4AWJC

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
135
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 135
sequence length 139
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4awjC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4awjC01
4W9GC 4W9EC 4BKTC 1VCBC 4WQOA 1LQBC 4W9JC 4W9FC 3ZTCC 4W9LC 4W9KC 4W9HC 4AJYV 4BKSC 1LM8V 4W9IC 4AWJC 4B95C 4W9CC 3ZTDC 3ZUNC 3ZRFC 3ZRCC 4W9DC 4B9KC 5LLIC
chains in the Genus database with same CATH superfamily
3FQNA 2DIAA 4XE0A 3IDMB 3LZFH 2WZPA 4HIHB 2PW2A 1BZ7B 4RX4D 4U1KB 4U49A 1GH7A 3QEUA 4JQXC 3GBML 1J9QA 2BVYA 4L29A 3Q2LA 1NDGA 3HE7C 3MC0A 3QJRB 1TITA 1PL3A 3TO4C 5I5IA 1NOLA 2AAAA 2A6IB 5CN3A 1XB8A 3MR9B 3N85H 4DN4H 3TEZA 2QV2A 1FH2A 4OZ4A 1N59A 5T3ZH 4U7KA 4LASH 3TEWA 1A7QL 3UYPA 5JIIA 2WYIA 4H5SA 2GJZB 4N8CL 5CJXA 1IFGA 3LEYL 1G6RA 2X70B 3SPIA 5I0ZA 4P9HH 4DOHB 3GLDA 2FNWA 2XKUA 4PJFE 4KOCA 1JBJA 2Z7UA 2OSXA 2ERJB 1QZNA 3O3BB 1AIFB 4Y1SA 2E27L 3VQLA 5GRZA 3ZY7A 5B3JE 3CCHA 4MMZA 1UQSB 3QQ4B 3VFTB 2GPZA 3U9PH 2XX0A 5GGTA 2ARJA 4MCYA 4F7EB 3OWRA 1OM3H 3US0A 1N6UA 4JFPB 2CNYA 3INUH 3MNMA 5JLZB 1IAMA 5C0GB 3AG1B 2W65B 5CBAA 1C8QA 4JDTH 3SBWC 3TYGH 2HRLA 3G9AB 1V10A 3OHXC 1XSOA 4HFUL 3WLWD 1AGFB 1HESA 3CWGA 2RBLA 1RJLA 4WQOA 1HKFA 1I75A 3L5WA 3AT9A 4KI5D 3RLSA 1KV3A 1PTZA 3VI4B 4XB7A 1PVHA 3WGUB 3F62A 3P0VH 4PV9B 4GS7C 4XNQA 1D5XA 3UIZA 1EDYA 1E8ZA 4ZW3A 1J8HA 5IB4B 3DTXB 4PJDE 1OGAD 3NOIA 1MFAL 4K0OA 5JW4M 3K5SA 1KGJA 3NG5A 4DP1X 2EQDA 1V54B 2L7EA 5LGJB 2Q7YB 1K8IA 1N26A 1U8MA 1P2CB 3JXAA 3LIZH 2BINA 4G6JL 1L4IA 4AG4L 4M3JA 3VD2A 1FFOB 3UP1A 4EZKA 4IMLA 4NZUL 5JDSA 2ICWJ 4Y5VC 2OMYB 1CICA 3VH8G 4PBWD 1WUNT 4X4ME 2NZ1A 4JM2A 3PDOA 3TBVB 4X4XA 4QO1A 4NRZB 2F7RA 4QYAA 5ICZA 4NGHL 5MEQA 3FSOA 2VLKD 4KK5C 2DLFH 1WDAA 4X42A 5KVFE 1KLFA 4OCLC 2IIJA 3G5XA 1MY7A 2PXYA 4HMCA 4X83A 2IPUG 5F3BB 2H1XA 2CLVB 4TTDC 1WYJA 4L5FL 1AZVA 2I07A 2IOOA 1JG9A 4X4KA 3K91A 1WFNA 3HAEA 2PO6B 4OKDA 3T3PE 1XH1A 5GRJH 3UABA 5JHDB 2AQQA 3OLGA 2WNWA 4M7JH 3L9RB 3PHQA 4KQ3L 2DJSA 2P24A 3CMOH 2YXWA 3A4FA 3VB9A 3U2SB 3FXIC 1NMAH 1OEZW 2Q3ZA 3FQ1A 4UQDA 5AVUB 3EH2A 3FQRB 3G5VA 2IQAB 1QI4A 1SF5A 4WFGD 5T1DH 3UG3A 4ZW5A 4HKBB 1IGML 1NFIB 1GGBH 4E9VA 4MJ6A 4I4WA 1CLZH 1YEIH 4PSPA 4DK3A 3R18A 2CH8A 3KPMA 2YFNA 4KRPC 3LAFA 5D5MA 4QWWD 3DGCR 4G7RB 2PYEE 1JNHA 4X7SH 5FX3A 2BZ7A 2JKWA 4P4KD 1ET5A 2VC2L 4NZTL 4XVSL 5EOTA 3MRBB 4MS8D 2P7TA 1Z9PA 1IARB 1MJ8L 2VDLL 1IAOA 2J72A 3GHPA 1PX8A 1DCEA 3F7KA 1R3LB 1MWAL 3U6XA 3IBEA 3DOHA 4XN1A 1WZLA 5FR3A 3KR3H 5DUMH 5L4FA 1BBDH 5JXAH 1EMTH 2OA9A 2XQYA 35C8L 4NHCH 3CSYB 3QZBA 5C7XH 5E70A 5ITFA 4HJUA 2NQCA 4S0HA 4U1KA 3IPFA 2CO7B 1N5YL 1R19A 3BPOB 3MPCA 5J6HB 4OU3A 4LCCC 5EOCL 2ODIA 2MPAH 1BAFH 1QSEE 2A6IA 3MR9A 1GGIL 4W9DC 1T2QH 4Q58C 4QF1B 5BQ7A 2HA1A 2MCPL 5JHMA 4PG2A 5E4AA 2XNAB 4HK0A 1SLXA 4LAQH 5DZJA 2W0LA 4FXGB 4G6FB 1IE5A 4ACPA 5CNHA 2VM3A 1FNSH 2F8IA 1XGUB 5IHHA 1XGPB 3BI9X 1AIFA 1FWXA 4P2AA 4M29A 3UBHA 2AEPH 3OBAA 2JTYA 1T1XB 4J3OG 1UQSA 3QQ4A 3VFTA 2WXLA 4UIKH 2HTKC 4MA8H 4KUZH 4G7SB 4F7EA 4JRWA 4PB0L 1IVTA 3RVXC 1JIBA 5I71C 3KCPB 4JFPA 4XNDA 4TLSA 4ELDA 4Z77B 3GSVB 5JLZA 4RSYA 4U1GB 5C0GA 2W65A 1CC3A 4OV5B 3I6SA 4WIQA 5IQLA 1RK1A 1EEYB 1AGFA 1GSKA 4MX7B 1Q1JH 2XOTA 4L1BA 4OCXL 3VI4A 4Z0BH 3KAAA 4AVIA 2XA3A 1DVSA 3EIFA 1AJ7H 4F27A 1MRCL 1SXCA 2V3EA 3FQ2A 3QARA 1ED3B 4QRTB 2QKIC 4KK6C 2EDEA 4G82A 5IB4A 2GI0A 1J9RA 3DTXA 3ENEA 3HS9A 4NN6B 4U3SA 2PW1B 1EFXD 3C09C 1JZJA 3TH3T 3ZHFA 3GRWL 3LKSA 1JGLL 3BAKA 4X6CB 2EEBA 2A74C 1AIZA 2V8MA 1AE6L 4W6XB 5LGJA 4GRLD 2Q7YA 1U3NA 2Y7OA 4RFOH 5I5MA 4OJDH 3FH8A 2NRDA 1A1OA 1NPJA 1KCRL 4GKNB 2ZUTA 2IANE 2NR6D 2CKNA 1P2CA 5DSCA 1DBKH 1FIGH 4TNGA 5E2UH 2ZICA 4QRUB 3DNKA 2YO3A 2YK1H 3DTDA 1W6LA 4XC1L 5IVZA 1RU9H 1U91B 1F02I 4NFDA 2OMYA 3ZRSA 3IGAB 1HZHH 2WUCH 3QFJE 3VXTB 5L6YL 3VB8A 4PQXA 1CGVA 3HC4L 1ZVNA 4EEEA 2HKAA 2FJFA 4WNQA 4F8LA 3L4XA 3TBVA 3P11L 2HCZX 4NRZA 4LU5H 4Z7IA 3QDJD 3V2AR 3CFQA 3BUIA 1IL1B 2EJ1A 5DJDA 1XVSA 4N2OA 2CZNA 5F3BA 4XPTH 2LABA 1O9WA 3BP7B 1WFUA 4IBYA 4Y8AA 1U9KA 4IBLT 2PO6A 2MH4A 4TL5A 4TQEH 3P3RA 3BWSA 2QHLA 5JHDA 5KYYB 2DBLH 