4AWJC

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
135
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 135
sequence length 139
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4awjC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4awjC01
3ZTCC 3ZRCC 4W9IC 1LQBC 4WQOA 4AWJC 4W9FC 4W9KC 4B95C 4W9CC 4W9LC 4W9DC 1LM8V 4AJYV 5LLIC 4W9JC 3ZRFC 1VCBC 4W9GC 4B9KC 4W9EC 3ZUNC 4BKTC 4BKSC 4W9HC 3ZTDC
chains in the Genus database with same CATH superfamily
2CSPA 3MYJA 4M1DH 3DVNA 3BUBA 3QWQB 2H3XC 1BECA 4QHKI 5G4NA 2D3JA 2YRPA 1QNZH 2FBJL 5IHWA 4XNMB 2IAAC 3FCGA 3EOBB 4HXBH 4ERSH 4WWID 5C0CA 3VQ1C 4AGNA 1CLCA 4XGZA 5MEOB 2RALA 2VDOB 5FDYA 1WBXA 4A2LA 2F7OA 3B2VL 2NQDA 1IEAA 4PGBA 3CJJA 5KSBB 1W72A 3QUKB 1PZ2A 1OIOA 2EQDA 1I8KB 4LSRH 5JHDA 1BXAA 2BIOA 1U4EA 4GBXD 4FJYA 3BWAB 3ZYIA 1YG9A 4XVUD 1WVZA 1AI1H 5ESVB 1KULA 3WE1A 2DM7A 2OTUB 3AS0A 3BDYL 3WFBL 1NM9A 5I1CH 2A6DB 4Q2ZA 1VFMA 2QGCA 2YD9A 2WSPA 1M2VB 2NLJA 3BGMA 3OGCB 2ZZUT 3GIZL 2CKBA 1S9WB 3MBEB 2H8PB 5CEXB 4RETB 3AY4C 4KAQH 4WFFE 4DZ8B 1TSRA 3IKCA 4U1MB 4DFIA 3TVMA 3SZ6A 2AK4E 2EINB 2H2SC 1FC1A 3NJHA 4AEFA 4FA6A 2P24B 3MI6A 1NCWL 1I7UA 5BS0B 2XWJA 3RAJL 1MF2H 1YEIH 3V0GA 3B9VA 1RMFL 2K45A 2BMKB 5C0NC 3L9RA 1N6QL 2CR6A 5AOJA 5EO9A 3RGVC 4JO2H 3T0EE 5JR1L 4TVSa 2XTJB 2DN7A 3MC0A 3LPWA 3EAKA 4ZSOB 2P8MA 3DPBA 1B6DA 2VDLH 2FWSA 2NY1D 3MODL 4ETYA 5CCKL 3HR5A 3LB6D 4LVHB 3FB7A 3ILQC 5FYKE 1YAIA 4HCRL 1OGAB 5J0BA 1HKFA 2BXZA 4TQPA 1W0VA 3MLSH 3CDGA 4M7LT 2EEXA 3ORJA 4HIHA 4WK0B 4MA3B 1OP9A 4QRRA 3K2UH 4M02A 5DMIH 2YJQA 3ZDWA 4G7YH 3UG3A 3KLDA 3RA7H 5IROD 1DQML 2G9HB 5ACLA 4XBGB 4WFGE 1YDPA 3EDJA 5KOMC 1HDMA 4U2YA 4R7NB 1DLFL 2KI6A 4PJFF 3RPIB 3A21A 4KV5E 4POZD 4Y2OB 5C97A 2NY3C 1RJYA 4XNQB 1P6WA 3D0LB 4GINA 3X14B 2Z9TA 2UWEB 2FJHB 4V2CB 4MCZA 4IGBC 3L4UA 3AXLB 4XPFH 4L8DA 3WD5L 4XCYA 1A4KB 5CR1A 1QEWB 5I8OL 5EIIA 3UIYA 1Q72H 1RJLB 4QYOB 3NJLA 1P7KA 2PW1A 4F80A 5C3LD 3BN3B 2G0LA 4XCEB 4H26A 1JHTA 4P23C 5GRUL 4HXAL 2IH3A 3M1CA 3TCXA 4BH7B 5J4MA 1B4JH 2GUOA 5ECJE 4CW1B 1E27A 2J8OA 1VGEL 4N9GB 1NTDA 1MFCH 1P4BL 2ID5A 1TG8A 4AH2A 2WBJD 3SPCA 3WL9B 2UVEA 3QCVL 4FQXA 4OLZL 1KCKA 1OOAA 1JI2A 1J0HA 1DN2A 2NQ3A 2YZ1A 3LN4B 4BQCA 3WAJA 4HKXA 4JCMA 3OHXA 3RPKA 5F8QC 4Y19B 4M5SA 3SGDH 5L2JA 2WWKT 2RMNA 4I13B 3QXDA 5A7BA 4EPSA 3LKRB 3MOAL 4PJIF 5JW3H 4XOBA 4TVPH 3SOBH 3LKSA 2L7JA 3WHXA 4D9LL 2WZAA 3IPEA 2FJGA 3KXFD 4LFHD 4LSVL 3VFSA 4B9PA 5C2BH 4BBWA 1T7VA 4O9HH 2IXQA 3QQNA 3K8LA 3MLZL 4JHWL 1LDPL 3SDYH 2VLKD 1M3IA 4AVIA 4G3YL 3ZNGA 2IBBA 2PXYA 2NXZB 5CKAA 3E3QE 4YHIB 5FKAA 4LEOA 2E59A 1IGCL 3QQDA 1I1CA 4NQCA 5A6MA 3QO0B 1MFVA 3GB7A 1Q9LA 1LVEA 5HHQB 4NN5B 3OV6A 4ZS7L 5B3JE 3F7PC 3WO4B 4ZD3H 3FAXA 1Z3RA 1A6ZB 5LO7A 5CCGE 4OR1A 5HD8C 5I0ZA 1XGPA 4WFEE 4FQ2H 5I6NA 2F61A 3GZQA 1KJVA 5FM5M 4ZJ9A 4TSBH 3HC3H 3SDDC 3W0WE 4L4TE 5IUSA 5AYTA 1FGNH 1IILE 4HJIA 4WI8A 3RWCA 5D2NA 2XOTA 1DVTA 3ZTNL 2Q76B 5FWQA 4GKZA 4HQQH 1GGCH 3F2LA 2V9RA 3MRQB 4ZW7A 4FTVD 3MRLA 1ZTXL 1QP1A 1XF3B 3FO0L 2GPZA 4FYRA 1C08A 1KNOB 1FFNB 1W9XA 2XTSA 3NGBB 1TJXA 3P30H 1WIUA 4UBDD 4GQRA 5GPRA 1D3CA 2XVLA 3A3YB 3N85H 3CMGA 1SOQA 1UD6A 2PWGA 5DUPH 3IS1X 4YQXH 2R0ZH 4MNQE 4WU5A 2JIXB 1X4XA 2FR4A 4DEPB 1W91A 2GBAA 4PRBA 2IFFH 4LLDB 4RDQF 2BSTB 3SPHA 2OMYB 1S9XB 3HZVB 4IU2A 5EEXA 3WFHB 2KHAA 2FWLB 1ONQB 1CF1A 5F96H 1GOHA 4ZDHA 1T66C 3EO0B 3KPOA 1T2XA 2Z92B 5BO0D 1AC6A 2XSKA 1P7HL 4XE0A 4RSVA 1DQVA 4QY8A 3CN3A 3LZNA 1ETZA 2HRGA 3AWFA 4YDVA 2R29L 2JQMA 3F12A 4F2FA 4LP5A 3UBFA 3UEQA 1E5YA 5T5FA 3L2LA 3T0VA 4LAQL 4JY5H 2VITA 3HC4L 5BV7C 4IBUA 5LDUA 5FA3B 5C0BE 2WZPA 4EQ3A 1SM3L 5KVFL 4N0YL 3OKOA 2B9BA 4NQTA 5D7JB 3W82A 4LCVA 1L5GA 3QEHA 4I3SH 5GRJH 1AHMA 1MVUA 4L3ED 3RBSA 5HYEA 3TTYA 3B3IA 3BEVB 3UTPD 5KYWA 3HEIB 4C4KO 3R7QA 1RK1A 4YOKA 4JG9A 4ZW8A 1XDTT 3PGFL 2CCWA 5I1DB 5J6GB 1CVRA 1FCCA 2V5SA 4GAGL 1DJXA 4YSEA 4I89A 2CJSA 7TAAA 2R0LL 1EGJL 1ZRUA 3HZKA 4FI7A 3BLPX 1JK9A 4KGLA 5F7EL 4QNPE 1D6VH 5IJKC 1Y6NR 2EXYD 4XCNB 3HS9A 4HS8L 2GSIB 2Y1ZA 1IGYB 1INDL 2WSKA 5I5RA 2VN3A 5ICXA 3O3AA 4JREB 3EJUA 5HYSA 3DNKA 4JVUA 5JNYA 2K4AA 3MR9A 2NY7H 2YMTA 4GKSB 4RMUA 2G2RB 3PL6B 5J1AA 4LCWD 2Q3AA 1JWSB 1QLRB 4HUCA 4IIQB 1NIAA 1OD7A 1XGRA 5H4YA 1LEIB 5JQ6H 3QUML 4Z3JA 3V5HA 1QSFA 3EDDA 2J57A 5IKCA 3QI9D 2XKSA 3OXRA 3TT3H 5FUOH 3SCMB 3EJZC 1WZ1L 4MDJB 1R47A 5B1AB 5CN3A 4Z7UA 4LSTL 3GSVB 4PJXB 4RZCA 5F89A 4TULL 1KBWA 1DFXA 2GEEA 4ODUB 1Y18A 5ALBL 3KYKL 2X89D 4P2OC 1CQYA 2EVGA 5B7MA 4XP9L 1SXBA 1U8QA 1U58A 2X09A 4Y1SA 2AI0H 1FORH 1KDIA 1PAMA 4ONGL 4PP2B 4TNFA 3VGGA 5EU5B 3TESA 1NC2D 2Q2EB 5MHSE 4MASA 4IOIB 1HKLL 3IETB 5E8PB 4F9LA 1IAII 4MLSA 1PU0A 2YLKA 5CILL 2HJFA 3ZKXB 2K6ZA 1RHHA 3CLEH 1WBZB 1T1ZA 3IWUA 2VQ1A 1JYNA 4X4XB 2AQNA 3QZLA 1IBFA 1JHLH 1OB0A 5C0EB 1KEMH 1TQCC 2BC4A 1KLUB 5B39A 4MA1C 1E4HA 3NCBB 4NXSA 1CI5A 4AQZA 3L81A 3PXJA 1GC1L 1G7IB 4XP4L 3HAEH 3P0VL 2PPAA 3LH2L 3VJ6B 3EYUL 1P84K 5FYLD 1UWGL 3RJDA 4N0UB 4FHBD 3UG4A 1G9NH 3CQPA 3FCSA 4HIIB 4KY1L 1DJHA 4CC0A 3QO1A 4NO3B 3TPUB 3BEWB 3EJPA 