4AWJC

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
135
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 135
sequence length 139
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4awjC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4awjC01
4W9GC 4W9FC 4W9CC 4WQOA 4AJYV 3ZRFC 4B95C 4BKSC 4W9JC 4W9HC 1LM8V 1LQBC 4AWJC 1VCBC 3ZRCC 4W9DC 4BKTC 4W9KC 4W9LC 3ZTDC 4B9KC 3ZTCC 5LLIC 4W9IC 4W9EC 3ZUNC
chains in the Genus database with same CATH superfamily
3U9PL 4E42B 2QKIC 1CL7L 2MNWA 1QQDB 3SPVB 5KUMA 5AAMA 3ILPB 2R7EA 3WNJA 3KL3A 2EJ1A 4ONGH 4EDXA 3VXUB 5DD3H 1QSFA 3OJDA 2YGPA 5B21A 3S98A 2A5UA 2GQHA 5I18L 1UM4L 2V9UA 4FABH 4FNPA 4LCWA 3Q1EA 5KG9A 3RZCA 3LRLA 5KSUB 1AHMA 3T6XA 1GMEA 3BSGA 3O3AB 4C4UA 2AV1A 4LARH 4PJ7F 1QFPA 3CXHK 3E6HB 3H55A 3T9WA 2WWKO 4YBQC 1BFSA 4LSVH 5F2FA 4JFYA 2BJMH 5DT1L 4ETYA 2Q6WB 1A02N 3MI6A 4ZTOH 4OZGF 4BSWA 3HVNA 4JO2H 4XNBA 1GY1A 3Q6FA 2CO6A 3ZL2A 5LWYL 2F7OA 3SDAA 3QIUC 4UANA 5B4MD 1T04A 3NIFB 5F9JA 2ESVE 5AKSA 2VZVA 2Y1YA 4FQCH 2BY3A 3IF1B 4KVNH 4PR5B 1QRNA 1MFBH 2WLYA 3KW8A 4P46C 3KYOB 4E9VA 5HYQA 4KO6A 4GAFB 4JCMA 1U3NA 1RZGB 4P2OD 4M1DL 4JO8A 1FCCA 3RTQB 3QRGL 3O11A 5FHBL 2P5WD 5I66A 1C08B 3D8MA 5CZKA 2Y5QA 3N50A 3CVHB 3T8XA 1E43A 1P6FA 4RZCA 1FORH 1MRDH 2WAQA 1PLCA 1QSEE 3TA4D 1AHWC 5I6OA 4MAYC 2HAZA 1MI5E 1BF2A 5E95B 5A7BA 3ZMNA 2JXMB 1EZSA 3MRMB 4HULB 2B5IB 4A7GF 4PH8A 5FUZL 1JF1B 3RGVC 4YK4B 4YEFA 5BJTB 3V95A 2ZXEB 4RSYA 1NA8A 3GBNH 5ITFB 3V5KA 3F85A 2G9HA 2DMHA 3U9UA 2NSQA 4KHTH 3WXVH 5MEPA 3VFUA 2C3VB 3PQYB 3QJHB 1INQA 2E9WA 1RZFL 3ARFA 1XB6A 3RIAF 4X8JB 3IK2A 1MCDA 5LUMA 4YX2H 1M2OA 1OAZH 4U1SA 5KEZA 5B22A 4DW2H 3PHQB 2O5ZL 3IJHB 4QT5B 5ESVB 3L17A 2Q7YA 3S48A 1V7ML 3TNNB 4H8HA 3FFCE 3VRJB 5F7FA 3UMTA 3VXTB 3NFNB 3MRIB 3L3KB 2AS5M 1EZUA 3AGVA 4KDWA 1R34A 4O02H 3DURB 4TUUA 3RWEA 4YHLH 3T6VA 3NCYP 2I5YH 5DK3A 4PREB 4RNRB 4QHUA 1DUYB 1CXIA 2TRYA 4NSKA 3FDWA 5SWSD 3PV6A 2Z31C 3G5YB 4M8UA 4JFEB 1IGML 4JKNA 4MMXB 4P4KD 4WI4A 4EMZA 2YGOA 1BQKA 2J73A 2Y5TB 5B1JC 4CVWA 4YHPA 1XGTA 2JI1A 2R1WA 3PUUA 2KC0A 4GXVH 5F9OH 2CXGA 3DSNB 3S37H 3H6AA 3O45A 2Y6SD 4Z18A 5T1KA 4OLVH 1ZS8A 5JIMA 3IU3A 2WINB 2QR0B 3H8NA 5DJZB 5DJ0A 3BWZA 3VI4B 3TT1L 2VWEE 4GJTB 2APBA 3D25A 4L9LB 2V5MA 1NCIA 4YDVA 4F15C 3HHSA 3D39E 2NX5D 1IIIA 3B9KD 5CZXC 3VXQB 2QHRL 4IHBA 4DF9A 5DI8B 3MLWL 3EHBD 5DQDH 1JGVL 2ZSWB 3HAEG 4FOMA 5G4MA 1RERA 5EU7C 3VFVB 1DQMH 3I84A 3T2QA 3OX8B 4FNSA 3P77B 5E9DB 4ODUB 1AGFA 1ZHNB 1FYHB 4J3OG 2AKRA 1NOFA 2F68X 3AZUA 5CFAA 4UYQA 3VB8A 3QS3A 5EBLB 4NC2B 4IU3B 4CVXA 3PHOB 3ZDXE 2BNQB 4J3OC 1XF3A 2FECI 5D5MF 1OCWH 1GKOA 3PGFH 2AQQA 3FB5A 5E8DH 2HX8A 5SWQA 1GPOL 3MQIA 1RUQL 3GSQB 4R7DB 2OZ4A 2L8AA 1L6ZA 2Q2LA 1W0WA 1QVOA 2FJFA 3PP4L 1TVHB 2XTJB 3RDJA 2WXHA 2ZWYA 3DX9A 2UUDH 1DLFH 1G9NL 4JPVH 4X4XA 1U92A 5DC0A 2BLFA 3FPYA 3W37A 3CHPA 2IQ9L 4M7JH 2EDRA 4R0LA 3MV7D 3BP4A 5TE6L 5CGBA 2XWEA 1FHNA 5EU6E 3UX9B 1I8MA 1CFBA 2B1AL 3DYPA 3I3BA 4GKZB 4M48L 4DKAA 1TYEB 4K94C 3DIVA 2F5BL 3KBFA 5DZAA 3ZKMD 2X41A 3VGEA 4C83A 1BJ8A 4Q9RH 5CHNB 3SOBL 5CJQL 5B1BB 1JGEB 1ADQH 3GF8A 4LPUA 1CGTA 3QO0A 1JWMB 4XN4A 2PW2B 1BDYA 1NH6A 1TJHL 5L2KE 4XXWA 2N3JA 2XRAH 2OMWA 3FJTA 1DL7H 1LNUB 2A73A 3CFEA 3N0PB 1A6TA 4CMHB 4EI5D 3ARZA 5EB9A 2AABL 2PN5A 4WWKC 4ZAKD 1FNAA 1NBCA 1R3IH 1YNLL 2J88H 2WNWA 3QDGE 4OGZA 1RMFL 3HN5A 5E4IA 3SY0B 2GIMA 4PVMA 4FG0A 4L4VB 1E9QA 3RX9A 5EORH 5AZUA 2VLJA 2QQQA 2FT7A 3FSVA 4S1DC 5JO5A 4OCXL 1HC1A 5KYUB 4LBEA 5L2JA 1H3WM 4GP4B 4Z3TA 4OCRH 1PZ5B 4H8WH 5MEOB 1TEGA 2VQUA 1BQSA 3BUIA 4NQEB 3ZPDA 1P2CA 4DCQA 3ARBD 4X5WA 1FFTB 2VMJA 4HT1L 5CLXA 2EDOA 3RWFB 3KWUA 2R2EA 2JELH 3KG5A 3F7RA 2B2XH 5JZ7D 2DQEH 2D7TL 4PGEA 3FCUB 4NWUH 1B9KA 1SOKA 3FOMA 4GRMA 4NZJA 4L1LA 1BSIA 3Q6GL 1F58L 2WO4A 2YSTA 4BFNA 1E8WA 1UVQB 1CE1H 2XA3A 3ES6A 1JK9A 4HIEA 5TDPA 3CX5J 4QY8B 4IIZA 3K8KA 3UBXI 1OTUD 4K0OA 1HZKA 3IDXH 1S2EA 4X9HA 5DLMH 4Z3EA 1YEIL 1MWAB 1WC7B 1CYXA 5I1DB 1T1WB 2BM3A 4FAAB 4JANA 3U6XS 1J05A 2X2YA 5BW7C 1KGYE 5DJXB 1KTBA 2CAKA 2CCWA 2YA2A 2ZP8A 5CEXB 4BBWA 4CILA 1HTYA 3APMA 3OWRA 4UOJA 4XP4L 4FZ8L 1O75A 3ARED 1SLUA 1XGRB 1P4BL 1N8ZA 4PJ9C 4F2ME 1IM3B 2EIDA 4PVLA 3MRNB 4KKBD 4PRPD 4F58L 1FWXA 4OT1H 5MEND 1IC4L 1MCPL 1HHHB 1FL6B 2DMGA 4UWQB 1F1DA 4NDMB 1A6AA 2NTFB 3ZZQA 5EMYA 2X6UA 4EIGB 1NAKH 3HCVB 3TA3D 3HNVH 4PY8J 2Z1KA 3EFFA 4FTVB 3EG9B 4ZFQA 1T7YA 5E03A 4FCHA 3T8VA 2XIBA 5EOTA 5CP7B 2A4EA 3L2MA 3GXTA 3K3QA 1WITA 5E6SB 2P28B 3VQMA 3APFA 4U31A 2AQ1A 2MJWA 3ZKJA 3VXMA 5DQ9B 4Y16A 4L1TA 3PCYA 1SLXA 4BH8B 2NXZD 3SE3C 5I8KH 2Y69B 4NRXB 2IF7A 4HCGA 3ML8A 4J6RH 2CJTA 2BERA 3GB7B 1CT8B 3FO9B 2N0KA 5J89A 3QFJE 1YYLL 3EJZD 4K9EH 4LLAA 5EUOA 2JIXA 4WO4B 3ROLB 3EJTA 5LXGH 1AKJD 4FX5A 1NAMH 1N19A 2E7HA 2XPZA 4F37K 1E6OL 2FCBA 3X11B 4WWNA 1ACCA 3JTSB 4J1UA 4N25A 1IMHC 2Z4TA 5GZNC 5PCYA 1WFIA 1EH9A 3F64A 2F8IA 3L4ZA 2HPTA 4YAQA 4N8CL 3LTVA 4BKLA 1CLOH 4TUOA 1UA7A 4GLRI 4IBLT 4NWTL 1MCIA 3GBDA 4PJBB 3VWKD 2ATKB 2ZF9A 3WFHB 8PAZA 3VWJD 1E6JH 3MLZH 2EVHA 3PU7A 4BV1A 1A9BB 1W80A 