4PJIB 5DR5L 3LKPB 3L9RA 4YHOL 5DRNA 3U2SA 1AZUA 2KT6A 4PSRA 2UWEB 4ANXA 1CDJA 4E9XA 4BWWA 3FQRA 2DD8L 1MLCA 2IQAA 2WXMA 4H26B 5FB8B 1X5FA 2C4FU 2MEJB 3NCJL 4AEIL 4AMKL 1NFIA 4LCWA 1CXLA 3EFFB 3HZVB 5CP3A 4LLWB 4XCCH 3JQOB 5CSBA 5BV7L 2AEWA 3TIEB 3DARA 1E4XI 2WO4A 4M6NH 5I76B 1RZ8A 4JKPL 3RVWC 4FP8H 1JPSH 5DZNA 1JD9A 1A6UL 3QIWD 1CDHA 4OGXH 1AXTL 2A1WL 3QJFB 3VD9A 2RALA 4MWFB 3S8FB 3MRBA 5ITBH 2XX1A 2BVQA 1YMME 1Z3GL 3FRPB 2F5BH 1FN4A 4POUB 4A2GA 2WLJA 3V4UL 1VSCA 5IW3A 4MYPA 1LP9A 3IJHA 3QUMH 1Q9OB 5HGGS 1CD9B 2BMKB 4WI3A 1NCAH 2KUTA 1A2YB 4G5ZL 2CG9X 3CSYA 3QEQB 2K7PA 2XIIA 3KJ4B 3RY5A 1NPUA 4U6XA 1ID2A 3MNWB 5LAPA 2CO7A 3IXTB 3OGCB 4BZYA 5J6HA 2QQKH 3K5RA 5BQDA 2OK0L 1H3GA 1CTOA 1JMZA 1IGYB 4OQTA 4ORGB 4M5YL 3MACH 3T8MA 1I3VA 2TSBA 4ZPVB 1F0LA 1USZA 4QF1A 4LSUL 3A47A 2Q3AA 1DQDL 3ZLQC 1TZGL 2VW6A 3OLDA 2XNAA 1X5YA 1Z5LA 1L6PA 4YXHH 3RIAF 5IP4A 4FA7B 5FS5A 2PWHA 5ICYA 5K59F 4FXGA 1AYRA 4HIPA 5FA3B 4HZAA 2R15A 3ROLB 4ZO9A 5D2LE 1R33A 3K1DA 1VADB 4XZUB 1SXZA 2VUOA 2UY6B 3QZLA 4AQOA 1XGPA 1NM9A 4NHUB 2NUPB 4NPKA 1XL6A 3IMTA 5FKPA 3B5HA 5CZKA 3L9EA 4XI5D 4B5ZA 1T1XA 3GZQA 3W5MA 2HMIC 3ZKMC 2XFGB 4JZJB 2FNBA 3QJSB 5CGYC 4H20L 5CMAB 3JZ7A 5ABZA 2Y72A 3VFGL 4N90E 1DBAL 4P3DB 1W80A 2LHAA 4Z77A 1VPOH 2BY0A 3GSVA 1JYVA 4G7VH 5J5EA 2C9WA 4EKJA 4Y4HB 3WY1A 1EEYA 2X10A 5J6GB 1NAKL 4MX7A 4NQEB 4KK9D 1AH1A 4ZZKA 2VLRD 2GJ6D 1F4AA 4NC0B 4F58H 1U2CA 5A6LA 3P2DA 4EIUA 4ZD3H 4YHKL 1RIHL 3W0WE 5J3HC 1PSKL 3V9EA 5T3XL 3CDGB 5HI5C 1G5GA 1ED3A 4QRTA 1ITBB 1KGYE 5ISZB 2PW1A 1HKLH 2K4WA 3IF1A 4H44C 2CQVA 2WOYA 3WEAA 4X6CA 4DW2H 1AR1B 1JYNA 5HHOB 2H3KA 1B9KA 3FB5B 3CK0L 3MJ8B 3ARFA 4Y5YB 2W88A 1JZ6A 1LE5B 2DQCL 3MQIA 4HJ0D 1JPEA 1G9MC 5CSZB 4L4TA 3OC5A 4TQHA 1A6AB 5TE7L 4QRUA 3VDBA 5DZOA 4Z78B 1WTGT 1MAKA 2G60L 3FF7A 4PRDB 3CFIC 1U91A 2EH8L 2R8SL 2VR9A 2J57A 3IGAA 4NJAL 1O9VA 3VXTA 3MLYL 3AG4B 1WAAF 2XXCB 1XIWD 3U46B 5ALBL 3GM8A 4P0DA 1FNEB 4WFHD 1ZK5A 5CZXC 1N8OE 3FW6A 2H2SC 1IL1A 4YBQC 4JHWL 3CMGA 2HX9A 1HSBA 3QNYB 4HKZB 3ROOB 1H6UA 5DVNA 4I0PB 3BP7A 4ES9A 4BYHA 1VFUA 2DLGA 2OKMA 4KHXL 3VFVB 4S1SL 1S9KC 2V6HA 2BS8A 2D7MA 5K93A 2YPLB 5KYYA 1RQ5A 3FUHA 1CG9A 5TF1H 3LKPA 3ATBA 1B4JH 1ORQB 1QWHA 1OAJA 4TULH 2AEIT 1QUNA 1RPQA 1XEDA 5K9JH 2UWEA 1ZJAA 3FULA 5FOBB 5JIMA 1OANA 3AS0A 2OJEB 4FJYA 1KIQB 3CD4A 1VIWA 5L88L 1TZHB 2WYHA 1RZ7H 1HWWA 5IM7A 4Y1AE 4Y9EA 1HL9A 3HZVA 1I3GH 3P3UA 2DIBA 4LLWA 4NDMB 5DEFB 3WTTA 4ZMOA 2J12B 1WHPA 4JG1H 4OBSA 2FWSA 2EEFA 1MFCH 2ZX9A 5A2IH 4QXTB 4AGPA 3UZQB 4G8EA 3QR1A 1CDGA 3D0VB 5JHLL 1X6LA 1P4LB 3SE8H 3FRPA 4K3DL 3C2SA 3DSNA 3FTZA 4P2QB 4IS6B 4FHKA 4L8BB 4JPVL 1LHZA 5J1TC 2KC0A 2DMKA 4I0KA 1Q9OA 4TXVB 5D4HA 3DO3A 1RCYA 3US9A 5KJRH 3ZL4L 2O5YL 2V17L 1PFOA 1Q9WB 4NQDD 1A2YA 1KDJA 5H2BB 3S34L 5BZDB 3QEQA 1NGQH 3Q48A 4N0RA 4JFFA 3O2DA 4TRPL 1F4HA 3Q2NA 3IXTA 3OGCA 2Z31B 4NJ9H 4OCSH 1Q72L 3TVMD 5BRPA 3C2AH 1G7QA 4OH2A 4JHAH 2DQGL 4OAWB 1IGYA 2IXQB 4ORGA 5EF0A 3N9GH 1SOKA 3NGBB 3POCA 4R97C 1PZ5A 1KTJA 3HCVB 1QSVA 3FU0A 4U33A 1A1MB 5KJ4A 3RB7A 3CNKA 5FA3A 3CBKB 3ROLA 1EEUA 1R5IB 4HC1A 1MWAB 1QPXA 1VADA 3D3VB 4Z7WB 1DQML 1EGJL 1KJMB 3ARGB 4XZUA 2UY6A 2WZAA 4NHUA 4X6CF 2NUPA 4IRSC 3WDIA 1WZMA 4YX2H 1MCBA 1J05B 3MROB 4R4BB 4JZJA 5CMAA 2YD5A 2ZXWB 2B39A 3HZYA 2CE6A 4P3DA 1TQTA 4D3CL 2WAHA 3H42L 3JWDH 4UAOB 1P6WA 4IW4C 4JGMA 4XMPL 4Y4HA 5E9DD 5T1LD 4ENEC 1CE1L 3GMMB 1YY8B 4XP6H 3S8WA 3KLQA 3ZZQA 4NQEA 1PD6A 2NZ9D 4JDZB 2IO5A 2CJSA 1RMFL 4DEUA 3P4NB 5F7LB 3AXHA 4EAEA 3CLEH 3CDGA 2VM4A 5E2VH 4K71B 1ADWA 5JZ7C 4YSSA 4KXCA 1KXVC 4JG0H 2CHWA 5ISZA 5LBSL 4HJEA 1RFDL 4GBXD 2CIIB 3HPLB 3QI9C 4AKQA 5HHOA 5E08H 2ZSWB 3N40F 4PJIF 3FB5A 1IKFL 3MJ8A 1UVQA 2DJ4A 3HRZB 4U6VH 4Y5YA 1WPCA 4JVUA 4OD3L 5KSBB 2UWEF 1WA0X 1LE5A 3CQPA 1U4EA 3BQUD 5CSZA 1A6AA 3TWCH 3N42B 4XVUC 4BFIB 4Z78A 3A4DA 5IVXE 5B8CB 1IAKB 4PRDA 1CGWA 2XA8H 3OKOA 4Y5XB 3RNKB 2I5YH 4WW2C 5B1AB 3II3A 1TTUA 5LWYH 5TE4L 1ILUA 4XO3A 1QHOA 4FHJA 5CUSL 1BYOA 3ZX1A 2HVJA 2MOGA 2OXHB 3RWDA 4CAGA 3GPEA 1OW0C 1FNEA 3V5HA 5IFAL 4GINA 2OULB 3CAFA 3ECWA 3L95B 4Y16C 4I13B 5FYJD 1IFHL 2A6KB 3QNYA 4HKZA 4KK8D 2IAMD 3ROOA 1XMWA 