3VI4F 1HK6A 2DQHH 4UT7H 1DCEA 5EU6D 4GSDH 5T3ZL 1CJYA 1OWRM 2C1OA 2J3SA 1A6VL 2KDGA 4WGKA 3SB3A 3SYOA 3WIHL 2A3TA 3ULUH 3PQYB 3WENA 1AR1C 1AO7A 2OX5A 1ID2A 2XX1A 3EYSH 2YWZA 2BZ7A 3GO1H 3M17B 2N4IA 1JZFA 1FZMA 5TPWL 3VMNA 2RJMA 3TEWA 2BIQA 4PN6A 1P0SE 1U3HD 1VEOA 1KPRA 4XMPH 4AUJA 3IJSA 5IVNA 5AFAA 1KFAH 4M7JH 3BP7A 1HXKA 1S7QA 3QIBD 3V6OA 3QJXA 1RZIA 2WV3A 1Q0XH 3JUYA 4OCSL 3TH4T 2A6IA 3GZOA 3K8KA 3Q6GH 4OLVH 5L6YL 4IDJH 1ASQA 4Q7DA 4X7TA 3RL1A 3T4YA 4Q6IC 2GTWB 1F11A 1KJMA 3MV9E 4GPVA 2GI7A 4JR9L 3NSYA 5B8CA 2FR4B 2XA8H 5BW7C 1G7MB 1UOLA 2K7QA 4AW4A 5H4ZA 3L1GA 5J12B 3CZLA 4QRAA 3HRZC 4CSZA 3RHWK 2W9EH 4TSCH 5JDSB 4Z7VE 4KKNA 4HUKB 2R39A 5KOVC 2XV2A 1QPKA 3UAJA 3QT2A 5ESQA 2B9AA 4PGCB 1G1OA 4OFPA 4KKBD 4HS6B 5AAPA 3MU3A 1F4WL 3VWJD 3C5ZC 2QDWA 4JVWA 15C8H 1TYEB 2AJSL 4FEIA 2W1NA 4NBYB 4NUMA 1BLNB 2AXHA 4HBCL 5I1IL 3EYOA 5GISL 1QUPA 3NCJL 4DGVL 1TTFA 1J8HB 4PJ9B 4S1DC 3OKMA 4YDJA 1QABA 2ADGA 1JD9A 4WNQB 2CO6B 3UTSE 1HCFX 1VESA 3BAEH 2X4RB 1LWRA 5D1QE 1T89A 1CZ8H 2HG5B 2MQGA 2AGJH 4OZGE 1V55B 3B8SA 5AZEH 1XGUA 3KYOB 2EEDA 4PJGB 4X5XB 4IBYA 3DGDA 2R2BB 3RVXC 3QZWG 1UHVA 3BUYA 3BJ91 3MBXL 1C5BL 4XT1C 2C3XA 5HJGA 3VXTB 3UPCA 1F4YH 3EW3B 3OF6D 4XO5A 4LPYA 1WISA 4XPTL 5DK3A 4BKSC 2IOMA 3FH5A 4EZLA 3MLVH 1OTTC 1QNIA 4OM1H 3BPCA 5DWUL 3UO1L 4RFNC 4OV5B 1WT5C 2UY7B 3FB5B 4K94H 4X6CE 2OMNA 2GSGB 4AQOA 1MI5B 3R19A 1EAQA 1WF5A 4NENA 1N0LB 5DRXA 3E3QC 1QVOA 2WUBH 1TO4A 4JRXA 5IBLD 3O3DA 2P5ED 1L7IL 3IXTA 3BFOA 2IH9A 3GS0A 4G9DB 5B38A 4JKWA 1VADB 2JKIS 3CWGA 3DYPA 4RAVA 5HHMD 1J12A 1WWAX 3BIAX 4AEEA 3ABLB 5DHEA 1H6FA 1U8NA 4N8VG 2DQJL 5C0AA 3VXUB 1L0XA 3MTXA 4OM0H 3PJSB 4IRJB 2NY5L 5CR8A 2R8SL 3DIFA 5CEYB 2ZE0A 4X8XA 4OSUH 1MWAA 4N2LA 4XWGL 1LILA 2QKIC 5HDBE 1JUFB 2AXWA 1SDAB 4KZCA 5DJAA 4PB0H 4MMZA 2CJ3A 2GAZA 2COVD 3EH5B 3NACH 4GFXA 5F0JB 5TH2B 4A1RA 1OHZA 2GC7C 4JY4A 3QS2A 3BHBB 4N2HA 3QULA 5HVHC 2ZP9A 4OQTH 5T3XL 5K69A 5KVGL 4M3JA 2XNAA 2JJVA 1AC0A 3L9BA 4PJHE 3GSXA 3U46A 1KGXA 1C16B 3GSOB 1NGPL 1NGZB 1ZHBA 2XVKA 3P73B 4KOBA 2FJFA 3HE7D 2BY0A 2YD4A 4N0RA 1A3RL 2ICCA 1SXSA 3UJIL 5AZ2H 3RQ3A 1R3LA 1H8SA 1KB9K 1PTZA 3MRBA 3P4OA 2QELA 3QDGD 5GS2H 4J4PA 1BZOA 4HK3N 4YUEH 2A73B 3VXQA 4DGWC 1N0XH 1AJ7L 2WIIB 4E9XA 2AFNA 1SGKA 4QAWA 3X11B 1P4IH 5J6HA 2E9JA 1V7NH 2G4GA 1YN6B 2NNRA 1GH7A 5F3BA 4PJ8C 4N8PA 5GSRB 3AROA 4HGWA 1QSVA 3F85A 2HT4C 1S3RA 3H2PA 1KYOK 2ED6A 4PD4J 1CFQA 1UD3A 1R5VB 2OXGB 1HQ4B 4JPWH 3JWDH 1P5UB 3F7LA 4LLQB 4XNYH 1QBLL 2CGRL 5E4AA 1IC0A 3Q06A 3QFJE 2YC1A 4L4VA 3T4AA 2IO5A 1IAKB 1KBGL 4XBEL 4ODXA 3IFNH 1SXCA 2LU5A 5KVDE 2HP4A 2F74B 4PRPE 5IMMB 1MHPH 4NJ9L 1FVEB 1DJZA 3SDCD 1T1XB 4HH9A 3W9EB 5C09E 3BAWA 1TQBB 2VNCA 1FL5A 1ZA6A 4EUPA 3LH9A 3IRPX 1GZQA 1I1YB 3BPNB 4R4FL 4EBQL 2Z0UA 2ICES 3P3RA 5FO9B 4E41D 2GTZB 4PRIA 5K1JA 3QE5A 3CAFA 3NPSC 3DX8B 1DZBA 4KMQA 2J1WA 2DQEL 1G6RH 3T3PE 3QHFL 5DFAA 4I18B 3CVIL 4WY7H 4ZFGL 1I9JH 4GW5A 3UOAB 1D5IH 4IBTA 1LXMA 5F9DC 5CCJA 3U6RB 2X4TB 4JFFB 1B90A 2NT0A 3QUYC 4YXHH 5GGTL 2K8MA 3IDNA 4H88H 1XAUA 4P3DB 4QWWC 3ISYA 2ZX8A 5F6IC 4W4OC 2VC2L 2EIEA 3GBEA 4XP6H 3CZUB 5CP3A 3CZFA 4NC1E 4UOW0 2DQGH 3IGFA 4XHQA 4GXUM 4YEEA 3T2PA 2OR9L 3GIVB 3IPFA 3UBXG 5EULV 1R5IB 1KTCA 3RFRA 3WHE1 4JRFA 2R0WH 2D2CC 3WG7B 1WWCA 5LBVA 1J48A 1V10A 3LXBA 4RMWA 1ZVYA 3L13A 1PD6A 1AQMA 3OWEA 5B22A 2YAPA 4JHZA 5C0RH 2E56A 3VA6A 2KS0A 1R3KB 5I1HL 1FNHA 2VDML 4YSRA 1YMHB 1XF5A 2JJUA 5H2BA 5TDNA 3U7WH 4NUGH 4B50A 4ENED 1XO8A 3EO1A 3MXWH 3RKDD 1X3DA 4JW3A 4HKJA 3X1FA 4ZUTB 4YGAB 4ALAH 3SPIA 4TNGA 4HIXH 5I1LA 4WW1A 1SQ2N 4TNWF 1BEXA 4N90D 4PRAB 1M7IB 4MWFA 1SRDA 4LLVA 2JJTA 2XY1A 3AMKA 3D50A 2Y5TB 4X98A 5IMOA 4AT6B 4BDVA 1F3DJ 1KDJA 2X2JA 5I26A 3ILEA 1GZPA 3H9SE 4MDIB 5HGHB 2O5XL 3VXOB 3C5JA 1ED3B 3RDTC 1HAWA 2Z35A 2AEPH 3N42B 3ZE2B 3EKCA 3SEPA 3IDIB 4JUSA 4ODHH 2Y23A 4U3XA 1AYOA 3N55A 4K15A 3WXVL 4ZQKA 5I75C 3HBGA 5F7KC 3HC0B 1FFPA 5KN5B 1D2OA 1YC7A 1SHMA 2NR6A 2GJ6B 5DFVC 3QWOA 3D6GA 1GXEA 1XFPA 3B3BA 2P9RA 2DEWX 3DX9B 5JMRA 1YNKL 3GMPA 3QB7C 1M6OB 3ZT6A 4UQDA 3QYMA 3NIGB 3AREB 5JDJA 3GMNB 3IMVA 1J0IA 1KCUH 5FW8A 1M7XA 4OB5H 3F6LA 1UWXK 2P8LB 5JZ7C 4BK4A 5FEBA 4ONHB 4RRPG 2NX5A 1NPUA 3JQOB 3DUHA 3UAEA 1PMYA 3ZQXA 5KUMA 4JG5A 3VFRB 4NEHB 3PP3K 4LIQE 1IRAY 3TCLA 2F5AL 1M56B 3MLTA 3W5NA 1R0AL 5JXED 3OKLB 4F1ZA 1YEDA 3ULVH 2JCWA 4NN7B 1T1YB 4NZUH 1TTRA 1TTGA 3EUUA 2O4EA 2EDKA 4BYHA 4P2RD 4RISL 4WO4C 3D9AL 4Q9BA 3O6FB 2D9QB 2X6MA 1S5HA 3L4XA 5E2VH 2OMXA 1TPXB 3EXLA 4PJ7E 1SY6L 4Y2DB 5GHWL 5KYXA 4HUWA 3ZDYE 3ZDZF 3NRPA 1YUKB 1EDQA 5HVGB 1AHWC 3F04A 1CFTB 3EZ8A 1S5IH 1JGVH 4ZZKA 3LNFA 4G8FA 3C2SA 1CS6A 1NH6A 4EN3C 5KYYB 3KR3L 1YEJL 4N25A 3VXMB 3DRTA 3IMTA 3WLBA 3QUZB 2VTFA 4X8CA 1DDHA 1LE5A 1TZGH 5J56B 3S35H 3D3VD 4ZTPL 1NMCC 1GMEA 3VFNB 4X9GA 1SOKA 5CINL 2F8VA 2NY4C 4ZNEA 1ACYL 3FB8B 1WC7A 1QLFA 2PCFB 4PJAB 2JKJA 3VFVA 2CNYA 4PRHA 5J13C 3CX5K 4GW1A 2ITFA 5D6DC 5KS9B 3F7QA 3ZYJA 2JKSA 2CCLA 3UACA 4CVXA 3FTUA 3TEUA 4OJDH 2FB4L 4G7QB 5E1IA 2FUQA 3BFQG 3SYQA 3FU7A 4KI5C 4LVNB 5JPNA 5D5MA 4M5TA 1V5JA 