5JDJA 3UYRL 5E2WL 1RKRA 1YYMH 4HJGB 4N0UB 4HKZB 5D4QA 4R97C 4JFXB 1T1WB 3WAJA 2R15A 1MHHA 3T0EE 1FP5A 3S4SG 1YNTF 4R4BA 1A7BA 4FQPA 1OSZB 1T2QL 2C9RA 5BUGA 1BF2A 3G6DH 4WY7H 3BVUA 1KJ2H 5EBGA 1YEKL 2HLAA 1HINH 4LSUH 2C9VA 2FGWH 1DDHA 4LGRB 2NT1A 3I9GH 1E5UI 4KZCA 5GISH 3MOBL 4NQCA 3Q8EA 5EF0A 2H5UA 1XSJA 3H9YA 2A9NH 4OV6F 3P2TA 4Q6IC 1BQHA 3RFRA 1KXQE 3EH4B 3AG4B 3WFZA 4WKXA 4JFZL 4IU2A 4P2RA 5E6SB 5C9KA 5BRZB 2JKTM 5TQ2H 2ITFA 1MXGA 1Q72H 2V7HB 3QI9B 4JPSA 4HU2A 3PNWB 2IFFH 2RTTA 4XHJD 1OP3K 3O4LD 1NGXB 4ELKB 4XZ4A 2JQAA 4ZMPA 4BDVB 3FUHA 2ZT9C 3H42L 2VWEE 1D5MA 1A02N 3OX8A 3L4VA 5HDLA 3MC0A 3ZE2B 2QQQA 4JFHD 5TE7H 3RL1A 1GGBL 2WOYA 3AM8A 3C6LC 2NY3B 3L3DA 5BQ7B 4MHHI 4P3DB 3WY3A 3VGAB 2F5BL 2PABA 2VZVA 4GAGL 1J5OL 4B9KC 2AJYH 4QRUA 3BLPX 2FO1A 1C8PA 3N44B 4DIXA 3WV0A 4HIXH 4Y1AB 3BKYH 5C6TH 3FYEB 1ND0A 4MAYB 4YXHL 2P80A 4Z77B 4HUUA 4S1DC 4GRLB 3V6FB 4LDOB 4M03A 3D69A 3X12B 5AWNH 3GBMH 3KPMB 5E24E 1T0NB 5MHSE 4TQPA 3MBED 5AL0A 5KVDL 1JZJA 1JHLH 3K2UH 4AC2A 4F93B 1J9CT 3GFUA 1F4XH 2IDTA 2A77H 4WI5A 5CMAB 4ZOBA 2K6WA 4TULH 3DOSA 4PJBA 3UAJD 5MP6L 4ADJA 4L37B 4RCAA 1JZDC 4K7PL 5CHNB 5D7LE 2HB0A 4DP7X 3S97C 4AK2A 4Y4FD 4F8NA 3FBKA 2ED8A 1NDMB 3SPVB 1ADQH 5FFLA 5T1LB 4WEMB 5FKPB 1C08A 1ECYA 1ZLSL 1Y0LB 1ACYH 4TNGA 4GI8A 1FSKB 3BAEH 5E23A 2X05A 4C57C 3ZIYA 2R1YB 3JUZA 2F54B 2EABA 4MGXA 4BFKA 4P4KD 2JKNA 2W60A 4Y89A 1X5YA 1E8ZA 3CX5K 4YHIA 5B39B 2VMDA 2W9DH 4OFPA 4FFVD 2BHYA 2ZXGA 5BO4A 5JZ7C 1JUFB 8CGTA 4NT6A 4UOJA 4LVNC 2YLKA 1PZAA 4ZFZB 5C0CA 4DKFH 3NRPA 1PTZA 4ADGA 1JZ3A 5GGRY 3KCWA 3AADB 2VABB 4U1MB 2H2SD 4KUZL 5IFHH 4NKDB 2X1QA 2Y7OA 2AJVH 4ZOCA 3OMZA 1MIEL 4R9HA 2WXFA 4FG6C 1PNDA 5EG6C 1LTXA 5AALA 2QGDA 4LO9A 1KGXA 3PL6A 4AE0A 1S7WA 4AIOA 5ITBH 3FKUS 5MEND 4NUMA 3OKOB 1H8SA 1HOCB 1YEGH 5AW4B 