4JVPA 4ZNCD 3PG2A 2HT4C 5D4QA 2GI0A 3BWUF 4FQQB 8FABB 2C1OB 2R83A 2GJJA 1SOQA 4QCIB 4IMLB 4UT7L 5I6PA 3L08A 3T1WA 3F5WB 1MF2H 1KN4L 1T4WA 2CBQA 3KH3A 3MLYL 1JPST 5IIEA 1R3LB 2W95A 1IGTA 1KTLA 2QSCL 2P8LA 4G1MA 3HG1A 4QHNB 4H1LH 1Q0XL 4E0RA 1A0QH 3FB6B 4XCFL 2GCYA 4WU7A 3V8OA 4HDIA 4FN0A 1NBZB 5DMIH 1IL1B 3QI9B 1JRHH 1ZHLB 2I25N 4KKPA 4PD4J 2VR3A 4KMTL 2HXAA 3F6LA 2FD6H 5KN5A 4Y1AD 3BIKB 4NHCH 5T3ZD 2IWKA 4N0FB 5ID1B 3FCSA 4PB0L 5C0GA 1VRSA 1KULA 4HZ1A 2BSSB 1WBYB 4YFEA 2VN6A 1ZLEA 1DQTA 3CX2A 3ARFC 4L5FE 3D4ZA 3FFOA 3SCMD 2QPSA 2GIXA 1MFDH 1S9XA 2DQGL 2HT3C 3GSRB 1CDUA 3RPIA 4FA6A 2A0LC 4RDQG 1OM3L 5G55A 1UEYA 5FO9A 1RL1A 5JW5A 3LY6A 5E1HB 2IDSA 5D7JD 3WIFA 1IGCH 3VM5A 3MX0A 1MUJB 1G4RA 2O30A 2Y6TE 3QDJB 4UOQA 3HI5L 2G2RB 3VFGH 5E8OA 1P7QA 3AS2A 2WZ6A 5LB1A 1MDTA 1RI8A 3O6KL 1SY6A 4QXTA 4ECNA 2EADA 3O6LL 3UJJH 1UB6B 1KCSH 1F6AB 1ZAGA 4ISVA 4Q6IA 1UXWB 3POHA 1GGBL 4WHYG 4X4YA 1JZ2A 1JZ4A 5KSBF 2EIZB 4QRRE 5DC9B 1NINA 2XTSA 4HS6A 5IT2L 1XZ0B 2PR9A 3DRQB 1MG2C 3K2MC 3GNMH 3BDBA 1X9RA 1UD3A 2A6JB 4ZUWB 4M7KH 5HGAB 3LN4B 3ABGA 5CD5D 4N5UA 2HN7B 4HUWA 3KXFB 1F86A 5E1GA 4QPEA 4F93B 5ICZA 3BZ4B 4P5TB 2ENQA 4L37A 3D87B 2CO3A 3Q5YA 4R4BB 3FQXB 1HVXA 4GBXA 2E0PA 3E38A 3EYFA 4KXCA 3UROR 5IB5A 4GAYA 4GQ9H 3A6BL 4XMKL 1YLBB 3CQFA 3E80A 3BAXA 4DK6A 3CC1A 2CM6A 2XV0A 4IRJB 5TFSL 1BD2B 5F7EH 4P9ML 4NAMA 3WXWL 1UASA 2PR4H 3CX5K 3ZGIA 4HUXA 3UPRA 1LEGB 4M4RB 2NY1B 1TKWB 3PRZA 5IKCA 4HEMA 4KH9A 3WFCL 3US9A 3ECWA 1UQSA 2VUKA 5IMMA 1T7ZA 1CFTA 1SJMA 4PJ5D 1B2YA 3NP3A 3GMLB 3FH7A 3OXRB 3TH2T 4N0UA 3HUJA 1SEBA 2N1TE 2I7SA 2XWTB 5KYNA 1G1OA 5H2BA 4NERA 2HRGA 4E9QA 3H3PH 4FRWA 2WO2B 3QS2A 3F01A 4ABQA 3BZEA 1I3RB 2JJTA 3FF7A 3AXLA 4AX3A 3G5ZA 4ILDA 5ALCL 3TIEB 4MJHA 3IDIA 4G83A 1PAZA 2O6CA 5J6GA 5JHBA 3L9EA 4Q52A 1YO4A 2ICWJ 3L3JB 2BHUA 5BUPA 3N40F 3RILA 2VMDA 2P46B 1HZLA 3TESA 1L9TA 5E94B 3QULB 5TE7H 4UM8B 3ZSTA 1B4TA 1FZOB 3SQOH 4H26B 3E7JA 4ODBD 2A1WH 2ENSA 3AM8A 4MJ5B 2CK0L 2LU4A 2R0KL 2EDNA 3ARDA 3B2DC 2HMIC 1JF6A 4F8QA 4PBWD 3U4KA 1D5BA 1KCRH 1NJ9A 1S7QB 4XNMA 4FQ1H 1S7VB 4LE8A 1DBJL 5MP6H 4A6YL 3EOBA 3D85B 4LVOC 3IDJA 3THMH 2V17L 1NCDH 1E5BA 4JN1L 5IF0A 3GKWL 5IHBA 1SHWA 1JIBA 3F12A 4QRAA 5A2BA 2PYED 1SDDB 3MV8E 3S4SB 4P3DA 2FWOA 4XPFH 2GTZA 5C70A 2QLVB 3DUSA 1M6OB 1DEEA 3FOLA 1CG9B 1WUNT 2ADIA 2DIEA 2VZOA 4XRCB 5I0XA 4P4RA 4BQCA 3DC0A 2IFFL 4PS3A 3PP3H 2N59A 5DUJA 4HMCA 3MBWA 5GPRA 4EDWL 3TFBA 1NEUA 1V10A 2R4SL 3LKRA 4JLRB 5C0CA 3WTTA 3RX7A 1EO7A 1KV7A 2OYLA 4P59L 2O6FA 1EPFA 5I9QB 4KHXH 5C86A 4D94A 4ZFFB 2UUDK 5KBLA 3X14B 2VABB 2EE6A 4IDJL 3TVMC 1KC5L 2E74C 4HKJB 2O5YL 4HPOH 5B3NA 2ZXAA 4G42A 2YK1L 1HYRC 1U8JA 2CXKA 5I1KL 1IM9D 3QIBD 43CAB 3GS4A 1XH3B 3VD9A 2D4FA 3L1OL 4EAEA 2GITA 4NI3A 2JB6B 3PWJB 3EO1A 3FTVA 3C2SA 4JO5A 4PD4K 1ROCA 1IQWL 2YPLD 1KG0A 3HBQA 1LK3H 4OCYL 4K23L 2XWDA 4XNQA 1UJ3A 1ZLDA 3FSZA 4MNQE 3MGAA 3IKCA 2UZYB 1NFDA 1G94A 3Q05A 4PJHA 1QABA 1ULVA 2H7WA 1JPFA 4IGBC 4DTGL 1NCBH 2GJ6B 2JMRA 4QXGH 4KVCH 1OPGL 1QSZA 3DBXB 1DLHB 3MUHL 2OP4L 4WW2F 4AI7A 4M5ZH 3MPCA 1NMCC 5CEYA 4JFFD 3T2NL 4CC4C 3S88H 4AJVA 1BEYL 1UH3A 2VC2H 2AERT 4G5ZH 1O6SA 4PRDA 3QQ3B 1BXAA 2FJGA 5FKAB 4M3JA 2APSA 2YD0A 4AYSA 2C9SA 2WBJA 2J1WA 2H32H 1JTTA 5LVEA 1DQJB 4P9HL 3NABH 5H4YA 2BIOA 1YQ2A 2GAZB 3WTXA 4KAQL 2RJMA 2R2CA 4Y16C 4LU5H 3NDYE 3OKKA 5J4MA 3BQUA 1VFMA 3AJ7A 4PWFA 4UM9D 3B9VA 2DQJL 3ZOAA 1P7KA 1HL4A 4ZBJA 4K5MA 3STZB 4I0PD 3CHQA 5EU7E 4PV1C 1GOHA 1I7TA 3ARGA 3ZKXC 4OF8A 3JWDH 2F18A 2FHFA 1XGZA 3VSTA 3MRBB 4PJ8B 4CW1B 3NBNA 3AUWB 2PWHA 2W60A 3OBAA 3F7YB 4YXHL 3EZ8A 1GHFH 2WVVA 1PX8A 4I3RL 5T5NG 4Y8AA 1GMIA 3O6ML 2AMUA 2UWEE 1RUPH 5D55A 2GB2A 1JNNL 4CGTA 3BYYA 1H9VA 3MCKB 3KDMB 3PAUA 4J6IA 1X5XA 4Y1TA 5ES4B 2QEJA 3HI6L 1BF8A 1VACB 3HI1A 1Q1JL 1NDGB 4XB3A 3D34A 4PTTB 4XNDA 4L29B 3TIDA 3MJ9L 1YG9A 1FIGL 2E5EA 2DM7A 4ODHH 4XWGL 4YXLH 2QJDA 4JFVA 3WNOA 4E68A 4WEBL 4ZW5A 4JPKL 3RNQB 5DQJB 5A6MA 2VDQH 4IEFB 2ALAA 5GQBA 4QIRA 1FN4A 5JPMA 4HV8A 4OLZL 5HHMB 1P4IL 5I1AB 4WNSA 3TO4B 1B3JA 2WXFA 4RRPG 1FNGB 5T8IA 4X7EC 1RJCA 1EAJA 5CLTA 2OL3B 1JMXA 1H3TA 1TZAA 4H4NA 1V7NL 3DIFB 3AT9A 2B1OA 3LKPA 4MCZA 2CLVA 3W9EB 1NUDA 3UTTB 1BZ7B 4RWYH 3TU6A 4QRPA 3VFNB 3U7AA 1PG7L 1BG9A 5AVVB 1YECL 3CXDH 3MRFA 3HHMA 4TVSa 5GS3A 5T1MA 4BKTC 2AJVL 4APQD 5IJVA 2D7OA 4Z7UE 1S5IH 3HJ0A 3ZQ9A 3OQRA 5C0RL 2WVUA 1Z5YD 3OPZL 4KJPD 1HDMB 3DMMA 3STLA 1CU4H 1OT2A 5J3HD 1R24A 1UD4A 4HETA 2NCMA 1JI2A 4HS8H 3WIIH 2MEJB 1FC2D 2DYPB 4JM2A 4GUCA 1RK0A 2FEDD 5KS9A 2BVQA 3FT4A 1VADA 3BESR 3D3VE 1BVKA 1N3NA 4JFPA 4TS6A 2PO6D 1ASOA 5ITBH 3FZUD 1TMCB 3WFBL 3MJ7A 2IG2H 1KCBA 1D5XA 2VQTA 4PRIA 1QW8A 3RTQD 2Z3FA 2F1EA 2XX1A 3H0TB 4G3YH 4G72B 2XG4B 2ARJQ 3GPEA 3CZFB 4AT6B 3G5XB 4KY2A 4U3SA 1RV6X 5E2WL 1SYSA 4NKMA 1XR9A 4WWOA 4WSKA 3UDWC 3KPLA 2HKFL 1V8HA 4MMZB 4HMDA 4FLHA 2W92A 3DO3A 2WWOA 4K2UL 2QLYA 3CZNA 5EIQA 3RE0A 4JPIA 5DR5L 2BP0B 4AV4A 5IHZB 3OZKA 1A14L 3NCWA 4G7VH 5IVXB 4UV7H 3H9SD 2OMVA 4WUUB 4L4JA 4P3CH 4YNYA 4MD5A 5D1QA 4DT2A 1PCSA 5IHWA 2R8SL 3UZEA 2NT1A 3FUDA 