2CHZA 3GJFB 3NEOA 5EZIH 5I15L 5AUMB 4W9HC 3FHAA 4JZJB 4YDLB 1YMME 1BAFL 1R34A 4JO1H 2WWOA 5SV4A 4NLAA 1ECZA 4F3FA 1RZJL 1BZ7B 1BXXA 1E8XA 4MZRA 3U6XS 1L9RA 5ACZB 1SLUA 2A83B 5E7BA 2VC2B 3V4PB 5KSBE 4ZX3A 1CK0H 1WH0A 2YK1H 2K3HA 2DI9A 5T1MA 1H9DA 1MFDL 4HT1H 5BOPA 4JRYA 3AAZA 3MRMA 4NUJA 1YVLA 5DURD 3A6BL 4L8CA 3F62A 5IJVA 2HT2D 3LN5A 2BVYA 3G6AA 3FQTA 3RBGA 2GCYB 2CBQA 3A47A 3OJ2C 4PTTB 3SGJC 1UVQB 3PAZA 2JQZA 1MCPH 1HQRA 2F15A 3LQZA 1I3GH 3Q6FB 4HFWB 4NAJA 4YAQA 1ADQH 4HGKC 2I69A 4N8VB 5KVMC 5AVUB 3CX2A 5DJYB 5MEPB 4DIXA 2ZXCA 4IBQA 1VLXA 2VR6A 2WUCL 4P4KB 4OCWL 4OF3A 1CXLA 1HESA 3U25A 5F9OL 2HFEB 3UYOD 4FFZL 3U7AA 1RP9A 3RX7A 5BS0E 2I9TB 1LM8V 1VCAA 4NNXA 7FABL 2Y7QB 2Z7YA 3I3EA 1ORSB 2IWKA 3WEXB 4AKPA 3HUJA 2X0WA 1QHQA 3H42L 4PGEB 1T0OA 2N7SA 4MZ2A 2Q8BH 2XN9D 2XTJE 4M8QA 1NKGA 5E8NB 3BAKA 1ODUA 2F1AA 4ZSOE 2F08A 2X6AA 1OAJA 3ASWA 3AM8C 1MREH 1SBBA 2XXGA 3K81A 2X05A 1FE8H 1MUJA 1PZSA 1HCZA 2A4EA 4IJ3B 4YR6B 1OM3H 1GYUA 3MUGB 1OGAE 5I74C 4WI7A 3RI5F 1M7DB 4JEGB 3STLB 4BFNA 4GKOA 4HS3B 3OR6B 3C2AL 2C9QA 3QPXH 3FRPG 5MENB 1M7UA 2V17L 1BBJB 4Z3IA 4DPAX 3ELAT 4HC1A 1QTPA 3JT0A 2H2SD 3LSOA 2WTRA 3CHRA 2MRYA 2QQQA 5E1HB 3TNNB 3UYPA 3QIWA 5DVPA 2BNUA 2VAAA 1KIRA 4CBPA 4O51A 1FIEA 1U8LB 1XB3A 3FRUB 4FG4A 3LIZH 2UWEE 3HZMA 2JIXD 4KKCC 4PVLA 3VGDA 1R6VA 4LSSL 3L1OL 2WO4A 1UKTA 4MMXC 2JNZA 3HNSH 2R1XA 3RGVD 3N41B 2G5BB 2X44D 1AFVH 4ZFOL 2V2XA 4PJBF 4QXGL 1FFOA 2VDNL 4J6RH 3JV4B 4IEFA 3NABH 4JFUA 3PWJA 2A6JA 4FFYA 4FFVD 4OZFB 1NKOA 4FG2A 1IM9B 4X6FB 3T65A 2VMCA 3L3IA 3C09C 4EI5A 1BLIA 3OKDB 4CKVX 4NGHH 4PV8B 5IG7B 1A6UH 1O7SA 3D34A 4QIRA 4U4BA 1N67A 3GDBA 4P2QE 1IBBA 4PGJA 1UXSB 1G87A 5KAQG 4NC1C 3KBPA 1YQVH 4NO0D 2A0LC 3GLZA 4UQ2A 1MFBL 2NY3D 4UDUB 1UOKA 5DHVH 3F7YB 3FAWA 5A2BA 2MHAB 2WPGA 3ABZA 4PJ5B 5SWZE 5TDPB 4O2CB 5KTEL 3OKEB 3NFSH 5DI8A 4IGBD 43CAB 4F93B 1C1EL 4Y1AA 3FN0L 2IMMA 3RY6A 4DO4A 3S5YA 4MJ6B 2V33A 2PPCA 3C6SA 1NEZA 3MROA 1B2YA 2PYEB 4P23D 1ZGLM 3L16A 2HKFL 3BZ4A 1LWJA 2MOQA 3I02A 1MRDH 3V0JA 2DL2A 3UCQA 2IGLA 1CDGA 2P5WD 3IAQA 1TQUA 4TSAH 4NZFA 1U93A 3O4LA 3QJZA 4JM2A 4HAGA 3LKNB 1BV8A 1N5AA 4HG4K 5ESAB 4FMVA 1ZT7A 3TNNA 1D9KB 4GRLC 3SIKA 1G7HB 1RZ8B 2AQ2A 1TCRA 4HUMB 3AWGA 4ZODA 2CUMA 1J05A 1KTDA 4MTMA 3B9KB 1AOHA 2E7CA 5C3TA 3ZVVA 4D9QD 3DV6B 4U6HB 2Y06L 5C9JA 4OZIF 3KPLA 2PCYA 2DLHA 2H0FA 4D0DB 5HJ3A 3UROR 1KYDA 3F8UB 3IAPA 1SN5A 5F1IB 3LQAL 1BF8A 4M6OH 3V7AG 1CFSB 4I88A 3K7UA 3KPPB 4KHXL 5DRZA 2VH5H 2IPTL 2HYMA 1NCHA 2IWFA 4L3FA 4NDMA 4QHNB 3MA9H 4K71C 1F4AA 2IAMB 1NAKH 2F53E 5JXAH 3IJEB 4DHLA 5FX3A 2IC2A 3O6MH 5I73C 5I6OA 3FSZA 2V6HA 3SE8H 2Q3ZA 2BNRB 2PP7A 3PU7A 2DBLL 1AKPA 1DP0A 3FCTB 3SDXA 2FRGP 4ENZA 3RWJA 5KSVB 3SDDD 5D7IB 1U42A 4M1GH 5GZNA 2X9YA 5KW9L 2HRPL 3LQAC 1RU9L 2C9SA 5ETUB 1X5JA 1WPCA 3BWZA 1NCCH 5DUBA 1FVDA 4JZNB 1QQDA 1RZKH 4LF3B 3CK0H 4R0LC 4PVNA 5F7DB 4PJCB 4OIFA 4W9KC 3I50H 5CD5C 4EIBA 1QPXA 1U8PA 3ARVA 4HHGA 5TJWK 4OLXL 4KXBA 2VYRE 1F3JA 2IG2L 3NK4A 2VLJD 2OMZB 1BVOA 1UWXH 2N7BA 4CKQA 4XC1H 2DDQH 2HJKA 4RA3A 1I1AC 2I9LA 3UPRA 5DZLA 5AAWC 1OWWA 3L3DB 2VN6A 1UATA 3PP3H 3EHBC 2BSCA 4QRPD 5DJ8A 1EXGA 3MJ9H 4LCYA 5KANG 5F88A 2AK4A 2VDRB 2V7NB 1YNTA 2QSCH 5KSUB 2AK1L 4KPHL 1QO3B 1RZ7H 2Q6WA 4AV4A 43C9B 4G9FE 4KTDL 2Y07H 4IKNA 3S3PA 1IBZA 1KCBA 4I0PA 3GZKA 3FU6A 5IEHA 1NPNA 5EU4B 1XXDC 3GBMH 1HJBC 3ZL4L 3ISWA 3T0EA 4N4YB 1BXUA 1ERNA 3C9NA 3BH8B 3MCYA 4N22A 4ZFOB 1OAXH 3ZUNC 4PJXE 5C9KA 3DUUA 3WTSA 1P1VA 4X99A 1PVHA 5HYIA 2DWDB 1A6PA 3O3BB 3DX6A 2G75B 4DGYH 1K4CB 5F71A 3PWUB 2XIBA 4EEEA 3DKHA 4AQAA 1H8OA 2GVYA 2OL3L 1A6AA 2GYSA 1CGUA 1CLVA 2IEPA 2OTWA 2GITA 3ARRA 4NRZB 3VTMA 3DX7A 1HSAA 1NWOA 4WWPA 5KSAC 1JVKA 1S7TA 4QOKB 1ZANH 1ZHNB 3ENEA 4EIZC 2OPCA 2OMWB 2CDGB 2HJLB 2RR3A 4TYUA 5E8DH 4MNGA 1E6JH 1LP9A 1OT1A 3L95A 1G7PB 5I6PA 3QK0A 2A9CA 1EJOL 4F37F 4Q0XH 2P28B 5CS7A 1FRGL 5I0XA 4DSYA 1JWUB 1HEJC 5EBLA 4S1SH 2ZG1A 3P0YL 3WBDA 3U1QA 5IFHH 1DUYB 1IC5L 3INOA 3RX9A 2BS8A 4LOUC 4X8GA 2FIRT 2XPGB 3T8VA 4AL8L 2XZAL 3A6CL 5JOPE 1HHIB 5HDLA 3EJZD 5CSBA 5C6TL 1TR7A 2WANA 5DEGB 4E9LA 2AZAA 1HOCB 3GXFA 4OUUB 3CFUA 2EE3A 4HHWA 4OD3H 4TRPH 1KY7A 3MGOB 5DJXB 3ECBA 2Q9OA 1OANA 3KPRE 2P44B 4JPVH 4M93C 4N0UE 4WWKB 5D72L 4P2OD 3V0VA 4AE0A 4EIUA 3QDHA 2HMIC 1A25A 1DEDA 4Z3EA 2Z31A 4R8WH 3QORA 1UB6B 4MSWA 5CGBA 4AL8C 3CFJA 3POCA 3HCVA 3RG1C 4H1LA 1IGFH 2VR8A 4Q14A 3WS6A 4C57C 1EMTH 3IGKA 3DUSA 4MNHB 5EZLA 3VYOA 4CNIB 4DPBX 2ZYSA 3R18A 5BVJA 3T71A 3PQYE 1UQSB 4J28A 1ZLVH 4LLWA 1XR9A 1N5YL 2UZXB 4RFEB 4ZMLA 1B0GA 1YPZA 3CSBA 4HJJH 4ZMYA 3G5YA 2VABA 3CZEA 4G42B 5H37A 4L1BA 5JO5B 3WN5B 1AZNA 3SKOA 5L9DH 1Z5LB 2JKLA 2Z1PA 4NQSA 2V4LA 1W72H 2YUVA 3B2MA 5D6CA 4WHDA 1RJZA 2JELH 3D08A 3NCEB 4JFDD 1KIUA 3LRKA 4JX0A 4R96B 3V0WH 4Q9CA 5HYJA 3ALWA 2R69A 1OE2A 5I1EL 4H8VA 4XVTL 1NBVL 1KCWA 3S2AA 5LHDA 4WFFD 1BVKB 4K9EL 3LEXA 3ZE1B 3ARWA 3ZHLA 3HC2A 3DV4A 1FAIH 1T04A 4XPGH 1I8IA 2WLZA 5K9QI 1GGBL 1GS7A 2HLEB 3ZMNA 1K2DA 1CLZH 3EBAA 4H8UA 4MQXD 2KZ1B 4OLYL 4DN4H 4WI3A 2BH0A 1DVSA 3NJVA 4L4TA 3W0WA 