2HLFD 4I0PA 5D7LE 4BFNA 4PMEA 4DCQB 1SXBA 1XBDA 3VO0A 4BCXA 2F54A 1QEWB 2EP6A 2YPLA 4W9LC 5E2WL 4AV0A 2F7IA 32C2B 1Z5HA 1ORQA 2FUTA 3FOMB 3KWWB 4PJXF 2WB1A 5FOBA 2YSTA 2WXOA 4HUCA 2CMRH 5L7XH 3HZKB 4GIAA 4L2YA 2OJEA 3VWJC 1W0WB 4HWBL 4PRNB 4WFFE 5H37H 2BJML 3IXAB 1TZHA 3DHMA 3GSNH 4I1NB 4EDWH 1ORSB 4QYOA 4FZ8L 1I8LC 3TZVB 4LPXA 3K6NA 2WSKA 4NDMA 4UTBL 4UQEA 1OCRB 2W9EH 3W2DH 3FO2B 4IKKA 4FFZL 3L48A 1MHEA 3EO1A 4QXTA 4TNVK 3I74A 5T3ZE 4ES8A 3UZQA 3EHBC 2WXJA 3APDA 1OGAB 3D0VA 2K0RA 4H1LG 2YSSB 1EK3A 1WE5A 4P2QA 4IS6A 4L8BA 5I17A 2BY3A 4FNUA 1OAKL 4ZO8A 1UXLA 2AXGB 1OAZL 2WVUA 4EN3A 1G4MA 5DJCA 1JRHH 4XP9L 3LTVA 3UJTL 3L3OC 1PQZB 5M95B 4PJ7F 3V0JA 4M1DL 1Q9WA 5H2BA 5BZDA 4IKLA 2OR9L 1CXIA 4KZDH 4HHAB 1CVSC 4PRPA 1J5OH 4FS0A 1HEHC 4B97A 1ZT4B 5AOJA 4M6ML 3QQ3B 3OG6B 4OAWA 1QVOB 2IXQA 4JL1A 3VRLE 3D1MC 1XSIA 3NJNA 3HZMB 3NJKA 4HBCL 2DKSA 3HCVA 3GD1C 3FO0L 1E8WA 5H4ZA 3DMMC 4Y19E 4CC4A 2MOVA 4FHBD 1R5IA 1XGQB 5BO4A 1MWAA 4I48B 4ODXB 4WUKL 3D3VA 4Z7WA 4XNUH 1KJMA 2H45A 3C5ZD 2X6BA 3V8OA 1SLVA 3HC3L 5B1KA 4HU2A 1MG3C 2OYPA 4CSPA 4G11A 4ZS6C 3TBBA 4E36A 1EXGA 4JM4H 2ZX7A 3MROA 2Z93B 4R4BA 2APXA 5D7KD 4X0KB 5KYXB 1MREH 1F90H 4WDIB 2NZIA 5KOVC 3INOA 4KO6A 2ZXDA 4GNKB 4YBLB 2RFXB 2K3TA 3WTSA 2NXZD 5FUOH 5I6XB 4WO0A 1U58A 1A4AA 3O6ML 3MXVL 3TFKD 3D39D 4GRWB 5J12B 2AJSH 3O6FB 1QOKA 1YY8A 4J3VA 5HVWA 2G0KA 3U4EB 3X1EA 5F7UA 1BVNT 2CCLA 2R23B 2W8CA 3MUGB 1X7QA 2WCGA 3DO4A 4NEHB 4NM4L 4JDZA 4PUBH 3ZVVA 5C2UB 5DJ0B 1AI1L 1E40A 4LSSL 4P4KB 3U0PB 1UJ3B 3AABA 3GNML 4J3TA 3UTPD 2TRHA 3P4NA 2V2XB 4XNBA 5EUKB 1PPIA 3V6BR 1B6DA 3VH8B 4AW4A 3QYMA 3RDTC 3P9MB 3MTXA 5EIQA 2D7QA 1A4KB 2Z92B 3RP1A 4ZMPA 4MQTB 4JFZH 2DM2A 3F7RA 2W1NA 3V10A 2HFGL 2W9DL 2ZWLT 3DJ9A 5BRZD 5F7HA 3RX7A 3HUJA 3MTRA 2DL9A 4P49A 5J4MA 1K5WA 4IJ3C 1GTNA 2ZSWA 2TRYA 1LMIA 2GIXA 4B3EA 4J8QA 3FO9B 1FPTL 2YUXA 4K23L 4FX5A 4LSDA 5KSBA 4S1QL 1IJNA 5KSUB 2B5IB 4TSBH 2OI9C 1ZTXL 2BM3A 1CLVA 1GGCL 1UOWA 3DX1A 1QTPA 4NLAA 2O6FA 4AY0A 3TO2B 5B8CA 3RNKA 2JTDA 2GTQA 3CHQA 1LD9B 5AB2A 3CX5K 4AJWA 4D8OA 3F7YA 4LEEA 1UA3A 4KKAC 2OXHA 4OZIB 2HJLA 2QGDA 3QG7H 4RDBA 1IBYA 4HCFA 3I6LE 1UWEH 2MOQA 3L95A 2MTAA 1BLNB 2X87A 4U0RC 5B22A 3IFLL 4BFKA 1RERA 1V7MH 3MBEA 1A7NH 4Z7OB 2A6KA 3V8CA 4IRJD 3GRWA 5AVZB 3MU3A 5HDOA 4ODTL 1H3VA 3UJJL 4NZRH 1OE1A 3EOTH 1A7OL 5C9JA 1QEWA 4FERA 1JGUL 4G70B 3RHWF 2EVJA 3TJPA 4TUJB 3MJ7B 4OFYD 1IGCH 5EZJB 2DS4A 1W0VA 5FFLA 4Y2DA 3FOMA 5CJ8A 4PLKC 1GOGA 1ADQA 3WKNA 1QI5A 4F15B 5L2JB 3LRHA 1F1AA 4UZUA 1JE6A 1SLWA 1FNHA 3V52H 1W0WA 1JVLA 2D3LA 4PRNA 1YCSA 3VGHA 3IXAA 3QZMA 4Y2NA 4ZFZB 4OGYL 1NC2D 1ORSA 3MLSL 5EBGA 3TZVA 4HK3J 2QQQA 2DQDL 3M1CA 3UPRB 5B1JA 4GQ9L 5C70A 1A3LH 3FO2A 3M46A 4P07A 5KVDH 1ZANL 2FEJA 4QRSA 1YNTB 1IC4H 2Y7MA 1LTXA 4ICWA 4L3EA 5FYJL 1EFXB 5BO1H 2FWLB 1OIOA 2YSSA 4Z7WF 1J10A 2LAGB 4O5LH 1WWCA 2J5LC 4GRLB 4PGCA 2YUVA 1QFWH 4YVNA 2JB5H 1XDTT 3CFUA 2WKLA 1FVEA 1P6FA 1DVYA 2WBJC 3ZGIA 1V05A 2EXWC 4NT6B 3B2PA 2WBXA 3FH7A 3NZUA 4H0IA 5BO0D 4QRAA 1YC8A 4HHAA 2VDMB 4FFYH 4HUXB 5LAXA 1NGYB 1ZT4A 1Z9NA 3MNZB 3QQ3A 3D06A 1QVOA 5C2BL 5D1ZD 1ZHNA 5HVGB 3QDJB 1I7RB 2Y7QB 1YUHB 5EO0A 3HMXH 4KXDA 5FO8B 4N2HA 3IAPA 2NY7L 3K2IA 4EO5A 2QDWA 4NERA 4JANB 1HCYA 1MFBH 1SQ2N 4I48A 4ODXA 4RGOH 1QR4A 1NLDL 1SXSA 1HJCA 1MWOA 1HOCA 5E5MB 2R69L 5AB9A 1IGFL 3VVWA 4GUQA 3X13A 2Z93A 4UT9A 4FLSA 4HPYH 5KSBF 4X0KA 5KYXA 2LVEA 3DUSB 4F7KA 5KG9B 4XOBA 4PJEB 5EU4B 2FECL 2XC8A 4TNWF 4M00A 4Q2ZB 1SFDA 4HWNA 1N6QL 2QPUA 4FQ1H 3ARBB 4OUOA 4Q52A 4OCYL 3O6FA 4FDWA 5C3LD 4J4PA 1F97A 4M48H 1BM3H 3U4EA 2UXVA 2R23A 3MUGA 4HEPG 4UOW0 1S78D 3LS4H 4PN6A 3HN8A 1PAMA 2C3WA 1FLTX 4P4KA 3QIWB 3TO4D 3BP6B 2L7JA 4W6WB 4L05A 2V2XA 5EUKA 4AC4A 3T0EE 3P9MA 5GGVH 3FC8A 3BRFA 3Q5TA 5SV3A 3BMWA 2CGRL 1SJHB 3NA4A 3ARVA 5DC9B 3AROA 1K85A 4MJID 3CC5A 3POHA 3J8F7 5C86A 4IOIA 4JGHA 5AW6B 5GGRY 1SY6H 2J1ZA 1ACYL 5I9QC 4S1RL 3O3UN 2ZCKH 4NKMB 4O2EB 4TPRH 4MB3A 3O3EB 1TTAA 3O3AB 4WSGA 4DVRH 4LKCA 2R59A 1A0QH 1OQOA 3L4TA 4WV1A 2YIHA 4DN3H 4KI5F 3HNVH 1PG7W 1I4FB 1UEYA 2GJJA 1CFSA 4YAQA 1LD9A 3ML9A 1DFXA 1DUYA 2X2JA 4PH8A 1RURL 5KTEH 4WEBH 4OZIA 5HYJD 