2V4LA 4GBXC 1SZNA 2AK4B 3D6GA 4C56B 5GZOD 1U8IB 3EJCA 3L7FA 1G7LA 3PQYD 4PJFA 5DFTA 1ECZA 3BPCB 3ESNA 1SOXA 1NAMA 4XP9H 5IOKA 4WV1B 1A7PL 4E36A 2ZE0A 1ES0A 2D9CA 4JO1L 2H1PL 4Y5XA 4CU8A 5FR3A 4NYLB 1JV2B 1XV8A 4JMNA 2MCAA 3MODL 2QADB 1HCZA 4L4TA 4NS0A 2Q2EB 4F2MB 5AZEH 2IEPA 1Q94B 3V4PH 3WL9A 4P5KA 5BZWB 3EJQA 3LDBB 1TO5A 4JHVA 3L45A 2MNJB 3TBYB 4U1KB 3GSXA 3FTXA 4YHIA 4PJIB 1KFGA 1MW2A 2NTSP 1EA9C 4TOYL 4P2QB 4OM0H 3RFZC 4PJGB 5TPWL 1SBSL 2EYRA 3MLPA 4PI0A 3WNKA 1FL5A 3HE7A 4AEFA 1OTTC 1E28A 3H53A 4HAGA 4ZQKB 1OGTA 1E5AA 4H1LA 1XL4A 2WBWB 1R1CA 2Z0BA 3Q8AA 4ZPVB 1Z3GL 3ZHFA 3AS3A 4W9DC 5BO0D 1W16A 3D0VA 3FCTA 3ZZ1A 4Z5RB 3MGTA 4HJGA 1N5YH 1NFIB 1AGBB 3QFJB 3HRPA 4J4PD 2AEPH 3EGDB 2ZXBA 3GT6A 3UYPA 2LU5A 2QSVA 3FQNB 3JWNH 2G75A 4PRHA 3WEMA 1JCKA 2Y7QA 2C9WA 1QRNE 5K9OB 1UA6L 5CR1A 3SKMA 3JWOH 2JQMA 1J1XL 1SXBA 5E9DD 1M1XA 4UQ3A 4KUCF 3KHQA 3NSCA 1WJ3A 1DQDL 4I85A 5D4IA 3HKZA 3JUYA 3SKNA 3CHRA 2BNUA 4AENA 5KVEE 3VD5A 2BNQD 1X44A 2A9AA 2KZKA 2HJFA 4XOCA 3UTZB 3VQLA 1ZK5A 4KNQA 3HBGA 3S5LG 1FL3A 1KTKE 4S1RH 1GSKA 4L0ZA 2GC7C 3IPFA 2E3VA 2Y36H 1PW3A 1Q9KB 4FQIL 5TE4H 4K3DL 4FCAA 3L7EA 1N59B 1SGKA 4HP5A 4MMYA 4EEEA 1A3RL 2VE6A 4OD1L 4F57L 3REWB 1GTFA 3CIAA 4ONHB 4Q0XH 3NPSC 2VMCA 4NNXA 2IBBA 1CWVA 1E9OB 1MCWM 4U1HB 2DIJA 5HGHA 5LHDA 4JG1L 4PJ6A 4C4KT 4EOWL 2ODHA 1G7JB 6FABH 2DTML 5GS1B 3FQTB 1JFHA 1TVBB 3QNZA 2FGWH 4YHYC 1K6QH 1NTDA 3QSKB 3TTYA 4CKQA 5C8JA 4HH9B 4UQ2A 4MXWH 2QQKH 2DM3A 5E00B 1JTOA 4HD9A 5TF1L 3RLSA 4JE4B 1C16B 5C0NC 2DKSA 3WJMB 5TD4A 3O9WA 1MWOA 3EJRA 4EQ2A 2OMXA 4HZLA 4ZX6A 1EGJH 2VIRA 4MQXC 1BBJA 5TJWK 3RX8A 4BZ2A 1CXEA 1AXSB 1HKFA 1PKQB 5ACZA 1B0RB 3ESUF 2BSED 5JHLL 2DD8L 1HE7A 4H8VA 1BX2A 4AM0B 1I3UA 2H3KA 4QTIH 4XPGH 3T0EA 2YUXA 1JV5B 1I8UA 1MFAL 4UNVA 4GY4A 5B1KA 4L18A 4U6XB 1FF5A 3VA2C 4Z3IA 4FZEH 2W9EL 4NQED 1ZVSB 3TEXA 3MSPA 1L4IA 1KJ2B 4TPRH 5IESL 4BQBA 4NZRL 3RKDD 2F5AL 1HQ4A 1C12B 2VDNH 3HPJB 3IXAA 1ZT1B 3PWLA 1A4CA 2FATH 3PP3K 3TEUA 5I75C 3MFFA 4RAVB 4I9XA 3TV8A 3LQAH 3VGBA 2NQDA 5B38A 1S5HA 3NTCL 2EO1A 1JGDA 3QZWG 3CHSA 4FFVD 5AYTA 2WZ5A 1A6VL 2RQEA 2HZHA 4KQ0A 1E27B 1PFOA 2HRPH 5IB3A 5MEQA 4LLDA 1T0MA 1SNRA 4OGXH 4GKOA 1MQ8A 3WUWG 5C1MB 4E41B 3JZ7A 3OR7B 5HHQA 2VLKE 2JH2A 3F7QA 3W0WB 1AIFB 4G9DA 5D7IF 3B34A 4M43L 2ED6A 2CKBH 5HYSG 4LNVA 5D2LA 4HWEH 3V7AG 1WAAE 5AWNH 3FQWA 4UTAH 2RD0A 1U8OB 1OY3B 2BXYA 3TN0D 1TMQA 3I6GA 1IM3D 2MFNA 3ORJA 5T3ZH 4ZMPA 4BSVB 3QQ4B 1OSZB 1QACA 4RFOH 5E2TL 2D3NA 3RVUD 1QLEB 1W8EA 1WO2A 4KRPC 5JXEC 4FMFA 4OKVA 1L0YA 2CLRA 4MWFB 1KBPA 4LVEA 3RA7L 3QAQA 2DQIH 1F45A 1EO5A 3CSTA 4ENEC 3C5ZB 1LM8V 1HL9A 2Y3AA 5DMGD 3Q43A 4H8WC 2F74A 3AG1B 1CGVA 3QUZB 5FO8B 1M71B 2X4OB 4B53A 3PAYA 2CHWA 4JZJA 2OTPA 5EZJB 1YQVH 1MREH 3B3IB 1SF5A 5JPMC 4JHUA 3C8DA 1CD1A 5IR1B 5LNGA 4UMGA 5LG1A 4HJ0C 5B8CA 1XL6A 4W1TA 2D2OA 5GS2D 3LCYA 3FSWA 5ANME 2IH3A 4AIZA 1AZCA 1CLZH 2GC4C 5E7BA 1BYOA 3QUKB 5ISZB 2J8UF 3QCTL 1S7UB 2ZG2A 1UD6A 3S3DB 5KVEL 2E75C 2V9TA 3BH9B 5GGVY 3EGXB 5GGRA 2YBRB 1CS6A 3OMZA 4R8WL 1ZHKA 1OK8A 2VLJE 3FBQA 1QUNA 5F9AC 2PXYB 2Z64C 4AQZA 1TFHA 2W0LA 1ERNA 1VGKA 2ZUYA 3NK3A 4AL8C 5E5RB 4I88A 3H42L 4W9JC 1ROWA 3JVGA 2EVJA 2ZWLT 3HN8A 1UACL 3CPLB 1TJXA 1I7RA 4FI7A 1T1YB 5I71B 5HPMA 5F96H 4DFHA 3IKKA 2XQBL 2CH8A 3AB0B 3WTWA 2N7AA 5GIRB 3KBHE 4EZJA 1I3VA 1RJYA 2OXGA 5DRNB 2VKXA 4F7EA 1CTOA 2R2HB 4KMLB 2P5EB 2Q8BL 3KLHC 1U36A 4AEIH 1MSPA 2XY1A 3OLIA 4PMEA 2GSIA 2XVBA 1Q72L 4NN6B 4P2OA 4N22A 1J5OL 2H32A 2GI7A 3BGFC 1T3FA 4A55A 3WD5L 1DFBH 1A8JH 4HK0B 1JDAA 3QI9D 3CLFL 2P5WA 1OO2A 4JFTA 5D1QC 5GSRB 1KEMH 5HHOE 2EE3A 1HOCB 4Z7NB 3C87A 2YMOA 3GSUB 1QI5A 3ZDYE 3P9LA 4PGCB 2JCCA 2A38A 2ZX5A 3MBEC 4K9EC 5IK3A 3C2AL 3GDBA 4XTRD 4H0GA 3UAJC 4HIPA 1I1YA 3B56A 3NFPA 2IV9A 1F11A 2R2BB 4L8CB 3I6LD 3D5OF 1XX9C 3LS5H 1OE2A 6CGTA 4EI0A 1NZRA 3GXFA 4Y5XC 1H15B 5AD0B 5I76A 2F8XC 3H7BB 4R4FL 3FW6A 1X5FA 4JR9H 1TYRA 4LAQL 1KLGB 5K1NA 4QHPA 1ZGLB 2EH8H 4M8QA 4PJEA 5FDWB 1TJIH 5JIHA 5TDOB 3G08B 4MZRA 3N1MC 4NC0B 1WBXB 2D7MA 4L2LA 4ZFGH 2R23B 3ESPA 1GS7A 3LH9A 4X6DB 1MHCB 4DERA 4JHWL 2JV6A 4UTBH 1IQDB 3LH2H 3HRZA 3KBPA 3BAEL 5F88B 1XF2B 4KKNA 2X3BA 1ZTXE 4LQ1A 3HE7C 4LRNL 1YNKH 4H13C 4FULA 2F58L 4FQHB 3TS8A 5FGCE 5E08L 1NEPA 1OAYH 1I9RH 3NESA 4MAUL 5SWSA 3BEVA 1OPOA 2AJXH 5JLZB 5E6ID 5GISL 3ZE2F 4L8SB 2CHDA 4P4KA 3WV0A 3FMGH 1TEYA 2DWDB 3FRPG 4JFOB 4NM4H 3WLWC 2IAMB 25C8L 3JV0A 3VFPB 3I50L 4GRLB 2X1QA 3UP6A 3C5JB 1T21B 3WKML 4QOKB 5I17B 1SFHA 2G5RA 1L7IL 1MIEL 1KXTB 1T1ZB 2E4FA 4QD2E 2HVJA 1NGZA 4LVNC 4WI0B 3KWWB 1PG7X 1M05B 3F84A 2NY0C 5C0JA 5C3TA 4NRYB 4KZDH 2IXQA 5HJDA 1BM7A 1FV1A 1IC1A 4G8AC 2ZYSA 2NX5A 4XC1H 5ID0B 3HB3C 4WY7L 3FN0L 4CN4A 3ZKNC 3FTGA 3NIGB 4PV9A 3IN0A 5TQ2L 1ZWIB 3HG1E 1IEBA 2ZJSH 4EVNB 4MGXA 5FYJU 2GBAA 2TSBA 2GUOA 1MVUA 3HZKB 1JTPA 1KJ3L 3LMJL 4LKCA 4NUPA 1VSCA 1I85A 4DGIH 1A7RL 3DI2B 1ZDQA 3QFDA 1CLYH 5J06A 1CFSA 1H0DA 4YHZH 5DO2C 3CWGA 3RL1A 1YEGL 3L3IA 4F7CA 4DZBA 3CN1A 2J6EL 2JSFA 3MUGB 1IGIH 4I48A 1D5IH 2A6KB 4U0RC 3SD5A 1CGSH 1T6VN 3EYUL 3LQMA 