2CKBH 1BM3H 3AGVA 1G4MA 4NYLB 4OFQA 5DGRA 4ZFFB 5DJ6A 4PS8A 5CD3B 2ZF8A 3K5RA 1K4DB 1UCTA 35C8H 1VA9A 2QEJA 5IQNA 1QSED 1ET7A 1WEJH 3Q8AA 1AR1D 1CUOA 1MW3A 3S36H 4K9EC 3FRPB 4ZFQA 3VXSB 4ZPTA 3J8F7 4O2EA 4QHMB 4PG2C 4DT2A 4RESB 1OGTA 4B7IA 4E42A 4JG1L 3EGDA 2X4UA 3PIQB 1WHOA 5FYKD 4Z78B 1J1XL 1DVUA 3P69A 4M56A 3G5VB 1OZTG 2XG4A 4I3GA 3IBOA 4MNQA 1CU4L 2LFGA 1E8YA 4OZHE 5CMAA 1WIPA 3M1BA 3LV3A 3FTWA 3Q1SH 3K72B 5SX5K 5T3ZD 4AUUA 1IFHH 3RUGB 2NSMA 2BCKB 1UKSA 3CSYB 4W9EC 1HWGB 1IKNA 2AV7B 4IRSB 1J5OL 4R26H 2N1KA 2QGDA 2Y72A 3KBFA 5GJSH 4EZKA 2WLJA 2X4QA 3PNWB 4PJGE 4PP1C 4WTZG 1CL7H 1XIWA 4YPGB 1F2XK 4UM9D 1UD5A 5ECGA 2VLLB 2Z8WC 4D8OA 1U6AL 4O02B 5B1KA 1ORQA 4LLMA 2W65B 2WBJA 1CYWA 3QXAA 2JB5H 2WJ5A 1BIIA 2F68X 5C0BA 2EE6A 4MB3A 1HHGA 1MI5E 4Z23A 4EXPX 4ZMNA 3K6DA 2ZWKA 2J1ZA 1PZUB 1LNUB 4OCXH 3VH8G 4OGXH 3VD4A 2J5LC 3ERXA 5I6XB 2IIJA 4GG8A 2C1PA 2HVKB 2O5ZH 3FTGB 1WA2X 4M1DL 3BESR 2XKNA 3PWLA 4ZOBA 3FUKA 2OL3B 4J39A 1F5WA 2ATAA 4S1DD 1NMBH 3KXFA 3WO3B 1QNZL 3U4BL 2EKJA 3FKUS 2FT7A 3WDIA 2YQ3A 2XQYG 4MDRA 4HXBL 4PWFA 3WELA 3VXUE 4ERSL 2JVUA 5CJOH 2ITCA 4TTGA 2BJML 1JF5A 4PJEB 4M48H 4TQEH 1W0WA 3DX2A 3UTZA 1LLAA 1MIEH 4LSRL 3QA3A 2PTTA 2DTSA 4BKLA 3X13A 3AJ7A 2J25A 2YD3A 4S11A 3TBSA 2MPAH 4LHUA 3LS4L 1DE4A 1JZ2A 2GJZB 1AI1L 2HFFA 4Y4HB 5C0IA 4OGZA 3PGDA 1H3XA 2FTAA 4JO4H 5EDXA 5I1CL 3SGKA 4DQOH 3S8WA 2ATKB 5FM5O 4Y5XA 4CL7A 1KC5H 4X9FA 4YSOA 1WAAF 1FH5H 1L4IA 1MELA 3EOAB 2VW6A 4WUKH 2JQAA 1EK3A 3W9DB 3V4UH 5LQBH 5J57B 3FO2A 2EYSB 1USZA 1CPUA 1JGDA 4UANA 2P49B 4KAQL 2MQ3A 3C5XA 4MS8C 3UZVB 3U36B 4L9LB 1A1NA 3DIDA 3QJHA 1TJGH 1PLAA 2ZOLB 2CO3A 4ZMPA 1O5PA 2ZX7A 3RWDA 1A2YB 4WFED 2D4FA 2BP8B 1E50A 3X12B 3BD5A 1YA5A 4NPYA 3KNBA 2ZONA 3OXSA 5EA0H 5IWLA 2WN3A 3VU1A 1MF2L 4APQC 1YEIL 1T0MA 4FQCH 5J1TC 5SWSD 4X6DF 4JO2L 1BG9A 2DF3A 3S4SA 4I3RH 2AXGA 2FO8A 1AHKA 2VDLL 4MAYA 3V9EA 1FL6A 3BW9B 3TN0A 2MQCA 2CLVB 1O0VA 3VVWA 3LKPA 2UV3A 3MLSL 3TJEH 5I24A 5CLZA 1T3FA 3N40F 3K2UL 4GNKB 4J8RB 5CIPB 3QZOA 5DMIL 5FCUH 4C83A 1JPSH 2NPLX 4G7YL 4NC0B 1S7SA 3WTWA 1XXFC 2X9XA 4F7EB 3RA7L 1VGKB 3VFWA 3SBWA 2EILB 1PG7H 1WFJA 1AGEB 2VERA 3KL5A 3M88A 1BSIA 1HNGA 3OZKA 4A6YA 1TITA 2VSDA 1A9EB 1YY8B 5T3XD 3UBHA 2CR3A 2MKWA 4R2GD 5I8CB 4Y5YA 3SJVD 3L5XH 3K1KC 4Y2NA 4BWTA 4Z7WB 4J7RA 1NZRA 4FHJA 5JHDB 3CSFA 4Z7QF 3SCMC 2FJSA 4XPFL 1I3RB 4Q89A 4CC4A 3I6KB 1QR1B 2WQ8A 4AQ1A 3E6FB 5DQ9A 1EXUB 4JFFE 1KBBA 4GSUA 5C2UB 1GL4B 1XCQB 5T5FH 3SPJA 4LCWA 2XFXA 4OJYA 3VFOA 3L2MA 1T0NB 3ML8A 1DSFH 3BGMB 4KK6C 5FGBA 1B4JL 2YRZA 1ZWIA 1AH1A 1K3ZA 2FBOJ 3QI9A 1MFCL 2OMUB 3UTQB 3MNWA 1I8MA 2ZXDA 4X0KB 4MD5B 3RP1A 1IAIH 1DVFC 1NCNA 2E46A 2L7EA 5FUCE 3EOTH 3JWNE 3KPNB 4FEMA 1BQLH 4ETQB 3L3HB 2J8UF 1BXVA 3RVWD 4Z7VA 3DBXA 1A3ZA 3ZR5A 2R2EA 5JW3L 4TVPL 1HSBB 3SOBL 4A66A 3D48R 4KK8C 2ITEA 4QLWA 5DZPA 4P5TC 5AD0B 2V3DA 5I19H 4NQDD 2JK5A 1JFHA 1BGXH 3D87B 4TM9A 3VG9C 4QMEA 1RD6A 2P42B 5C2BL 2EICA 4O9HL 2X38A 2AITA 4PRDA 2E9IA 2A9DA 4IOFC 3SDYL 1N6UA 3J27A 1IGTA 2ICEA 1SJEA 2CBOA 1MLBB 1ZV5A 2R1YA 3S3DB 3UJJH 3R4RA 5KBMA 4TNWK 3NYKA 4N2AA 2DAVA 5BCAA 1SYVB 3MACH 3QUYD 1B3JA 4HIHB 1V27A 3OR7B 4ZD3L 3UTSA 1OAYH 4HETA 2XXCB 5D1QA 2WVUA 2J71A 1CC3A 4FQ2L 4AYFB 3IPBA 4TUJA 4TSBL 3HC3L 3BYYA 4HU2A 1FGNL 3ARZA 4XP1H 5EORH 2Z7WA 3HAEG 5MHSD 4WFHD 4B0MM 4N2MA 4WDIB 4P3CL 3V6BR 3ZE2E 2Q5BA 2WKOA 4HQQL 1GGCL 1RJYB 1CXFA 1E5ZA 2XDHA 3N5AA 3PDOB 5DYFA 4Z8FH 4JLRA 2D3LA 4UUJB 1DQJB 1SF3A 1TLMA 3NP4A 4JK0D 3P4LA 4RMSA 6FABH 3RFZB 4L8DB 5HGDB 2FT8A 4XNDA 5IF0A 3TBCA 1CICC 2GJ6E 2AANA 1U0QA 1U95B 4X6CA 3N85L 1LWHA 3FQXB 5J7CC 1E8ZA 2NNAB 5DUPL 4YQXL 4KI1A 1HI6A 3M45A 4LBEA 3U83A 2F9BT 4ZUUA 2IFFL 3NIGE 2M26A 3D0AA 2Z4QA 4M5ZH 1RUQH 1UJ3A 2PW2A 4R90H 1VEMA 4FLOA 1KELH 4P59H 1U3HA 1BVLA 2I7OA 2C7FA 5F96L 2VJXA 3G6JF 5J12C 1E4WH 4AH2B 4OZGF 2P3YA 3ESUF 4U33A 5I28A 2ZCKH 2ZYRA 3C60C 2AABH 1D5XB 4MYPA 4OI9A 5EZJB 3QGVA 4IRZA 1DEEA 4DZBB 2PLTA 3SE9H 4JY5L 5AOLA 3QZNA 1XF4A 1HH6A 1OQXA 3HE6C 3FPXA 1Z9SB 2MOVA 3RDTD 3LKSB 4ZX6A 3ZL2A 3NA9H 4FCHA 2DYPB 3SKNB 1S7WB 2QV4A 3KJ4C 2EDMA 3A4EA 3VXNA 1QG3A 2FJGB 3R06B 4ONFH 5GRJL 1PZDA 4AQEA 1M9SA 5GGQH 2AKRB 1D5MA 5LUMA 4KI5F 1GYWA 4HSCX 1WO2A 5DFVD 4EN3B 3KG5A 5JIIA 2ZKMX 1EQWA 1PD1A 4PJHA 5G2NA 3BWSA 5CGYC 3VCLB 4LEOB 2KL6A 1FO0B 4ZXBA 1E4XI 3JV6B 3KPSA 5FYKU 2O6PA 3WJJA 2VO8A 2WXFA 3VXME 3GBLA 4KMLB 2YD0A 3STZA 4HV8B 5DEZA 4D8PB 4JDEA 2QSVA 2ZAHA 1D6VL 2IQAB 3QUXC 1UH3A 4OAWB 3MV9D 4OFVA 5JZ7D 1AD0B 3GI9H 4FG6C 4ZO6A 1XGPB 2UY6B 5EZOH 3QXWA 3TNMB 3UTTD 3GD1C 5JQIB 5GGUB 2KLTA 4HEPA 4AJYV 3RWCB 3AGWA 5D2NB 2NY7L 1G7LB 1QA9B 2J1YA 4PJAE 4PWKA 4HLZH 4A2MA 5F0PB 3EGSB 2OSWA 4WEEA 4R7LA 5KS9E 3KDMA 1FP5A 2EIMB 5JQ6L 1HXMA 5DMKB 1XGTB 4LOFA 5SX5H 3UZEC 4MCNA 3MRLB 1TTUA 5FUZH 4YDKH 2WWNA 3TT3L 5FUOL 1XCXA 3QDJA 3RIFK 5F9JB 5DK2B 4WO4D 2BNQA 4DFHA 3GZPA 3BQUC 5K1VA 4K9JA 1CMOA 3CSGA 3S96A 3TBBA 4WKXA 2VWEE 1MVYA 1P1ZA 2NY2B 3WNMA 2HSIA 3S35X 4W9DC 1OK8A 3IXAB 2Z7UA 3VB9A 3DK0A 1GSKA 3REVB 3BMVA 2LU3A 4X80H 4IU2B 2D3VA 2AI0L 1FORL 