4WGWB 2GBUA 3CZKA 5AVQB 4QRPE 4XOEA 1I1AD 1IGJB 4QOKA 3F84A 4D0CA 4DO4A 3BH9B 3NFSH 3ZDXE 4KKBC 1IQWL 3HLKA 3LMJL 4KKCD 5A40E 3NPZB 4A63A 1F11B 5F7WC 4PIBA 1F00I 4FQ2L 3CSTA 3MREA 5CGBA 4TUJA 3MJ7A 4P59H 5EZJA 3NIFE 1HHKB 4O02L 1RZKH 5E51A 5J13C 5L2JA 2WKOA 4PV8B 1QFHA 5BPPA 4OBRA 5GJTL 5L6YH 5KSAC 4XCEA 2VLRB 5J11B 4PJ9D 1N70A 4DGVH 2GJ6B 4RBPH 3CDYA 3C08L 4OJEH 4IRZH 1J9CT 2ED7A 3AM8A 3UPRA 5F72S 4AVKA 4LEXL 2XZQH 4I88A 4JFDD 4TUOB 2XUWA 3NSCA 2O61B 4IOSA 1PY4A 2Y1VA 3D07A 4B7IA 1YNTA 1F8TL 5IIEB 1RJYB 2GFBA 1EFXA 2WTRA 3VX1A 1QW8A 2OL3H 5C0FB 1PBYA 2RA1A 1CD0A 2ZYHA 4KK5D 4L4JA 3FQ4A 4ZBJA 4GRLA 4AK2A 1R0AH 1X5HA 4TTDD 3RJDA 3FHAA 5SV4A 5I1GH 5EC2B 5IJKA 4MLSA 4YE0A 1T20B 4PS4H 3DBXB 2JLPA 3WYRA 1INEH 3MCYA 3QJXA 3N0PB 2XU9A 3HHSB 2NXYC 1NGYA 4GT0A 1XIWB 1QG3A 2MJWA 1NMCB 3H0TB 2IQ9H 2VH5L 4M7KL 3UZEC 4KNQA 1HAUA 3LZNA 3QDJA 1I7RA 1FFTB 2Y7QA 1YUHA 2MSPA 5EA0L 4EKXA 3ZYOA 1GXEA 1FZOB 2HLEB 5IMMA 1S7XB 5A6IA 5FO8A 2DTMH 4YDZA 1FO0B 4DF9A 4KRPD 3E7JA 2VJXA 4PGDB 1ZHKB 1ZA6B 5K1NA 2E9BA 1ZT7B 4JANA 1MCNA 3DDFA 2NX5E 3T8XB 4CKVX 4OM1H 1OM9A 4FJZA 1MLBB 2EC9U 2A6JA 3E0GA 1KCSL 1OO2A 2ODHA 5A16B 5E5MA 1JWUB 1CFBA 5L4IA 4IBUA 3NH7H 3GXUB 2W60B 4XBGB 4PG9A 1B0WA 3V0WH 1UKQA 1IQDB 3ZJAA 2YRPA 2CHXA 3DUSA 1KB5L 4FXTA 5KG9A 3KJ6H 4PRIE 5HGDB 1J1XH 4PJEA 5EU4A 5H4YA 1NGPL 1WUZA 1KJ3H 1HCVA 4Q2ZA 5K33A 2JCCB 4FMFA 3ARBA 4NN5C 2YD3A 3BP5B 3EGSB 3IMBA 3EKCA 4I0CC 5CAYB 3LD8C 1T0MB 3ES6B 3LKRB 1EIBA 1N6VA 2HUEA 2X1PA 3MRCB 3VCLA 4QHKJ 3GXNA 5DZPA 2DEWX 3UTTE 1A3RL 3BP6A 4BEIA 1H8OA 2XETA 2NUTB 4Z7OF 2PYED 1P4IH 3HKZA 4GXUM 4LSVH 4Z6AT 1CFTB 4KXZI 3GLZA 4J7RA 1NIEA 1SJHA 3HB3C 4LEOB 5A3IC 3NACH 2LQRA 3MV8E 3NJIA 1Y7VA 2W91A 5IT2L 2XY2A 2NMSA 5I19H 2B14A 5C0AE 4NQDB 4ZMYA 4HULB 2KYIA 4LIQH 3D5OF 3QH3B 4EMZA 1ZHBB 2V2TA 3HFFA 5F8QC 2YQ2A 5DEZA 4NKMA 4O2EA 3GXFA 4MQ7B 5G4OA 3ALWA 3UJIL 4EXPX 1FCCA 2WKOF 3BGFC 4I5BB 4ZYKA 3O3AA 3TVMB 3QRBA 5AUMA 1T4KB 2LLLA 4OZHB 2PYFB 4LLDB 2B77A 3GBMH 4MBOA 4PJGB 3L9YA 4ZW8A 4P23A 3SBRA 3HI6L 1EHLL 4P99A 1KUMA 3RVXD 3L2MA 2CDFA 2CU9A 1I4FA 4M5ZH 1PAZA 1MSPA 1KOAA 4DEPC 1VZGA 3MHZA 4NCC1 4QT5A 1EAPB 3GIVB 5D1XB 3AUVA 1PZ2A 1OGTB 5KVEH 1JPFB 2CLZB 2X1QA 5IQ9B 1IGJA 3WFZA 4PAZA 3LH8A 1W8OA 1O6SB 1YJDH 4WY7H 4ZUUB 2QGCA 5FYKU 1NIFA 3QZPA 1ASPA 4GFXA 3VM5A 2Z64C 5E6ZA 3TYFA 2G5UA 1F11A 3X1BA 2E27H 2OYMA 2XV2A 3K8MA 2G5RA 5BRQA 4JFHD 4LSPL 4H13C 1KN2H 2O1AA 2P5WA 1NSNH 5AAWC 4GRMB 4OJFH 4J3OF 4W70A 5AEAA 1DEEA 1DVXA 4HXBH 2CR0A 1RHHB 4PV8A 5E9DB 5T1LB 3ERXA 1N0LA 3NSFA 1SJXA 5IVNA 2VLRA 3GXPA 2F19L 5D1QC 1M53A 2EYTB 3A23A 3IGKA 1R34A 3TCXA 5MHSE 1QX1A 2Z7ZA 2O4EA 3ZIYA 4JNXA 3KW7A 3QZWA 4V1DA 1ZLDA 4KQ4L 4HMEA 3VXQA 2BO0A 2O61A 1E6JL 1GR7A 3IMUA 1EQWA 3DC0A 5IIEA 3G04B 5CJBA 2I60H 5F21B 5F8RC 1J0JA 3D05A 1FG9C 4GBXB 5C0FA 1FG2B 4X8JB 2A7BA 3D2UD 3KXFE 5F9AC 1V55B 3IS0X 4MAYC 3RTLA 2C9RA 1JRHI 3TJEL 3X1NA 1XF3B 1MFAH 3ARDB 2WLIB 4PWGA 4AM0B 3ULVH 4H0LC 1OHQA 3LNDA 5EC2A 3BQUB 1TZAA 4XNMA 1N19A 1C7TA 3GPSA 4ODHL 4RGNB 1T20A 2VXQL 1N5AB 1E2ZA 1VACB 1DVQA 4HWBA 4YN3A 4U6YB 2IAND 1N7MH 2MQCA 4KTGA 3HHSA 3S36X 5EF3A 4OLVL 4NZUH 2HAZA 4UTBA 3BT0A 1PEZA 1ZLSH 1OALA 3TV3L 4AXWB 1XMEB 1CFNA 2XG5B 2Y3NA 3H0TA 5C97A 1BM7A 1NEPA 1TQBB 1U8PB 4ATTA 3FS9A 2E4FA 3ZKQD 4QTIL 3ABKB 4NGHH 5D71H 2BWDA 2IAMB 1FO0A 3OMAB 3SDXA 4UMSA 1ZHKA 4DK5A 1ZA6A 1ZT7A 3IDJB 3T8XA 3FCTB 2OZ4H 2AQSA 4XN9A 1MAML 4RBPK 2YAFA 5D7SL 1O7SA 3FT9A 1U8JB 1COBA 3CFEB 3RVWD 5DS2A 1MFUA 2NCMA 1T7VA 5DS1A 5A16A 4KVCL 4FYRA 1JWUA 1U0QA 4QRRB 1JXKA 5IW6B 4UT6H 3JV6B 4GW1B 2W60A 4IYKA 4XBGA 2NTFB 4CILA 1IQDA 4G9DB 1W15A 4LMQE 4KQ3H 5C08D 5HGDA 5I18H 3K4ZA 1T0OA 1P5VB 2R0KL 3L3IB 1O5PA 1MH5B 2IDTA 4I2XA 2BFVL 3F7VB 2JCCA 4IK7A 5CSGA 1FGNL 3TBWB 4U1HB 3EGSA 2QT6A 4YC2C 4EDXB 3QK0A 4F37F 2PWEA 4KAQL 4HLJA 1T0MA 3EXJA 1AOHA 3ES6A 3LKRA 5DMJB 1AACA 1T7YA 3MRCA 4QCIB 1QWUA 1C1EL 3A6CH 2X28A 1HYSC 1S6NA 5I1IL 3PDGA 1QP1A 3H9ZA 3FPYA 4LK4A 2NUTA 4Z3JA 2VC2H 4Y9CA 4DPAX 4NZTH 3BMVA 4K5NA 2LU5A 1CFTA 1P7QD 2Y07H 2ZKMX 5CJXC 4NRXA 2VDLH 3GSOB 1YMMD 3UXFA 1S4IA 5TQ0L 3L4YA 3VFWB 2KERA 4R4NC 4U1MB 4XMVA 