2VLJE 4G8GB 4ZPVA 3MFFA 1NAKH 2VXQL 3QS2A 1WEJH 1S9WA 2Q8AL 4N1CA 4QRPE 5LUMA 2ZOUA 3VFMB 5K9JL 2EIMB 2FX9H 5JIHA 1JZ6A 1RERA 2Z8RA 2GJ6B 1UJ3A 3LKOA 4AGQA 1WIOA 5AW5B 5CEXA 3VM7A 4AGNA 4X9GA 1P7KB 2ZSVB 3Q1SL 5E8DL 2ADYA 3HOGA 2MNUA 3RURA 4EDWL 3QIBD 4NAQA 3UTTE 1F02I 5J5EA 3U9PH 5F6HJ 3D5OF 4B9JA 4DGVL 3L4XA 1FRGL 4KROD 5AVSB 5IUCA 4XWGL 3VXSB 1V7NL 5L88L 1FFNB 3H56A 3TFBA 1Z5HA 4ZS7H 4E42A 3BWAA 4H26A 4A39A 2CUMA 2HKAA 4K94C 4ZMLA 2ETWA 3FTSA 2ZWKA 4LLDB 4M4RA 3TASA 2X7LA 3P73B 4PGZA 4N0UE 4FQCH 2R2HA 4Q9QL 1T1YB 1SHXA 5K69A 2JF1A 2K9FB 4ZQKB 5IF0B 3JWOC 4R83A 4DOHB 2VE6A 5LNEA 2BO0A 2G3MA 3HN3A 4YHYC 4OCRH 4YBQC 5BZDB 4K3JL 3W56A 4ICXA 2EILB 3SGEI 2GEEA 3P0VL 4CU6A 2F19H 4TNEA 4KKZA 3RIFF 2ZG2A 4JFSA 4IDJH 1WBZB 1OOWA 1JGEB 1EO8H 2DI7A 3R4RA 2KLTA 4GMTL 1EH9A 5ICXB 5EF2A 3AITA 4YHOH 5HPMB 1IC1A 3UBXI 4K7FB 3AUVA 4FQXA 2K7PA 4A63A 1HX0A 4MCMA 1OWWA 4F2MA 2WYIA 2DKUA 4LHUB 1IL1B 1MUJB 1I1FB 3BP7A 5LG1A 1CVSC 3FQRA 2WNWA 1T80A 2NQ3A 2EVGA 5IEHB 4FXLA 2E7HA 4MX7B 2W9LA 4X80H 4E9TA 3H9SA 2IAND 1TYJA 5F70A 3EFFA 4ODXB 3ZE2E 1VLXA 4LFHD 1DQLL 4LLUB 3FO2B 4M8UA 3CHXA 3Q13A 1TKWB 1YEWA 2DJ4A 1MJ7H 4RSVA 4Y2LA 1YNTB 2LT9A 1LNUA 5EC1B 5IV2A 2LLNA 4X8CA 1J8RA 1EFXB 2ZKWA 4B9ZA 2EIKB 1A4BA 4U3HA 4MA3B 5LO7A 4KI1A 4WW2F 2HRPH 4FG4A 2OMUB 2RB8A 2D0GA 4LB8A 4YSQA 5BMFL 4JGNA 1ZXKA 2DIBA 3WKML 2J55A 3KG5A 2ITCB 2GTZB 1AH1A 3UYPA 1LL1A 4HHAB 4L4VB 1NAMA 4L23A 5AYUL 3ECBB 3L9YA 3ZTJG 4LBAA 2NY4C 3RPKA 2ZSWB 1A9BA 5DVPA 3VYNA 2Q76A 2ARWA 3DROB 3TJPA 1RZIA 2KZ1B 3TU6A 1DUZA 3UDWA 4U0RB 2NZIA 3BQUD 2WAQA 3PDOA 1WPCA 1EGJL 4N0FB 4QLWA 5AZEH 2Y1YA 1PZ2A 4G6KH 1NFDF 1PDKB 1KYOJ 4LAJH 4N26A 3ARYA 3RNQA 3STLA 4FQHB 4KOCA 2QPEB 3H3BC 4O9HH 1ZTMA 2AXFB 2DTMH 2LHAA 1ZGLP 5CKAA 1TCRB 1S5IH 3DUUB 4ZTEA 5CEZL 4JQXA 