4AWJC

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
135
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 135
sequence length 139
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4awjC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4awjC01
1LM8V 4W9KC 4AWJC 4BKSC 4W9FC 4W9HC 3ZTCC 3ZUNC 4W9LC 4W9CC 5LLIC 4W9IC 4W9EC 4BKTC 4WQOA 1LQBC 4AJYV 4B95C 1VCBC 4B9KC 4W9JC 3ZRFC 3ZRCC 4W9DC 4W9GC 3ZTDC
chains in the Genus database with same CATH superfamily
2EDMA 2G75A 4NQVB 5IIEA 2YLHA 3X13B 4HS6B 2G4EA 3RVXD 1R5IA 4XPHL 1S7VA 4OQTL 3W1ZA 4QHNA 2PW1A 2XFXB 2GI0A 4NHUB 3LSOB 5JW4Q 3BISA 1CU4L 4BKLA 2X4UB 1JPST 2ILLA 4G70B 3RTQB 4MA7H 1PLGL 5I24A 1TQUA 4P9MH 3PY9A 1LD9A 5AAWA 2DLIA 1E5AA 1ZMYA 2ZD0A 1ZOXA 4B9YA 5C6TL 1IM3B 1AQDA 2WLMA 2QVTA 2Z8SA 5HI4C 1F4YL 1IEBB 1QLEB 1O6SB 3FRPB 5LGJB 2Z4QB 1KFAH 3CZKA 3A6BL 4LHQB 4ICXA 3RBSA 4F8TA 5BRZE 1ZWIB 4PJ7A 5DDHB 3LV3B 5GHWH 4F7MA 5JHLA 1I1AA 2HLAA 1ET7A 3IRPX 3OAUH 2AXGA 4G2AA 2G3NA 3Q43A 2G60L 1RULH 4N0FA 3Q6GH 2QQNH 4RGNB 2QADD 2GQHA 4G8EB 2KS0A 4KFZC 3TNNA 5C2UB 3T6QC 1J86A 5FF6B 3R8BB 1JZEA 1QQDA 3EO9H 2X1OA 1OM9A 4HBQA 1A21A 4J3VA 3SZKC 1QEWA 4GP4B 2W9LA 4GSDH 4L3EA 3U2SA 4AX3A 2XICA 5DWUH 3ZKXB 2PPCA 3GFUA 1G4RA 1NGZA 3C09B 4BFIA 1NDGA 1BZDA 2EABA 1CZ8H 3Q2NA 3S97C 5AAPA 4Y2DD 1MZZA 1HXYA 1IRAY 1IGCL 5I1DB 3FBQA 4Y16B 4PS4H 5BRZA 4PBXA 4DGUA 4PFEA 4JFQA 4WUUD 3LN9A 3MLTA 4Q7DA 4AGOA 1ZLVH 3B9KA 1G94A 4GNKB 4JKPL 3WEMA 2H5UA 5ESQA 2D7NA 1L9QA 4ZUUA 3TBVB 5ICYA 2XZZA 4RFEB 1YUHA 2ZPKL 3WUWB 3WV0A 5A7EA 4HK0B 5JPMA 5KZCB 1I8MA 2QPFA 4IRZL 4NGHL 4NO3B 3GBLA 1UEMA 4FX5A 4NAJA 3DX8A 4XP1H 3MCG1 1BJMA 1J0HA 3ULVF 2VO5A 4WWNA 3UBXA 4APQC 4A6YB 2B59A 3L54A 4NOBA 5I2IA 4PS3A 5F93C 2AXJA 2Z65C 4QRBA 1T7VA 1WCBA 4FA8A 1MWAH 2EC9U 4NN6B 2QVMA 4P23A 5IBUG 3DOIA 4JANB 2YGQA 2GBTA 1Y1UA 4YXLL 2ZP0T 4AJYV 1G6RL 2KDYA 3WEXA 2R1WB 2ZOWA 5C08B 3I6KA 3BPNB 2MIZA 4JFDA 2YD0A 3DJZA 1IC7H 3KLLA 3O3EA 3I9GH 4I88A 3UJJH 2A83A 3T8XA 4KKLC 2WVUA 4WI8A 5T1DL 5MHSE 5GGQH 3P0VH 4ZS6C 5EIIA 3MLVH 2ERJC 3R06B 2NY0B 1H8SA 3QG7H 2V5RA 5D71H 3TEZA 1VZIA 4NNXB 2JE8A 2HAZA 5A43C 1HJBC 4LASH 3T77A 1QYGH 4FGMA 1DZ0A 5HHME 3VB9A 3EYSL 2JCCF 4NM4H 5JA8B 4DSYA 1JPGA 5TQ2L 4QHKI 1TITA 5DJCB 4YHZH 3GJFK 4E9VA 1B4JL 4TVUA 1DSFH 1RIUH 2NY1C 1Y6MR 4GQRA 5GZNC 3TOPA 2XZQH 1NGPL 5TF1H 4IOIB 2X28A 1S9XB 2ITCB 2ZP9A 2EXWC 5K33A 2ZXBA 1N6QH 1D5ZA 2J5LC 4NKMA 1J1OH 5EZOH 1JPEA 3WUZA 2GFBA 1FP5A 1ID2A 2WWOA 4H8QA 2GSMB 4R6UA 1T7XA 5C70A 2RCSH 2NQCA 5E6ID 4PJBF 1AGBB 4DKAA 3U46B 1S9VA 4EN3B 1MFBH 1NC2B 4LPXA 1W80A 4OKVA 4AYEC 4O02H 3QQ4A 5DS2A 3KYOA 4U1HA 2GIMA 1QSEB 1O7DE 1EIBA 1W16A 5KOVC 2VM4A 4ZFQA 5ACMA 4LOUD 5FECA 2BVOB 3QAZB 3ULSA 2WTRB 3BUPA 5F1NA 2FVNA 4NXKA 4ZAKC 3OPZH 3GEWB 2VXQL 1BP3B 5ACZA 3WE6A 1JV5B 4ISVB 1JGEB 2OYMA 3AQZA 3DARA 4YLBA 4DOHB 1Q4NX 4TF4A 4TUOA 4QTHA 3WL9A 1LO4H 4XN1A 4JPVH 2PW2A 5KSUA 4DPBX 1J12A 2YUZA 2YZ8A 4YH6A 1FJ1B 4PY8J 3QIBB 4YNYB 2H3XC 1BZ8A 2OR8A 4CGTA 1QSVA 3DIFB 2Y07H 3G6DH 4R7NA 1QEXA 1V3JA 2NSQA 5TGBA 1ZLWK 3U79A 1PEWA 4YHML 3JWNC 2OFQA 4JE4B 4N6RB 4BZYA 5JIDA 2LW3A 2YKLH 3P9WB 3QUXC 2EIDA 2NR6C 4X6EB 1FYHB 1I85C 1OM3L 5KS9F 2NXYC 5C0DA 3IDGB 5HGAB 3MLZL 4RAVA 5SWSB 1F0LA 1GIGH 5SX4I 2C4FT 3FB8A 2FCBA 4RMBA 5DK0A 1PSKH 5JLZB 1TTFA 2JJWA 1OAKH 4WDIA 1E4XL 1OAQL 3JTTB 3MJ7A 1AKJB 3NCFB 4JB9H 3DX9A 1I82A 4ZUTB 1Z5LA 2NNXA 4G3YL 4HFWA 3L7FA 3BVWA 3VRLE 5F21B 5E99L 2QEJA 3QYCA 5JR1L 3HN5A 1U9KA 3GINA 4P4KD 2OQJA 2Y1ZA 4X5XA 2JQAA 5EORL 1T3FA 3EYUL 4I2XB 3P0GB 3HI1A 4Z7WA 4OLYL 4CVXA 1NEUA 4HDIA 2XG4A 1BFSA 1FHNA 4HHAA 4IOSD 4XN2A 3AU0A 4KZEH 1T6VN 1ADQA 1BSIA 5KBDA 3ZJAA 2N59A 3QJTB 3BN9D 4M62H 5AOKA 1QFOA 2VZUA 1UACH 5E6ZA 1JNLL 2X4NB 2TSBA 4P5MA 1T0OA 2HKHH 3L2LA 5C0IA 6FABL 5EBWB 1M6UA 3MUUA 5AW5B 5AFAA 3BSHA 3CDZB 5GRVL 3IFPB 3VX1A 2NW3A 2J8OA 3MLSH 3AWFA 1M42A 2FLMA 1NLBL 3BP4A 3PWVA 1J8SA 1F97A 1M6OB 2KYIA 2CLVA 4H0IA 4NI6A 5IJVA 4ELKA 4HMEA 3PWNA 4F9LC 1NGYB 1UM6L 4OAWA 2CLRA 4ZZFA 5FXCH 5DJDB 1OSPH 1JHLL 4O2FA 2H8PA 3FSOA 4IQHA 2FBJL 3DV6B 2GTZA 4QXGH 1S9KC 3FONA 4PJEB 3MLWL 1NCIA 2DQEL 3O2WL 3OXRB 5HI4D 5DO2D 1IFHL 4EQ3A 3I50H 3VXMB 1BF2A 1N0LB 1SN5A 1QBAA 3FTXA 1VEOA 2QVIA 3QZOA 2CJSA 2XTSA 3EYOA 1NSNL 1Q0YL 3C6LC 3QDJB 3CX5J 1FG2B 2APXA 2MCAA 4WNSA 1MKFA 1GCFA 4LQFH 1DO6A 1XZ0A 2I07B 5EU4B 1S3KH 2WQAA 1JYWA 1A25A 2EE9A 3H42L 3MX0A 3ILPB 3NJLA 3OV6A 3BESR 3QUML 5F6IB 2DPKA 3SJVA 4UUJB 2OYKA 5IEKA 4BIKA 2WVVA 1ETB1 3M1BB 1FYTB 4J2QA 3QORC 2WBJB 3VFNB 4JDTH 4L4VE 3QPKA 3CD4A 4BZ1H 4YHIB 4JW3A 4Y1AD 3QW9A 2Z31C 5BUGA 1WZKA 3EJJX 3ZRFC 3LZFH 3K6DA 2F5BL 4LPUA 1PMYA 2OR7A 3EJQA 4I1NB 4Z8FL 2D0HA 1LK3H 3CFDA 4WEBH 4NM8H 2FJGB 2KLTA 3T0AA 5CD3B 5E8DH 3MGOB 3GSWA 2ZWNA 4OT1H 3IGUA 1X5AA 3RIKA 3L5XL 2AQQA 4HZLB 1MCHA 3IXAB 4IRSA 3O45B 3TBWB 5KVGH 2AKRB 3NCEB 2BIIA 4YLCA 4MDJB 1BGXH 4APQD 1S3RA 2H26B 2B3RA 3KYNB 5CIPB 5C0EB 2UY6A 1FIEA 5J13C 2VSMB 1WWAX 3VXSD 1QSFB 2BIHA 2IV8A 5LB1A 3ULVE 3IDJA 3P4NB 4PB9H 2V7HA 4Y5VA 4WI0B 3CDFA 5FC9A 4M48L 