5CHNA 3QFJA 2I26N 1QLEH 5GJTH 5C08B 1HE8A 4ZUVA 3KPOB 4RLDA 3O41A 1WZKA 3QEGH 1N64H 4QJ3B 3RTQC 2G60H 4PRPA 3LN9A 5HHOB 4YDVB 4KJQC 4CMMB 1COBA 2NY4D 1GGIH 3ECQA 4Q4IA 5EF1A 2B0SL 3AZUA 4L1HA 2BVOB 3CLEL 4LGSB 3D51A 1JJUA 1K9TA 5DLMH 3NUKA 1Z2KA 1JV2A 4RMRA 3RZCC 1AXTH 2IQ9H 1JHLL 1B0WA 4P4RA 1UZ8B 2WVVA 4W70A 1KEML 3IDXH 5D7IF 5KZCB 2AJXH 4KI5D 1QW9A 4MBOA 5FWRA 3TJHC 3WNPA 1JZEA 1ACXA 3HS0A 2NDGA 4NCC1 3MUJA 3DXAB 2O6FA 4LLYB 3MV8B 1ES0A 2BZDA 4FNTA 1OY3B 5D55A 1IQDA 3APFA 1G9NL 4WUUB 1JYXA 5JPMB 5E1GA 1JK9B 2D8KA 1UXWB 3Q0HA 1GYCA 2YD7A 1MCRA 1TDQA 2DQHL 4UT7L 1TVBB 3UDWA 1X5FA 4IIZA 2PYED 4GSDL 4ZAKC 1DQKA 3U6XA 4AIXA 4FNPA 2WCPA 4R4BA 4JKNA 2VISA 5TE7H 3TBVB 1ZA3A 5BRZE 5J1AB 1OSZB 6PAZA 3EYSL 3GO1L 1ZJBA 4JVPA 3MFFA 3WTXA 1PPIA 2G3ZA 4BSWB 1G9NC 1UXLA 1QSFB 2FX9H 1QBMH 3PLYA 4OQ1A 3TONA 1WD8A 3ABKB 1YECH 5J1SC 1KFAL 4M7JL 1UA6H 2YO3A 3BQVA 3U4KA 4LQFH 1D9KD 1OF0A 3ZN6A 1Q0XL 3Q6GL 3GKWH 2AEQH 3BD4A 4OLVL 5JORB 3ULUC 1K8DA 1TIUA 1G9EA 1DBKH 4OFKA 4NKIH 3TEXA 4U1LA 2OMVA 3ZBMA 4N26A 1FCGA 2XA8L 5E4EC 5E9DD 3T3ME 2W9EL 4TSCL 3Q9QA 4KH2A 2PO6B 3I9PA 3OTTA 3H9SA 3JTBA 2D7MA 4LO9A 4NZDA 3ETTA 2YKLH 5DJ0A 2MTAA 4ZPVA 4M9PA 2AJVH 3FQNA 3MA7B 5A3IC 1F4HA 3PFQA 15C8L 3BVXA 2WSDA 1PDKB 3GSRA 3NN8A 4GLRH 4XC3L 5F7LB 5LDSA 3GPEA 3DO7A 1UT9A 4PI2A 1QRND 3FO1B 4FXTA 2F18A 3VXRD 3EFFB 1FPTH 5KWYC 5DMJB 1MQKH 4RNRA 1GGYA 3MJGX 4I5BA 3G9VA 4A2FA 5IW1A 4DN3H 5BQDA 5DEFA 3I6GA 1CZ8L 3MRRB 5BUGA 1IL1A 2AGJL 5FUCC 5I2IB 4RGMC 2HH0L 3HG5A 4KKZA 5AZEL 2NY6C 4HJSA 4CC1A 2WINB 3QO1B 2KYIA 5D4HA 4GRWB 5EBMA 4AQ8C 4PJ5E 5B4MC 4FXKC 4AM0Q 5BJTB 3O9WC 5I18H 4GXUN 1VFBB 3FQ4A 4KKCD 5C09D 1ND0B 3WIFB 2YQBA 3OL2A 1F4YL 5K1NA 4M61A 1Z9LA 1RUPH 2WQXA 1ZIBA 4RAHA 3RU8H 4UYQA 3JYBA 4K94L 1I7ZA 3Q2WA 4J3SA 1BMGA 2XBDA 1TSHA 3A4FA 3QUGA 4RMQA 4GUQA 5T1DH 4E9VA 3WGVB 4PJ7A 2I25N 2WUBL 3MCLH 4EUPH 2JCCB 1RLBA 2LAGB 4JY6A 2XIIA 5FFLA 2UYLA 2NCMA 2WNKA 4P99A 3UZQB 1UD8A 1YJDH 2EDLA 4TPRH 1DN0B 1OCWL 3BZEB 1YLBB 4X7TB 3RL1B 1FQ9C 4GQPH 4HKBB 4AUYA 1OPOA 1YNLH 3Q48A 3B4NA 3GMMA 4K94C 3MNDA 1H3PH 4OM0L 2A0LD 4Z77B 2M2DA 2WAQA 3WYRA 1CLOH 4ZMWA 4AZ8B 4NWTH 4XX1E 1EFXB 4QXTB 3L2NA 3TWCH 3BVDB 1D5ZB 2BZCA 1BMWA 2PN5A 3MLRH 4KK9D 4LEXH 2QADB 1IGIH 4PB0L 1B3IA 1NM4A 3CFTA 1OAUH 3NACL 4G7RB 5CP3H 5ESQB 2E6JA 3S8GB 1B2WH 1K72A 5FYJH 4OJFH 3NQIA 1G84A 4OQTL 2Q7YB 2V8LA 5EV7A 3ZDYF 3AU1B 2Y7MA 3DIVA 4KFMA 3RJQB 3EYOB 3OKYA 4NOFA 3F05A 4PJDB 3GMOB 2DTMH 4XNMA 1XSKA 3EOBA 3DJRA 1EEYB 4JUTA 5TD4A 1F4XH 4YDJB 2ADGB 3SKMB 5MEOA 1DBMH 4Z76B 2DMHA 5HVWA 5AOZA 2EC9T 4Q9RH 5AZ2L 4KFZC 5EO1B 5KSBA 4MB1A 2EVFA 4ZS6C 5IJCC 3FUHA 3QUKA 1T5XB 2F8XC 1NCGA 1XGUB 1I8KA 2VUOA 4S0SD 1JVOA 4LKXB 4YUEL 4YBLB 3MRHB 2O26U 2YSTA 1N0XL 3BWAA 4NM4H 2YPVA 1CXEA 4PJCE 1HNFA 2CLRB 1SVCP 1MAKA 3LY6A 4DTGH 5ESVA 1P4IL 1S78C 2OTUA 1V7NL 2PP9A 5ENWB 3T77B 2UUDK 4L29B 1D5BB 2A6DA 1W2KT 4JJ5B 3TO4B 3U30C 4DP1X 1Q8MA 1M2VA 1LO5A 2DEYX 3S3SA 4BELD 3OGCA 2Y36H 2XI9A 3BSHA 1S9WA 3MBEA 1DANU 2H8PA 3DMMB 2KMWA 4DZ8A 4Z3FA 1QFPA 4U1MA 1U2CA 3JWDL 1I85C 4LP8A 1KWKA 5HHPB 2P24A 3CHPA 4Z9KB 2NXYB 5IFAH 1HINH 2DZEA 1VPOH 5BS0A 4DUWA 4RAVB 2QPSA 3IFNL 4J2XA 3HPJB 4HPHA 3MMEA 5D2LB 1SXAA 3II2A 5I76A 2BMKA 3T0DA 4XXWC 3NZHH 5D9SB 1JVLA 3EOYG 5DO8A 1MWAB 4YSDA 5F44A 4UU9B 3F5WB 1NFIA 4ZSOA 1MHEB 2QTEA 4B9IA 4M6AA 4NQEB 1FDLH 2VGLM 1JDDA 1BD2E 5HPOA 1HILB 3H4HA 5CD5D 4MMZB 5SWQB 1G6RL 5DVKA 5BRQA 3V6ZA 3PHQB 1OGAA 3L4WA 4WY7L 5IQ9B 1I9JL 1ASOA 1D5IL 1FYTE 3T6QC 5CSZB 2VWEC 2VZVA 2XNAB 5HHXH 4FJZA 4QOKE 3C12A 2QFRA 1BJMA 1I1AD 4L9DA 2XQBH 4R4NC 3RKPA 1JCKA 1CTOA 4WGVB 4YXHL 4F37K 4H88L 1P2CB 2G9HA 4XBGA 4URTB 2D0GA 3JVGA 4B60A 5I6KA 4R7NA 4XMTA 3RPIA 4XP6L 4Y2OA 4B5EA 2WY3B 4XNQA 3QDAA 2DQGL 3TZVC 3D0LA 3BSZA 2F7IA 1ML0A 3X14A 2MQ0A 5D7HA 4BINA 3NCWA 4Y89A 5C0DB 4GQZA 3WTVA 2WBKA 5A7EA 2FJHA 2R0WL 2BFVL 3AXLA 4Z95H 1A4KA 3FPYA 1QEWA 5GGRY 1RJLA 3K4DA 4QYOA 1QI4A 4JM4H 5GS3A 5C0RL 3G5WA 4R6UA 4XCEA 1IV8A 4M29A 3SBRA 5CZKA 2QQLH 4WI5A 4Y4FC 3U7WL 1A6TB 4NUGL 4BH7A 3MXWL 2VIRB 3X3GH 4TUKH 4CW1A 1NCIA 1R75A 4XVSH 4N9GA 1O7DE 4ALAL 5KSAD 3WL9A 3ZSSA 4HIXL 2EE0A 4JKPH 2DI7A 3LN4A 2JTYA 4HUXB 4ZQTA 4PPTA 3Q5OA 4X0NA 5EO0A 7PAZA 4GKNA 2MSPA 4Y19A 1ZXQA 3C8HA 5FC9A 1E2WA 3H53A 2E27L 1XBDA 2I07B 4BE5A 3BGFB 4Q52A 1L9QA 3G3LA 1KENH 2AEPL 4MXVF 2GQHA 4ALAC 1JK8B 1VRSA 1A64A 4C54A 4ODHL 2NY0C 3NJJA 1BJ1J 3RE0A 5JHLA 4LOUD 3P2TA 2DIEA 4L2YA 3F6IA 4YHIA 1J0KA 2NOYA 4Z0XB 1WZAA 1PY4A 3C6LB 3QO0A 4UIMB 4A7TA 5HHQA 1H0DB 1TTAA 3GHEH 3ZE1E 2XIDA 1A6ZA 4N0FB 1SLWA 2EYTB 2HMID 3BUIA 3UXFA 1KCLA 2DM3A 4OB5L 1J7VR 2EH8H 2UVFA 4Z1PA 3KLAB 5IBUG 5DT1H 1H15B 4UQ3B 1IIIA 4KK5C 1YN7B 1CGSL 2Q76A 3KMDA 4HU8A 1MZZA 1V8HA 3H1ZA 2WWMC 4BSVA 1QFWI 4YHPB 1XF3A 4PW3A 3VXSE 3ULVL 3WY2A 2X6UA 1KNOA 1FFNA 2VLRB 2VDQH 4NZUL 5EEVA 1ZS8B 3W3BA 3L8QA 2ZXWB 4NNYB 4EI6B 3LD8B 2OXHB 1HN1A 3EJTA 2B39A 4QR7A 5E2VL 1JHKH 2JIXA 4PWEA 5DEJA 3T0WA 1WCQA 2NZ9C 4LLDA 4C56E 4DPCX 4NSKB 4PG9A 3SDAC 1UB5B 3RUGE 2PCPB 2OMYA 3HZVA 1YEEH 4G2AA 1ONQA 