3T77A 1UFUA 2P47B 4ZUVB 1IIIA 4WK2B 1BVLA 1CDHA 3DO3A 4LQ1A 2OTWB 2AEQL 1NLDH 3HG0A 2XZQH 2VXSH 3VACA 3D3VA 3DO4A 4RAHA 3VW3H 4WI0A 4XPGH 3W2DH 4J4PA 1JD9A 4NI6A 1LP9A 1Z9LA 3WLWD 4IMLB 5JUEL 5GGUA 3BPCB 3ZDWA 4X99A 1AP2A 5DMIH 3MUGB 3O9WC 3O4LB 2KZWA 2G3ZA 3P3RA 4AQ1B 2ARJA 1MKFA 1YECH 3TBTB 3K8MA 2ADFH 5KSVA 2X6CA 1NSNL 1YRKA 2X87A 3VH8B 2RR3A 2EDXA 3FJTA 4OJFL 3SE4C 2Z4QA 1ET8A 3B1UA 4G8GE 4JHWL 5I8CB 5JPNC 4WUKH 3BPNB 4A2LA 4ZX4A 5KVEH 3C8KB 2KKQA 4PSPA 3WHE1 2EKSB 3KLLA 2FWOB 3G5YA 5TDOA 4A2EA 3QORD 2BX5A 3QIWC 1J8SA 1AZZC 3FULA 2GJ6E 3PIQB 1G87A 4OY9A 1GS6X 3T65A 1G7MB 3ZYJA 3P30H 2JELL 4L3AA 1KIRA 1WH0A 4O02B 5J1AA 4EI5A 2Q86B 4QNPE 1QQDB 2BWDA 3V5KA 3MBEB 1BFTA 5DD1L 4HOMA 1BF8A 1BFOA 4OZ4A 4NZTH 1U8QA 4AQAA 5E0QA 4L5FE 4MKTA 4OZFB 4PGEB 2BLFA 4N8VB 1UH3A 3B2VL 4FF9A 5EU6A 1JNNL 4F7MB 2EE9A 3HIZA 1I8KA 3SKNA 1GYUA 4JPQA 3GM8A 3DBSA 4P46C 2WINB 1PCSA 1BQLH 5DQDL 2MPAL 3GSNA 2IAAC 4Y4FB 3VXOA 2X10A 3LKRA 2E59A 5EPMA 3FQNB 3OAUL 4OCMC 2A83B 3RZCD 2YKKA 1I7UA 1DEEA 1L9PA 4S0SD 3DTUB 4K71C 5FA3A 2JB6A 3ZDZF 3CSGA 2EECA 1M42A 4P4KB 5I82A 4HJ0C 4UUJA 4DOHE 4J39A 1KPUA 4JZNB 2BSED 3KYAA 3UH8A 3P9MB 3T2QA 5E4AA 1RJYA 4D0DA 2FH6A 1IKOP 1SZNA 4OFKA 3CFEA 4DUVA 1G7HA 3KYOA 3LMJH 4RQQB 1F2QA 1LO2H 1R3HB 3LNHA 4N2BA 2XYCA 3RVTD 1QA9A 4RMUA 1E5AA 4XTRD 3VXNB 5JO5B 3D48R 1CI5A 2H0PA 3QDGE 5IHZA 1RUMH 2A7BA 4F20A 2R69L 4BH7B 1H5BB 4N5EC 3MV8B 4FQLL 3FTGB 1BZ9B 5MEOB 5T1KA 3BQVA 2H3NA 1VGEL 2IPTL 2OTUA 3P0GB 1WCQA 5E6IC 3L95A 1PZCA 3KL0A 1SHMA 4YQXH 4Z7NF 5MENB 2AANA 3N85H 1L6PA 5IB2B 2EP6A 4FJYA 2D0FA 3VQMA 4PJAE 2NNCA 4HIHB 3OWRA 3ZKXB 3ZUNC 1XIWA 4NGHL 5FOBB 3AUWB 2IWEA 3N1GC 3ARDA 1WFIA 4MNHA 2MFNA 4H8WL 1J1XH 1R5VA 2VLME 4DZBB 1S9XA 4JO3L 3U4AA 4U1HB 3HAEG 4TTDD 5C07A 2AW2A 3HNVH 4IRSD 1R19A 5C08B 