2WIIB 1U6AL 1P4LB 5BXFB 3IJHB 4LLMB 4ODHH 5JNYB 2A38A 2PCFA 3Q48A 1URIA 1NBVH 2VR6A 4GO8A 4KKLD 2RGSA 4WO4B 3FQWB 3ARUA 3QDMB 3E2HB 4GKZB 3C8HA 3NIFB 1K4DA 2H1PL 3RWFA 3WIFA 4XMPH 3GSXA 2P8LB 1UVQB 4LBAA 4U1KA 4LKXB 1MNUH 5DHVA 3X11B 5ICZA 4FDWA 4MNQA 4YPGB 3D39E 4NQDA 1GGTA 3RL1A 4FEMA 3RWEA 5EEZA 1T03L 4GUOA 5IB1A 1KGJA 4V1DB 2PNDA 2JMRA 2AJYL 2WUCL 1MN4A 3FN9A 3EO1A 1W0YT 3TV3L 5F97E 3D69A 1TNMA 5IQ7L 5L7XL 3PL6C 3MRJB 3AS0A 5C0JB 2N4IA 3AB0C 4QYAA 5AB1A 3L5JA 3QC5X 5HDLA 2NY1D 2RTTA 3QIUA 1F4WL 5GZND 4BH8B 2JCCE 3B2PA 1TVHB 5DRZA 1PTZA 2IDFA 3P11L 1ZEAH 5C0RH 1D6EA 1KB5L 1L9MA 2XY1A 4PSPA 2J72A 4K5PA 3SCMC 1I1RA 3CH8A 2A7BA 4L8CB 2EDLA 1R0AH 1JK9B 4GT0A 1KXQA 1NDTA 5DA4A 4PRIB 1EFXA 4L48A 1AXIB 3PWJA 5SWQB 3KD4A 4PJBE 4JFED 1HCVA 3GBMH 3QS2A 4MMZB 1RI8A 4EZLA 2YRZA 3PHQA 2IAMC 3O0LA 4GRMB 4D0CB 4XTRC 3RX7A 3V0AC 4JO2L 1GGIH 1CQKA 3REVB 3ARXA 4XNXH 1MUJB 1ZHKB 4C4BA 3GSVA 1KJVB 3KCPB 4EVNB 43CAA 4B5ZA 3QYMA 1KIQA 2XV6B 1ZA6B 4IGBB 3D34A 2VDQB 2R2BB 1NC4B 1OTUC 1P7QD 3M46A 3CXDL 5EC2B 4K55A 4ORGA 4Z7NB 4I0PC 4K8RL 3FQUA 4R2GB 1LE9A 3UYPA 3HMXA 3WIHA 2OMZB 4LCIH 3RU8H 5I6PA 3L13A 5HHOB 5I16A 1CR9L 1GVIA 3AREC 3EGXA 2V2XA 2VLJE 3GEFA 3ARYA 3CTTA 1XBRA 2QQKL 1U8KA 4LNRB 5AW0B 1M56B 1WLHA 3QUXD 5EV7A 2NR6D 4Z7UF 2YA2A 4FAAB 1IAIM 1UENA 2NXYD 2J8UF 3ZDYF 2V0AA 2XTJE 1JVKA 4KX9A 3KL0A 3OSVA 5CEZH 4NKIH 3F83A 4OZHF 1TOXA 5KS9E 1R3LB 3SDAB 2DWDB 5DF0A 1JCKA 4YDLC 1ZDSA 4JFXA 5A7BA 5D2NE 1UOWA 4HT1H 1CS6A 1FAIH 4OZGA 1M71A 3GMQB 3KPQB 1DBAL 2DIEA 1ZXQA 3LJ3A 3RGHA 4ZOAA 4C56A 2N1TE 1OANA 5IQ9B 1UM4L 3CU1A 1A3RH 1CXHA 1LO0L 1AZNA 1AKPA 2DB8A 4HS8L 4LOFA 3X1EA 2XCMC 4XCYB 1BOGB 4YBQC 4XNYH 3SDCC 4PW4A 4LLQA 2J2ZA 3LB6C 1COBA 2WAHA 3MJGX 4ZXBC 1NAMB 1H6TA 1Q1JL 2BSRA 4Z7VA 2FSDA 1FNSL 1JUFB 2VDNB 4JFOB 2AQ2A 2DBLH 5GQBA 5I0VA 4XCCH 3OLGA 5M94B 3RY6C 1RZKH 3B56A 4ANWA 3TT1H 2OXGB 5ISZB 3E6FB 2ZICA 1O9WA 2C3XA 3OGOE 4M4RA 4W6XB 35C8H 3BAKA 1DJSA 3F7KA 3BQVA 1NGXB 1P9MC 2VR8A 3MNVA 4H5SB 4NPJA 3H9ZA 3VMNA 3U30C 4BFJA 5F7WC 4PGEB 3VMOA 3CZFA 1RU9L 4JG1H 4OD1L 1XF1A 2FR4A 1N4XL 3ZDZE 1HSAB 2GBVA 3QJSB 2AJZB 3U7WL 4ZFGL 3GF8A 2Y1AA 4ZG1A 4RRPA 4WEMB 1NBZB 2ITDA 4RMSA 1VJSA 2Z8WC 4EXKA 1U2HA 1ET8A 2YZ1A 3DC0A 1OAZH 4N2IA 5I1LB 1S7QA 4ATWA 3MACH 4F8QA 2QTEA 4KPHH 4NZUL 3GO1H 2QFPA 4W4NA 1NCCH 3ZTJH 2BIOA 5AVRB 4ZMAT 5K9OA 1XGTB 2AEWA 5J1AB 2GHWB 3IFOB 4FQ1H 4ZW5A 3RI5K 1RZGA 1VEPA 1X9LA 2J55A 2WLLA 1KXVA 2XC8A 3DNKA 3C6LD 4PUBL 4EN2A 4LF3B 5IVXF 4NT6A 1BQLL 1QRKA 4PJ5D 1SXBA 2R69A 4E9RA 3JV5A 4NLHA 1QLFA 1BQRA 1E4WL 4WFHE 4Y88A 1Z6JT 4LSVL 4KAQL 2OK0L 4XWOD 2EE6A 4AYFA 1IBDA 4IKLA 1PZ3A 4G7RB 3UIYA 4DKEH 1RHHB 3TYFB 3QORD 5GRUL 2X4RB 1W72B 3A47A 4QRPE 2BNQA 1TENA 4NO5B 5J12C 4IKJA 2Z31D 1H3PL 2BOBB 3VU1A 2CPCA 1WC7A 3DSNB 5E51A 2VISA 3IDIA 4HH9B 2FYVA 3JT0A 2ICWB 1U8MB 3NK4A 4YR6A 4DAGH 4L1DA 2OW6A 1AZRA 4G6KH 1N7ML 4IHOB 4WWKA 1IB5A 1A9BB 4CVWA 3EDFA 3FB6A 4G7QB 3V6OE 2CNYA 4PM1A 2G75B 5IIEB 4UTBH 2P48B 4NHCH 1PZBA 5LCVH 3B8YA 4QHNB 2PW1B 3LH8A 1G7QB 3UC0L 5JDSA 3ARFA 3JV6A 3KW8A 2CM6A 5D7LD 1MFUA 1A9EB 4U4BA 4QRPA 3ZGHA 5GIRA 4NQSA 5CLTA 4EDWH 1LD9B 4Q8BA 1PFOA 1PS3A 5BQ7A 3QHZL 2NY2C 1SVBA 4XAKD 3HHSB 5LBVA 4WW1A 2X6CA 4FXTA 5E8PA 1AXTL 1NIAA 4OV6F 3L4ZA 3A22A 1SBSH 3HN3A 4PJ7B 2VNCA 3LPGA 3LXAA 4F7MB 1MF2L 3LQAL 5F1IB 3UO1L 2HLAB 1ZLVK 2AXGB 3QZNA 4S0TD 1DE4A 4G8FB 4OLVL 4N0FB 4HWBL 3GIVA 3AT9A 4Y4HA 3TNNB 3VWKA 1YMMA 4PJFF 1KPRA 2AV7B 2WLJA 4KXDA 4L05A 1LEIA 1A6AA 1QEWB 2YWZA 4L3EB 4IRJC 5HJDA 1CFVL 1DQJB 3L3GA 5KTEL 1NGZB 2Y7QA 1TJGH 1AI1L 2XU9A 3ABKB 3PL6D 1NDGB 3D9AL 3KWXA 4BFIB 2Y1VA 3KGUA 5LQBH 5FYLL 1HXYB 2OL3H 4RFNC 4F20A 4OM1H 1EMTH 5HDOA 4JN2A 4WUUE 1IX2A 1KELL 1Z5YD 2A1WH 3D25A 5JW4N 4W9HC 4JFQB 5E95B 2VZ3A 3B9KB 1I8LC 4NRZA 4L9LA 4XE5B 4PJHE 4F33A 3CIAA 5ESQB 1WBZA 1R3IH 4ZUUB 5T3ZL 2VDRB 1YUHB 4O2EA 1L5GA 2F8XC 1HHGA 5JPMB 1I8MB 5DJZA 3L95A 4U1JB 5CR1A 3D3VD 5DUJA 1CF8H 4EE2A 3ZZ1A 1U36A 3UBXB 1X3DA 5I2IB 1RFDH 2B59B 1MPAL 2E56A 3ZY7A 3SYCA 2WXKA 1TJHH 1WCBB 3BJ91 4KVCH 4TQEH 1T21A 1DQDH 2FHBA 2IAMD 2IPTL 5DVOA 3UDWC 3GSOA 4QOKB 4XTRD 3QWQB 3TEUA 2Q87A 4RNRA 3WEXB 4HG4J 1DQLH 4KNUA 3GRBA 3I6KB 5DRWA 3LIZH 4ELME 2VUKA 5EBLA 3HG3A 3OJ2C 2WK2A 4HKXB 4JFDB 4U6TA 2E3VA 1AE6L 3O3EB 4JREC 5IJKC 4PY7A 2PTTA 1OTUD 2A83B 3T8XB 3F5WB 4JGUA 1DBKH 4I0PD 1T1YA 1HZLA 1KJMB 3AABA 3AMKA 3TNMA 3HRZB 4WEEA 2OLDA 2BSTA 4C58B 3ARED 3FQ1A 4TQPA 3MN8A 3T77B 2HKFL 1OAJA 4XN7A 1WBXA 3II2A 4L3AA 3U25A 3RNQB 5J1TC 4X80L 4UT9L 3BFQG 5F3BA 5JW4R 4TMPA 3IWVA 3W3BA 1G6RB 3L3KA 1IC5L 3FDWA 4QTFA 1A65A 2OTUA 2ZCKH 4I13B 5IHWA 5DD0H 4BFOA 3O6MH 2K70A 3IMRA 4G71B 1OP4A 1D5ZB 3QHFH 4NKMB 4Z7UE 3BD3A 4L1BA 2J8UE 2GFBB 1KCVL 4JKWA 1E2WA 1BQKA 1ASOA 3SPJA 4DN4H 1EBAA 5C07D 3OKLA 3O81A 3HMWL 4BZ1L 4KO5A 1S9VB 1TTRA 5HVHC 2YJQA 4KHXH 3P9MA 4NENB 1Z9LA 4OZHE 2HRPH 2PXYA 4ONFL 3TL5A 3V0DA 3KYOB 1A14L 4YX2H 4JQXC 2OMXA 3GI8L 4U1HB 4G7YL 5E6YA 1XAUA 2YEQA 1TZIA 2N7BA 3HJEA 4YBQD 2CK0L 3RUGB 4U7MA 5FECB 1CDIA 3LB6D 3ULSB 1Z0NA 2Y06L 4MBRA 