3UAJA 4NQDA 4AC2A 2XTJD 1J8HE 3KYAA 5HJ3B 3J2PA 3QH3A 4PRHD 3ARQA 3LXUX 1GYUA 1ZHBA 5D4QA 1J5CA 4MMZC 2FSEB 4X9YA 1NANH 3OM3B 4MQ7A 4APXB 3DPDA 3F04A 4I5BA 1EJFA 1S8DB 4YHZL 4ZAKC 2LU7A 3TVMA 3ZKMD 5E24E 2HMID 2P9RA 4OLEA 4OZHA 2ZPKH 4LLDA 1AMXA 4PJGA 2NY2C 3RQ3A 5EOCH 3QHFL 3DX4A 2J44A 3QRFM 2AXFB 2Q8BL 2XVGA 3BKYL 5JPNB 4YUEL 3U9UB 5D1XA 1EAPA 2CRZA 4K94L 4NYLA 2MHAB 3BAIA 3GINA 1OGTA 3ZGHA 1ET8A 1JPFA 2CLZA 5IQ9A 3RIFK 5HHVL 3SKJH 3C5ZB 4AL8L 2OMNA 3SD5A 4I7ZC 1HT6A 1VENA 5EU3B 3T0BA 5IB2B 3QIBB 4NQXB 1QPPA 5HI5D 1NCTA 1FSKC 2F74A 4WGVB 1KLUB 4H1LB 4OIIL 3B56A 1ZSDB 2JLLA 4X4YA 2NXZB 3QJVB 4HIXL 3MKKA 4X6BB 1U8HB 4GRMA 4XWGL 2Z8SA 2E7HA 2WP3O 3WTWA 5E9DA 5T1LA 2V9TA 5TPWL 1JWMB 2EO1A 1RZFL 4PP1D 1CWVA 1F5WA 3WKYA 5IOKA 4PBVC 2F8XC 2NY6C 3HI5L 5EORL 3Q6GL 1RD6A 4OCXH 1UADC 4M61B 4JM2C 1OTUC 4NAJA 1TJHH 2N0KA 1EANA 1PF3A 1Q0YL 1UWFA 2QGEA 3UGXA 1FNFA 3LOWA 1MRCH 3G04A 4YHPB 3W0WD 5BRZB 2WW8A 4YDNA 4G5AA 2W9LA 1QFWI 3P4LA 5D5ME 2EILB 5CZXD 1FG2A 4OZFH 4X8JA 2VXTH 1XF3A 4Z7UB 3ARDA 1BVOA 4AM0A 2QQLL 4O02B 4D8PB 3DX6B 1XZ0A 1HXYA 4YFLI 1Z2KA 1N0XL 3BQUA 4WO4D 1EZUA 1GZHA 1N5AA 1VACA 2H0JA 1G7JA 4V2BA 3VG9B 4U6YA 3PCYA 2WK2A 2XV3A 3ZQWA 2UX7A 4AQ8A 3FK3A 2Z35B 4WUUA 4B53A 3TURA 2JCCF 3MN8A 1VHPA 4K8RL 4XC1H 4J3BA 5F9WB 3DXAD 2EDRA 4LBAA 4AXWA 4YHYB 4MBRA 2APBA 3WEBA 2XG5A 2XZAH 1BQHG 4HQQH 3HC4H 5ENWB 3IJ7A 4PS3A 1U8PA 3F7LA 2N7BA 4DERA 2NOYA 3SY0B 2B1HH 4OB5H 3UC2A 4YDIL 3OKYA 4IRJB 3U79A 1IBDA 2IAMA 1TJIL 3BD5A 4UT7L 1NOFA 4I1RA 2UUDH 5I5RA 5CLYA 2NQDA 3IDJA 4R8WL 4N20A 3FB8B 1U8JA 2XDHA 3CFEA 1Z9LA 4LKXA 1XF5B 2VISA 3MA9L 2GB2A 1OHZA 1YN6B 4WKZA 3SGKA 4RGMB 5DA4A 3VA6A 5CWSB 4QRRA 2VT0A 1VFBB 4HPHA 3JV6A 2EE6A 2GTWA 3PFUA 4GW1A 4LLVA 5DR5H 2NTFA 1D5RA 4G9DA 2E9GA 1BQKA 2WLLB 4YHOH 1FAIL 2XVBA 3L7EB 4ZRGA 3BZEB 3EF4A 4WI6A 1WH0A 1NC2B 1T1ZB 1KJ2L 2X09A 1MH5A 2DD8H 3EXLA 3F7VA 2N56A 2WC7A 3CLFL 2VLJD 3JVGA 3BPCB 3GGWB 5CN1A 4U1HA 1ODAA 4AEIH 2YD4A 5F2FA 2EH7H 2IGLA 1GGYA 2JKTM 4QCIA 2MWCA 5BV7H 4B50A 3NK4A 2L7UA 2V7NB 2QJDA 4MMXB 6PAZA 4QLRA 4PG2C 1A6UH 3VXPB 4YDKL 1AXTH 2A1WH 2YXMA 3REVA 3VI4E 1T7ZA 1FCGA 2LV4A 2R69A 2PCFB 4CVXB 4EI6B 3DX0A 4YOKA 4H0GA 3CG8A 1ES0B 3S8GB 1EX0A 4HS8H 5K59E 3V4UH 3COOA 2ERJC 1D5IH 2ZNXA 4L9LA 4ZMAT 4LFHG 4IRSD 2P8MB 4G5ZH 4APXA 1OK8A 1VFAB 4A39A 1S8DA 2AVFA 5HD8C 2YGOA 3D2TA 1Q0EA 1JGEB 3I9AA 4FFTA 3O4OB 1XCWA 1GGTA 1AHWB 3OB0H 1BF8A 5D1ZB 3EADA 3FMGH 2R1YB 2CUMA 3L4ZA 3LPGA 2VLMD 4I89A 4M5YH 3PL6D 5JPNA 3U9UA 4XE5B 4U31A 1TVHA 1WZAA 3BEVB 1TZGH 1DHKA 2Z0BA 4DEWA 5AWNH 2QTEA 5I6NA 3C5ZA 3KEDA 1H3XA 2XTLA 3AY2A 1AG0A 4G42B 1JF6A 3QIBA 3I6KB 4G7QB 3F6LA 3MOQA 5DHVB 3V4PH 4M8RA 3MFGB 2ZONA 3S3JA 4C57C 5JZ7D 2R2HB 1KLUA 4H1LA 4PJCB 5CFAA 4I87A 5E1GA 2CJTA 4F57H 1ZSDA 3I2CL 3QI9D 3WY2A 1FE8L 4XMWA 2FX8H 4H20H 1PD1A 5IMLB 2WB7A 4X6BA 2EUWA 1U8HA 3SJVB 1V3MA 2CUHA 1DBAH 1OKEA 2YEVB 5JHDE 1KPVB 1JWMA 2WIMA 4TVPD 1ITCA 4IU3B 3Q3GB 1WWAX 4F91B 4QXGL 1NQBA 1DJGA 3TO4B 3QYNA 4ZX5A 4LFHD 4XVUD 5F6HJ 3WNMA 3RI5F 2EDHA 4M61A 4LCWE 4D9QE 4YHKH 4ZMTA 1UG9A 5IQOA 3OZ9H 1OOWA 4YHPA 4MJIB 5BRZA 4JGUA 5T3XH 4L8SB 1T89A 3QAZC 1I1YB 2KZKA 5T5NG 2EDBA 4M1CC 1A6VL 4Y16D 1N9PA 1AXSB 1GJWA 4MA1C 4Z7UA 5GHWL 1BVLB 1J9SA 2ZG3A 2AQ3A 4O02A 4D8PA 3DX6A 5E2TL 2DMGA 2F1BA 5CEZL 1KTDB 1M6OB 4KV5E 4FNSA 3CK0H 4YSRA 1HHGB 1VB9A 4DUXA 5ALCL 2DMCA 2DQCH 2QQNH 3P77B 1DSWA 1LP9E 3H9HB 1QFUL 2WHVA 5EZIL 2C9AA 4ZDHB 3FT1A 4ZUWB 2VE6B 2G60H 3FN9A 3FT3B 2KLTA 5K1VA 3TPUB 1MAJA 1U8KB 3AW5A 2Z4TA 4U4IA 4YPGB 1WIUA 5HYJB 3MLYH 5EDSA 3OHXB 3RWJB 3VWJD 5ENWA 1EFQA 1I1AB 5AB0A 1BV8A 1EEQA 2YA1A 2FJHA 3CQFA 3SY0A 2MCMA 2P44B 4IRJA 2QGBA 3OQRA 4KJPC 4BCZA 3D34A 5E8PA 3M6DA 3ZHDA 1CXFA 4C56B 2IWFA 4PJFB 4N2CA 3L3GB 3V6FB 2KBGA 3REWB 4G3YH 3FB8A 2J6EL 1A64A 4R4FL 2VERN 5DJYB 1CZ8L 2E7LC 3H3PL 3EHBD 5D7LD 1XF5A 5EFIA 1J0ZA 4NO5B 4UANA 4OFYA 1YN6A 2VMJA 3NCEB 12E8L 5CWSA 4AMXA 1QLEH 1VFBA 1JCKA 2UXTA 3H6JA 4HGWA 3QR0A 4FQCL 5A1AA 3UDWA 1BGXH 3TEYA 4XVTH 2KS0A 3BZEA 2WCSA 4NKOB 4KO5A 4AENB 4PJ9B 1T1ZA 1Y6KR 5DD1L 2YMXH 2IVFC 5F7DA 3BPOC 4Y5VB 4NXKA 4JFDB 5LVEA 2YOAA 4UIMB 