5H35A 4MJIE 3PHAA 2WTPA 1S5IL 3BSGA 1JGVL 3CNKA 3EO0A 3QIUC 3ULVC 1B6UA 2Z92A 2YMOA 3GSQA 4G43B 4XE5B 1L0QA 4BRVA 4XBMA 2IDQA 3KCPB 2TAAA 4ELME 3DVFA 1OSPH 3S35L 4X98B 1JXGA 4G6FD 3VI3F 5BXFB 5FA3A 3EBGA 4KVNH 1EHKB 3ARDB 4W81A 3QDME 1IQWH 1ZHLB 5D7JA 4M9OA 1GTFA 4TN9A 1AE6H 3H2QA 3MJ7B 1WS7A 2CO4A 4HWBA 5AW4B 5DRWB 1MY5A 4JRWA 2W60A 4P0DA 5HGAB 3BEVA 2Q1EA 2AQSA 2Y1AA 5CM1A 3UGUA 1BAWA 1UH2A 4UAOB 1YEGH 5I1DA 5J6GA 2CG9X 1NAMH 5EZIL 4NKMB 1JXDA 2VUKA 3H85A 4JO1L 2V2TA 3ZTEA 1DUZB 2D7PA 3O2WH 4IM8A 4PJEE 3NZUA 1IC7H 4XCNA 1B0RB 1CYXA 4GAJH 2GSIA 4NHCH 5FECA 1IGYA 1VAHA 1X44A 3OAZK 1CK0L 4DP6X 2DB8A 2YK1L 4WNSA 5IVXF 5I16B 4GKSA 3SGEI 2G2RA 2H2PC 5B1JC 3PL6A 4HT1L 3HPLB 4MXWH 4P5MB 1JWSA 1QLRA 3GRBA 4Z3GA 3C5SB 4IIQA 1LEIA 3MRCB 3WCYA 2G2PA 5SWZD 4WTQA 4E9YA 2ZPKH 3IMUA 4F8QA 1G0YR 1Q9OA 5GRXG 3P3UA 3S34L 4MDJA 2XG5B 2PKDA 4IQHA 4M7KH 3VYPA 3GSVA 4PJXA 3DJTA 1SFDA 2YPLE 1XGZA 1MCPL 5ES4B 1I3GL 1O6SB 3BDBA 1ADQL 2OMXB 5BUAA 1MJ7H 4M00A 3AT0A 4HUWB 5BV7H 4L1TA 3GRWA 4JO8A 1SMDA 4PP2A 4IKJA 4PJBA 3P40A 1ETB1 2BP0B 4QO1A 5EU5A 4F27A 2LU4A 4AYSA 3GC3A 5EUOF 3KAAA 5D1ZB 4ODBD 4I77H 4Y5VC 2ZOTA 4IOIA 3CLFL 4EMZA 4NUPA 1U41A 1ZLUK 1NIFA 4P04A 4IOSD 1ZSDB 4UTCA 2Q8BL 2OYPA 1WBZA 5T1LB 4X4XA 1GVIA 2CCVA 1IKOP 3BT0A 1MREL 1OAKH 2APVA 4LDEB 2VE6A 4IU3B 1FE8L 2QPFA 1OM3L 4U1IB 1KLUA 2W95A 2WQWA 4UZSA 4CVWA 3DHPA 3QAZC 2XWDA 1G7IA 4HJ1A 4PB9H 5CEZE 4F7CB 3FU7B 4Y4KC 1U3ZA 3VJ6A 3QPXL 3U9PH 4XI5C 5E0FA 3OLDA 3DJSA 2F53D 3RY5A 4N0UA 6CGTA 4MS8D 5C0CE 4HIIA 2AVGA 2YUXA 3IJYB 1UD2A 4J2QA 3TPUA 1OGPA 3BEWA 4AI7A 4D0CB 3ZL1A 2QLVB 3KPMB 3KS0H 4Z7WE 2UUDH 3MZTA 2XN2A 1HH9B 4APQD 3LOWA 2JV6A 3LIZL 5JHDE 3PQYA 3L1EA 2X40A 3AG3B 3U0WH 2BIIA 3B7SA 3L3OC 3HNSL 4UCFA 1AFVL 2N0MA 5IJVB 2VQ4A 2ARJQ 2XWBB 3L48A 1SZNA 4J6RL 3G6AB 1FFQA 3T8MA 1PLBA 4FQPA 4U05A 4OCYH 3C87A 4OLWH 1PG7X 5CP7B 3N1QC 1W8OA 4U7MA 3EO9H 2GTWA 1H3GA 5EC2B 4NGHL 4K2UH 3CHQA 1NUFA 4M6NH 1A6UL 4KXZI 1ZY9A 1G7MA 4R7XA 3TCTA 2MH4A 5JDSA 3DYMA 2FYYB 1JYVA 2R29A 1YQVL 4HOZA 4NB7A 4BHUI 1BYOA 4P46C 4RGOH 1V3MA 2WXKA 2BOBB 4PGCA 5JIKA 1GYAA 4DGIH 4HS6A 2VO5A 1A21A 3NFSL 4KQ0A 3A24A 3K6IA 2EIKB 2DMCA 4GG6F 1KJ2B 3IVKB 5CNHA 3NFNB 1BLNA 1MUJB 3N44B 2C4FU 4M03A 3OMNB 4I9WD 4WKZB 1DSYA 3H7BB 4W6XB 4GI9A 1J8HA 1YCSA 4PJ9A 2H1XA 2N59A 2CO6A 5DTFB 1A5FH 1ZGLB 4QRRE 1G9MH 2X4RA 5CCHE 2HG5A 1EGJA 4WW2C 3FC8A 2EXWC 2WQSA 4KRPC 3KYOA 4TSAL 4PJGA 1DVFD 3LSOB 3Q8BA 4X5XA 1RK0B 5FYKH 2K70A 2R2BA 3ZZ1A 4U0RB 5DWPA 3GRGA 4WZ9A 1S4IA 4CA4A 4K23H 3TPKA 4JGJA 3VXTA 3ZDXE 1Z5HA 1T22B 3KEHA 2C9VA 2YS4A 4XVJH 4GS7B 3FONB 4KK8D 3QUMA 2G3MA 2D03H 4OV5A 1BDYA 3VFMB 4Z7NE 3JWOH 2UY7A 4P5TD 3FB5A 3UGXA 3OD3A 2BIPA 4GQ9H 3VB8A 5L2KD 2GSGA 2L3BA 3EH2A 1NCAH 1BFSA 1I9IH 2E4FA 1N0LA 2E76C 4IOFD 4M6OL 3CDZB 4A04A 2VH5L 4G9DA 3LRSA 4ZZFA 2CA4A 3MA9L 2X0UA 4NZTH 3KPRD 1VADA 1NAKL 2B4CC 1PIFA 5JXAL 4TVPD 4OY9A 3O6ML 5FGSA 3SE8L 3QEQB 1OARH 3VXUA 4A38A 4ABQA 1JPEA 2WKLA 3VGAB 1I31A 3PJSA 4IRJA 5HBBA 2BOLA 4Y16B 5CEYA 4MRBA 4M1GL 1TXKA 1GY2A 3L08A 3U4EB 4HWNA 5KZCD 1F2QA 1USQA 4U7SA 4OT1H 4YDIH 5DC9B 1NCCL 4RGNC 1ZLDA 2H5UA 1QASA 3NJMA 3FFCD 3PF2A 3P4MB 1RZKL 4HEMA 2YHGA 3CK0L 5E8OB 5TH2A 3VWKC 4W6YB 2KDYA 2OSYA 2BY1A 3BHBA 2G30A 4AITA 3BDXA 4WUUD 3OLEA 2X3CA 1H5BC 1CICD 2I7SA 3BH4A 3P4NA 1ZSHA 3EIFA 4F2MB 5DVMA 2K9FB 3C6SB 1NEZB 2Z6FA 4MKTA 1JL8A 3PHOB 4X8JB 2ZIDA 1C16A 2DDQL 1NGZA 3GSOA 4XC1L 5IBUB 4LCUA 3JVFC 1NCTA 3P73A 4WV1C 4YNYB 1IC4L 3NQKA 4JL1A 5T1KD 2EUZA 1E9OB 1CVSC 1EX0A 3MJ9L 3UC0H 1RZKC 2C26A 5EN3A 2A77H 4YHMH 4E9WA 1U21A 4CMHC 1RZ7L 1E28B 2R69H 5E6IB 1MFNA 2DQFB 3C60D 3GPSA 5D2NE 5DMGD 1U93B 4Y9CA 2Y07L 3AACA 3WIHA 3KHQA 2GW5A 1KACB 1EEZB 1S9VB 4GSQA 3X11A 1TCRB 2BS71 3IMRA 4JFWA 1KXQA 9PCYA 1YN6A 3HE6D 1J05B 1KGWA 3GBML 4UTAA 1KBVA 5GSRA 2HLAB 1DDTA 1FAKT 1PCSA 5DQDH 2ZSVB 1OAXL 3KPLB 3O8XC 5KYUA 4A2DA 4BFFA 3TURA 1R5VA 1XMEB 4DGYL 2OXGA 1HQ4A 1NLDH 2HLFC 4IKIA 4LLQA 4EZMA 3IDJB 4D3CH 2NNCA 4MGXA 3ATAA 2A9BA 4JMNA 5CGYD 3ROLA 3CZKA 4WTXA 3TLRA 1ZANL 1IAKA 3AFLA 2IANB 1UFGA 2CA3A 3QUXD 5E8DL 1E6JL 2F74A 2J6EA 3BIBX 5HHOE 4FG6D 4XOAA 5IMMA 1FVEA 4LCCB 3W9EA 1T1XA 4LL1A 4P2CG 4Q0XL 3LQMA 3WJLA 3P2DA 2CIIB 2AEOA 4DH2A 1TEFA 5IHHA 1RL1A 4GYBA 1I1YA 5AB9A 4JRLA 4UT9H 1XX9C 4S1SL 5FO9A 5IFHL 1FVDB 1EEQA 3DX8A 4LPVA 4UV4H 2F5BH 1TTBA 5I66B 3FW6A 5IOPB 4I18A 3W57A 4DVRH 3QWNA 1E9QB 3U6RA 2X4TA 4JFFA 3BQUD 4JGMA 1F6AB 1N18A 4ODSH 2PYFB 4N8UA 4OD3L 2GHWB 4TRPL 2WP3T 3M86A 3OAZH 4JFHD 3HVDA 4P9HH 3MV8E 4JPVL 3ZLQC 4P3DA 1II4E 4CUCA 3ULUF 3UPRB 4CDGC 4N2CA 3BYTA 2H6PB 5E2WH 4R8WL 1NEPA 2V5RA 4N1CA 5J6SA 2OMTB 2J73A 1L0YA 3GTTA 2B3IA 3VTTA 3FU9A 1IGFL 2AJ3B 3GIVA 1JPTH 1EMTL 3IDYC 1H3VA 3NJXA 3ARPA 1R5IA 1QW8A 3RTQD 3D2UB 3O6KH 4KJQD 2IPUK 1JZIA 4IHOB 4Z3HA 4UNVA 3WJMB 3CIAA 2A74B 2CIKB 5IEHB 3O3UN 1QSFE 2WNWA 3SE3C 3CQFA 3RZCD 3IDMB 1PZ5B 5L9DL 2CK2A 1JWMB 1YMHA 4Z7UE 1U4FA 1J9CT 2JELL 2V5YA 2X10A 2EAEA 3WFDH 3V0WL 5HP5A 1EZVY 4ZUTA 3VG0H 5EOCH 3TJHD 3MV7D 1HWWA 1SF5A 4AQAB 3PV7A 1A6AB 