1INDH 5F1NB 3P0YH 4ZXBD 1ROWA 5HYEA 3HG1A 2KKQA 3ASWA 3T0VA 4QYOA 5ACZB 1AQKH 3GSNL 3NFPB 1BXUA 1OOAA 4Z7UA 3WS6A 3G7TA 1IGYA 2COVD 4QTHB 3WL9B 1ANUA 2F53D 2Y5EA 2PW2B 2XV0A 2F0CA 2F8OA 3M6DA 3CK0L 3ZT7A 4OLZH 1NCWH 4DPCX 5E2TL 2EO9A 5AWNL 3D18A 3JVGA 3APMA 1E5YA 3OR6A 3QQNA 5DMGC 3ZL1A 4X4MA 1GY1A 2V4LA 4FXKA 3WFBL 3WMQA 1SXAA 5TGBB 2X4QB 3S3SA 2W9EH 4JRXD 5I66A 3NH7L 1F4XH 5D1ZC 2AK4A 3FFOA 2YPVH 3TN0C 2NY3C 3ZPDA 1WIPA 1PNDA 1JDAA 5I76A 2YRLA 3PE9A 3TS8A 4ONGH 1HIMH 5DQDL 3D52A 2Y7OA 5C0DB 1X44A 2AEPL 5EIQA 3RDJA 2ZWSA 1FL3A 4B96A 1BW8A 2EDJA 4MJIA 1T0NA 5DK0B 3EO0A 5DTFB 1KLGB 3OKYA 4X9YA 3MJ7B 2UZPA 3GSRA 5JMOC 1ZTXH 4X5LA 3DX9B 1Z5LB 3HA0A 3QJUB 2XWRA 1FSKB 1YEWA 2NCMA 4M6OH 2PO6C 1WFUA 1G9HA 2HH0L 3U36B 2JIXD 4LFHD 5IVXE 4DUVA 4X5XB 1KZQA 4AM0Q 1T3FB 5JORA 2J43A 3HI1B 4Z7WB 5DD6A 3IB4A 1E3ZA 2XWTA 5ACLA 1EAOA 1DQML 2XG4B 4U6YA 1E4KC 4TULH 1PAMA 4HHAB 5FGBA 3T0EA 1EV2E 2DQHH 4L8BA 2Z7UA 4JFSA 4U31A 2WM0A 4XAWL 4JFFA 1L4IA 5ECGA 1A1OA 4OY9A 3AAZA 2K3TA 4P5MB 4YK4B 4CC4A 3VXUA 2XIBA 5C0IB 4UDTA 3CFNA 4TYUA 3F65A 4FG0A 3VFGL 3WO4C 4I8DA 2PWFA 3B9VA 2OPCA 2NW3B 4HCRL 4JG0H 4V2CB 3KZ8A 1XT5A 5ELIA 5FWRA 3PWVB 4U6XB 5IVXA 1PD0A 5ECJE 2CLVB 5IJVB 2FK9A 4ELKB 3PWNB 2RQ8A 5AVQB 5EA0L 5EMYA 2C7UA 4OAWB 4F58H 2CLRB 4KKZA 4IDJH 4NBXB 3APDA 4QHUA 1GS8A 2H8PB 1K2DA 2OCCB 2GTZB 4RMWA 1UD4A 2NY2D 3FONB 3JWDL 3SDXB 5DGQA 4RMQA 2F8IA 4KJWC 1UCBH 1CICC 1XR8B 4MZRA 5I6NA 4I18B 5CFAA 4AW4A 3K91A 3S34H 4KKBC 1A4BA 3NSDA 3EYOB 3N42B 1T6WA 4LRIC 5TE6H 2D0FA 5DJAB 4JX0A 3ZQWA 1CL7H 2DEWX 4ZO9A 1XZ0B 3BUQA 3OJDA 1TIUA 4N2GA 4MD0A 3NCYS 4LLWA 3O6FA 4ZFZA 1KIRA 2J3SA 4M5TA 1NCUA 2G2PA 3X2QB 4DP0X 3ELQA 3WFEH 4F15B 3SJVB 1SN2A 4DP2X 5IEKB 5JOFB 2ZUUA 4DKTA 3DLQR 3ULUF 2WVVB 1OEZW 1J5CA 4IRJD 3BUTA 4N2AA 4WJKB 3W81A 3N1FC 4M5YL 2DF3A 4Y1AE 2Q6WA 2NCEA 3EJUA 4I9WD 5FO8B 4N22A 4Z7OF 1HK6A 3BPLC 3NPZB 4FQCL 2WVSA 1PVHA 3LNEA 3ZU8A 3N85H 4QHMB 5GISL 5HVGB 4YS4A 1CURA 2ED8A 4PGBA 1JZ7A 3WKYA 3WXWL 4KRPC 1TJXA 1ILSA 2CGZA 1D5BB 5L0QB 2CKBA 4K9EH 2OW7A 5GRYA 4GRLC 3WG7B 3X3GH 4UM9B 3BVNA 1UXLA 4HIIA 2H6UA 1FV1B 4FQQA 4IRSB 5F89A 4BUHA 4XOBA 1I9IL 2P80D 1ILUA 1Q9OB 2NY6C 5IP4A 4FI8A 1DR9A 5BZXA 3FSAA 2XPGA 4WGVB 4KXAA 4J3TA 4P2CG 5D5MB 3VI3B 3NACL 3CLEH 3QUMB 2VKWA 5JHDA 4GFXA 2B8OT 2B9AA 4AG4H 1F5WA 2UY6B 1FORL 1MCCA 2FX9L 3GHEL 4JPWH 2KZ1B 3VXSE 4UTAH 5FPIA 1SYSA 1K5NB 2LAGB 5FM4A 5DVLA 4L8DA 4PJFA 1QPPA 2NRDA 2XHNA 5TF0A 4I3RL 3SE4A 2EUWA 3IDJB 2V7HB 4Y5VB 2X89D 1K72A 5CP7A 5CJQL 4Z9KB 2MCG1 3N55A 3PU7A 3OB0K 1GS7A 3B2DC 1YNTA 4TNGA 9CGTA 3F7QA 4QF1A 5LLIC 2Q5BA 5KVGE 3FOMB 1FFPB 3CDYA 3ERXA 3RWFB 3WIFB 3QUYC 3GSXB 4TRPL 2ZXEB 1IAKA 1Y18A 1A1NA 3NOIA 4UB0H 4AYBA 4PWFA 4U1KB 1TYRA 3P02A 4BYHA 4A67A 4MNQB 2ZONA 4NQDB 5AOMA 3RL1B 4W93A 1KTKE 1L9RA 2ZX8A 4XC1L 3HR6A 3S98A 1L9NA 3NN8A 3K8LA 2YRPA 3EO1B 4FTVD 2EUXA 4XR8C 1SHMA 3D69B 4U49A 3SPHA 3IDXL 3D85A 2CBMA 2ZCLL 5I1GL 4RFOH 5KOMC 2ESVA 3D5OF 3ESMA 5H37H 3VD5A 3WAKA 2HFTA 3ALPA 4NPYA 1EXUA 3S88H 3UTQA 2RQEA 5KJRL 1K5WA 1DN2A 5G4OA 4GAFB 5DRZB 3WN5C 1IBBA 1HOEA 2HWZH 2Q8AL 1D6EB 4KITB 3GQFA 1BM3L 4H7VA 2HXAA 2X87A 3LXCA 4WF7A 3L1OL 3FMGH 1ZHBA 3NSFA 4LLDB 2L7JA 2XZCL 1CT8A 4PWIA 4OD3L 3RWHA 5CZVL 3QUHA 5ALBH 4JFEE 1EFXB 3PWJB 5TK2A 4XNAA 4AQ1A 4KVNH 1IKNC 1VRSA 3EBHA 3DHJA 5KUMA 3UCRA 2YGNA 5SWZA 2JCWA 4ODTH 4XVTH 3L9RA 4X4YB 1LO3H 1F18A 2I5YH 4LAQH 3V6ZA 4X0NA 2EUZA 5G5DA 3QZLA 1KCUL 1OPGH 1T7YA 3CSGA 3E8VA 4IBTA 4LE8A 1KIQB 4NB7A 3S2AA 3CH1B 3UBGA 3ZZSA 4LEBA 3QYNA 4B97A 2Q76A 1HI6A 5FUOH 3FQUB 4ELDA 4M5SA 4YEEA 3UYPB 3ZHLA 2CH8A 2YEZA 2X38A 1NCBL 2OSWA 3VXPA 1LEKA 4J1UA 5DMGD 5T33H 5I16B 2OJEA 3CQFA 4A55A 3VJ6A 2AJSL 2CJUH 3JWNE 4WW2C 2V2XB 3MYJA 3B2XA 4FFYA 4Q14A 5D1ZD 4OBSA 2DKUA 5HTSA 3TN0D 1U8KB 2NY3D 3BN3B 4Z1PA 1OHQA 5EO0A 5MI0B 1GAFL 2PETA 3FPYA 1FO0H 1TVBA 2ADGA 3MYZA 3NSJA 5DUMH 1JS4A 1P7QA 1XDTT 1Q9WA 4WJG3 1F3DJ 2C9UA 2YPKA 1JI1A 3NJVA 4HJSA 2K78A 3KLHC 4ERSL 5HXMA 3H9YA 4JFXB 2YN5A 4OZGB 1M71B 2B16A 3CVCA 4FZEH 3BLKA 2PO6D 1WVZA 2PKDA 4FMKA 3PPEA 4S1QL 2D2OA 4C56B 1D6VL 4MZIA 4R90L 3J07A 2E9JA 2MHAA 2NNCA 3QQ3A 2EDWA 2BIPA 2W60B 5T5NF 5FB8A 4KKAC 1DEEA 5JQHC 2J2ZB 4Q6IC 2Y36H 3QR0A 3J8F7 3DRQA 4N0CC 4Z7VB 4B7IA 1U58A 2JTYA 5CJOL 5T5FH 1F02I 3OTTA 2QV2A 2F61A 4IBQA 4Q0XL 4GW4B 1JZHA 4AOFA 4P46A 2HLEB 5CHNB 5CO1A 2C1PB 1XSOA 4DEPC 5AOZA 4Q52A 3WY4A 3MNVB 1JRHH 2CBQA 5IV2A 1QHPA 2OSXA 4JL2A 4UILH 5DUBA 3R7QA 1XO8A 1G5AA 2HCZX 1NA8A 5F7DA 5JQ6L 2O5ZL 4ODXA 5ESAA 5LXGH 2ITDB 3ULAB 4XPGH 5LVEA 1YYMH 3IFLL 3QH3B 1JK8B 3CE1A 3ML9A 1B90A 2YQ2A 4C4KO 1ZLSL 2DDQH 4MJ2A 4KJWD 5K9OB 1CICD 4LLAA 4J3OH 1QKZL 4X7TB 3LKPA 1D5XA 4XPHH 4N24A 4HIQA 4CAGA 1ZANL 3CAFA 1VSCA 4J23A 5SV4A 2XT1B 4NQUA 5HD8C 3WGVB 3BP7A 4PJ5E 1CU4H 4XP9L 4NT6B 4TVSa 2YUWA 3EJPA 1MI5B 4J6IA 4NJ9L 5BZWB 5EOCL 4Z5RA 1U3JA 2QBWA 3ROLA 1QLFB 3MV9B 2GJZA 2H7WA 4HXAH 4F37K 5C6TH 1KCKA 3B6SB 2H3NA 4PV9A 4ATTA 4AYFB 2O26U 2VL5A 3DHUA 5GJTL 2BNQB 1M3IA 3UC2A 4WTWA 5L9DL 2R51A 3L7EA 4AWJC 2WWKO 3MNWA 4QRTA 