1N18A 1BQSA 1S9VB 3IWUA 4EUPG 1XD0A 4DQAA 4KNTA 2DYRB 2AEQL 3P4MB 3WJJA 2VNCA 2V7NA 4MMXA 5F7YC 1WAEA 3VXPA 5T3ZD 4PJDB 5JHLH 2PCFA 5CIPB 4CVXA 3DMMD 4EI6A 4K3DH 4LCIL 4K7PL 1U8QB 5HGHB 3ISRA 3N3EA 4JRXD 1KB5A 1RL1A 4XNYH 4MZIA 3TIDB 1CL7L 4X5QA 3ZL4H 3TTSA 2HJFB 1XF2B 2P8MA 1ZY9A 4X6CE 4NZ8A 4ZS6D 2MNUA 3S34H 1KIUB 1X5IA 3CVHB 1IAIL 3MRPB 4DPCX 1JGEA 4TRPH 4FA6A 3LPWA 1AHWA 3BKJH 4Q9QL 5I24A 4K4KA 5IJVA 3ZU8A 4URTB 2JK5A 3V0AC 1MHPH 1R46A 4TS6A 4L4TE 4RRPA 3CUPB 2X6MA 1HHIB 3AT0A 3CGTA 3U4BL 1LVEA 4ETQA 3OR7B 4NFBA 4KRPB 3S98A 1JK9B 1BEYL 4N3UA 4O00A 3WUZA 4Y19D 5E7FA 5J06A 2VXUH 4NNPH 4S11A 3UP6A 2K6WA 1DQMH 3M8OL 1EGJH 3I6KA 2A9DA 1MVUA 5DHVA 5D7IB 2E74C 4J2QA 4Z7UF 3RDTD 4AYID 1S7SA 2CM5A 2R2HA 2ZOUA 1A4JB 4PJCA 4QKTA 3ZMNA 1KEML 1U8IB 4K7FB 1YEFL 3MBXH 5IMLA 3K4DA 1Z66A 3QUYA 3ARFC 3R1GL 4RZCB 2D7NA 3SJVA 4FMVA 4Q89A 2YN5A 1KPVA 2CGYA 2IG2H 3H42H 3Q3GA 3RL2A 4XMPH 2WXGA 1QBBA 2UWEE 4LCCB 4LHUA 3TO4A 1AGEB 1V7NL 3B2UD 3O41B 1AQ8A 4NP4H 5DWPA 3SCMD 1RUAH 3RFRA 4J3SA 5DK3A 2EO9A 1ZSHA 3CU1A 1A47A 1MCPH 4G8GD 2CUIA 3P3YA 3CVIL 1T6WA 4TUUA 1VKXB 4L8SA 4LE8A 4QTFA 4OCRL 4D9RE 3S5LG 1I1YA 1YEWA 1CDIA 2CD0A 3DOSB 4PJAF 3ESOA 5LBSH 2B15A 1RFDH 1AXSA 1I9IH 4P5KB 1BVLA 2LT9A 3QA3B 4WWKA 1UM4L 4GUPB 4QRBA 2DMHA 1KTDA 1M6OA 3MUHL 4OGAC 2VW7A 1IKFH 1RK7A 4M9PA 1HHGA 2BWQA 4OD3H 1D6VH 3EJJX 3CN4A 3OKKB 5CLZA 3P77A 5CEZH 3WMPA 3BWAA 1WSST 4R5XA 2J71A 4MJ2A 4TVPL 3G3LA 1NGXB 4ZDHA 1LWRA 4HXAL 1T2JA 3QZNA 4ZUWA 4PLKD 3FT3A 1U8KA 3QEQE 2GITB 5HYJA 2L3BA 3O2VL 4JFFE 4KX7A 3RWJA 4ODUA 1I1AA 1L9QA 1S7TA 3LRGA 1CTNA 3T0XA 3N5AA 3HG4A 3SODB 2IPKA 4LSTL 4G43B 3DX3A 3IMRA 4HEPA 4C56A 1KPRB 1EBAA 2CDGB 1A25A 2VZOA 1TCRB 3L3GA 4FNLL 5E4EB 3V6FA 2CRYA 5KZCD 3REWA 1DLFL 4C47A 3EH5B 5HJGA 3QFGA 3SOBL 5DJYA 1B3IA 2E3VA 3FU3A 1X5GA 3LKOA 4BFFA 2HRGA 2PR4L 2G4GA 3R06B 2VXQA 4YXKH 4BZ1H 2N3JA 2A74B 2D03H 4G1MB 4LIQE 3NPSC 1WITA 2EAEA 2VXVL 1SEBB 1QLFB 1MUJB 2ZOOA 4UV7H 5ADOL 2WBJD 4NKOA 2ZUUA 4PJ9A 3GF8A 2EXWD 2DWXA 5DHDA 3B9AA 4LGRB 2B4CL 4JHUA 1P84J 2FL5B 1JZ5A 4Y5VA 3ZPDA 1TQUA 4JFDA 3MXWL 3E1ZA 4BFOA 4HAFA 2AJYL 3GHBL 2PF6A 3I50H 3TBTA 2AERT 5ID1A 4UTBH 5B4MC 3LX9A 4N28A 1S9VA 4HISA 4WF7A 4FFZH 4W9EC 3KGSA 4PGEA 4K3JL 3P4MA 2VKWA 5FW7A 4OJCA 4NQEE 3D2UB 3VGAC 4IDJL 2YWYA 3X12B 1MCHA 1HILB 2X4PB 4JN2B 4M43H 3ZKJA 1TJGL 4ZMZA 4F8OA 3FU8A 5CIPA 2FBOJ 1U8QA 4WHYH 1KGCE 4P3WA 5DUJA 5HGHA 2N7SA 2XVLA 1NANI 4PJCF 4ZTOL 2J56A 1F42A 1XX9C 3OMIB 4WNSA 5JIHA 3ULUL 1OAZH 3P9LB 4KJYA 3EYUH 3JT2A 3TIDA 3WHE0 5FYLH 3VXOB 2WIIB 5ISZE 3UJTH 2CHDA 5JQ6L 2HJFA 3NABL 2XWDA 2JV6A 1XF2A 4JZJC 3OKEB 3V7AG 1YAIA 2OR9H 5HHOE 1KIUA 3CVHA 5FLUA 2BDNL 2XYBA 1J8RA 1FC1A 3MRPA 1FA4A 5FAAA 3LZFL 1IEAB 2OSYA 3OHMB 3GMLB 3WJLA 3DRTB 3ZQXA 1JPTL 3CUPA 4Y4HC 1UH3A 5FDWB 5E03A 1RAMA 4PWEA 2AVGA 3NDZE 3X3GH 3OR7A 3K1KC 3DUUA 4HBCH 3WHXB 1JK9A 1U93B 2WTPA 3FO0H 1W72H 1L3WA 4LASL 3OTTA 4IGBC 2H26B 2R2BB 3S5YA 1BX2B 1JZDC 4XXCC 5D7IA 5EUOB 4QXWA 3L1EA 1V3KA 1ZV5A 1MJJB 2P45B 3NYKA 5CD3B 1A4JA 1JV5B 3R0NA 4RAUB 5C08B 2Y25A 1U8IA 4NUPA 4A2LA 5GZNA 2P52A 3OZKA 2P8LB 3B8SA 3U9PL 2PPDA 2ZXCA 4RZCA 1T5WB 2F54E 3R7RA 3WDHA 4Y2OB 1KT2B 2YPLE 3E6FA 5LGHL 1H3TA 1C12B 3MXVH 1OM3L 4HZLB 2I27N 3INUL 3RU8L 3U0WL 3L4WA 1QBLL 3T1FA 2GT9B 4XN4A 3ESPA 3TYGL 2ZT9C 4NM4H 2BRRH 1AI1H 4YIQB 3BVWA 3GNMH 4FZEH 1EO8L 3ME0A 1P7QB 2FWUA 5ESQB 2OTUB 3D85D 3MRIB 3OKMB 4PJFF 3EGDB 1VKXA 1YMMB 4QHNA 5A2KH 5DJXB 3P0VL 1BMWA 1L0XA 4MVBD 3DOSA 2XTJB 1TYRA 2HFGH 3VXNB 5B3JF 3E6HB 5CD5C 2XXFA 4PRHB 2WZ6A 4L5FE 5IG7B 2ZF9A 4I0PC 4P5KA 2VUKA 3IJ8A 3HMWL 3QA3A 4OI8A 1SQMA 4GUPA 5AOIA 4KKBD 5L9DL 2X41A 4P2QE 1QPKA 3SDDA 3OKKA 1A6WH 1KNOA 4MMYB 3AS1A 3D0LB 3H9SA 4R7VA 3ZTCC 3WIFB 3LIZL 1KFAH 1BQRA 5AKVA 1CBJA 2GITA 4JPIA 1MF2H 1AKPA 2JJTC 3OD3A 4C54A 3FU7B 2ADGB 3NFPA 4PRPE 5KSAD 3TA4D 3UTOA 4DK6A 5AVTB 4UTAL 4HBQA 2VUYA 1KIPA 5C7ZA 2AV7B 3KWXA 3IFLH 3QFDB 3QGVA 1KPRA 1N3NB 4PJDF 1EAJA 2CDGA 1KGXA 1TCRA 3B2VH 1I53A 1IM9D 2DLFL 4W9JC 3OAWA 1MI5D 5I1AB 3IE4A 15C8H 1BECA 3SOTA 3R06A 5DK0B 1JGUH 2A74A 2X2IA 3D3VE 4Z7WE 4NENB 2QPDB 2CGZA 3MYZA 3SO3C 4EN3C 3JV0A 