1EFXD 4U3SA 4UDTA 4ESKA 3IB4A 3PWVB 4PRAA 1M7IA 1FAIL 1IKFH 4S1QH 4XPGL 5DYOB 5C6WH 3EF7A 2DV6A 2Y5TA 1URIA 1CLZL 3OX8B 4AYMC 4MNGB 3VMPA 4OJAA 2CKBL 4MDIA 1BM3L 1OO2A 5HGHA 1OPGH 2GUYA 5CZVH 4ZAKD 1ED3A 2R2HB 1XQ4A 1NANI 35C8L 3IDIA 3MOQA 4YZFF 1IGJB 1WEJL 2FK9A 1MCWM 4AEIH 3S36L 1PZ3A 3D69B 2YFNA 2KLRA 3HC0A 5KN5A 2FNBA 5BZDB 3NCYP 3QNYB 4OFYA 3SJVA 2FVNA 4L5FE 1QHPA 3DX9A 3GHPA 1A22B 1FFRA 1A7PH 1M6OA 4GBXB 3Q1SL 3AREA 1IFHL 1TEGA 3TVMC 4XPBH 3ULUD 2B1HH 1FF5A 4R26L 2X0VA 5GJSL 4ONHA 12E8L 4FRWA 1R46A 4WRLA 1TQWA 1PNCA 1CL7L 3K5SA 4GRWE 3L3JA 2YA1A 4TLKA 1YHPA 4P07A 4YDNA 4H1LB 1THCA 3DUSB 5EZLB 3DMMD 5BVJB 5FIEA 1T1YA 2JB5L 1AO7E 2HA1A 5CFHA 1SXNA 4E5XB 2QZ5A 1HS6A 3KJ6H 3B37A 3FH8A 4IMKA 4M62L 3L4TA 3O6FA 3PY9A 5A3ID 2DD8H 5F7AA 2VABB 1ZEAH 3L5IA 3BUDA 4Y2DA 1PSKH 4GI8A 2JCCE 4NQSB 2O5ZL 2OYMA 1CFTA 3DK2A 2TRYA 2HG0A 1NMBL 1KJ3H 1E4KA 1A9VA 5BUPA 1LK3H 4G80B 3BPLB 4R7VA 3QUZA 5KG9B 5FM8A 5CJOL 2Q3XA 3DV4B 1I8IB 4L8SB 2DIAA 3DGGB 4M48L 4TQEL 2NY6D 3VFNA 1K2DB 5HHNB 1UTDA 4YSSA 1MIEL 5F1NB 3O9WD 3FB8A 4U1GC 2PCFA 4PJAA 1MXGA 5GGSY 2XN1A 2MPAL 5JTWA 2W9DL 5KS9A 5AW3B 3VGFA 3Q3GB 1LK2A 4JO4L 3Q1EA 1ESOA 1KY6A 1KC5L 3GJFA 1FH5L 1OGTB 1PJ9A 2E8YA 4WUKL 1Y07A 1YRKA 4U1JB 3V4UL 4JZJA 4OCLC 4Z7OF 5CN1A 5E6ZA 1MJ8H 4FQXC 3ZW3A 1TJGL 3FYIB 4K73A 3S37X 4QRSA 3V4PA 1T6BX 5A43C 3AADB 3OHXC 3LNEA 2L0DA 3AXHA 1O9WA 2ZX9A 3QNFA 2OA9A 1R17A 1ZOXA 3QWRD 4OGAC 2WXJA 2P8PB 5E5UB 2B8OT 3U1PA 5B39G 3DX1A 2WXPA 3MRJB 1Y0LB 2GCYA 4PTTA 4YVUA 1HHKB 2J88H 4I3RL 1RUAH 2M8XA 4DO5A 1UVQA 1AXSB 3Q6FA 3LKQB 4HFWA 2PXYC 3ZRCC 4N8VA 5C6PB 3R0NA 5DJYA 5MEPA 4JRXE 4GG8B 4UI2A 2V2WB 4P4KA 3IF1B 3SKJH 2EC8A 4W68A 3TJEL 3VW3H 4KO6A 5A1AA 5FCUL 2HFEA 4LNVA 5ABAA 1JPSL 1CD9B 2I9TA 3KXFB 1JPST 5IHUH 2ISDA 4BD4A 5SX4H 2Y7QA 3ESPA 1ORSA 1HC1A 1PG7L 3FTVA 4I48B 3WEXA 2VLKB 5T8IA 2HKAA 1I53A 3MPCA 4PGEA 2AXJA 4ZS6D 3QHTC 3OLGA 1MRFH 2AQPA 4GB9A 3O6LH 5FGCB 3L5XL 3NAAL 4FAAB 3KLKA 4NQEE 4F20A 2XWTB 4BKLB 4MJ5B 1OF2B 4EO5A 2ZKWA 1S78D 3FHEA 4NT6B 3MUGA 1WWWX 2XHNA 5F3FA 3UTTA 4PU2A 1L9OA 1M7DA 1Q90A 2H1LM 2BSEA 1CFVL 1G1KA 4PJFB 4X6BB 4XMKH 3STLA 2CDFA 4HS3A 5FXCH 3OR6A 4HLZG 5T5FL 4TKWA 5C0GB 4AVHA 5MENA 4K55A 5BZWB 1PEWA 1BBJA 1DSFL 3L3KB 3HMWH 4LHJB 2A9NH 2FX7H 4FTVB 1KFGA 4A67A 3VFPB 3AY2A 4GT0A 1WYJA 4W9IC 1IAIL 4GH7B 4DPRA 2BWDA 1E5AA 2R4RH 3EOTL 2NQCA 3RWDB 3II1A 5A2AA 3FRUA 1BQLL 1EO5A 2WXGA 1NGQH 2R56H 3OXSB 1AY1H 3UERA 2VR9A 3BIKB 1OB1B 3HN5A 1MCOH 1SBSH 2G5BA 4N3UA 1CD1B 3CFQA 1GR7A 1KBKA 5I19L 4LKCB 1X5XA 3JV4A 1BGXL 1CQKA 4YEFA 2B7DT 2AQQA 4OZFA 4NFCA 3L54A 1WQVT 1YZZA 2X1QA 5HGBB 1IM9A 3AB0C 3BRDA 4X6FA 3UJJL 2FBRA 4PJIB 3OKDA 4N20A 5I1KH 4PV8A 5FA4B 3MACL 1X5GA 4R4ND 5IG7A 2RTTA 1OAYL 1T3FB 3NPZB 3VX1A 3ZIMA 3IGLA 1E2ZA 1UXSA 5F3HB 1UM6H 3WLWC 3IE9A 1J5CA 1JGIA 2IV8A 3KYNB 2QV2A 2PABA 3GLEA 4L3EB 4F57H 1A66A 2CUIA 2QGEA 4XP1L 5EORL 3CN0A 3L4ZA 4F7KA 4UDUA 4YXKH 3F7YA 2IALB 3TZVD 4BEIA 4YXLH 2MHAA 3IEAA 3LMJH 2BOCB 4B0MB 4R97C 1EUTA 4XNXH 3IMWA 2ZT9C 3OKEA 3QZPA 4RQQB 3V8CA 43CAA 4Z8FL 3PPSA 1MNUL 1YEFH 4NCDA 5CF3A 4BV1A 3TT1H 4F1SA 4AKOA 5CBEA 5KVDH 2CALA 4CRPA 5DHMC 25C8H 3F7RA 5B38G 2PYEA 2VRQA 3T2QA 4AQ1B 4FA7B 2RFXA 2UX6A 5DQ9B 1UASA 2EDHA 3ETSA 1IGMH 4Y4FD 2JB6B 2F6AA 4LCWB 4M5ZL 1RUQL 2XVGA 4IJTA 2QPUA 2FDBP 4R90L 4X7DC 3BAIA 1BF5A 1KELL 4P59L 3ULVF 1ZWIB 4K5NA 3QI9B 2QQKH 3SGJA 1OE3A 5LB1A 5C07D 1E4WL 3AUWB 3LKNA 4ZO9A 2ZCKL 5ESAA 4H0IA 1BWWA 3A22A 4AJVA 4WJ5B 1D9KA 2AABL 5DS1A 3ARGD 1G7HA 1RZ8A 1EVTC 1X6NA 3B9KA 2VLRE 3SE9L 2H6OA 4U6HA 1SUJA 3KVPA 3TC9A 3B2DC 3RHWF 1LD9B 2XZQH 3NA9L 3AVEA 1WCBA 5HSFA 2NY0D 3L17A 1TETH 5F1IA 1NC2B 4ONFL 4Y9EA 1CFSA 2CJTA 1EJ6A 4LE8A 5GGQL 4PD4K 1FFTB 4QHNA 1MG2C 4RBPH 4OF6A 2IAMA 5KVEE 2FQDA 2ICEB 5KBNC 1OZUA 1SJEB 3IJEA 4P5SA 3VD7A 2I60H 3CQQA 5F9AC 2BNRA 5LCVH 3FCTA 4DKEH 4XAKE 5KSVA 4NQVB 3SPVA 4FNQA 4Y1TA 5D7IA 5EZOL 3R8BB 1ID5I 2YGPA 4M4PA 3VXRA 2YXVA 4G6JH 4WHTB 4KK5D 2ROYA 1TZ8A 1UZ6F 3RTLA 2FEEI 3X1GA 4JZNA 4QRBA 4EDWH 2C3HA 2WWMD 4LF3A 3NIFF 4PAZA 5F7DA 4PJCA 3LZFH 2VXQA 1AGFB 2BSRB 2HPTA 3UBXI 2BM3A 4YGVB 4YDKL 5FUZL 5IB2B 3FJTA 2X70B 3EGXB 3MAWA 1Y6KR 2JI1A 2DIJA 1OTSC 3M1OA 3MRGB 2HX7A 2OMZA 2VLMD 3V6OC 1E6OH 5EU6B 4RRPA 1MCLA 3KYAA 4UZGA 5IGXH 2NZ9D 4W6WB 1KGCE 2KQMA 5DS2A 2YN5A 3SDAD 3L3DA 4JG0H 2V0AA 3W1ZA 4H44C 3D33A 2Z4QB 2XY2A 2WVTA 4X80L 1UJ3B 1A4CA 2PW2B 4LRNH 1QUNB 2V7NA 4DW2H 3ULVD 3QIUD 2YEQA 1QO3A 2FWOB 5B8CC 1O7VA 1U3HB 1BVLB 1QLEL 43C9A 5GJTL 5A6IA 3TASA 4EUPG 3QEGL 1N64L 3QIBB 4ELDA 5ADOH 2G60L 5HYQB 5I30H 3UAJC 5EU4A 5IMLB 4LVEA 1GGIL 4L2LA 4JN2B 1SN0A 2VXSH 3A4AA 2I27N 3OC8A 4ZFOA 2W5PA 1HH6B 2EVJA 3UMTA 5DLML 1HT6A 1QWNA 1O9VA 1TQSA 1AXTL 2IQ9L 4LMQI 5IW6B 3O3BA 4LSUH 4GT7A 2G75A 3FBKA 3ZKNC 5F7HA 5AW6B 1K4CA 5FECB 3IDXL 3QNXB 2FZ3B 2CRIA 1Q0EA 4LIQH 2JKTM 3PWUA 5CGTA 2AJXL 4AQEB 4AYBA 5I23A 2WLLB 4NRZA 4YBQD 4QOKA 3UG5A 2H26B 1HX0A 1ZHNA 5CBAB 2R7EB 1T89C 4NP4H 2CDGA 2HJLA 5TGBB 3IFLH 3VWJB 1DHKA 1G7PA 3BVWA 2X2IA 3CDYA 4BFIB 1P7QD 1U8OB 3ARSA 