1Z9SA 2J12B 1GOHA 3E9UA 1WC7B 3O6KL 3IDIB 5A16A 2IEPA 2LR4A 4OZFG 3M7OA 4KRPD 3X12A 3D05A 4HCIA 1PZ5A 4YR6B 2VRAA 1XF4A 3CJJA 4WWKB 5KG9A 1P7KA 2GW5A 1MJ7H 3FB6B 1IGFL 1PD6A 1V3LA 4GRLD 1F1AA 3RWJA 3AXIA 1P84K 1GW0A 1TCRA 1RZFH 2HT3C 2NY6D 3AW5A 1J87A 3GD1C 4Z3FA 2AS5M 4PJGE 5MEND 4HV8B 4J8RA 5AW3B 2C3WA 2ZUVA 5D7LE 4F2MB 5JDSB 3ARFB 3JV6B 2AEOA 3BYTA 2AJUH 3HFML 1E8WA 5ALCL 2VLKD 4IBLT 4TQ8A 3TF7C 2EE3A 1NM9A 5GIRB 3BRDA 4B9ZA 2X88A 4NQSB 5BQ7B 1BQUA 4XAKE 1OLLA 1A3LH 4JKPH 1NKGA 5K69A 2XIDA 2ORBH 4I7ZC 4PHZA 5TFSL 4PS8A 1X5JA 4JM4H 2ZPKH 4DIXA 1A6WH 4WW1B 4Y5XC 5IMOB 4UZGA 3FUDA 4M6AA 1I8KA 1FZKA 3FUJA 4NJAL 3UG4A 4IRZH 4NGHH 5LNDA 4QXVA 4ZOCA 4AGNA 3QZBA 4FD0A 1NCAL 4KXZH 1PAZA 5CSGA 4CA4A 3QUYD 4Y4KC 2EKSA 2BOCA 1DE4B 4AV5A 3PIQA 1WYJA 3UAAA 4YDKH 1OCRB 3GIVB 4Y4HB 4KKCC 1HEHC 3VWKB 4BEIA 1QVOA 1S7WA 1YMMB 3KNBB 1KPRB 1S5HA 4ZTPL 5D1QC 2WNXA 3RURA 2PTVA 1LEIB 2LU5A 4BRVA 3BAEL 4HC1L 3A3YB 4LGRB 5FO2A 3V10A 4PJAA 3L3GB 1CUOA 4YHNA 4EXPX 1LK2A 2Y7QB 1P5VB 1AVAA 2HVBA 3APCA 5IWLA 3UTZA 3GBEA 2OMNA 3UPRA 3PGCB 5T1DH 4JN2B 4FLSA 4XXWA 3TH3T 3RGVC 3EFFA 3B9AA 3D25B 3UCQA 4PTUA 5DHYB 2R4SL 4NRZB 4UNUA 4L9LB 1MH5A 5IBUB 3UJIL 1J5IA 1T83C 3LHAA 4W9IC 4O2EB 1L5GB 1A7PL 1HHGB 2WZPA 1R47A 2OZ4A 3WMSA 4A1RA 1FC2D 5EHFA 3N1MC 2UWEF 2EEXA 3L95B 3UOAB 3D3VE 5ANHA 5KBNC 4UDUB 2WB7A 1B4JH 4M7JH 2A9AA 2CIIB 3J2PA 4FQXC 4BQBA 1NGPH 3ZLQC 1IBFA 4YWGH 4RA3A 1T21B 3GUTB 2EDDA 3ZW3A 1RVFL 3GSOB 4I3SL 3Q8AA 4J39A 1M7DA 1CBVH 4AGMA 4RNRB 1BAFH 2FEDC 2LABA 2H32A 4JR9H 4I0KA 2O5YH 4WU7A 3E1ZA 2FX8H 1OO2A 2EINB 5JPNC 1FDLL 2DL2A 2Z93A 2VAAA 5EBLB 3WEBA 1G1KA 4TVPH 3RZWA 5KBPA 4BFRA 4ZMNA 5EFIB 4PY7B 5KW9H 2GJRA 4R96A 3N04A 3VTMA 2A2QT 4LQ1A 3GIZL 4NUPA 4JL1A 1NMCB 3DBXA 3GNML 3QEUA 5DZPA 3ZE2E 4ODWA 1EXHA 2BSTB 3DROA 4KDTC 5J0BA 4GLRI 2JKLA 1N6UA 3N1GC 5K93A 4KK5C 2KPNA 5F44A 2VXUL 3LZLA 1JHKL 3TEXA 3WTTA 3QEGL 3BC9A 2OTUB 3P4MA 3PWUA 3GJEA 5HHPA 5JZ7C 1JYNA 5BJTA 3FC8A 3IDYC 3KLHD 3KPPA 5T3XH 2VQUA 2FL5A 1ZLUH 5D4JA 5C07E 3MLXL 1VGKA 1UB6A 1KT2B 4YHMH 3OKLB 3GZKA 4YHLH 3WFZA 4MB1A 3WJJC 3JZYA 5F6HJ 3LXBA 2PXYB 4GEIA 2QSQA 3PP3H 4K3GA 3SODB 4N0YL 1J7VR 2YD9A 1OCCB 3Q8FA 4K94L 2QPSA 1TZIB 4R3SA 3P3YA 3WJLC 4KKAD 1UTDA 3HI5H 4G6FB 4GKSB 4M6NL 1OAQH 4N0CD 4F5CE 1R34A 3HG1B 1E67A 3OKNA 4DESA 1OARL 4QYOB 4HPHA 5KYWA 5L8LB 4G3YH 3LQZA 3U7AA 5KSAA 4GG6F 3RB5A 2F53E 5JR1H 5L4MA 2RMNA 4PV8B 5C07A 3ZDYB 5L6YL 1GMIA 2Z0BA 5EORH 4AEIL 1QUPA 5ANME 4E5XG 3IJSA 4LDCA 2P47B 5C09A 4DGIL 3D18B 1FNHA 2BLFA 4GBXD 4I5BA 3OR6B 4APXA 2WGNB 1C8PA 1OF2A 4FXKB 4JRXE 5I66B 2P8MB 1Y1DA 5HY9B 3FTWA 5G4MA 3CPLB 2AK4B 2BHYA 2XN0A 2XPYA 3MBXH 3VWJC 3CVDA 5I76B 1KEGL 1OAXH 2VN4A 1VFBA 4ZW7A 1RZ8B 4YSTA 2A4ZA 1FL3B 5IK3A 2F53A 2ZWZA 3I02A 5ERWB 3ZE0B 4AVKA 5IESL 2QJDA 4ZUWA 1I1CA 5BW7C 2CBOA 4MJIB 1T0NB 3F58L 5HD8D 4U1SA 3WNLA 3EO0B 4JPQA 2DYPD 1N68A 4JHAH 3HE6A 3GSRB 3Q8EA 4MJ6A 1KYDA 1UM6H 1JGLL 4I48A 4LVHC 4UZUA 5C0GA 2YA0A 4TUKL 4HUNB 3QFJA 3W11C 4EKXA 1JHLH 1OQXA 1YN7A 2PN5A 4JRXA 3WNKA 1H5BA 4D0BA 5BRQA 3V5HA 3MLWH 2DQEH 3OWRA 3O2WH 5KUKA 5E70A 5JORB 1IFHH 2B15A 2GITA 4NUGL 4RETB 5DD6B 2XWTB 1MJJA 5HGHA 4Z0XB 3UMTA 3C8KA 2DD8L 2IG2H 3OAYH 4U6YB 5I30L 4QHPA 4ZMYA 1TMCB 3POHA 2K6YA 4M7KH 3T0EB 4WGWB 2VR9A 4X8GA 1KWKA 2EE2A 4KTDL 4JFFB 3SGEI 1LGVA 3RTQC 4WUKL 1A1OB 4JKNA 5E2VL 1XH3A 3HR5A 1EQWA 2EDXA 3AAZB 2H0EA 1ZTXE 2DQUH 4GRWB 4FNRA 4N0UE 3VXUB 3KYKL 4UDTB 5I6OA 4OM0H 1JXGA 2HT3D 2JQMA 2BNRA 3B83A 1Z3GH 4QMEA 1T0MA 3AS2A 4U6VL 2FSEA 4AUJA 3MNZA 3D1MC 1I9EA 3FT3A 1ORSA 1U3YA 3VXTA 5BS0B 1UHVA 2PPEA 1HJCA 4IBWA 1TTUA 3PWPA 4XBGB 2BO0A 2PUQT 1G7MA 4NO0A 1H15A 2IOOA 4RGNC 4QHUB 1K2DB 4S1RL 4X6DA 3GHBH 2BJMH 1T5KA 2DJSA 4LSPL 4MQTB 3L5XH 5CMAB 2DKMA 2R2CA 3D48R 4FL4B 4P9HC 5B1CA 4TSAH 1CI5A 1NCOA 2YGVA 4N0UA 3C09C 2E5EA 2HMIC 1FZMA 4HD5A 1H6EA 4ZO6A 1P6WA 4Y16C 1FLRH 2NXZC 4Y4KD 1PU0A 3ZYOA 3H8NA 3QVAA 4YSQA 3LQMA 3IKKA 3OJDB 3PJSA 4FMVA 2LFEA 3VQ2C 2YD8A 3ARDC 4JJ5B 1RY7B 4AMKL 4KKCD 4LLWB 3O6FB 4IM8A 5K9JL 5T1KD 4K3JH 1XIWA 1UWYA 3GPSA 5KN5A 4MJ4A 4TNFA 5EC1A 1GOFA 1JJUA 3L48A 4G6AD 4M48H 4TSBL 4I9WE 4OFYD 3FT1A 1U6AH 3LY6A 5E1IA 3L4WA 4U6HB 1R46A 2VDLH 4FNLH 4KX7A 2Q6WB 1BMWA 2P5ED 1G0YR 2FX7L 2NT0A 2IBGA 4PGBB 5FUZH 2H1PH 4D9QD 3T09A 3RGVD 3MUJA 4AUUA 4Z3JA 4P48A 2CKBB 2NX5B 4NN6C 1KULA 1VADA 2XQBL 5E2JA 4HWUA 2GJ6D 2JJVA 4WK0B 1T03H 2CDGA 3BVNB 3MJ9A 4HIIB 1AS7A 4FQQB 5F89B 1T1WA 2AJYH 3LEYH 5AYUL 3BPNC 3FF8A 5IGXH 5KEZA 3TV3H 1MHPL 1KTJA 3C08L 1YPZF 2NY5L 1FH5L 1CGXA 2XPGB 1EJ8A 1YEIL 5JHDB 3ZR5A 4FQXD 3V0JA 2UWEE 2B08A 1SYSB 1DDTA 2NY0C 3GDCA 5JW3L 1OCWL 3B1UA 4L8DB 4PJFB 4MQSB 3MFFA 3OMIB 5GGTA 3P11H 5AZEL 2FEDD 25C8L 2EDQA 4XMLH 3G08A 5E8OA 1CDGA 1BXAA 2WHVA 4JRYD 4EI5C 3MRNA 5CCJA 1ERNA 2DIBA 5G55A 1YNTB 1ZSDA 3DPBA 1BA9A 3V4PA 1EH9A 4X98A 4QF1B 3BZ4A 3IS0X 3TC9A 5EBMB 3MRRA 5IOKA 4WGKA 1A1NB 1MCKA 3NABL 3H0TA 4FF9A 1HEJC 2XIIA 3MRIA 2ZXCA 1OLZA 1MRDL 3WKMH 1KB3A 4FTVE 2CHDA 3D0AA 3UDWA 1AIZA 5TDPA 4N6QA 1YLBB 3P30L 4ZFOL 4EN3C 1L6ZA 