1URZA 4BZ1H 3EH5B 3WY4A 1EZLA 4NIYE 1I7UB 2XPGA 2Y7LA 3UJIH 2E4TA 3GZKA 5F7WC 3AUVA 4FG6D 2UY6B 3R7QA 1OQXA 4R5TA 4TTDD 4GMSH 5F97E 3MV7A 3P1VA 1R6VA 4OFQA 5F8QC 3GSVA 1LO0L 3TFKC 5AB0A 2F6AA 3IFLH 2Y72A 3MRPA 4GAJL 4U1IA 1UT9A 1KT2B 4N2AA 2GKIA 4NJ9L 4O2EB 4TULL 1W8OA 3Q1SL 2XYCA 3V4PA 4DQOL 4KKAD 3HS0C 3Q3GA 4TUJA 3TASA 4AYFA 4EIZC 2KZBA 1TQCC 2DZEA 4QRTB 1AJ7L 1KFAL 3IFPB 1V3MA 5D7SL 5GHWH 3D2TA 2CR6A 2WYHA 4I77L 5C08B 3EAKA 3SN6N 5EEWA 1PL3A 5DJ8A 2CUMA 4XAKD 1WK0A 5D1XC 1AS6A 1JP5A 3O2DH 4EI5A 2DMBA 5IMKA 1T2QH 2N0MA 4ELME 1T03L 4G2AA 1OAQH 3OMNB 3P0YH 4ZAKA 3CFKB 3BFOA 1FO0L 3ALWA 3N43F 1QSED 3QUXB 4JY4B 5B38G 3WHXA 1GJIA 2DQDH 1MI5D 1F4XH 5HBBA 4AMKH 4BQ9A 2Z0UA 1I53A 4J3XA 5I0VA 1BGXL 2PCFA 1ZSDB 2WUCH 3SGEI 1LO5B 3K6OA 4NN7C 4UOW0 2GBUA 2GEQA 1G4MA 3Q5OA 4NT6A 3GJEB 4MA3A 5DZPA 3O3DB 3MXWL 3R18A 3U46A 2ZOKB 3ARBA 1JPEA 2H4EA 3PNRB 4JFDE 1JWUB 4ZFOL 1VFBB 4Y8DC 4HEME 5HDLA 1N2RA 3IJYA 1KCUH 2CBMA 3OKNB 3HR5A 5BXFA 4TLUA 2YAEA 3C5SA 1F13A 3FFCD 5DTFA 3Q2NA 2C3XA 4X80L 4ZZKA 2FX7H 3R8QA 2Z6FA 4B9ZA 1WHOA 1IGJB 1KB9J 2BFGA 5CCGE 4EBQH 1URIA 2CALA 4LLQA 3IMTA 2MTAA 3ZRFC 3BW9A 4FHKA 4WWID 5GJSH 2OSWA 3UBFA 2D31B 1YEFH 3K71B 4BKSC 3GSNL 7TAAA 4MA8H 3A4AA 1FNEA 1DBMH 1EHXA 2XVGA 3RWJA 2PETA 2VITB 5A6LA 3AREA 4JFXA 4QTFA 3QUGA 4YN3A 2OYMA 4KI5C 2WMPB 2Q76A 2Z92A 3SKOB 2NNAA 4PRPA 5IVOA 5CD3B 4DP9X 5MENA 5B8CC 1WUZA 2FH8A 5B1CA 1BM3H 2VN3A 3BP6B 2W07A 3CVHH 3UGEA 3VGHA 4PJ7B 2VDPL 3TA3A 1MLBA 2XUWA 4GSXA 3UTQA 2DWSA 5JA9A 4HWBH 3D39D 3CH1B 4JZNB 3U0PB 3RAJL 4XVSL 4LIQH 4OZGB 4D0BB 3UC0H 4BFRA 5FAAA 5HY9B 1NMBH 5HJ3B 1A3LH 1GXEA 4E5XG 4KDTC 5E8PA 3TX4A 1CDCA 3N42F 2DEYX 2ADFL 4W9CC 5KJ7E 4KGLA 1KBGH 1SOSA 3T3MF 3FSOA 5HHXL 1Z5LA 5EEVA 3BDYH 3FT2B 4OJYA 3X12B 1IAKA 4ZFZB 4Y4FB 1EGJA 2QZ5A 5IV2A 1I1FA 3A4FA 3R06B 1RJZA 4IOFD 4DEPB 1FLRL 4G43A 4BFIA 3JVGC 1R3KA 5F9DC 3T4AC 1AKJA 3QVAA 4FQ2L 3IDNA 2B20A 1R9FA 2AJYL 2F54B 2YN5A 4D8OA 3FFDB 2BOCA 4RISL 4GKSA 1X3DA 4WTZA 4YSEA 4NO3B 4GW4A 2OLDA 1AYOA 3VXRE 4FNRA 3UPCA 4X6BB 3TBSB 2VXSH 4OUUA 3W9DA 4OV5A 7PAZA 3U1SH 2CDFB 2W5PA 3PGDA 5JPNA 1O7SA 1A8ZA 3QNYB 3VWKA 3WNIA 3VWJA 1OGAA 1FZJA 1WFJA 2WXMA 4MBRA 4WI7A 4YHKL 4YOKA 1EHLH 3RNKB 4XH2A 3T8MA 4EXPX 2ODIA 1DQQB 2AJUL 2VGLM 2TRHA 4MFHA 3UTTD 2XKSA 3IVKB 4FLRA 2OR9L 3V0VA 3K81A 2G2NA 1C5BH 1LMIA 3K1DA 5J1SC 2NY5H 3RZWA 2PP7A 3TYGH 1MHHB 1MEXH 4FQXB 4O00A 1U8KA 4XWOC 4LKXB 5D93C 1MHPH 1OE3A 3JWDC 2OKMA 1XHHA 5IVZB 4NLHA 4HS3B 2CKBA 1F3JA 1QOKA 4BWTA 4HC1H 2G5BB 2X5PA 1LE9A 4ONGL 5F1NA 4AYGA 5CLYA 1JZGA 1TU2A 1O5DT 3QDGD 4PTUB 4YDKH 2DYPD 3ZX1A 5JDSB 4UTAA 1IFGA 4Z95L 3QUYB 5JNYA 3LZRA 4Y1AA 4HGWA 5E56A 1UJTA 2QZQA 4PB9L 4LPCA 5IP4A 2P8MA 2QTEA 4LEOB 2YGQA 1VHPA 2G3MA 1PJWA 5E99L 2OULB 5BQ7B 3FB8A 3GMPA 4LL1A 1NLBH 3NJHA 4XB8A 4R96A 5DA4A 3KJ6L 2DBLL 3FQRA 5EA0L 3SCMA 4XMLL 3WTUA 1HHJA 4XAWL 1L0XA 3H1ZA 3KPMB 1KYDA 4DUWA 4YEEA 1UT2A 1GC1C 4X7SL 2FLRT 3P9MB 4X8CA 1NUNB 3WIHL 4XVJH 1G1KA 3B1TA 2AAAA 4XP1L 4YUEH 3CDZB 5D7JA 1BEXA 2Z4QA 4I2XA 4JB9H 4M02A 4JFQA 2GT9A 2JJVA 1MIMH 1Z3RA 1GGUA 1J0JA 4KVNL 5F6IC 4WUUD 2MOQA 3ZQXA 2Y07H 2NZIA 4X6FB 5DYOA 4OI7A 1UZ6F 3D4CA 1UFGA 2YFNA 3FRUB 3X1EA 2AQ3A 1DJZA 3PIQB 2AK4D 3MJ8B 4P23D 3V0WH 5DC2A 2I69A 2WBKA 5LAXB 3DX1A 2BXZA 4XN9A 4NJAL 3IFOA 3OV6A 4MDIA 4FE9A 3WKQA 4XP5H 3WJJC 2Y6SC 1NEZB 3L2NA 5HVWA 2AVGA 3VG0H 4PLJC 1D6EB 4Z3FA 5I1LA 2EYTB 2Q9OA 2O6EA 2IQAA 5CSGA 3INUH 5AZ2L 1VFAA 1YEHL 3B9AA 2VLLA 15C8L 4LDLB 3MRDA 4IYKA 3EFOB 1CPUA 1EEZA 3LKSB 3QR2A 4Q2ZA 1KPRB 3B9KC 5LAPA 3A47A 5AW8B 5EUKB 3EBAA 1RSFA 2LAAA 1T89A 5KANG 1EANA 1KB9K 2VNCA 5JR1L 4AJYV 1ZE3C 2KLRA 1BLNB 2XN0A 3DV4B 3GBNL 4P2QD 5D5MB 3WAKA 2JTYA 4YO0A 2W88A 1UOKA 4KHTL 2NR6D 4TNVF 4ES9A 4M5SA 1QWUA 1B0IA 4LNRB 5KYXA 4A68A 5EUOF 1PLGH 5K69A 2K6ZA 1WBZB 1WCBA 1GIGL 4X2UA 2NUTB 1TQBC 1K5NB 3D2UB 4IJTA 1KTCA 1BVOA 4DW2L 3RUGB 5JQ6H 5ANMB 4D7BA 5AVQB 1RCYA 3FHQA 1HH9B 2AXJA 3OPUA 3PHSA 4KK6D 3M07A 4O02L 1I1AD 1CR9L 3QFJD 1IGFH 4IQHA 4K5LA 3VMOA 2R0WL 1TIUA 1PQZB 3IPBA 4YPGB 1T20A 3VCLA 2VJ0A 1JGLL 3MMEA 2CMRH 3DV6B 4OJFL 1VCBC 4KK8D 4Z8FH 4PCSA 3B2VL 4KNSA 3LRSB 3K2UH 4NIKB 3WE1A 5EC2A 1U21A 2ZICA 4JX0A 5TF0A 3S37L 3ZR5A 3PGCB 3ZKMC 4FEIA 3HC0B 5ICXA 2CDGB 5BRPA 1JXKA 4OLYL 1P53A 1FVCB 2X4QB 2HUHA 2XZAH 1BZQK 5DK2B 1R3JB 2EECA 4HZAA 1X9QA 2XCMC 2XWRA 5DHEA 5IGXL 4NKOB 1OP5K 5F89B 2EXYD 1EXUB 3L9RB 5ABZA 3KYMA 3L9YA 2EC9T 4M3KB 4DN4H 4UTBA 3IGAA 1U3JA 2PYEA 5D1QE 3MXVH 3QGVA 1HI6B 5K59E 2V9RA 3UTPE 2OTWA 1C5CL 2JTDA 1CVSC 4PJFE 4XNAA 2UVFA 1P69B 5DF0A 4FP8H 4UNTA 3V4UH 2DJUA 5JW4N 1FO0B 1I8IB 4C4BA 1YHPA 2ISDA 5CCJA 3SOTA 3SZ6A 1WA2X 3ARBC 1AY1L 5E8DL 1TOXA 1ZPLA 2P47B 2O26U 5HD8C 3MGOB 1AD9B 3NVQA 2UX7A 5GS2H 1S4IA 3S2AA 3NGBC 2YAOA 1EAPB 4JRYB 1DLFL 3PNWA 4JPVL 5FOBA 2E9IA 3SQBB 2WPGA 3TBWA 5AW1B 4F7TA 1IM9A 1ADWA 1WQVT 3QIBA 1FVDB 3BGMA 2WY3B 3A24A 3WJLA 1UM4H 2NY3C 2VT0A 5I18H 3DUUB 5AQ0A 1D9KC 1YMHB 4PBDA 1SVZA 1YY9D 1HE8A 2QMKA 3VFWA 1T0NA 1IBFA 5F8RC 2R56L 4HIJB 3KYKL 4FYTA 2V37A 2YPLA 3FN3A 