1USZA 3KWXA 1BD2B 3QIBB 4CSPA 1OL0A 2DI8A 2JCWA 2XPGB 4G42B 1S5HA 5FUZL 3R4DA 4BKLA 1TTCA 2A2QT 1MFDL 3EYSL 4KROB 3S35L 3AT0A 1QRNA 4L4VE 2Z8WC 4JN1L 3VXPA 5ERWA 1A0QH 3H3PH 3LN5A 1XGUA 2CJTA 2J57A 3REVB 3EW3B 4Z8FL 1I9IL 3QEQD 4FC3E 1HC1A 1OGAA 2PLTA 4CMMA 1MNUL 2NW3B 4KRPC 3ZL4L 4I5BA 5IHUH 5AYQA 3ZO0A 2WJ7A 4XCYB 3EOAA 2CM6A 1X5ZA 3EJCA 4JREB 3AABA 4TLTA 1DQML 3ERXA 2R8SL 1K2DA 4ODHL 1A3ZA 1JGDA 5H37H 5TPWH 2ZUSA 1JHTB 1NOAA 2BP8B 5M7QA 2D7OA 4MQ7A 2BZ7A 2DLGA 2H6UA 2B59A 5K9QG 3SOBH 2VDPH 1FFPA 2WLKA 2B15A 1NH6A 1GZHA 1JI2A 1X4YA 5J13B 1LO0L 2L7QA 3MV7D 4L8CB 5CD5D 1C16A 3D8MA 4WW2B 4XC1H 3IDNA 1FH5H 2QMJA 2ZUYA 3I2CH 3QIUC 4FE9A 2I69A 5A2KH 3RJOA 4ZJ9A 3HCVA 4AZ8B 1IZJA 3FSAA 3HNSL 5HTSA 2VLLB 3OVUB 3FB6A 3QW9A 1MVFA 1UM4H 4KGJA 2HJFA 3DIFB 4X8JA 4XNQB 3BD4A 2XT1B 1LEGB 3F7PC 3O4LE 1IGMH 4PTUB 2C4FU 4NLHA 1QFUH 4IRZA 4NXKA 4QHNA 2IANB 1H3UA 3ZVVA 1FH2A 4FQJL 3V0HA 3DBXA 3FQWB 2G60H 5JQIB 2R56H 3I02A 4JO4H 5KJRH 1NFDB 4JO1H 4RAUA 1CLOH 2R1XA 4WFHD 3CXDH 2H9GA 2A6KB 4HFWA 1KXTA 5JYLA 4AVKA 1OSEA 4OKDA 3DX1A 5DJZA 4C83B 5CF3A 5GZOA 3NEOA 1Z9MA 3MLZH 3PWLB 5DFWH 3VI3E 3WJLA 5KVFH 1CD8A 2YIHA 4H8HA 5JLZA 4D3CH 4MASA 1SHSA 3LS4H 3KW7A 4N9OB 5ITFA 2DQIH 3WY1A 5L7XL 5E08L 4APQA 5E00A 2J1ZA 2X42A 2QKIB 4OKVB 1KIUB 2EIZB 5KUKA 2WKOA 4L0PB 4M5YH 1OAKL 4G8EA 2R59A 4CC0A 1KBPA 1HYSD 1G9HA 1E27A 4YHZH 3KJ4C 3IGAB 3K6NA 3IN0A 4XN1A 5IMMA 2V9UA 5KSAD 1SLWA 4FA8A 2JWYA 2R9HC 4JFEB 3BH8A 3QNYA 2I32A 2BNQD 4N6RA 1I82A 4U7SA 1U8KB 5I6NA 1QYGH 3CX2A 4LEXL 1A66A 4TSCL 3B2MA 2E74C 1S7QB 2FHBA 1DQDL 2BY1A 4IRZH 1XCTA 5ID0B 1K6QL 3QRGH 4XCEA 2QVTA 1RZQA 4B5ZA 4U1KB 2MTPA 3PP3H 5HGBA 5F3FA 3QCVH 4BFBD 1MAKA 2B4CH 2F7OA 1Q0XH 3GBEA 3GMRA 5I73C 1EHNA 1RUPL 1RUQL 3V6ZA 1A1NB 1LEKA 1SYVB 3QYNA 1NMAL 2DLHA 4Z3FA 