4BZ2A 3D85B 3IBOA 5B21A 1B3JA 1H0DA 2FD6L 4PB0H 2ESVB 3CXDH 4F9PC 4NPYB 1EXUB 3UTQB 2WQSA 1O7SA 1MCSA 4WSJA 3T6WA 5JZ7D 2WXHA 4HJIA 4JKLA 5D7JA 3II1A 3QAZC 4MX7A 3SBWA 1CR9H 1MCPH 2VMCA 2EXSA 4RMVA 3T8MA 3H6JA 2Y4SA 1ZHBB 1MDAA 4BUQA 2GTQA 1TNNA 2YAMA 4OIBA 1CT8B 2XZAH 2C9PA 3WXVL 5ICXA 2JWYA 1KJ2L 4GXUM 1A5FH 1JGVL 4AQ1B 2ZQKA 1TO5A 4E2OA 3DMMA 4QTIL 1SDYA 3QIBC 3U1SH 4UNVA 3GMRA 1IKFL 1QFWL 3AGWA 1YJDC 5SWZB 1Q72L 5FGCE 5I71B 1A6ZB 1G1OA 3UADA 2H0JA 2DIJA 3RLSA 5I8KL 2CDEA 3V6ZB 1D7BA 1ED3A 3SYAA 5G5DB 4HMDA 1DBAH 5GGRY 4YHPA 2V2WB 1UM4H 1BJ1H 2JTDA 2Q76B 1VZGA 1HI6B 1LO0H 4JQIL 5FS5A 2JI3A 3D8MA 4JN1H 1KGXA 4YC2C 5JA9A 2BVTA 3SZ6A 3DIDA 4JQXA 2VDML 4GG6E 3ZMEA 4JDVA 1CTNA 3VXPB 3MFGB 1LEKB 1UXWA 5E5MA 3VJ6B 1FNSH 3K5RA 3MYJB 4NFBA 1MCIA 4OGYH 3BE1H 1P1ZA 4ES9A 5CU9A 4X9BA 3VWJD 3VD2A 4MXQD 1AMYA 2XQYK 1IUZA 5EU5A 5EO1B 2PYEB 4P8QA 5GSRB 1TVBB 3TCXA 4TUUA 4GAAA 3ABLB 2NYKA 4OLXL 1YQVL 1GGUA 3KVDD 5BO1L 4H0HB 3N0AA 1Q9WB 4FC3E 1HQ4A 4ZQTA 4NUJA 2YJLA 3GRGA 2R4RH 3UTTB 4U1LB 4LCUA 5DK2A 1EJOL 2VXSL 15C8H 2WINB 4PJXF 3W11D 4PR5A 3VDAA 3GKZA 2HRGA 4GQPH 1EEUA 2UXVA 4WI9A 5D1ZA 1AFVH 3E1F1 3FU7A 5F88B 4NZUH 4R9HA 5D4QA 3UZEA 4M43L 3W0WA 2ODIA 3QQ3B 1C12A 2JLLA 3MV8A 5JO5A 3B37A 1I3GH 5I6XB 4RWYH 1DEEB 2MQ0A 3T1FA 2AV1A 5I9QC 3T3ME 4PUBH 3VE0A 4LAJH 3DRQB 1M57B 3CHOA 1BQLH 5J9PA 1U58B 5FHAL 1JF5A 3RTQD 3WGUB 5FWQA 1X5LA 4P9HH 2DOCA 1MCDA 5F9JB 4P46B 4ZMLA 1H3WM 3QUKA 1IM3D 3QQXA 4LSVH 3LZQA 4KAQH 2OK0H 2VN3A 3BZFA 4QI3A 4DEUA 4K7FB 3DPDA 4N1CA 5IV2B 4QRUB 5DUBB 3IJEA 2X4OA 4KGJA 3UL4A 3K80A 4F1ZA 4P5TB 1ZVHA 3CV5A 1TU2B 4OCLC 2ZX5A 1H3PH 2R0ZL 4L4TB 3BDYH 3G3LA 5ESAB 1AOZA 2J88L 2VZOA 3RY4A 1S7SB 4AE1A 1FLTX 2R0WL 1QNIA 2ZWLT 4NP4L 2JI1A 4RGND 4F93B 4Q9QL 1N7MH 3QNYA 3ZTEA 2PABA 5F6IC 2ZOKA 5DXWA 3RVWC 1D5IL 5KAQG 3S3DB 1U8IA 3LKPB 1D5XB 2WBJC 4NBYB 4E9TA 4LSRH 2X41A 3UYRH 3LH2L 3NCJL 2HMID 1AZZC 3ZKNC 3UC0H 4X5QA 1GXEA 4Y16D 2NXZD 1BF5A 4GUCA 4EI6A 1KOAA 3DO7A 1NDMA 4OZFA 4MCNA 3UO8B 3ROLB 2HJLA 3NSXA 4LMQE 3FL7A 4MQXC 4CN1A 3QHZH 4FQIL 5J57B 4PJ6A 2H3NB 4PV9B 5KZCD 4JE0A 4OVUA 2VL5B 5E6SB 1AXTH 5DYOA 1QUNA 2OMTB 3GRWL 1DANT 2X9WA 2Y5QA 2R7EB 3C5XA 3L7EB 32C2A 2CRYA 1YMHA 2DMGA 5CWSB 1MF2H 3GMNA 3LQAH 2OMBA 1V3KA 5A16B 4RA0C 3BVDB 4J3WA 4X50A 4X4KA 3VGDA 5HGBA 4YDIL 3S5YA 1SEQH 4OLVH 3MA9L 1PZ5B 3SPCA 3L3OA 4HWBH 2KQMA 2P28B 3OHMB 3ZTJG 5KG9B 1P7KB 3OXSB 3GMPA 4G72B 4NUMA 3RWJB 1HN1A 2G3ZA 5C08D 1TCRB 5MENE 1K8IA 1TQSA 5C97A 3N41F 2CM5A 2QHRH 5KTEH 4MNGA 3QXDA 4HWZA 4YDZA 5E7FA 3D9AH 1AZBA 4BINA 1YSOA 5FYLH 5IVZB 2VLKE 4DKDC 3E2HC 4MGXA 3CSPA 4HU2A 2VLMD 3ECVA 5GHWL 5FO9B 1GL4B 5LAXA 2NY0D 5IMKB 4ZS7H 1WTGT 1YPZE 3QI9A 2VW4A 4DZ8B 3Q6GL 5T3ZH 2P26A 4UT6H 4JRFA 1N0XH 4YAQA 5HI5C 3O6LL 4EI5D 4Z7OB 1I8KB 1FZKB 4NC1C 3EOYG 3LNIA 3HC0B 2L3BA 3FQTA 3B3BA 2HVJA 1CXKA 5DWUL 4GI6A 5TQ0L 3T4YA 1I8IB 3LXUX 3ZK0A 5IHUL 2LTQB 4QAWA 2EKSB 1ZHLA 1AGFB 3MREA 3PIQB 4MA3A 3FU3A 3RA7H 2IPTH 5IFJB 2EJ1A 2JKRM 1F00I 1QVOB 1S7WB 3FTUA 3K72A 4BSWA 5I8EA 4LT7A 5K1VA 1S5HB 3V52L 2DQIH 4MJJA 1HNGA 4KV5F 1JVLA 1XGRA 4H88L 1UT1A 2OI9B 4PJAB 1O0VA 4YHNB 1LK2B 4EN3D 2CXGA 1NC2D 1FGVH 3VRJA 4OCWL 3EADA 1E8XA 3UTZB 2W9DH 4YDVA 3ECWA 4MB5A 1QSED 3UPRB 3LRKA 3LKSA 4UOZA 3OKMA 4DPAX 3MAWA 2ATKA 3EFDH 4MMZC 1OT1A 4Z3IA 2YAPA 2WLIA 4GIPD 4G8GA 4PTUB 1U33A 1MH5B 1R4XA 2IPUG 4Y1SA 1MWAL 4N1EA 1MELA 4J4PC 2HKFH 1TG8A 5D1ZI 1RSFA 1XH2A 3MR9B 3OKOA 3Q0HA 2FO4A 2DH3A 5LBGA 4IGBC 1OPOA 2A6JA 1J18A 2FBRA 4R26H 4TUJB 3I85A 1G7HB 2QPUA 3ZKQD 5HYFA 3SOTA 4R2GC 3I9GL 1HQRA 3AUWB 3PDOB 2Z92A 3ZE1B 3QIBD 2XSKA 5IBTH 2BFVL 3G6JF 4N87A 5E4EB 5GGQL 3P0VL 1F6FB 3MLVL 1M7DB 1SQMA 1LMKA 5CR8A 4NSKB 4HUUA 2H32B 4MDIA 3QG7L 5DWPA 1E9QA 4XB8A 1FBIH 3TBYA 4RSVA 5AG8A 1S7UA 3HMWH 3EDDA 4W4OC 5AUMA 4LDLB 2JNZA 4R96B 1IFGA 4KRMB 4NM4L 3DX7A 1P2CA 1A14H 5KVEH 1HL4A 2W65A 3GI8H 1O6TA 4G7YH 5LBSH 4B41A 1EHXA 5SWSD 3DBXB 3FQXA 4M3KB 2NZ1A 3O2VH 4NZFA 2NSXA 3QEUB 3IJ7A 1AXSA 1ZS2A 1DSFL 1RIUL 1DUYA 2CSPA 5E9DA 4ODWB 3DROB 1OWRM 1MCWM 1DSWA 3SDAC 2Y06H 3SBRA 1AKJD 4UQBA 1IKNA 1DJXA 1N6QL 3HUJF 2DQGH 5I6LA 3PP3K 4URKA 4HOZA 5I82A 5DC0A 2Y1YA 2NNAB 2AZUA 3BWAA 3MROA 4UIMA 4ALAL 1PKQA 1T5XA 2VN6A 7FABL 1EO8H 2YOAA 1CFTA 3L9BA 3O9WA 2O6DA 3P4MB 3GZQA 3GJEB 3PWUB 4YDJB 5BJTB 5AWNH 4OCYH 5HHNA 3KPPB 4NUQA 1MFDL 5GS2H 4PGZA 4PGJA 2FL5B 2AEQH 2VC2L 3HE7A 2DEYX 4OCNC 1IEAB 3VYOA 1VGKB 2OMUA 1F4AA 2E4TA 1GOGA 1UB6B 2VZVA 3G5YA 3VI4F 1MVFA 4WTXA 1BYPA 1TZHA 3OPZL 1JMZA 3R4RA 5F9AC 1THAA 4KKNA 1CFNA 2KBGA 5DQDH 4L0YA 2DQCL 3HBQA 4PJXE 4JPVL 5IREA 4R3SB 4CL7A 1FAKT 2CZNA 4FFZH 5MP6L 5D9SA 3L3IA 4E5XA 2GBUA 1BX2A 3V7MA 1OV8A 3CBRA 5D7KD 1NEZG 5DS1A 2OXHB 2QELA 5DZOA 3OKNB 1K4CA 5KYWB 2F54A 1MVUA 3ORJA 3H54A 2QHLA 2Y7MA 3G6DL 3LQZB 4IKIA 5KSAB 4L1TA 1RHFA 2KDGA 4O02A 4LVEA 1KF9B 4X6BA 3TWYA 3T0XA 1RK1B 4KMLB 4U3SA 2CUIA 5LGHL 4LMQI 4XMKH 2JELH 3S96B 3I84A 2J7LA 2YKLL 2JJSC 4PSRA 4X9GA 3V0VA 4EQ2A 3VXMD 1TQBB 3HCVA 1E3FA 3IJSB 1U0QA 2D03H 5C09B 1DQMH 3IDNA 3JTSA 1GIGL 3JTBA 4I5BB 