3V79C 4XCYB 3OGCA 3DJTA 1X5GA 1ADQL 4GS7C 1OZUA 4G6FB 4LEEA 1HYSD 3AREC 1LGVA 4QRRD 5FW8A 3VJ6B 3D69B 5HDBF 5LWYH 3MNWB 4MD0B 3IJ9A 3GSNB 4WFEE 4U1GC 4ZYKA 2EZ0D 3ZE0E 1OTSD 3DTUB 3MROA 4Z7VB 2J88L 3AQZA 4NO5A 2KI6A 3RVTD 3E3QC 3S8WA 1U58B 4PRHE 5CMAB 4Y5YB 5L0QB 4JFFA 3FPXA 3KPRB 2NY6C 4Q7DA 2ZONA 2CIIB 3NA9L 4ZPTA 3P3TA 4BUHA 2YOAA 4M1DH 2K70A 2M1KA 3VI3A 4DZ8B 2FR4A 4BK5A 4YSPA 2Q7AA 2J44A 3QRGH 5HHVL 4Q9QL 4XXDB 5FHBH 4H8WL 3HUJF 4WRLA 1J8HB 1Q9LB 4RWHA 1CFNB 3S36X 2VR8A 4F27A 4O2CA 5L6YL 1NUFA 2C26A 1D2OA 2IANB 1M6UA 4LZKA 2CRIA 4XBGA 2BK8A 2FUTA 3QJQB 4UM9A 2NXZC 1IZJA 2DQEL 4I0PA 4AIOA 2ZUWA 4AEEA 2V5YA 4PRAB 4NWUL 1SQMA 5AVXB 1G7MA 1U93B 1RIUL 4NUQA 5FUZH 4R97C 4CSTA 2RAMA 1KGCD 1V3LA 4FMKA 1XR8B 3EH4B 4Z23A 2HVKA 2ZP9A 2DB8A 1KPVB 4LLYA 1G7QA 3C5ZD 5GRVK 1NBYA 3DECA 5I74C 1FG2A 1MXDA 2BNRE 2XVLA 5IB2B 3O2DA 1P1ZB 3IDXL 4YBQD 5DLML 1U3HB 4OZIF 3ABMB 2WXLA 3Q8EA 4K3GA 4DNLA 1N5AB 5TDNB 1NQBA 1X5KA 2CO4A 5JPNC 1QUPA 3EBIA 4AL8L 3VWJC 3MN8A 1V7MH 4IKJA 3ZTDC 1QQDA 1ZXQA 2BWQA 3VGGA 3QDMB 1G7HA 2KZWA 2XN9E 4M93B 3ILPA 4HJJL 3QIUD 4OT1L 2ENYA 5ISZD 3NSFA 4N86A 3AU1B 2H5UA 2EYSA 4YIQB 5ABDE 3GSOB 4P46D 1Z6JT 4IIQC 4Z0XB 5GGRY 4M3HA 1NAKL 1UZ8B 5KSUA 4AH2B 1A4JB 1IGMH 3HNVL 4Z0BH 4DVBB 4HUKB 5T5FA 4H20L 4XXCC 5EZPA 3F00A 5DFWH 3KPSB 3FS9A 2PXYD 3QNFA 4X8GA 3CJJA 1FNSH 3VFSA 4LLWB 2ADGB 1HSAB 2WOBA 4HFUL 2R4RH 5D1XE 2WXKA 3ZT6A 2BOLA 3UADA 1D6VL 1MY7A 1Y1UA 4FC3E 4APQA 4HUCA 4W9ZA 4KX7A 5I8KL 3D9AH 3SKUD 1SVCP 3M1OA 4XC3L 1FG9C 4OF3A 1Q9OB 3V0GA 3ETTA 4BK8A 2BC4A 4JKWA 3RWDA 4K9EL 4LT7A 3O4LB 1QPXA 2H1XA 1AYRA 4PR5A 3R0NA 1AKPA 4I3SL 2P5ED 4FQLL 1JDDA 3RGVD 5LXGL 2IOMA 1CFMA 2FX9H 3VRIB 3IXTB 4K7FB 2HA1A 3MLWH 1AXTH 1JGVH 2PO6A 5KSBB 4F2EA 4FJYA 4Y5VB 4RDBA 4RQQA 1YPZB 2HJLB 3RTQA 1A6UH 4OZHF 1F56A 3SYPA 1TZHA 1UWXH 1ZKAA 2CK2A 4X6CF 1PGRB 3GJFB 4FI6A 1QRKA 4LHUB 1SLVA 3QA3B 3CFJB 1LP9E 2VDLL 4OFVA 4EPSA 4PJHF 3MLZL 1F2QA 4HWBA 1KOAA 4UNUA 3R8BB 2A6IA 3HBPA 5HJBA 3ZTEA 5L88H 2JXMA 2BOBA 1HXKA 1NCCL 2OSYA 3CBKB 4W4OA 5EULV 1K3IA 5HI3D 4F91B 1RZ7H 2PCPB 3H9SA 5D7IE 3N1FC 4OU3A 1NC2B 3GC3A 5CEZH 2ROYA 4A7UA 2ZX9A 4LEBA 3SHSA 3VNZA 4ZS6D 5ITFA 2FNBA 4Y9BA 1PPIA 4AQ1B 3HKFA 4W9FC 2FTAA 4KTDH 5CN2A 3RWHA 5GZOA 3CFBA 3SDCB 4MQTB 2C3VA 3PQYA 3NCFB 3POCA 1AZUA 1G5GA 4Z9KB 5F7LB 1HT6A 3DKHA 3EH2A 3P4NB 3SPHA 3DVNB 1JRHL 2B1AH 4KI5E 4M48H 1HAUA 4PPTA 3SD2A 3SPGA 1E5CA 2YEVB 2FD6L 4TL4A 4N2KA 3PHQA 3IJHA 5ESVA 1SN5A 5CJQH 3MKKA 4P57A 4UQ9A 4F7MB 1ACYH 3ZY7A 1DSWA 5EF1A 1YA5A 3LPPA 1J9SA 1TJHH 3A22A 1PJ9A 3DURA 4ZMXA 1XB8A 1MFDL 4BWWA 1RZJH 3QHFL 3R1GL 2XSKA 2FJUB 3PDGA 2J25A 5J1AB 3ZL1A 2W94A 3D7PA 1NM9A 2AABH 2IOIA 1R0AL 2AJ3A 2HRHA 4GI8A 1RMFH 3G5YA 2WXOA 4MMXA 4AYDC 1HKLH 3AT8A 3KPOA 3LVTA 3B2PA 3WY1A 3PWNA 1U8MA 4NNYA 1TQUA 2APXA 3AVEA 1DSFL 3IRPX 4GRLD 4OCXH 4G8IA 1O9ZA 3PDOB 4NGHH 1XCTB 4OB5H 4R7VA 4RESB 4AGOA 4EUPG 4LRIA 2J8UE 4NQCB 4N6RB 3UJJL 1TQWA 3EYVA 5DVPA 3WEXB 1KCSL 4MS8C 4J3OD 5DWUL 4HC1A 5DJZA 3ZQWA 1TLKA 3VI4A 4AITA 3LKNB 3Q8BA 5EIIG 2BZDA 2ROXA 3IMWA 4IHOB 4L9LA 4UDUB 2RH0A 5J7CC 5FPIA 3G7TA 3BKYH 5IW1B 1J48A 3PXJA 4J4PA 2D7TH 2C7UB 1E5YA 4I18C 1Y07A 4NC1C 3S5LB 2BVUA 3ZHKA 3V8CA 3Q6GH 1F58H 1UGNA 2ZSWA 4R83A 3S96A 1P5UB 2K3TA 1GZQB 4GKLA 4RMUA 5E9DA 3PAZA 4ODUA 1ZHNA 1RP8A 3G5VB 1M56B 3KD4A 5F7BA 3ZDZE 4EIBA 4ZSOB 2OR8A 5F7EL 2NMSA 2F53B 3KJ4C 3US0A 4Q6KA 3GBLA 4Z77B 4KI1A 2BNQA 5C09B 3KL0A 1HHIB 1W9XA 4NQVB 5GGTL 3S3PA 2HPOA 4FZ8H 1F97A 4OLWL 4JO4L 1P4BH 2JCCE 2QVFB 4B9IA 3MTXA 1Z1WA 4CRPA 4F1SA 2HG5B 2EC9U 4JM2F 4Z7OF 4AQEB 4F58H 1U33A 4AK2A 1IC4H 4O51B 4WWKD 4W81A 5AW5B 3MNDA 4LMQE 3RPBA 2BMKA 2E8ZA 4L3EB 4PJEE 4S1DD 4PLNC 3L3GB 4Y4HC 3IWUA 4MSWB 4U6YB 2XIIA 1WA1X 3MRRB 5SV3A 3SDDB 3BAYA 4JKMA 4A7TA 1WIOA 1IAMA 2PPDA 3D3VD 3D33A 1RH8A 3LKQB 5JUEL 3WJLC 4N5EC 1KWGA 1JGEA 1LWRA 3L5JA 4OLEA 3Q06A 3UXFA 4FL4C 4XNXL 1NIEA 4PJAF 5C08D 5EBWB 2FQDA 1G5AA 4YFLF 5IBUB 2G3ZA 4PLOB 4XVTL 3CZJA 1YUKB 2V5TA 5TE7L 3K72A 1L6PA 2CIKB 2AJSL 2ITDA 3BZFB 4AK1A 3RPKA 2A1WL 1YYLH 4K5PA 4WW2B 2MPAL 2F61A 4QRSB 2OCJA 4Z7WA 2CRMA 4OSUL 5AVSB 1D5MA 1F1GA 3RWGA 3MDJA 5KZCB 4LCCC 2YXFA 3TT3L 4P5MB 4FQ1L 1BAFH 2BSEA 2J71A 4ZW8A 5MP6L 2VYRE 4A66A 1DJGA 1B2WL 3QZWB 3BH8B 3LQZB 1AZZC 4OD2B 4EF3A 5MEOA 3V6BR 5BV7L 4N8CH 3DJSA 2K6YA 2V0AA 4NQEA 5MI0B 5TH2A 4NWTH 1AO7B 4JY6B 4LLVA 4XB7A 4N2LA 3WUWB 1F8TL 1KELH 1QSVA 2FSDA 3RWFA 1MW1A 2R1YA 4H2AA 3OC8A 4QKTA 4RVBA 1JVLA 3S2CA 5HDQL 4G80B 4B9JA 3MRLB 5DJDB 3WE6A 4HSQA 1T4KB 1VDGA 4BFKA 3RHWF 2CPCA 3C6EA 3RRQA 2X6MA 1S7RA 2NX5E 5FXCH 3C09B 1WEJH 1UVQA 2QSCH 4NN5C 1QR1A 5IQ9A 1XCXA 2Z93A 4I0PC 3VH8A 4XCFH 4NZ8A 4WI8A 5CJBA 5SWZB 1WC7A 1T1WA 3FF8A 2AMGA 3VDCA 1NMAH 4PY7B 5DJXA 3K4AA 3OAYH 4E2OA 4HX1A 3S37X 3ATEA 1ID2A 1XCQB 4KMTH 4JJ5A 5EV7A 1PZ2A 4FNTA 4PB0H 1G1CA 3TN0A 2CLZB 1IM3A 2O72A 5C0AB 1KLUB 1KY7A 1TTBA 3MLVL 1RJLB 5KSAB 2J4WL 4FXTA 1MCJA 4YHML 1FL6A 1BIIB 2EICA 3T65B 3VFRA 4XCEB 5LGHL 5E2JA 2UZXA 3WS3B 3FKUS 1ZT7B 4KXZH 1AAJA 4X5XB 3VFMB 1NCBL 1OGSA 2B1HH 3EUDA 