5D70H 4JGHA 4IS6B 4ODWB 4EI0A 4KTYA 1JWUA 4M4RB 3ZTJH 5J06A 3QZMA 1PD0A 1T80A 4LDCA 3WKNA 1DUYA 3CFBB 3H3PL 3H9ZA 5TE7L 1GAFH 2BY3A 2B16A 3RL2B 2XPGA 5PAZA 1KGYE 1XTLA 1HHIA 4X9BA 2FX9L 1GW6A 3FO9B 5DEGA 1QBML 3T1FB 3VI4B 1YECL 1HOCA 4HAKA 5GRVK 3ZQ9A 4OUUA 5D5ME 2ZYIA 1UA6L 3ES6B 3MGOA 5DJXA 5DJZB 5F9WC 4WWKA 4LQFL 3CE1A 2LT9A 4V1DD 4DP0X 4V2BA 1PYWB 2AEQL 4AVJA 5I71C 1P1ZB 1ICTA 2CGYA 3BKYH 1JXJA 3QG7H 3VSUA 3CX5J 1UB6A 1DBKL 4YK4B 4B97A 4NKIL 1UACH 3Q5TA 1MY7A 4MNHA 1F90H 1UQSA 4LNRA 1F00I 1AZUA 2KZWA 1BQHG 5TF1H 2P5EB 2UZXA 4JRYE 5J11C 4YBHA 4JFED 5E94A 4ONOA 2ZJSH 2YKLL 4NHUA 1U91B 4QF1B 2VDOH 4JQIA 4MMZC 4BM7A 2HRHA 3Q2NA 4G42A 4OUOA 5HHMB 2AJVL 3WN5A 5JO5A 3H4FA 2HZHA 1Z5LA 2DYSB 1HXYA 4JHVA 2JMRA 3ARFD 3U4AA 4WI2A 3CPUA 4FOMA 4R96A 3TV8A 2EDOA 4P2AA 5AVQB 1MN4A 1MFMA 2HB0A 2NUPB 1V05A 4LRIC 5LN8A 2O6EA 2CDEB 1DJGA 5I9QB 4IBSA 3NP3A 6PCYA 3FN9A 4Y4KD 4BXSV 2KBGA 1FPTL 4XZUB 4KKAC 1MQKL 3FK3A 3FUNA 4XI5D 1BVKA 4R7DA 4N9OB 3CVHB 4ILDA 5EPMB 4DN3L 3ILDA 1A7RH 3CMOL 4H8PA 4LVOC 1EH9A 2MNWA 5IESL 5ISZD 2UXTA 3GBNH 4J4PC 3PRZA 4XO4A 3TA3B 3W11C 1WUNT 5I18L 1K4DA 3HG1D 4W9GC 1MH5B 1VFAB 5E5MB 5MP6H 4O2FA 2QMKA 4JDVB 1IUZA 3NT0A 3FRPA 1RUPL 3HE7B 3VXSA 3KPTA 4QHMA 3M8OH 1K3IA 1BD2D 3RU8L 3G7TA 4KKQA 3ARBC 3PIQA 2JTDA 2GABA 3QDGB 3G5VA 2DWXA 2KPWA 2IADB 3BO8A 4E9SA 2FECL 5T1DL 5E4IA 1FYTD 5TE6H 2Y2TA 3MCLL 1J0YA 1LO2H 2BCKA 1JF1B 4IRSA 1C7SA 1KCSH 2AV7A 1YEHH 1W16A 4W9JC 1YJDL 4KZEH 4TPRL 2P52A 3T4AC 3PNWA 4FZ8H 4S2SB 4ZO7A 1KYFA 2YGQA 4O58H 4PSRA 3REWB 4HUUA 3L7FB 4YPGA 1QLEB 1YNLL 3D05A 3NSFA 3CVCA 5HY9B 2VLLA 5I6MA 2YMXL 3ATFA 4BFGA 1H3PL 4O02A 1U8IB 1IARB 4YSAA 1H3WM 2W65A 4P46D 1CLOL 4I2XB 1Z66A 2LLLA 2A9AA 3EDEA 3H6AA 3FT4A 5L0QC 2C9UA 2RGSA 3OG6B 3S37L 3TWCL 4RZKA 3RILA 2ZNWA 2O1AA 5CXPA 1YJDC 3MLRL 4LEXL 4DNLA 5D93B 5BPPA 1OAUL 1LNUA 2QLYA 1B2WL 4OZ4B 2HVKA 3FTGA 4OJFL 3BSZH 3DOSB 2DQTH 5TDOB 3SDCB 1SLVA 2OL3A 2NYYD 1RIUL 4UF7C 2AW2A 2BVQB 1FNAA 2DTML 1J87A 3D52A 1BWMA 1CCZA 1F4XL 2VN4A 4E41B 2ZAIA 4LBAA 4I5BB 2E9GA 2E86A 5DFTA 1KGIA 4PJEA 4G59C 2WYTA 4KRPD 4PW9A 5IREA 4Q9RL 5PCYA 4GUPB 5GGSB 5B21A 5E70A 1CE1H 2PWHA 5K9OB 4JAMB 3KVDD 4NM4L 4JPIB 3I2CH 5AL0A 4DTGL 2GJZA 2WXOA 2PR4H 1D5RA 4Y4HA 4WJG3 4BZ1A 2ATKA 3EOAA 5D96C 4R84A 4G6AD 3DJZA 3W9DA 5M95B 2Y36L 2EYSA 2IPKB 3HW7A 3NFPB 4JN1H 5CJQH 4CSSA 4ELKB 1KGJA 3A4DA 3D2UD 3UZVA 3U36A 2ZNXA 4ANXA 2ESVD 3B9EA 4HFUH 4L9LA 5M7QA 2VMJA 2ZOLA 2UYLB 5JHLH 1A2YA 4D9RE 1F13A 2BP8A 1IT9H 4HX1B 3OGOE 3X12A 2AMUA 1HINL 5IFAL 2JJTC 1URZA 4GAYB 3NEXA 4W4NA 1TZAA 2HFTA 1PLGH 2WB1A 2YQ2A 1EO7A 4LU5H 5E4OA 1R33A 5CUSH 3NZHL 4G8GD 3L45A 4RGND 2JJWA 1Z3GH 3OJMB 3VWKD 2DJSA 2SODB 3B2VH 5CGMA 3BW9A 3KEDA 2WLHA 5D7LD 1OL0A 3CXHJ 2NR6C 1FI8C 2G5RA 3J7HA 1R24B 5HHXL 4J8RA 5CIPA 2XQBL 1I7TB 2IANE 4XHJC 2BDNH 4F7EA 2EDTA 4MJID 1VGKA 2PTUA 3QR2A 3ML9A 3SDXE 1FL3B 3D39D 2M1KA 1AGEA 1VERA 2HKHH 4X7FC 2MJWA 1A9EA 4BA8A 1YY8A 4XMWA 4YHYB 5I8CA 3GMRB 4Z7WA 1KPUB 3POHA 4K8RH 1PS3A 2FEDC 1IJNA 5DD0H 4FL4B 2J72A 2WK2A 1I3RA 2H1PL 3I6KA 3LHPH 3QDMD 4Q4EA 4Z95L 1QR1A 5HHVH 1HL4A 3E6FA 1EXUA 5D7KE 4JM4L 4B9JA 3L5WB 1KLGB 1FSKB 2OS7A 1AIFB 3O8XD 6TAAA 1XCQA 4LPCA 5F1OB 4YSPA 3NK3A 1RMFH 1PBYA 2FAUA 2QQLL 3TBYB 4DF9A 1LO5B 4GOSA 1CGWA 2QSTA 1T0NA 3VX0A 3X3GL 4TUKL 4DVBB 3WTTA 1EO8H 1JNHB 2HLFD 2HVJB 3S98A 2OMUA 4NI3A 3UTQA 3K74B 5HTSA 4HWBH 4LAJH 4X0KA 4MD5A 4XP5H 1IEBB 4P2RB 3SQRA 4YE4H 3KPNA 1QACA 3PP4H 4WK2B 3FSOA 4PFEA 1CDHA 3MO1B 4ETQA 3L3HA 2B5IC 4M7LH 4N3TA 1WG3A 1HSBA 3MMEB 2QSQA 1KXVA 3HMXH 3SE4C 5I76B 1MCBA 3B7RL 5AD0A 4W9CC 3CD4A 3OB0H 1KENL 4KMTH 1AZCA 3M6DA 3IRCA 5INCB 1NFIB 5AVWB 3DPDA 2E7DA 1T7WA 2EZ0C 4KU1A 1UA7A 2YPLD 2CJUH 1MLBA 3D3VB 5JPNC 3KWTA 5EU7E 3V6ZB 4J8QA 4F5CA 3BWUC 4UOJA 5D1XE 1F3DH 1SYVA 3ARXA 4K07A 4GFTB 4OD2B 1KTKE 2X3AA 1LQBC 3GHEL 3OR7A 5I8OH 3WS3B 4ATWA 3ZPDA 4UILH 1Z1WA 2YD5A 4AYFA 3B2XA 1Q9KB 4K5MA 4MNGE 3WY4A 1LP9E 2EH8L 3IU4H 2WQUA 3VQ2C 4J27A 1IBGH 2YBRB 5DT1L 3FFOA 4WDIA 5A2CA 3V5KB 3GRWH 5KANI 1BBDH 4OJEH 3PDOA 5DUJA 2ZXEB 2MIZA 2Z1KA 3GS7A 2J44A 3O4OB 32C2B 3AG1B 1IU1A 4UUJA 3D07A 1DQJA 3AQYA 4ANWA 5ID1B 4XNZB 2VDQL 3RFZA 5HGDA 1BJ8A 3K6NA 1ILUA 1T2JA 1U95A 2ZOUA 3FQXA 2NNAA 3MOAH 2WZ5A 4JFSA 1JHKL 2AJYH 2BHUA 4PTUA 1OGSA 4MX7B 3VQLA 2Y4SA 3V4VH 3ASOB 3VUAA 1XVSA 5DURB 5AOMA 5JIQA 5A2IH 1BQHB 3THMH 2BERA 5C0CD 4JHWH 1LDPH 2DW5A 3ZE0F 1D5XA 1GJWA 5EZJA 4OKDA 1N3NB 5EO0B 1UH4A 4H8HA 1OSPL 4GKNB 5INDA 1RZQA 4DZBA 1YYLH 3ZDZB 3NZSA 1AQKH 5EZPA 4X5WB 1Z9SA 1R5WB 4KVNL 3S88H 2XICA 2QVIA 1SJVA 1YPZE 2NCEA 3MZGB 1MHCB 4LCIL 4XAWH 1IQWL 2DYPA 3SKNA 1S7WA 1XF1A 4FKEA 3CPLB 1AE6L 3R06A 3QBTB 1C5CH 4N68A 4ZW5A 2AKRA 4HHAB 3OSKA 5HYJE 1U3JA 4EN3A 4IKLA 3RGHA 4S10A 4BK5A 3VCLA 1YEGL 1FO0A 2XN9B 1NAML 3JV6A 2WQVA 3H54A 1HTYA 3ROOB 3MXVL 3TVMD 5L88H 4HV8A 4NM8H 4N2KA 4D8PA 3O2WL 3ISRA 1BOGB 2IQAA 3N50A 4OAWA 1MHHB 1AD0A 1IC7L 4U0RC 1H8LA 1JPGB 2UY6A 1RVFH 2E74C 2Q2LA 4GAJL 3QIWC 4NHCL 1LO0H 1QTYT 3B6SB 5GGUA 3V5DB 1TENA 4YHKL 4F8LA 2YXFA 1CGXA 2YUZA