5CXPA 3QDJD 4Z7QB 1OF2B 5EU6B 2OAAA 3S8WA 3RPKA 3CZGA 5HDBE 5K9QG 1PSKL 3HOGA 4BWTA 3FH5A 1UA3A 1XHHA 4UQAA 3SY6A 1IAII 4JB9L 3RIAK 1EUTA 2CRMA 2IQ9H 2IGTA 3RVWD 2YC1A 3ABZA 3IAPA 3OAYK 3VFGH 5IK3B 2WBJD 3I02B 4NYLA 3IT8D 4ZUWB 1BIIA 4U1SB 2CO3A 3ZKND 4ZO7A 3KYMA 1RP8A 3HE6B 4D94A 3OHXA 4I48B 1WHOA 2EDBA 4KQ4L 4PBWD 4GBXA 3DX1A 5EA0H 5C0GB 1M7IA 3L4TA 3QFJB 1SNRA 4UANA 2HPOA 3ZIMA 3K8MA 4CU7A 5CLZA 3W39A 4PJDB 2L04A 2GYSA 4ZNEE 1OT4A 4KZEL 4XX1E 5CZRA 1YN7B 4MQXD 1H5BB 4M62L 2C5DC 1HOCB 2MOQA 4QGYA 4ZX5A 3JWDH 3V5HB 1IGML 3F7VB 4XNZB 1CN4A 1JNNL 2GITB 3SDDA 1XAKA 3O8XA 3K5SA 3ZHFA 5MEPA 3F84A 1ZHNA 5HGHB 1F2XK 3C8KB 4LEEA 5F7BA 4JM0A 3DJSA 4P2YA 2XX1A 1TZAA 2OJZH 4Z18A 3P3RA 4EMZA 4EIBA 1QSFD 2MEJB 3AG4B 1FNEA 3P54A 4KKQA 4MS6A 5AAWC 1E6OH 1NCGA 4FHJA 1OSPL 4PCTA 4DP4X 4ZNEA 3L45A 2BNRB 1ZD6A 3S6CA 2BVYA 3UAFA 4M5YH 1MHCB 4BFFA 1ZE3C 1T0MB 2YD1A 2FB4H 3Q1SH 4AM0A 4GI8A 1IEHA 3I50L 4WO4D 4LSSH 2QPDB 1U4FA 3U82B 3FT3B 2IFFL 3QDMD 1ORSB 3UZVA 3BQUA 1RXLA 2DIAA 5AW4B 3VXTB 3WXWH 3PWPB 1RIHL 4NO0B 4XN4A 3PJNA 4J3UA 5EOQH 4X6DB 5JIIA 4KXZI 1S3KL 5DEGB 1RPUA 5INDA 1Q9LB 4V1DD 4OJFH 4ACPA 1KCSL 5ID1A 4G83A 2DQFA 4H13C 3OF6A 4KUZH 2FEEL 1FZMB 1YEFH 1SGKA 1QR1A 4JDTL 1X6NA 3NACH 3AG1B 4K07A 2GEQA 1FORH 2FX9H 3PJSB 3RX9A 3LZFL 1R3JA 2PWGA 3B34A 5EF2A 4JUSA 4OV5B 2W92A 3DVNA 3B9KC 2D31A 1XIWB 3MXWH 1HU8A 4MRBA 1U8CA 4NM8L 4KZCA 2WYIA 1KTLA 5KN5B 4BCYA 4PCKA 1WF5A 3B7YA 5EC1B 5JPMC 4OT1L 2OCJA 1C5BH 2WXOA 4FKKA 2PYFA 4RRPM 3KS0J 5GS3A 2P5EE 2MNJB 4QXUH 1HESA 5KVGL 1ZIBA 3BOVA 4CSTA 3A4EA 4LL9A 1JIBA 4PRID 4D9QE 2EH8H 4QKXB 4TRPH 4DKFL 1NWPA 3QQDA 1BGXL 2GJ6E 5FYJH 3SSGA 5GS1A 1VADB 4J2XA 4GQ9H 2FNBA 4KJYA 4LPYA 2UY7B 4S2SA 3DYMA 2CDGB 3UJTL 4LPWA 2WXPA 4XRCB 1T1WB 1ETA1 3MGTB 4PIRF 5T1KA 1KCWA 1RZIA 4MDRA 2ZT9C 3RJOA 4KUCF 3IDXH 4IGBD 5I1GH 1NC4D 3CFJB 3GZOA 3RHWF 3IVKB 4ODHL 5DT1L 4UM8A 4R2GD 3P69A 3M17B 1Q0XH 5DZLA 5KJRH 3QDAA 4ZZKA 3HRZC 2G5UA 4Y9CA 5FR3A 4XMPL 4BM7A 1OGAA 3MFFB 1NJ9A 5HHOD 4NO2A 4XCEB 1A6UH 4IMKA 3X1NA 2PP7A 4JRYE 1BM3H 1ML0A 3G08B 5E8OB 2GJ6A 4ZPTA 1MSPA 3HC3H 5FYJD 6TAAA 3MRNB 1NCJA 3V9CA 5KWYC 1GGCH 2XZCH 3DPBB 1VPOL 3V4PB 4X98B 5C9KA 5HDRA 5CZVH 3BIAX 3BZ4B 2IALA 1AHKA 1HAUA 1NAMH 1F2QA 2F18A 3MRRB 3OX8A 2VDNH 2TRYA 1MCBA 2WLHA 1I1FA 1N64H 3ISYA 1HH6A 2IPKA 1TSHA 3GGWB 5AW9B 3H0TB 5J3HC 3SDAD 4BRJA 3MRIB 4ZMVA 4BFGA 4ZRGA 1TMQA 3L4UA 5KANG 1ZEAL 5TDPB 2CJTA 4DP5X 5B4MC 2IQAA 1FUNA 1IM9A 2AQSA 5I0XA 3MOBH 1J5DA 1IIKA 2JKTM 3WTWA 3PV6B 1WEJL 1R0AL 3HUJE 4NIYE 4C55A 3G6JA 2KZWA 3FO2B 1P4BH 3H7BA 1ZVSA 5D7JB 4JVWA 4MX7B 3GBML 4HEPG 1I7TA 2Y5TA 4OB5H 3SY0A 4ZQKA 3L3JB 1D9KA 2AJSH 3V4VA 5A6LA 4MRCA 2W0KA 4KO6A 5L4JA 4GAGH 5CINH 1EHAA 3SQOH 1FIGH 5ISZD 4JAMA 5ICXB 2KERA 1QI3A 1F6AA 4FXLA 1YNLH 3EH2A 4Q9CA 2FHCA 4OF7A 1KPUA 3DMMB 3VI4E 3U4KA 1FL6A 3IETA 5LKNA 3GMRB 3WHE1 2APFA 1C5DA 3X14A 5CUSH 4ZFOB 1T1XA 4HP5A 2Z9TA 4PCSA 4DGYL 4F80A 1CFSA 3RU8L 2CDEB 1A7NH 1MLCA 2Q7YA 1ED3B 3B9DA 4W68A 3TBCA 2YPLA 4PJ8A 4AVIA 3NUKA 5H37G 1U8HA 3RYMA 3JYCA 5A2AA 1PBYA 2E6QA 5MERB 4YHPB 4FJYA 2V33A 2A77L 4HIXL 3SOBH 1RMFH 3DRTB 1PG7H 1NGQL 2QKSA 5F70A 2CALA 3CC1A 1ACCA 1U4EA 1SF3A 2ICEA 4CSPA 1II4E 3I6LD 4ZSOE 5IBLC 5IQLA 1JXDA 1UXWB 3MBWA 3ZYJA 1JTPA 5I0DA 1KFGA 3HNVL 4NKIL 1K9TA 4JBSA 5CJOH 1VCBC 5I17B 1YVLA 4Q0XH 4R7VA 4FABH 3MKKA 1P1ZB 3CZLA 3IJ8A 5LAPA 4HT1L 3A4AA 3WJMA 4CN4A 1CYXA 5EU5B 4TLUA 2QSVA 1PCXA 3NCXA 4XE0A 1X4ZA 2CO7A 4GKLA 2JJTA 3QWOA 4G42A 1A3RL 1ONQA 4G5ZH 4QXWA 2VN5A 3TO2A 3ZDXB 1HQ4B 2XV3A 4NUJB 4XNYL 5CJXA 1F1GA 2O5ZH 4LCUB 4YIQA 5DK2B 4JGJA 3S3BB 2IVFC 1M1SA 2CAKA 2CJ3A 2HFEA 3IJ9A 1UH3A 2DBLL 2V8LA 4ZSOA 1ZE3H 3KVQA 4YK4C 4XCCL 2EEFA 3FU7B 1QG3A 1MRFH 2GBAA 2WQUA 1RZKL 5JHLH 3TT1L 3W0WB 1JZ4A 2B9BA 1UEYA 1QKZH 3H2PA 4NWUH 2K3HA 2Q86A 3MV8B 5JO5B 4YFDB 35C8L 1J1XL 3R0MA 2QT6A 1ZANH 3T1FB 2AV1B 2NDFA 3R1GH 2EYSA 2R2EA 2W07A 4G8IA 3VE0B 5J9PB 5JHAA 2BY0A 2OP4H 4JG1L 4AIEA 1Q0EA 3TBSA 2UV3A 2MMXA 2LU7A 3SE6A 5C1MB 5E4OA 3S9DB 1BMZA 2IBBA 2YQGA 3QUKB 3VM5A 3CHQA 1OAZL 1MCNA 3BZFB 1O9ZA 3DA0A 4N5UA 3INUH 4NNYB 2XWXA 1I3RA 2R8SL 4B5EA 5GJTH 1WAAF 3CMGA 3GO1L 4B9JA 1NCCL 1K8DA 3GYRA 2FQEA 1CTMA 2X4OB 3QJQB 4HK3N 2NY4B 4X99B 4B7LA 5IR1A 1A9VA 5L9DH 2C4XA 4FQ1L 5D6DA 2FWOA 1HKFA 4X7SH 3O6KH 2VDRH 1EXGA 4NHUA 4P3WA 4RGNE 4KROB 5J1SC 3L8QA 2A9NH 2CR3A 2X4UA 2H6OA 2Q20A 4FEIA 3QNYB 3K81A 4JO3L 5GPRA 1TFHA 1NFDA 1PPIA 1IGFH 4F15C 2ZOKB 2I7SA 2YAOA 2F68X 1KGCD 4B3VA 3K2KA 4FN0A 1U8IB 4XNMA 1IQWL 4L3ED 2D3JA 2CKNA 4OF6A 4YGAB 2JXMA 2VJ0A 1QFUL 4ORZC 3RHWK 4WI5A 1IEBA 1JBJA 1O6SA 2F7OA 1A6PA 2Z4QA 3VTTA 2YXMA 4ENEC 4JEGB 2ZF8A 2O1AA 4EI6B 4M7ZB 4XMUA 3MC0A 3H4FA 3DO7B 1NDMB 4OZFB 2LU4A 4KO9A 5L0QC 1S46A 3ARZA 3HRPA 2HJLB 2K4AA 3B9KD 3ECUA 1HCFX 4DAGL 2GIXA 2AVGA 4G6KL 5L4IA 1DUZA 5TFSH 1QW9A 3U83A 4G8EA 2BINA 4IRSC 3T6XA 3D50A 2DMKA 3FTZA 2DWTA 5DYOB 4X5WA 3FAXA 4NJAH 1UA7A 4UTBL 4NHCL 1PLAA 1YMHB 4UQ2A 5DR5L 5LCVL 2XX0A 1XXDC 2RALA 2OULB 2AGJH 4DP6X 1JZFA 3L3OB 4Y16A 3HC4H 3PQYB 4J3OG 1BG1A 