4QXGL 4KVCL 5GZND 3KGRA 4XOAA 4PP2B 5CP7A 2OX5A 3JQOB 3HI5H 5DZOA 1VENA 2WTRA 4NQDB 4WU5B 2YXVA 3LD8C 1ET7A 3LKOB 4MCYB 2VC2L 2CJ3A 1NIFA 3C6SB 1GGBH 4LQFH 4XHQA 4BH8A 5HI5C 4AJ0A 1G87A 1NKOA 2LLNA 4AXWA 1ZDSA 4NRXA 3APCA 5IT2H 1CT8A 4YXKL 2QV4A 2H8PB 2H0PA 5E5LA 3GM8A 4DOHB 1XIWB 3UPAA 4MNGA 3KPPB 4LU5L 2Y1ZA 3UG3A 2FVNA 2J43A 2XHNA 4B3EA 3M1BA 3JYBA 1WZAA 4BGLA 5G5DA 3ULUF 4KJPC 4XMKH 2P43B 5FF6B 1S7WA 4AJWA 4Z76B 4XNUH 1JK8B 5TFSH 3PY9A 4P2RB 1UWYA 4A1RA 5JW4M 3GIVA 4YGVA 4P9MH 3DK0A 5IQLA 4J28A 3NG5A 3O41A 1GHFL 3PJSB 5A2JH 5H4ZA 3MZGB 4IDLA 4WK0B 1WYJA 2BVTA 4PJBA 5HI4C 3WFHA 3FZUC 3VQ2C 4YSUA 2NY2B 5SX4I 3BUYB 1AOZA 1HHGA 3RTQC 3U6RB 1UD8A 1RUPL 2CJUL 3OMAB 1GGYA 2ZCKL 1OB1A 5FUCC 4FQQA 3L16A 4ELKB 1ZVHA 4QCIA 4RLDA 2OMUB 2WXRA 1N6QL 2I32A 3F5WA 4WFGD 2HT3D 4FLOA 1WFMA 4FQXD 2Y5EA 3GMNB 1Y6NR 1C1EL 1YUHA 5K93A 5I30H 3OKLA 4ODHL 1OV8A 4EXKA 1F42A 3DOSB 1GC1L 2V2WB 2K9FB 5C3LD 2VDQL 4NCDA 2B5IC 4OW6A 3REVB 1NBZA 4HWNA 3S8GB 4U2ZA 3S3BB 1IL1A 3QI9A 4YK4C 4D2NA 1ZHLA 2X2JA 2XNAB 4XT1C 2EDEA 2VDLB 1ONQB 2JCWA 1ACXA 1JUFB 5ALCH 5ILTL 1WT5A 2EUVA 4O5LL 3BIKA 2AGJL 4N0FA 2J8OA 4W68A 5ID1A 1G9MC 2CDEB 5EU4A 4ONFH 5GZOC 3LEXA 4IOIB 1WBYA 4G8EA 4JM4L 1Y1DA 3L54A 4EN3B 1XSJA 2VERA 3IDYB 1JN6B 5IZ7A 1PFCA 3LSOB 1IAII 2EIJB 2DLIA 4OZFB 4B9KC 1NCOA 2PPCA 1ZMYA 3FUJA 2WTOA 3I6KB 4G7QB 3SJVE 2CK0H 12E8H 2R0KH 3E3QE 5DHVB 1N6UA 1QD0A 4LOFA 4XOBA 1MUJA 1DBJH 1ZLVK 1CU4L 4Y9GA 2OMZB 4UU9B 2G2RA 1EEQA 1J5IA 2RHEA 3A5VA 5SV4A 5D2LF 4K71B 4P8QA 2V17H 3PWPE 4JN1H 2YGNA 2ZUQB 3GKWH 3UZVA 1J8KA 2UY7B 5EU5A 4MMXC 1WTLA 2R1XB 2IG2L 4PJCB 2VLKD 2EIZA 2P80D 1I7ZB 1QLRA 4ZS7L 2C8NA 1UWXK 2NY5C 4G3YL 2HJKB 3KGTA 4IBSA 3ZN6A 4N2FA 1MFNA 3VO0A 3X2QB 5HGAA 3LN4A 2HLAB 3WGVB 4L48A 3EUUA 2IFFH 4D9LL 2RFXA 4GW1B 3ZU8A 4EDWH 5E6IA 4R4BA 2R4SH 3FQXA 5I0ZA 1JYVA 3JUZA 3JV6B 5J56B 4P59H 2OMTA 3ABLB 4L9LC 4G7VL 1DJSA 4JCLA 4UV7L 3U30B 2OZNA 4IDJH 3CFCL 2R0ZH 3GBML 4P3CL 2YK1H 4O2FA 5DJYB 3UYOD 1GZHA 2YAHA 2DWTA 2J1YA 4MDRA 1JZ8A 1TKWA 1XXDC 3L1OH 1V27A 3MA9H 4MKMA 4OF6A 4IRSB 5FLUA 2J7LA 4M6OL 3DYOA 5DVKA 3PDDA 4GYBA 3C60B 4GINA 1T7VA 1KZQA 3OXRA 5D8JL 3IJEB 5IG7B 3G9VA 3MNZB 2HMID 4F5CE 3NIDF 1AC6A 1KJVB 4ADIA 2XTJC 4BXVA 2Y7MA 5E6RB 3CHOA 5CBAB 4GIOA 1KJ2H 4KOBA 4DTGH 2FK9A 3K6FA 3IE9A 1H6EA 2J5WA 1DJXA 1NLDL 1QHPA 3BPLB 2ZCLL 1Q0EA 5KVDE 1YY8B 3J07A 4HVBA 1F4WL 5D1ZA 1QFWM 3O0RL 2IALA 4GO6B 1OCOB 3T2NH 4FF9A 4OM0L 4PP1D 3R4RA 1BEYH 4DAGH 5T3ZE 3ZRSA 4WGWB 1XTLA 4JRXE 1NGXB 2FJHB 4IOSD 1M7IA 1AI1L 3NSYA 2YHGA 4UM8A 1N6VA 4AZ8A 1FZOA 4H26A 5KJRH 2WLIA 4P9HH 3DX6B 3D4YA 4MJ5A 3IMBA 4IKNA 4JS7A 4KAQH 3CQQA 1YRKA 3CC5B 5DD6B 3VACA 3IRZA 4LSQL 3OKOA 1S7VA 2DQJH 2OQJB 4JPSA 2UXVA 1N5YL 1GYVA 5BRZE 2I9TA 5FM4A 1MZYA 1IJ9A 4CMHC 4I2XE 3S3CB 3TVMD 2WVTA 1ZANL 1PKOA 4WFHE 4CU6A 4FQPA 1T5XB 2IH9A 2EXSA 1U8HB 1WDAA 1KLFB 4Z6AT 1QLEH 1I8KB 3S4SA 4QF1B 5E6ZA 3UO8B 3GI9L 3MV11 4YXHH 4DJMA 3QJTB 4JG5A 1I3GL 2ARWA 2UYLB 1M6OA 1CG9A 4XCNB 5CSZB 4U7MA 2L04A 3AMKA 4NENB 3O6MH 5HHOD 2M2DA 4Q14A 4AQ8A 3SBPA 1X6LA 1JNNH 1JYWA 3M7FB 1X7QA 5KBNC 5KVMC 1HEJC 2PP9A 1UZ6E 4FXGB 5AW9B 1QSEA 3ATDA 1HXYB 3BMVA 1MI5A 1VEMA 3MJ9H 5C0BB 1K4CB 4HKXB 4S1RL 1FIGH 3MCYA 4XWGH 1OL0A 4G6JL 4XI5D 3FHEA 4IGBD 4CSPA 3IPEA 2J55A 4HKJA 4JPKH 4C8XA 2UXGA 4PY8I 5D6CA 5BV7B 1TUPA 4UDTB 5DJCB 3LVEA 4QYOA 4TKWA 1PZSA 1JAEA 4HAFA 5CBEA 4X7FC 1XH3A 1ZEAL 3O8XB 3Q0HA 4OLZH 3HG3A 1XQ4A 4H2CA 2JB6A 2EE2A 3G6JF 1DTUA 2P7TA 4X83A 3S9DB 4A2DA 1HHKB 1I8AA 1UXMA 3PL6B 4UQIM 3QE5A 3KEDA 3OR6A 5AAPA 3MRQB 2A77H 4TL5A 4ZUVA 2Y23A 4U1MA 5KYWB 4G6FD 4MVBC 2E6JA 3IWVA 4PJ5E 3FFCA 4UT6H 1PG7H 2QQKL 2YARA 5AVYB 5MERB 1NFAA 2IADA 5DJ6A 2AJVH 1MH5A 2B8OT 1EHAA 3OTTA 5C0RH 2X3AA 1H3VA 2VRQA 1N12A 1CD0A 2WQRA 3N85H 1GGCH 5FYJL 3RVUC 3OPZH 2BH0A 1E9PB 3J8F7 1DLHA 3BO8B 3QUMB 4JMXA 3ULSA 2AITA 2ZG1A 4GUOA 3EJSA 3DLQR 3ZHNA 5DMGC 4N9GB 4QTIL 4DP1X 4QTHB 5FKAA 2VR6A 1E42A 4RAUA 2IIJA 5DDHB 1SVBA 4E5XB 1BMWA 2JNZA 2XWBB 4FZEL 3ILQC 2M26A 2GAZA 3BVNB 3T3PE 2VMEA 3WY2A 2GBVA 2HKFH 3T4AB 5JHDE 4NC1E 5BZXA 1CDYA 1YMMB 4K2UH 4ES8A 1GS6X 3BIBX 3BVWA 2FATL 3MACL 5DR5H 3D39A 1A14H 1AIZA 5KSVB 3FQYA 4ZXBB 1QPPA 4GSQA 4WO4C 3X1GA 4CW1A 2MMXA 1KPUB 1VEPA 3Q7JA 1KGIA 2OMYA 2R8SH 3VXPB 2PYEE 3TNMB 4GRWF 4L8DA 4PS7A 1JYNA 4BYHA 5HVFB 1U3HD 2NXYB 1R5IB 2BCKB 2CKBL 3OAYK 3VD7A 3LN5B 4H40A 3O2VL 4W6WB 1PYWA 5DU7A 4LDCA 3MCKA 1JHTB 5KVDL 1CLCA 4JO1H 4X7TA 2W8CA 2H1PH 1HQRA 2N7SA 4APXA 4ZMWA 5GGSA 4PTTA 4L29A 4KBPA 3MODH 4WJKB 1G6VK 2ICEB 2MHAA 3FB7A 4BCXA 1KBVA 1YNTA 3DVGB 4N8VA 1UT1A 1JNHA 2ITCA 3DHMA 5IJCC 4LCUB 3SGKA 3CVCA 5AW7B 4PG2C 4TOYH 4QHLB 3LZNA 2PTUA 4PVNA 2PTVA 3M45A 4I1NB 5TPWH 1SBSH 1MREL 1YQVL 3LNDA 2X4PB 3QI9C 5EC1A 3UTTA 4PJXE 5IEKB 1TITA 3ZKSD 2YPLE 3VFNA 5I1HL 5EO1B 4YS4A 2QSQA 3F7LA 1MQKH 1BQUA 1SN2A 1F4HA 1W72L 4PWIA 3H9YA 4TN9A 5JW3L 4CVUA 5L2KA 2PCYA 3PAVA 4XTRC 1UM5L 3AXHA 4PGBB 1PDKB 5E8NB 1CLZL 1DZBA 1S7TB 3DDGA 4FYQA 1W0VA 1WZMA 4HA1A 3BX7C 2F7IA 4HGKC 5KBMA 2YUWA 1E4WH 1HDMA 1AP2A 5HXMA 