1KCVL 3ULVL 4NRZB 2CO3A 3M8OH 1UC6A 5FCUH 2CCVA 3P2DA 2BOBA 4V1DD 4ABQA 3MKKA 1HEHC 2XXMB 2FR4A 4L3EA 1Z3GH 1UD5A 5GGTH 3T4AC 1ZXQA 3SDAC 4Q7DA 2OMYB 1F41A 2MHAA 3RVVC 1FDLH 2ZCZA 4RBPH 2VITA 3N55A 4E9XA 1F6FB 3NABL 4CVZA 3SPCA 1I1AC 4JFUA 4F33A 4M6NL 3LS5H 2Y7SA 3AT8A 3KEHA 4NRYA 3QR0A 4ODWB 1MCNA 2DMKA 2F53D 4GSXA 5E7FA 2NSXA 3SE6A 3VI4A 4QJ3B 2W07A 4NO0D 2R2EB 3FN0H 4DGYL 2VAAA 3RILA 4PCYA 2WUBH 4WJG3 4HS3A 5IBTL 3VWJD 2NYKA 2WWMC 3ZDZB 3QORB 1MLCA 3QUML 1EHLL 4X6FA 3QUYC 3DOIA 3K1KC 4G7YL 2JXMA 4X7EC 4NX0A 2Q3ZA 4GBXC 4F9PC 2AABH 4NOFA 2A6JB 5HGAA 2FQDA 1ZHKB 3I6GA 2EDQA 3MBWB 2XKSA 3O8XB 4NC1E 2P8PA 1WA2X 3VB8A 2AJZA 3MNZA 4P23C 2DQTL 1DN0B 4HSAC 4JLRA 4OZGA 2V37A 3R18A 3IFOA 4KY1H 4FCHA 1KT2A 3AW5A 1WT5A 5LCVL 4X6BA 5ESAA 1NCOA 3K72B 3NZ8A 4FNPA 3G08A 3X13B 1NLBH 1YY9D 3N43F 3RZCB 4Z7NB 3DMMD 1WICA 2VZUA 2FL5B 4PU2A 3BC9A 3G7TA 3HRPA 2DMHA 4PJCA 4BSJA 2AK1L 1AZUA 1AGCB 3U30C 4UQAA 1TITA 4KJYB 3LD8B 1SJHB 4X0KA 4X6EA 3CZKA 2A73A 3T6XA 3GHEL 3FU3A 1J1PL 2FUQA 3SGJA 3QUHA 1URZA 4L9LB 5IJKA 2PW1A 1JGLH 1TVHA 5DEJA 3ILEA 1UATA 3BVNA 4ZK8A 2JLPA 2XZAH 3TO2A 4O2FB 1G7QA 1YEIL 3VUAA 3H53A 1BOGA 5CIPA 4KJPC 5I74C 3LTVA 5KN5A 4KZEL 3O3AB 2HSIA 4JFDD 3WL9B 2YPKB 2BS9A 2PYEA 3M1CA 5IFJA 4QOKD 1WZ1L 3IRCA 4DEPC 4FNTA 2LLGA 3VTAA 4Y5XC 4MMZC 5B8CA 1GOGA 3QO0B 4LHJB 5ISZE 2DPKA 3BEWB 4OZIA 2W0FA 3EYQC 1WF5A 2IANE 1NCCL 3NQKA 3HZMA 1UUNA 1VCBC 1YG9A 3E7JA 3TNMA 4U2ZA 3T8XA 3W0WE 2OMZB 3FCGA 4IOSA 2EXSA 1NFDE 3FRPG 2NXYD 2RH0A 3RTQC 3LZOA 1H3TA 4OIIL 1K4DB 1CFMA 3I75B 2ZCKH 3MROA 3P3YA 4M93B 1N5YH 5BO1L 1XH1A 2Q1EA 4CVXA 3T4YA 3BH9B 2Z4TA 4DSYA 2QQKH 2ENYA 1BFVL 2XACC 3VM5A 3RU8L 2V6HA 1XB6A 1P7BA 4LCCC 2OMBA 4GFXA 1G43A 4U6HB 5GSVA 1YSOA 5AVTB 3RWIB 3VCLB 3OGCA 3X1FA 2BIHA 3WHXA 5EMYA 3TTYA 5D7JD 1DVQA