1SOSA 1KENH 3GMPB 5C08E 4Y5VC 3NIFF 2L7UA 2YMTA 1E5ZA 1BFVH 2BP0A 3V9EA 3DUHA 3VXOB 5AB0A 4H44C 2EH7H 4JFDD 3QXDB 2KZBA 4RFEA 5C92A 4KQ0A 3LRGA 1SBSL 1MOEA 4Q2ZA 1L7IL 2VLME 4BBWA 4ANUA 43C9A 1GPOH 2VDPB 1RURL 3ARVA 3QBTB 3QI9B 3E9TA 4XVOA 1C7TA 1FNLA 4R83A 1OAUL 4NI3A 2QKIA 4MLSA 3DGDA 1A7PH 2L0DA 4YAQB 3NPSB 3Q2LA 4Y8AA 3NA9H 4H1LH 4UQ3B 3FQTB 1YYCA 2HVJB 2X1XR 2YMXH 3GLZA 1TJGL 3QIUC 1ZHLB 3FOLA 5LQBL 2LQRA 5K59F 3MREB 1OCZB 2YD2A 5J3HD 4TPRH 3D30A 1QW8A 4GW1A 4I3SH 3K72B 2A1WL 4BSWB 5I8EB 3HAEA 2X05A 2JSFA 3UABA 1HCZA 1W0VA 2GTWA 4KVPA 5B4MD 4HJJH 3CIQA 3VRJB 1W8EA 1MIEH 2Y2WA 3N9GH 4FNQA 3QCVH 1QSEE 4YDVB 3PDDA 4NC2B 2GG1A 3AVEA 1SMAA 3OKMB 5DJCA 1F58L 1YA5A 2ATKB 3IF1A 5HJ3B 1EHLH 1RFDL 1QHQA 4P05A 5JUEL 4G8AC 4IOIA 4KVCL 4TQEL 1DQDL 3FUEA 1SLUA 4DOHE 1WSST 4U4IA 1JZ5A 2NQDA 3DVFA 3OKOB 4AEFA 4HLJA 2JB6A 1DQLL 5KJ4A 2FO4B 3WTUA 3LIZL 3H3PH 3U0TA 2OL3A 2A6JB 3A67H 2VXUH 4K3DH 3U46A 1WH0A 1OTTC 1CGVA 2EIKB 1JHKH 2GJJA 4EN3A 5L2KA 3VFWA 1IGIH 1HQRB 5B1KA 4XO5A 2WSDA 3SDYH 1DBKL 4HJUA 5F0JB 5FLUA 3VFMA 4EUPH 5LUMA 4QDGA 5C2BL 1WP6A 1L3WA 1ES0B 3T04D 3GJFH 5IG7A 4GS7B 1YEHH 3DDGA 4JFHD 4R7DB 3PP4H 1E28B 4NKQB 1S7UB 4A04A 3CCHB 2C9WA 4IDLA 3C5JA 3PGDB 3MU3A 2EQDA 1J8KA 1C7SA 5MI0C 3DX7B 4FP8H 1DBML 5SWSE 2DV6A 1NLDL 2AJVH 2W65B 4N0YH 4X6CE 3CN4A 1E30A 1ADQH 3FQXB 1J9QA 3EIFA 4AYID 1AXSB 2ZKWA 1DUYB 1AY1H 5E9DB 1GC1C 4WY7H 5IBLD 4YSOA 3V0GA 3ROOA 4Y7OC 2AANA 4WWPA 3DGGA 3O6ML 4YNYA 1EAPB 2LE9A 1TZOA 1VFOA 2FJHA 3QHFL 1S7XB 3MBEA 4K8RC 4K4KA 3WYRA 2H1LM 3K0WA 2E86A 1YRKA 4UIMB 3QIWB 4GI9A 4I2XE 1PKQB 5L6YH 4KHXL 3T2LA 2Z64C 1CFTB 4AEIH 2HRPL 4HEMA 3FU8A 2R29A 2DLFH 3IMTA 3O9WB 1RSYA 1BBJA 4HA1A 4YX2L 4DGIH 3U4EA 5HHNB 3X1FA 5KVEE 1AGCB 1RIVL 3GS0A 3QCTH 2WGXA 2DAVA 5SWSA 2W0FA 3HE7B 1OK0A 2ED9A 3D4GA 3F2LA 1PJ9A 2OMUB 4I85A 5JLZA 1BVOA 1INDL 3CVIL 3P0YL 1ECYA 4XP6L 1JZ3A 3V8OA 1JOIA 1TZHB 3LKQA 2XBTA 3QCUH 1KEGH 5K39A 1CFNB 1JDCA 3QQ9C 3TIDA 4MCZA 5HI3C 4GAJL 3ZHNA 3L3IB 4C57C 4E5XB 4I2XA 3F58H 1BX2B 1FNFA 5D7KE 2RB8A 1S5IH 4L8SA 4P06A 2Z7ZA 1K4CB 2F54B 2YK1H 1MVUB 1IZJA 1UKSA 2I9LB 3LZNA 4O02B 4PJEE 3VXRA 1OVZA 2W9EL 4X6BB 2BXYA 1F4XL 4U3SB 3OVUB 4UQ9A 2X42A 1YDPA 5GRXG 2A4EA 1JZGA 1GYAA 1EBPA 1CFMA 3QRBA 4WCYH 3VXME 2X4NA 3V0VB 1ZA3A 1Z9MA 1WWCA 3ARRA 4NUGH 3QUZA 3HCVB 5EBWA 3RVUC 4ONGL 4A2EA 4DQAA 4X8XA 2AJ3B 1A8JH 3QDJE 3IDNB 5I30H 3PAYA 4JPIA 1KBKA 3MV01 4IIQB 4L2LA 3E6HA 4R7LA 4AMXA 1HILB 2NSMA 2QV4A 3B2UD 1CFQB 1VACA 1KC5L 4KTDH 1WAAE 4WUKH 1QNZL 1SJMA 5BVJA 5FM5M 1ZTXL 5F9WB 1R5WA 4FFVC 1WTLA 3I6GA 4NQEA 4Z78A 1CMOA 3SJVD 1XCQA 2CA3A 2CK2A 3IE9A 1OWWA 2D7PA 2GEEA 4WAFA 4MMXB 4P2QA 2YFNA 4W9EC 3OXRA 4RSYA 4E9QA 4A38A 1BIIB 1GSKA 3VMPA 2ZOUA 3VXMA 1M7UA 3KYMB 3PHSA 5H35A 4JVPA 2YPVA 1UQSA 2V9UA 2DQHL 4O00A 3W39B 1NEPA 4HK3J 1FG2A 4P3DA 3NCYP 1J9SA 2J25A 4WWKC 4S1RH 3JYBA 4CW1A 3CUPA 3FB7A 4IU3B 1HYRC 5EDSA 4LSPH 2J6EL 3F7RA 3QZWG 1WAAA 4IRSD 4CNIA 1RD6A 1R9FA 3SDDB 3JV0A 1NOLA 3O8XB 4MMYA 5B39G 4UV4L 1WA0X 5MEPB 4LSUL 3ESPA 2CO2A 5DMIH 3ZUCA 5DHVH 3M1BA 1FYTA 2UXGA 2VQ4A 1ACXA 3ARFC 1HH9A 4TS6A 2OM5A 4LDOB 1CXFA 2DWEA 8FABA 1BZ7B 4WRLA 3MRBB 2F08A 1QSFE 4ZW6A 1A7QL 5B1JA 4KXBA 1FNEB 2FNWA 3D87B 3WKQA 5K9JH 3FTGA 3ULVH 3H9SA 2X1PA 1BVLA 4XP5L 3RIFK 4LCWA 4AK2A 3ARGB 2NYYC 4JHUA 1XGQB 3Q5YA 4M7LT 4HIEA 4YSEA 2WANA 2WXMA 3QT2A 4JGNA 5AYQA 5A2LH 1TQWA 4LPVA 4AM0B 3V2AR 3O45A 5D2LF 5TE4L 3QDME 1NINA 2FX7H 5J6HB 3UZVB 3VGAB 3DO3A 3BQUB 2PP8A 1U3NA 3D0LB 4JZOB 5D7EA 4A66A 4G6JH 3X17A 4Y4HC 2YAQA 4MNQD 4NQDD 5CIPA 2XQBH 1FE8H 1P6AB 2WWNA 4V1DE 3VWKC 2YSTA 3LNFA 5INDB 4ABQA 2Q9OA 1E4JA 4NC1E 1WCQA 1X5XA 3WFEL 4ZW8A 5KBLA 5ID1B 1M2OA 2WWMC 3FS9A 2NY5H 1FH5H 3Q3GB 1QR1B 3ZUNC 4JM2A 4RAUA 1YEIH 1CLZH 4UQIM 1H8OA 1WITA 4OLUL 1ZCRA 3N85L 4WO4A 2Y69B 4LDEB 2C1OA 1R3JB 2QGCA 2OMYA 4Y1AB 3QDMA 4YXHH 5JW3H 1OCWH 1KN4L 1VA9A 3DVNB 2D31B 4KJPC 4L9LC 3IAQA 3AADB 1U8CB 4LKXA 25C8H 2VABB 3VG9B 3X11A 4JFTA 4YPGA 4ZX3A 4MTMA 2ZOOA 5DVKA 2IOIA 5K59E 3BWUF 4P59L 2VH5L 3DTUB 2LOEA 2PYFB 3M07A 2APVA 3BP5A 4J3XA 4E42A 3HMXH 1MXGA 2X53A 3EJZC 5F7MC 4PRIE 1ZSHA 1HSBB 5KVDH 4XVJH 1EFXD 2A6IA 1J0KA 1BVZA 4WK2B 6PAZA 2GUOB 3R19A 2WKLA 3CLEL 3QQDB 3OQRA 4R7XA 5GS1B 1EGJA 1U8OA 4KJYB 1A7RH 4UTAL 4S2SB 1HZKA 3DVGA 1QFHA 1EDHA 2ED6A 1KEML 4LCYA 1RZIB 3P30H 5HDQL 5DQ9A 4LNVA 1O5PA 1X9UA 4Z7NE 1GC1H 4L8CA 1J48A 1OTTD 3I75A 4UM8B 1AJ7L 1NMCC 4LLYB 1FFOA 4L0ZA 1GGBL 1JV2A 1SFDA 5HHOE 3PV7A 2CCVA 1OGAB 4UB0L 1NJ9B 3HN8A 4NO2B 2ZXWB 1VZHA 1XD0A 3IMWA 1D5MA 3LNDA 5FYJE 4OF0A 4D0CA 5IB5A 3IGKA 1BZQK 2AF2A 4ZPTB 3UP1A 3EGSA 1WZAA 2W81C 3N1QC 1QATA 3KPNA 1MUJA 1AS6A 2DN7A 3WXVH 1AYOA 4S1DC 5DFTA 5B3JE 2IALB 3OZLA 2YIHA 3D2UB 3OX8B 4NN7C 1KJ2H 4LGPB 3GK8H 3RZCA 4RFOL 5EN2A 4BQ9A 1JGVH 1I1FB 3Q7JA 4K5LA 5BOZG 1OGPA 4M4PA 3Q5TA 3S88L 2WOBA 1Q72H 1I75A 5J11B 3IAGC 3MCKA 5DUPH 2WKOF 3RUGF 4K8RD 5FA4B 2HWZL 3AY4A 5EEWA 5DMKA 4KX8A 1IM9B 1AZCA 3K4AA 1TTGA 4C56D 2PXYC 2D4DA 1KBVA 2GT9B 1PZCA 1UZ8A 3UROR 4GINA 4JQIH 3POCA 4QJ4B 3G6JB 1UKTA 