4PAZA 2BHZA 3QDGA 5SX5H 4G9FB 1MW0A 3ECBB 1EFXD 2DYPA 2P42B 3DXAB 3FU7A 5AG8A 1G7IB 4Y19B 1BVLB 4YHNA 1RY7B 3CSFA 3EGSB 1QLFB 1UA6H 4ZNEE 2YRZA 1D7CA 1J1XH 1YYML 2A99A 2XG4A 1U4EA 4R6UA 5ESQB 5IEHB 4AT6A 3NACH 1BMZA 2YSSB 2QKSA 1DQDH 5JOFA 3AWGA 5M7QA 5C7XL 3TPUB 4B60A 3IAPA 4HG4J 4R3SA 4POYA 2WSDA 4JFDD 1B9ZA 1UH4A 3ZE2B 4XPAL 1A6ZA 3WIAA 2XXGA 1SMAA 3FXIC 2BP0A 5C07E 5IHZA 5I1GH 4ABVA 3IETB 5IVXA 4JRFA 4I0CC 2BY0A 5FO7B 2K9UA 4M8VA 3V4VL 4WUUA 4ATWA 4HJEA 3OHXA 4AEIL 1DVXA 4FA8A 5F3BB 2ED8A 3PWUA 4P5TC 2EVGA 2XZCL 5GRJL 1UADC 1G7PA 2AK4A 2DEWX 4UINL 4IRZH 4OD1H 4P23A 4B9GA 2R7EB 1DFBL 3PWVB 4EDXB 1QSFB 4IRJC 3OAZH 2FNWA 4KRMB 1OTTD 1PS3A 2Z7ZA 3V10A 4PWGA 4LCWB 2DTMH 4N1CA 1GZHC 3RZCB 2YRPA 4KOCA 2AV1B 2NY1C 2CUAA 2GPZA 2JKTM 4P99A 3VUAA 4F2MA 4PWHA 1Q94A 2HX7A 4HXAH 5TF1H 5I6XB 5ENWB 3LS5L 2YD9A 5C7ZA 1NPJA 4QRQA 3WFZA 2BZ7A 3TBYA 4U1KA 3D06A 4N2CA 3VXUE 4PJIA 3CMOL 5ABAA 3Q6FB 2CO6B 4JR9L 2EH8L 3IMVA 4Z7AA 3V2AR 3SDAB 4P2QA 3NJLA 1BWWA 4R4ND 1HILA 3V55A 2NR6A 2QTVA 5DD5L 2VH5H 4AYMC 2DQHL 5IBLC 4I5BB 5HYJB 4MBOA 3UACA 1MFAH 2BP8B 4ZQKA 3PE9A 2V7NB 4B7IA 5HYQB 1LO3H 3T6QC 2W0KA 3TYFB 3MOBH 4G6MH 5EOCJ 4JREB 4ZPVA 3O11B 5IESH 5A16A 1WA0X 2K4WA 5I66B 1I1AA 1DDTA 2VXUL 3QFJA 2XYBA 3PXLA 4YL4A 4ZUSB 3RFRA 2ARJA 4MLSA 3T8XB 3NIFE 2DJMA 1I9RL 5DWPA 1AQ8A 3FQNA 2XETA 4J3WA 1FBIH 1MFCL 1YEWA 3NRFA 3NTCH 3STBA 4FG6C 2AJXL 4N2MA 2V8MA 3OKEA 5F1OB 1H5BB 1IAIL 4LOEA 4H8UA 3B2XA 4ZZFA 2VDRB 3S4SG 3VXRD 2EO9A 5E0QA 1CXHA 1BFVH 4G71B 2H1LM 4NQUA 4R84A 3ZHDA 2Y2YA 2F53D 1PX4A 3BEWA 3E6FA 4ZOEA 1OW0A 4TQHA 4DVRL 3WN5A 5IFHL 5FUCE 4KKAC 4JKPL 5C09D 2L7UA 4I9WE 4B27A 2H2PC 1N67A 3CN4A 1CJYA 4NBXB 3U9UB 2CR3A 5MEPB 3VFUB 5B39A 1RZJC 2NNXA 3U25A 1INQB 2DWEA 2V3DA 1DHKA 1X9UA 3BKCL 5KVGE 2WXJA 3DOIA 4KZDL 4PWEA 5C0ND 3RGHA 2GTWA 5FHAH 2UZPA 3UP1A 5CJ5A 4E9XA 4U1SB 5E2TH 2X4NA 3G9AB 4CC1A 4J5VA 3JTTA 4XC1L 1N59A 2Q7YB 1MCWW 3V7MA 1XF4B 3VU2A 4MQXD 3TF4A 4KXDA 3RA7H 5I9QC 3REWA 5I15L 4XN5A 2FSEA 3D18A 2OW6A 5KBKA 1FZMA 4YDZA 3ROOB 2OMNA 1KGJA 2X4TA 1DVTA 5CO1A 3SDDD 1J0HA 3UYRH 1PNDA 3K46A 3SE4C 4DGIL 1BVNP 3D05A 4N90E 1G7JA 4NSKB 1CLYL 1JD7A 1H3PL 3FQTA 2EP6A 3PV6B 4MJIB 1TVBA 3UH8A 3BZ5A 1UWFA 4HH9A 1E2VA 3EFDL 1D5IL 3U9WA 3KVQA 4H0HB 5E00A 1XGTB 1CGSL 1RZKH 3QQNA 1WGVA 4BZ1L 1UKQA 3WJMA 3O45B 2FO4B 4X98A 3U0WH 1CFQB 1PY9A 1UOLA 2V33A 1VESA 3AY2A 5CZVH 5T1KB 1ZS8B 3QCTH 3IU3B 3UJIL 4BDVA 4ODWA 2MCMA 2YC1A 3RI5K 1CIUA 2P52A 2VQ4A 1CB4A 3VRLE 5KZCD 1PKQA 3NEXA 5TGBB 5I1IL 4JFEE 4ZK8A 2IPTH 3LZOA 4R8WH 1NKGA 2XI9A 3B5GA 5HSFA 4YDVB 1JV5A 2HP4A 2P26A 3HHSB 4PCKA 3CIQA 5F3FA 3BSZH 2DY2A 1KB5L 1MJ7L 4EI6A 4Q6YA 1ZVSA 4RMBA 1AO7D 1OSYA 4G6KH 4WHDA 3RY6C 3H42H 8CGTA 4HKBA 5IMOA 4QRRA 5GHWL 1UXLA 5FW6A 3QEHA 3HPJA 2AKRB 4L05A 4LDEB 3QNXA 3VI4E 4L1SA 3HLKA 2FT8A 2XQBH 1LEIA 1P4LA 4CVXB 5HHNA 2OSLA 3VXNA 4HG4K 1XSIA 3TJHD 4GMTL 2PWGA 1OAQL 3P0YL 1XF3B 4U49A 5JTWA 3ZYZA 2I07A 5JXED 3IU4L 2PYFA 3ETBF 2VB5A 2DQDL 1ED3B 5SWQB 3N42B 1H19A 3UERA 1F4XL 5F1IB 2L4OA 1W0WB 3GM0A 1QVOB 2FJFB 3T3MB 3JZYA 4AOFA 3QCUL 1J5OH 1SXSA 2FBOJ 3DX9B 5TK4A 4FADA 1X5AA 4X4XB 5E9DE 43C9A 5SWZD 3WD5H 3BWAB 4KROB 1FSKB 4PJ8C 1UCTA 3QEGH 4GEJA 3CLFH 1EZVY 1AG0A 1X9LA 4UOZA 2BW4A 4R0LB 4ORGA 1IT9H 2QFPA 2ZXWB 3BP4B 2FWUA 1A9EA 1IAOA 2BNQE 4OVVA 4U3CA 1I8MB 2QKIA 3QDAA 3C2AH 4NP9A 5C0AD 3EO0B 3L95B 3MRKA 3U6XA 4BSVA 1OSZA 3RJOA 1G0DA 2X40A 3IBEA 5KSAD 3G5WA 4IOFC 2XTJE 3SGDH 1ID5I 2WW8A 3ECUA 4BELD 4MWFA 3F3HA 4R4FH 1S7XB 1A1NA 5FFLA 3CVBA 3QO0B 4Q74A 5H35A 3C5ZA 2OR7A 5JW4Q 1QR4A 2ADJA 4LAQH 4HOZA 3H54A 5FO8A 1HJCA 1DP0A 2A73B 4DEWA 4MXVF 1NPUA 3QPXH 1YEFL 4HIIB 2VO8A 2XC8A 3MRHA 4XX1G 4PEEA 3NCMA 1VZHA 4X0NA 1LE5A 1WWWX 3BD3A 3DWTA 4QHKJ 3TO4C 1NL0L 3MJ9A 1NANH 3MVSA 2YPKB 3VYPA 4KJYB 5A3IC 5JO5B 5L2JB 2HG0A 4ODVL 5EU3A 2LFEA 4LRNH 1HL5A 3A4DA 3QIUA 3QUKA 5ISZA 4A63A 1KCKA 5AVUB 1XIWD 2F58H 4HBCH 3HLAA 2X9WA 4DCQB 4DH2A 5E08H 3BH9A 3KLHD 2J21A 1V5JA 3EGXA 4LVHB 4P46A 3CVHL 2R2EB 2CHNA 3QXDA 3V9CA 5GISH 4L4VE 5KVGL 5IHUL 1T22A 2FEJA 5I8OH 3QK0A 3VFOB 2PXYA 3IYLW 3FOMB 4LLMB 2VDOB 5HGDB 4P2RD 3WKMH 3NCEB 3OVUB 1W72B 4JW3A 3QIWB 3FO1A 1NMBL 1L7IH 3NZUA 3GYRA 3UBHA 3QYMA 1FP5A 1JK9B 3ES6B 3MLTA 4HIEB 3ECQA 4RZKA 4YZFF 5TDPB 3UTPD 1YDPA 2NY2D 3CVIL 3NCCB 4NQEE 4U33A 1T1YA 4A37A 3QRFM 4G70B 3MBED 2Z65C 1SDYA 4WI5A 4L3CA 3BDYL 5LXVA 3UAJD 1XGQB 3OAUL 5GIRA 3BYTA 1G9ML 1GGIL 2IWEA 4UIMB 2CO1A 4OCWL 3GK8H 3Q48A 3UCRA 2R2HA 1MFMA 5D72L 2P5EA 3KM1A 4MMZC 3RGVA 3VG9B 4WY7H 5CP3H 1N8ZB 1EQWA 4UAHA 3FT3B 1XF5A 4JFZL 4N0YH 4IKIA 2DH2A 1N26A 2IBZX 3VMNA 3NJVA 3DX8A 4P2AA 3V5DB 3ISYA 4IBVA 5CWSB 1DSYA 1Z9SA 1MDAA 4LSPH 5GSRA 2VXSL 2EC8A 4BUGA 1HOCA 1A6AB 1KJ3H 5IFAL 1RPUA 1A7RH 4HU2A 5GS0L 4V2CB 4NZUL 2VAJA 1LTXA 1L9MA 4PGCA 3KGSA 2YMTA 3AY4C 2GHWB 4LXFA 5EOTB 5FEBA 4GEIA 1X5ZA 1BECA 3WLBA 3V4VB 4UZUA 4WV1C 2KBGA 3WHE0 1D5RA 3TYGL 3H7BA 3VXMB 2QADC 2PKDA 4RGNB 1ZGLA 4NI6A 2HRLA 4PSRA 5FDWA 4LSTL 3DOHA 1JCVA 1LO0H 3LDBC 1BZDA 5DURD 3WU1A 4FTVE 4I7ZC 4GAJH 5EUOB 