4R83A 4ZMNA 1I7ZB 4WI0A 3L3KB 1G7HB 1L3NA 1SEBA 1QLFA 1MUJA 1JK8A 1EEZB 3CMOL 1YUKB 1YPZB 1NMAL 3OAUH 1B0RB 5J1AB 5JPMB 3LRLA 4YSCA 4BJLA 1F3JB 2FL5A 1JXJA 2FYYA 1MIML 2IWKA 4NWTL 5ECGA 4MASA 3B7TA 2YQ3A 3I85A 2DQDH 2NXYD 3TEXA 2VRAA 3KM2A 1CLZL 2GK0A 5F1KC 4UILL 1MCEA 5DFAA 3W0WB 3NGBC 1KY6A 3I3EA 4HT1L 1MFMA 3X12A 1HILA 2X4PA 3T3PF 3W39B 3GRGA 3SZKC 3B5TA 4CC4C 1PG7X 3E3QE 5D7IF 3VXUA 4UQ2B 3T0WA 3IS1X 4JZOB 4AVHA 2WXKA 1MHHB 4HUWB 4AGOA 4WO4B 4DKDC 2IC2A 3LB6D 1S7WA 2QADC 4AT6B 4MCZB 3P9LA 1X9RA 2CO4A 5JA9A 4NQVB 4MZ2A 3VXOA 2WIIA 4V2CB 1KJ2A 3HUJE 3KR3L 1JZGA 5JXAL 3OKEA 1K2DB 1HINH 1D5BB 1XSJA 4NHCL 1UOVA 3DXAB 2Y6SC 3QZOA 5AW0B 1UGNA 2NDFA 5GRUL 5C7XL 1A66A 1QATA 1IEAA 3QNXA 3P4OB 1NBZA 1H3PL 3DRTA 1ML0A 3ARZA 3ALPA 5DUBB 3UCRA 3DX9B 5FDWA 5IHUH 2MPAL 4GG6A 1BAFL 5DZ9A 1A6PA 2V9RA 3BAWA 3WHXA 2YC1B 1T2QL 3CZSA 1CQYA 1F2QA 2NY7H 2NY4C 3E3QC 5EEYA 4U3CA 3C9NA 4LAQL 3QXWA 3Q6FB 1DO6A 2H26A 4ZXBD 1C5CH 5E9NA 1X5JA 2EYRB 1G1YA 2E56A 1BX2A 2VKXA 5EUOA 1TLKA 3QR2A 5JOFA 4YGAB 4E5XG 1FNSL 3IGFA 1QNZH 1NFAA 1F3DH 4WJ5B 43C9B 3AADB 4PW3A 5F1IB 4RAUA 5C08A 1RIVH 5A3ID 1MHCB 1ZVSB 4ODBD 2AEPL 2P8LA 2B20A 4PGJA 1LO3L 1KN4L 2YAPA 4HUNB 4K3GA 4UIKL 1T5WA 2XLLA 2VLJB 4KUZL 2ZOTA 4Y2OA 1KT2A 3Q44A 4K5PA 3UL4A 3FFCA 3KPQA 4NC1E 2YUZA 4Q14A 1KULA 2FH8A 1B90A 1U21A 3V4LA 4XPGH 2DN7A 1BQLL 4TYUA 3SE9L 2GT9A 1ET7A 1KGWA 1PW3A 1MEXH 3KS0J 4UBDC 2G9HB 1XAKA 2ZKHH 4R97B 1CCZA 4XB3A 3DK2A 2DOCA 1P7QA 4Z0BL 5ESQA 1MCRA 2RJMA 3MRIA 3OKMA 1J1OL 3EGDA 4ZMWA 4MJJA 5GS3A 1TUPA 4P4RB 5DJXA 1J8KA 3MBEC 2XN1A 3FN0H 1M05B 3IM1A 3NA9H 2R56L 3VGGA 1HWGB 4BFJA 4PRHA 4L3EE 4Q6IB 3T65B 4YS4A 4IRSB 5C0AD 1LE9B 1ACYH 1RI8A 4S1RH 4PFEA 4XVJH 2DBJA 3PRZA 4LCVA 1ZPLA 4MMYA 4NC1C 2P26A 4RFOL 4JAMB 4Y2DC 3D0LA 3GBEA 1OLZA 2OCJA 1VLXA 3AQZA 4IKNA 1DBKL 1FIGL 5ESVB 5DS8B 3PL6B 5E2UL 4P2CG 1L9PA 1VESA 5DHYA 2YK1L 3R7QA 3V6ZB 5AKSA 3TZVC 2XCMC 3FU7A 3N1MC 1HZHL 1RURH 2WUCL 1ZCRA 2FUQA 2RHEA 5D1QD 1C9SA 4BD4A 5T1KD 5B1JC 3CXFA 3UBXI 2AV7A 3B7RL 3QFDA 5JIDA 4FYQA 4N5UA 4Z1PA 1N3NA 1IGTB 1BVKB 2X1XR 5CZVL 2ATKB 4KKZA 4G7YL 5IGXH 3PP3H 1ESOA 1MN4A 4URKA 1OAUH 1BQUA 1IQWH 4UV4H 5I1AA 3QI9B 3FUNA 1MJ7L 1UA6L 5DK0A 4FQ2H 4NENA 1RH8A 4MAYD 1U36A 4W4OA 4CSSA 1I7ZA 3V4VL 5C0CA 1G7HA 2DBLL 3FU5A 1WFIA 1CGXA 3ABZA 4WFED 4BRJA 1IM3D 4PBXA 1YPZA 4F2FA 5EEWA 3L16A 4AYEC 1B0RA 2H8PB 5J1AA 5JPMA 1GW0A 1F3JA 3UIYA 4WFGE 1NTDA 1HHHA 3N41B 5BV7C 3NCFB 4N2FA 4LEXH 5BUAA 1CUOA 3GKWH 4FXKA 4GRWE 3V6OA 2A4EA 1TF4A 2ZUSA 2B9BA 4UDTB 4AV4A 2J6EA 3PWVA 2QHRL 4Y16B 5T33H 1BFOB 1DSFH 2YBRB 5C8JA 4FP8L 1JPSL 2YD0A 4OGXL 5EUOF 1JCVA 3IJYB 1PZCA 4UQ2A 2OBGA 1Z0NA 4JZOA 5ITBL 4HUWA 1MHHA 3VSVA 4WO4A 2F5BL 1SHXA 2GHZA 4MCZA 4NQVA 4OFPA 1EHNA 2ENQA 2BP0B 3T5WA 4YSAA 3ZOAA 1D5BA 1IBBA 1NCAL 3DXAA 3CX2A 3MOBL 3DX7A 2IWEA 1LDSA 1K4DA 4XN8A 5GQBA 3P4OA 3VWJB 5IY5B 5I6XC 2VDNB 3MLXL 3EYVA 5DUBA 2YD7A 2WZPD 2XN0A 3DX9A 3O6FC 5DK2A 4J4PC 3M86A 2DZEA 1HI6B 2YC1A 4P4KC 4A68A 3STZB 3L5XH 3Q9QA 3NP3A 5I1EL 4KHTL 4YXHL 1X44A 4OZIE 2DI7A 3EHBB 4XP5L 5D7LB 1TQSA 3Q6FA 3ZDYE 4AGMA 4DJMA 2EYRA 4QOKE 1M9WA 3CIQA 1KCSH 4AEHH 5F88B 1YN7B 4WTZG 4XPFL 4CNIB 1M7DB 4XOCA 5FM5O 4WJ5A 1QO3B 2BSTB 5F1IA 4LEBA 2B2XH 4DAGL 5AVRB 2P4AB 1ZVSA 3AREC 3BCFA 5C3IA 3G6AB 5D2NE 3SKOB 4X6EB 3L3OB 3PAUA 4R4ND 3IVKB 3LZLA 4HG4J 2VLJA 3FJTA 3T0DA 1E43A 2HT2C 3CVCA 3MJGX 1NGPH 5SX4H 3FCUB 3K3QA 1R3JB 3OAYK 1VPOL 4WV1C 4ZAKD 1R5VB 4G7VL 3RUGB 4ECNA 2DKMA 4AWJC 1PZUB 1F41A 2NY2D 2EVGA 1WHOA 1KWKA 3ZHNA 2G9HA 2J8HA 2W07B 2Y1ZA 3BVTA 4GAYB 4W9ZA 4MD4B 1ZIBA 4LLUB 4F7MB 4JO3L 5D2LF 5A2AA 4G83A 2EABA 2CO2A 4KJQC 4P4RA 4ZD3L 5HDRA 3NZHH 1I9JH 1GZQB 4JRXB 5IR1B 1M05A 4YHIB 2R4RL 5IF0B 5F70A 5IT2H 3MO1A 4Q6IA 3T65A 3ARTA 5D2NC 4UQBA 5KANI 4IRSA 2BZCA 1HKLL 1LE9A 4J3XA 4N9GB 1CDYA 1J8HD 1OZTG 2AP2A 2DMBA 3RWHB 4DW2L 1TR7A 2BNRD 4PM1A 3UJIH 2NNXA 1UCBL 1EZVX 1ZV9A 2H9GB 5EN3A 3MMEB 1P84K 4JAMA 3QQNA 4AQAA 5DQJB 3S3BB 1YPZF 2FZ3B 5I6MA 5F44A 1ZGLB 1EHLH 3HI6H 5ESVA 2BSBA 3PL6A 2ZCZA 4BKLB 3L6FB 2CWRA 1AZZC 1YC7A 3V6ZA 3DOIA 3IKKA 4UZSA 5FGCB 3MUZ1 5E5LA 4MA3B 3C5JB 4ALAH 3AM8C 1YNLH 