2VLRA 3MRLA 3P77A 3S4SA 2VDMH 4QEGA 3N43F 1CDCA 3NESA 3DJTA 5I1JH 1KMGA 4WHYH 3SYQA 2WMPA 4KVNL 1I7TB 3UX9B 3BI9X 2GI7A 3O3AA 3WDHA 1O9VA 3SY0B 4ZQKB 1D9KB 2EDKA 3V4VB 1WUNT 5EOTA 2DWDA 5ISZE 1LO3L 2I5YL 4DQOH 3WS6C 2YBRA 2R9HC 4GYBA 4OJCA 4LAQL 5JW4M 4P4RA 1GW6A 5H37A 4JAMB 1TZGL 4ZAKB 1NFIA 4NXSA 1SY6L 4TNEA 5T1LA 4AIOA 5IQ9A 3VRIA 2R69H 4LP5A 5HI3D 3NYKA 5BO1H 1FL6B 3IETB 1BZ9B 2DW5A 1C5DB 2K8MA 3JVGC 1KB9K 3X14B 4UI2A 4XCYA 1T1XB 3DIVA 3VUAA 4FXKC 1CFSB 5AAMA 4TNVK 4FXGA 3HIZA 1MLCB 3C6EA 4HSCX 1EJOH 1CGUA 2VXSH 3TP4A 2YPLB 4QRRA 1IGTA 4PJ8B 5T33L 1PL3A 2CJUL 1JUFA 1U8HB 2G2RA 3LPOA 1F13A 1A1MA 1UWEL 3KHQA 4HU8A 2GC4C 4M43H 5DFVD 5ISZA 4EJ1C 3RVUD 4PLOB 4GO9A 1FO0L 3I6LE 4OZIA 5DUML 1NGXA 1T2QL 2ICEB 1SXNA 2FLBT 1TQTA 4PVMA 2QZQA 4WZ9A 2WQVA 3MBWB 2CPUA 2ZYHA 4LB8A 1MI5D 3FQ4A 5FHAH 2WO3B 4JO8A 4IIZA 2AJZA 3MV9D 1BVNT 4FFVD 4GW5A 4NQCA 1NBZA 4CN6A 2B0SL 3QWRA 2CO7B 2IJ0C 1SM3L 4JY6A 3AGVA 2H41A 3S5LG 3QWOB 1MREH 1ONQB 3TO2B 2BNQD 3TO4A 2H2PC 4S1QH 4BK5C 2DQDL 2Z8VC 3MGAA 3IFOA 5FGBC 5I8CB 1AANA 3T0EC 1F56A 3T6VA 4YIQB 1EZVX 2Y36L 2EVGA 2J88H 2V17L 2A6DA 1JXKA 2VQTA 2QMKA 3DUSA 2VL4A 3JVFC 2HFEB 1WZ1L 4NP4H 4L9DA 5HYSG 3U7YH 1E43A 4WWKD 4Q9QH 2GIYA 3ZMNA 4CC4C 2LGNA 4KY1L 3QULB 1J5HA 5FGSA 4QNPF 2Q86B 4DZBA 1R75A 5E8NB 2ADJB 4LL1A 3SDXF 2FT7A 3A4DA 3FHQA 3NCJH 4JMXA 1RHHA 1JRHL 3TYFA 1B0WA 1RH8A 3ARFD 2B20A 2W07B 2R2EB 1W72A 2EYSB 1PY9A 2VITB 4FFWC 4G8IB 3US9A 1JE6A 2CCLA 3ZZLA 5EWIH 1A4JA 1GYVA 3TBSB 1UD3A 5J8OA 4AE0A 5JIQA 1NUGA 3DSNA 4M9OA 2AXHA 4XPGL 1YYML 4GQQA 5DZJA 4N85A 1AOHA 2NYYD 4PJCA 5AB9A 5ID0A 4IHOA 4MCYB 1WT5A 4PRPA 1A9BA 4UQCA 4PRHB 2DDQL 5K1JA 3FT0A 4BCZA 5KYNA 4AQ8A 4PJ7E 3WU1A 4F8LA 1K8DB 2MH4A 2ZUWA 3GRWH 3ZHKA 3FFDA 3DHMA 2VAJA 5IR1B 2L8AA 1ET5A 1WICA 2N01B 4YSAA 2FWOB 5T5FA 2CHWA 1LDPL 3ALXA 1HL8A 3C2AL 1IAIL 1G7QA 3O2DA 5DD1L 4YDIH 4MB3A 3OLEA 1A4KA 1QBBA 3UZQA 3WFHB 3MA9H 4XZ4A 4Y4HD 3CVHL 1QRNA 3LS4H 3O6FC 2C9QA 1A9EA 3OJMB 3VWKD 5T1JA 4QLRA 1YMMD 1KGCE 1NFDB 1LNUA 2IIJA 2YXWA 3WSQH 1EA9C 1XEDA 4L3EE 4PMFA 1FHGA 2QVFB 4HXAL 4XNMB 1H9DA 3GXIA 2JXMB 2WWMD 3HHSA 1JGUH 4MAUH 2JK5A 1TO4A 1QHOA 5DO2C 1IE4A 3SQBA 1UD2A 3FK3A 4M8QB 2BW4A 4BE5A 3QJHA 2E27L 3P4LA 1MAML 4H2CA 5F1IA 2FWUA 3TM6A 2CGYA 3VI3F 5D5MF 4PVNA 4PJ9B 4KJPD 2ATPA 4G8FA 4RDQG 1O7VA 1T2XA 1UM5L 2XI9A 1DUZB 4OQTA 3G6AA 1MJ7L 1EAQA 4QRQA 3O6LH 4X5WB 5CGYC 5D2LA 4CJ0A 4ANVA 2AV7A 2IH3A 3QE5A 1RZFL 3EJZD 4ANXA 3NJFA 4UQ2B 1DQJA 5IHUH 1BCIA 5TQ0H 3B7RL 3M1OA 4TNWF 1JG9A 5B22A 2AJUL 3ENEA 2R23A 4NBZB 1TEYA 1USQA 3SE4C 2J20A 2ZG1A 4EKJA 2VGLM 4L29A 3R8QA 3IMVA 3K6FA 3ELAT 3V52H 5J13B 2BP0B 4JFDE 1A3LL 4H88H 2ORBL 5JHMA 1TKWA 4JM4L 3HFFA 4YO0B 1A6WL 1V3MA 2BW5A 5EUKB 4OCWH 1XSKA 2ADYA 4F7CA 4WU5A 4P5RA 2UX6A 4Q2ZB 4U1JA 1PQZA 2JF1A 1CD1A 43C9B 3OAWA 1QWNA 3V0WH 1UD8A 1P69B 4NRXA 3L08A 4U0QB 3OC8A 3QDGA 4YDKL 5EG6C 3ZYZA 1RK0A 2P5WA 4LSQH 3RWDA 2QKIB 4DFIA 1E0OB 1Z9OA 4QOKA 2FT8A 3KL3A 5DRXA 1KIPA 1AGEB 2Y9RT 4S1DD 1YC8A 1ROCA 1L0YA 4HKXA 4NP9A 5I1AA 3ZO0A 4YMPA 5CN1A 4PMEA 1WD8A 1QZNA 2FEJA 3FOLB 1TEGA 3UYOD 4P99A 2BVQB 1MCLA 2DWYA 3F5WA 2BFVH 1WIOA 4GW1B 1KJMA 2EDTA 4MXVF 1H3XA 4OIIL 5DZVA 3AJ7A 3HAEB 3HRZA 4FCHA 4XMWA 3WN6A 1W0VB 2DLTA 2GTWB 4IRZA 1WG3A 4EDXB 1AZVA 4NRYA 3CZJA 4RISL 2PXYD 3ASNB 3DTXB 3SCMB 4FQPA 4MD5A 3ZN6A 2XWZA 1BVNP 2VDOB 3RNQA 4AQ1C 2CRIA 3IF1B 2Q2LA 1UATA 2BNUA 4KBPA 3D3VB 4M7JL 4CUCA 1F3RB 1G6RA 4G6FD 5GGSY 3T3PB 4G9FA 5GZOA 1LM8V 5I71C 3PAUA 4YWGL 4AQEB 1CIDA 5LDUA 3HG1D 4KDWA 1G7LA 1MQKL 4D9LH 3BT0A 5DLMH 1CBVL 3M45A 1PG7W 1F11A 1BAFL 4ZMQA 2JB6B 2R9HD 4JR9L 2NZ9C 2O5YL 3FN3A 2ZKYA 2B7DT 2FX8L 4HIHA 1A66A 3RDTA 4HUMB 3U0TB 2OL3B 4NWTL 4TVPL 3MZTA 5E7BA 4ALAH 4PGDA 7FABH 2Z7WA 5L2KB 3VFWB 2YXVA 4NENA 4PHXA 5KW9L 3VFMB 3RFZA 4P04A 2KH2B 4J6RL 1MFDH 3OPUA 3GS7A 3MUY1 4FQJH 2VC2H 2WKOA 3GMLB 5IG7B 3RUGA 3MHZA 1IBGH 4JFHE 4AQZA 2IDSA 2ICWI 1MQ8A 3ESVF 4RBPK 2AK4D 3GSUB 4IKNA 3C5JB 1EJFA 4XPFH 3NFPA 3FHEA 5EN3A 4M29A 4OZGF 2DQCH 3GMOB 4OCRH 3T08A 4GUPA 1PEZA 4W81A 5MP6H 3Q9PA 4MJID 1M05A 2L7QA 1VFMA 2K1MA 3LEVH 1G0DA 3ROOB 1NL0H 5J6GA 3DGGB 2FJHB 5T3XL 4S0HA 3MBEB 1BZEA 1LVEA 12E8H 3AROA 1ZDQA 4ZFFA 1AC6A 2X4QA 1AZUA 5LXVA 1EK3A 1PDKA 4Z3EA 4Z7VF 3DUUA 4C8XA 1JF6A 5LGHH 4A7VA 2P9RA 3BAJA 4NIKB 4PG9A 4Z7WE 1PD1A 4YHLL 5K5YA 1SF5A 1JF1B 1E42A 5FW6A 1BBJB 2H2PD 5I6XC 2E75C 4XVUC 3P1VA 5AW6B 3U4EB 4WHDA 4MSWA 3T0ED 1T20A 2W0FB 5HYJA 5IROA 2I9TA 3HI5L 2VXQA 3K8KA 2E6JA 2H2SC 3H2WA 4F91B 3VNYA 1NEZB 3JXAA 4YFEA 4JFFD 3SDCB 5DTFA 1KLGA 5IUCA 3I3BA 1FNAA 2VYRE 4P46C 2DZEA 4M3JA 2XN9B 3LKQB 3VXUD 4IJTA 2WB1A 1CLVA 2MQCA 4M6ML 4BSJA 5K39B 3EKCA 3V7AG 3D06A 1AQ8A 3U36A 2YD3A 4U2YA 3TIDB 4MCZB 4NZJA 5CZXC 4OFKA 4P5TC 2VIRB 2XJLA 4FFWD 1N5AA 2X10A 4L8SB 3VYPA 5DURB 5BS0D 3AWGA 2VT0A 4KQ4H 4X9FA 3U30B 1ICTA 1BZOA 2ZXQA 3MRDA 1MY7A 2IMMA 3ARWA 3HI6H 3VXRB 2QQLH 3X3FL 3LNHA 3QPQC 4U1GB 4YDMA 1YDPB 1P4IL 3VGBA 1T89A 1IGMH 2BIQA 4R4BB 5GS0C 1ZA3B 2AABH 3MBXL 2QDWA 2DEXX 2OZNA 1JNNH 3AQYA 3HJ0A 3TTSA 2CHNA 3QUZB