5B1JA 2RTTA 1F4YH 2WAHA 2JIXB 2FEEI 2FRGP 3DRTA 3MREB 4HCIA 5K9QI 4AYID 4NO0B 1BIHA 4HIQA 4NJ9H 1MHCA 1IRAY 5DRZA 4J1UB 3GSWA 3VYOA 2XICA 2DLHA 3PXHA 1G9EA 1AJ7H 1U8PB 2ZZUT 3ZK0A 5D7SH 2NY0D 4EUPB 4I77H 3PYCA 1NLBL 3ALXA 4YAQB 3EDFA 4BKLB 2EILB 4TUOB 4FQHA 4YPJA 2AHIA 3G6AA 1BZOA 1XFPA 2YMXL 4XPBH 5F93C 1T03H 5ACMA 2NNRA 4KJWD 3V0EA 3ZKND 1FO0H 3QORB 4AGMA 5JLZA 1YYCA 3ATFA 3DYMA 4KK6C 1F6LL 5KYYA 1CGWA 1MLCA 1X5MA 1Z9NA 4JB9L 5KAQF 2DWDA 1NCAL 3GIZL 1MIML 2ZOTA 3L3DB 4JFOA 1BAGA 3VFPA 4KUCD 4GRLA 3VM7A 3WTSA 2L3BA 1T21A 2GEEA 1RUKH 3BCDA 1BGXH 3D0LA 2V2XB 5IIEB 3HAEA 2C1PB 1U6AH 1KTLB 1A64A 4Y9EA 3LXBA 2CGZA 3RWIB 2BNRD 3V0WL 4WI0A 3NCXA 5I6NA 4HDIB 4PJBE 5J13B 1WICA 1M05A 3HZVA 3OAZK 2UWEA 4IRSD 2Y7NA 5IFJA 4F3FB 1TG8A 1OW0C 4HIXL 5EBMB 2JE8A 1Q1PA 2VZ1A 3NYKA 2IMMA 1N10A 5KN5B 4M7ZB 1HX0A 5ID0A 1PZDA 3FCSB 4UQEA 2LFGA 5C0GB 2H6PA 3HNSL 4KPHH 1YSOA 5JHMA 3INUL 4KV5F 4X80H 5C0IB 2XN9D 4G1EB 1R4XA 2EDQA 3MR9B 3TFKD 4ADJA 3W2DL 1P84J 1E7UA 1S9XB 3ZZLA 5J6HB 3RPIB 3GSNH 5FO9B 5JW5B 4Q58C 1AH1A 1DYZA 3GXDA 2F7QA 5IM7A 4F8PA 3MX0B 4X9FA 2KLSA 3NH7L 4F8NA 3KDPB 2A6KA 5E6YA 2LVCA 2XXCB 2BRQA 4A7VA 4DGYH 3SB3A 5GS1C 1OP4A 2IDUA 1IEAA 1F41A 5D1XD 3I6LE 1WWBX 4QXTB 1U8CA 4PJDF 4Q6IB 4WWKA 4I8DA 2UY6A 2FO8A 4Z7UA 2WUBH 3K0WA 4GI9A 4JQVC 4L3AA 2FLMA 1IJNA 3V6ZB 1L3NA 4N1HB 3QJOA 3GXIA 3UGUA 1E4XL 1MCCA 1T66D 3O6FB 4HUWB 4JFWA 2MPVA 3QDJE 5ICZB 4O2EA 5JORA 2CMRL 2RCSH 4XE0A 3D3VA 3RAJH 4Z8FL 4JDVB 4L37B 3NA4A 4XVSH 2P9RA 1UHVA 2DQUH 5GGUA 1VKXA 3EYFB 3TZVB 5IB5B 1KYUA 4X5LA 1KIQA 2C9RA 2GY7B 2ADFH 2WLHA 5HDBB 2XBDA 5C08A 1GCFA 4OGAC 3BGAA 1BQRA 5HHXH 2XKNA 2EXTA 3DDFA 1IC5H 3DROA 4HUXB 1MWAL 3CFKA 1JYXA 5ANHA 2V6HA 3UPRB 1RZIA 1RK7A 2XZAL 1IKNC 5JHLA 1Y0LA 3KXFE 4JY4A 1KIRA 1P7HL 4Y88A 4FQ2H 2Q86A 2XFXA 5C0BD 3MLUH 1EAOA 2EKJA 3T77B 4YSCA 2B3RA 2EZ0C 3IBOA 3X3FL 1OTSC 3FL7A 1XVSA 3B3BA 4U6HA 5IMMB 5BOPA 5J12B 1CFTB 2ZX6A 4P04A 2FHBA 4QO1A 4HXBL 1ZSDA 4N0UB 3HUJB 2Z8RA 3RVTC 1SEBB 2HFTA 1BD2E 1IC0A 1KIUB 5BW7A 2Z35B 3D07A 4PYGA 2R0LL 3KYNA 2EVIA 4K7PL 2ZOKA 1D7FA 1TCRB 3BZEB 5FB8A 4D0DA 4YHKH 2AJZB 1VFBA 4KI5D 1FYTB 3HW7A 3NDZE 3AXLB 3GMMA 4PG9B 4LP5A 2YKLL 1NCWL 2NY4B 3PL6D 2WNXA 2AJUH 3DPBA 4UB0L 1P6WA 2F08A 3BLKA 3IDIB 2OR9H 3FO0L 2RMNA 5CS7A 5J6GB 4PLKC 1KN2H 4YZWA 2AQNA 4KJQD 1QZNA 4NOBA 1VFOA 3BOVA 3TO2A 2WM0A 3AS0A 3KYAA 4GT7A 4K4KA 2I26N 4QLRA 4OZIB 1AZVA 1VEOA 1M1SA 3K71A 4MX7B 1RURL 1O7DC 4YDJA 4Z95H 3C5ZC 3CD4A 3LD8B 1D5BB 3N55A 4XNMB 5FA4A 3FTUA 1OVZA 3QUZC 1PZBA 4PB9H 3BPOB 3EOBB 3AQDA 3SKOA 3A23A 3IDJB 5DEFB 3T0XA 4QNPF 5IF0B 2ATAA 4LK4A 2BIIA 2ERJB 3SE3A 1NC4D 3BN9C 2LAGB 3F12B 5E99H 5CEZE 3CLEL 5EA0H 1M3IA 3KJ6H 1ZHBB 2DBLH 1J0ZA 4XMLH 4XAWH 2FWOB 3GHEL 2GTZB 3BP6A 4HSCX 3V9FA 3PLYA 3GJFH 3QQDB 4JGUA 1DEEB 3FOLB 4K55A 4TXVB 4X7SH 4CVZB 3KWVA 1YMMD 3WIHH 1R17A 3D09A 4XP1H 5A2KH 1UOVA 4CDHA 4W4NA 2I9LA 2WANA 4NBYB 3CH1A 1X5YA 5GZNA 1TETL 2YQ2A 4N2GA 1D2PA 4ZXBD 3MBWB 3P2BA 1Q9WA 3U0PA 4RA0C 3I2CH 4D0BA 4YDIL 3UBXG 4HIHA 5C0CB 3RJQB 4ODSL 2LU7A 2WB1A 4Y4KB 5F0JB 1YVLA 1QASA 1QEWA 32C2A 3CPUA 3PV7A 4J3SA 1ZA3A 1NDMB 1B0WA 1UM6L 1CLVA 2PXYC 2YPVH 1V3JA 4G42B 4ZFZA 2FBJL 1U8JB 4NJAH 5F0LB 2ADYA 1WPCA 2R29H 1YZZA 3A6CL 4WDIB 3EOYG 1CI3M 5GRUL 3RIAK 4XAKE 1L0PA 5ESAB 3HBZA 5HYIA 1RIVL 1T83C 3CZKA 2PWEA 3I3EA 3LZFH 4NZTL 4IKLA 5GGSY 1Z9MA 4EE2A 5I71C 1JGIA 4XWOD 2YRLA 2J12B 4R9HA 3SQRA 3WSQL 3AB0C 5AZ2H 1YEHH 15C8H 2FQEA 4OZHB 5EN2A 1UJ3B 3EBGA 4X6CB 4B9CA 1SDAB 4OJEH 4X6BA 2WP3T 4CGUB 1I8LA 5G2NA 3GHBH 4JHAL 3IKCB 3KPQA 2CDFA 4HYTB 2HFFA 4P07A 2XBZA 5HDWA 5JR1H 4NN6C 4PJHB 1JPFB 2QVTA 1P84K 5I8EB 3DJ9A 3NJNA 4IMKC 2Y22A 1QBLL 5E5MB 4GG6B 1DQQA 4RBPK 2Q0ZX 2BSDA 1KYOJ 4FJ6A 1KV3A 4Z7WF 5CEYB 1XGPA 1GIGH 3NSDA 4FQXA 3FO2B 1FFPA 2Z7YA 1O6SB 1E3FA 1DR9A 2FJGB 1KJMA 3MRJA 3KH4A 5DD1H 4ZMNA 2WBJB 5IJKC 1EEYB 4YSTA 5HI3C 1XXFC 2AAVA 4JGNA 2V7HB 1CR9H 4BJLA 2GJ6E 4G9FD 2R0WH 1Y7VA 4KDVA 1Z5HA 3DXAD 1TTFA 3QFGA 3GPSA 4Y19D 3B2UC 2RIKA 3OKKB 5D96B 5JDJA 3BQUB 1WFTA 1JGLH 4YC2B 5AW4B 4ZS6C 4OJFH 1MFEL 2EDBA 4Z0BL 3OL2A 4HK3J 4XGZB 3B2VH 4J7RA 3ARGB 2X10A 3ZKQD 5JYLA 4N20A 4WENB 1DVFB 3D1MC 3DTXB 2WJ5A 3RB7A 2CA4A 1FNSL 2W60B 4PIBA 1NKRA 4FFYL 2R4RL 2CD0A 3I9AA 4CDGC 2WVVB 4PLJD 4OLYH 2HCZX 1ORQB 4M62L 4PHXA 3N9GL 2CO7A 2V2TA 3P9MA 1DJYA 1GS8A 1KBWA 3D9AL 1MCOH 4NB7A 5IGXH 2AANA 2ZSVA 4PRBB 1HK6A 3QRLA 5AYUH 1NCUA 4BIKA 3HI1B 4C47A 4GXUM 1TZGH 2FX9L 3FRUA 4ABUA 1D5ZA 4L8SC 3CDCA 1P7BA 1AXTL 3PIQA 1W6WA 4EQ3A 4WCYL 4CL7A 2IAMC 2VLKA 5LAXA 4F8OA 1XTMA 3ARYA 4GRLC 1GL4B 2P80A 1A6UL 4ODTH 4WW1A 3X17A 1C5CH 1N4XL 5J1TC 1HESA 2WWMC 1FN4B 1GH7A 4Z78B 2KYIA 3TP4A 4HV8B 4FA7B 5KAQG 3TEZA 3BT2L 4B9FA 4QUOA 1WAAA 5JOPE 5IHHA 5DZVA 2B14A 5AOZA 1AY1H 5B3JF 3QYCA 4MCZB 4X5QA 5L88L 1O6VA 1S9VB 2I60L 1RZ7L 2JFCA 3P2TA 4JDEB 2BIHA 3LKSA 4QRPB 4XMWA 1I1RA 1MVYA 3QAZB 2Q3AA 4AC2A 4BSJA 5CEZL 2O61B 1DBAH 5I0WA 1QMUA 1QAWA 3MRFB 5FYLH 3RUGF 4M9OA 3U4EB 3DV4A 1BLNA 5HHME 4E9TA 1IKFL 4RFNB 4KTDL 3NSXA 1EX0A 3ZMRA 3L81A 2IGFL 5F7NC