3MBWA 4Y19B 3IWVA 3UC0H 1L7IL 1D5MB 3QRGH 2ISDA 1HEZB 3QDJE 1H8LA 3RDTB 5F6HI 2EVFA 4JM2D 1IGTA 5KYWA 1OTUD 5I6PA 2ATKA 3E8UL 5FEBA 4HX1A 3O4LD 3FCSB 3JTTB 3DSFL 4BIKA 1C08A 1YAZA 2DIJA 2WXNA 1TYJA 4P3CH 4JY6B 4GRLC 2GI7A 4HEMA 3UCQA 3D25A 3UAAA 3RZCC 5KBNC 3RX8A 3KL3A 1T6VN 5EEZA 5IJKC 4X80H 3ILDA 3CZGA 5TF1L 4FJ6A 5B38G 2OI9B 1SJEB 2JE8A 1X5MA 2LGNA 2A38A 4OV6F 4TULL 5DDHB 4CA4A 5HY9B 4BH8B 2EE0A 5DO8A 1K8DA 5K9JL 4BHUI 3MCKB 4HUKB 1BZOA 2FTAA 3I3DA 2F19H 3SCMB 1U42A 4PJEE 4GQPH 4DFIA 4G8GB 1WK0A 1I8AA 2G5BB 4KO7A 3S37X 4BUQA 2FIKB 3ZDZB 4UDTA 5IV2B 1E6JH 1XV8A 2FT7A 2IMMA 4FG6C 4U0RB 4BH7B 4PW4A 1SUHA 1MFCL 4Y16A 2CBOA 2YZ1A 1BFOA 5DVKA 2IDFA 2EADA 4R9HA 2DTSA 4OI7A 3IJYA 4PJ5B 2X4SB 4BK8A 3V0FA 2IH1B 2FGWL 3IYLW 4W9IC 5JXEA 4AW7A 2BP0A 3VACA 3NK3A 4JW3A 1A3ZA 2JKJA 1N10A 2XV6B 1JVKA 5KJRL 5LKNA 5HYSA 4Z7VB 2XWRA 1OLLA 4D7PA 1NGQL 1FGVH 3VWJA 3GMOB 1J0HA 3ARBC 1BJ1H 1BVNP 4NJ9L 4OCSL 1ZLWH 4P04A 3C2AL 3ZSSA 2YWZA 3MV9A 5I30H 5IREA 5GRXG 1LLAA 4JHAL 3QJUB 3N9GL 4QTIH 5F97E 1HI6A 1CD8A 3QSKB 1ZLUH 1QSFA 2A4ZA 3STZA 5FO9B 1RP9A 4UOW1 4U6TA 5E00B 3ATAA 4ZMVA 2QSCH 2N7AA 4LSRH 3BSGA 4XAKE 3T09A 3WTYA 1JOIA 4BFBD 2J5LB 5F88A 4FKKA 5DHMC 1YN7A 3EZJB 3H4FA 1M7DA 4KVCH 4QY8B 2VM9A 4CNIA 2BSTA 3WU1A 3S5LB 2N0MA 1BSIA 3G6AA 1AQMA 1SXAA 3SKOA 2YXVA 3L3OA 4KFMA 3IVKA 2JKIS 1FRGL 1I1RA 4ZW6A 1BAGA 1M9SA 2P5WE 3B9KB 1R3JA 1TT6A 2VR5A 1HXMB 5HD8D 3EUDA 4P23C 1R5VA 2W95A 3JWDL 2C7UB 4KAQH 3RUGA 2LE9A 3KWTA 4H8WC 3T6XA 4IKJA 3K80A 3PFQA 4N6RB 4L8DA 4XP6L 2W07A 3EGXB 1WBYA 4LBEB 2VLRE 4GAYA 1RJZB 4AGLA 4AIEA 5I1IH 4MD4A 1BREA 4F7MA 3MUJA 1TJXA 2QSVA 3BKCH 1OF2B 3DKHA 2Y9RT 5D4IA 5A2CA 5I8CB 4V1DE 4F92B 3CLEL 4JRXA 5IR1A 1CK0L 3A5VA 3D4YA 3K2KA 4KX9A 4ZFQA 2E4TA 5IF0A 4KMTH 2YD2A 3BWUC 1NC4A 1UM6L 1CR9L 1IC1A 3Q0HA 4JG0L 5BVPH 1DANU 2CR3A 4OR1A 3CSFA 4I85A 4N9GA 2B0SH 3H6AA 3S7GA 1PMYA 2YRBA 1ZGLP 3FDWA 3OL2A 2DLHA 3FNKA 5GISL 5HGBA 2H9GA 2HXAA 5KVGH 3MMEA 2EZ0C 2YD6A 1OK0A 1S9YB 5DQJA 2FZ3A 2X3CA 1MW1A 4FN0A 3RFZB 4UQ3B 1XH3B 4BKLA 3TWCL 5ESAB 3N41F 4WW2F 3ZE2E 3NIDB 2IWGA 5J11C 1DP0A 2XA8L 2Q8BH 4FAAB 2VR7A 3O6KL 2I5YL 4UQCA 4YUEH 1HQ4B 4MA3A 3C5JA 4K94H 1Z9SB 4C59B 4HPOH 3ISYA 2Z65C 3FYIB 2Z6FA 1D5MA 1WCQA 3RDTA 4JCMA 2CRMA 1NCWH 3FAXA 4OLXL 3FCSA 3JTTA 3NFNB 3HBZA 2VJ0A 1E67A 5HDLA 3EJSA 3SDXE 2CJUH 4XH2B 2X38A 2GAZB 4JY6A 1E50A 1O75A 3FUKA 3LKQB 5CJ5A 4M1CD 4M4PA 1QFPA 1TZIB 4WSJA 2VIRA 3OJMB 3I75B 4HIXH 3RGVA 5GS2H 3Q5YA 3LIZA 2CLRB 2PPAA 5IVXF 1K4CB 1SJEA 5DDHA 4JREB 4R5VA 3S2CA 3MCKA 1WRFA 2CMRL 3SCMA 3L2LA 2H0PA 2KDYA 3MLVH 3IRPX 1H8SA 2BNUA 3T3MB 1CF8H 2VCOA 3M88A 3GSNL 3Q43A 4G8GA 5T8IA 4I2XE 2MPVA 4OGZA 1NMCC 2CO1A 4I18B 2G5BA 2J4WH 2JCCE 5B7EA 3JTSB 4W68A 3SPCA 3V0DA 3EO9H 2FIKA 3WXWH 1YQVL 2OCCB 4Z3FA 3LHAA 5A7EA 2FX9H 4LCWD 3W2DL 5IV2A 4D9QD 3OX8B 3FT2B 3FKUS 4BH7A 3FCGA 5TE6H 2IDUA 3HFML 2H5UA 1MOEA 3JZYA 2HKFH 2R0LL 1SMOA 4YSDA 4KJPD 3BUQA 1II4E 5E5RB 4B60A 3PQYD 3CPUA 2FLBT 4PJ5A 3DROA 3ZTNL 2IH1A 5JW5B 3AXLB 3B37A 1A3QA 3DIFB 5T5NF 3ZTJH 3L81A 1N68A 1ZEAL 3B3BA 3CFNA 5AZUA 2YPVH 3QDMD 4UOQA 3VTMA 1WGOA 3Q8BA 5DZVA 1JRHL 4ADGA 1V5JA 3GSRB 4NQDE 5J13B 3FB6B 1XGTA 5AW4B 4Z7VA 3TCLB 5AENA 4KZDL 7PCYA 2EKSB 5JMRA 3GMOA 1RSYA 1XF4A 3S2AA 2OSWA 1GCYA 5E6RB 4YWGH 4PJGE 4OZHE 5CM1A 1MRFL 4R6UA 3ZYIA 4LDLB 1F1DA 1KBWA 4HUVB 1F1GA 3O9WA 2W92A 3BUYA 4YDIH 2X0UA 3QNZA 1IM9B 5FO9A 1DQVA 1TJIH 2ICES 4JPWH 5CU9A 5E00A 5D1XE 2FHFA 3S96B 4QRQB 1MI5B 3QUZC 1G94A 2B1OA 3A6BL 1PNDA 3BLPX 1OSYA 3CVDA 3MA9H 2EIZA 3D4ZA 4XNUL 5B1BB 1D7CA 3QUMB 4WEEA 2A0LC 3U36B 3S5LA 2WQAA 4KTDL 1HCZA 3UAJC 1XHHA 4R26L 1T6BX 4AGNA 4JM4L 3ML8A 2AJZA 1UXWB 4OF7A 5EU6D 4ZTPL 4MHHI 1SYSA 3HG2A 1ZTXE 3D51A 2EE2A 5DU7A 2V5YA 3TVMC 3B9KA 3FTGB 2NXYB 3LXBA 4LOUC 3VRLF 3CLFH 1HXMA 5FUOL 2QSTA 2FEDC 2NY5L 3DGDA 2C7UA 5E9DE 3KWVA 3O0RL 3RE0A 1I3UA 3EGXA 3MRRA 4JRFA 3VFOB 5DCCA 1RJZA 4JE4B 5D1XC 2A77H 4PUBL 2X40A 1XR9B 3EJTA 2B3IA 3VA2C 1LM8V 2H1PH 5AZEL 4H8QA 1OF2A 3TASA 2WJ7A 1R24B 5ICUA 4YDKH 3NZ8B 2WGNB 2A99A 2X9YA 2WXRA 2Y2TA 1ZLWK 3V6OE 4HLZH 4N2BA 2APSA 4MNGB 3EDJA 1A9VA 3CXDL 1ZRUA 3GMRB 1ZLUK 5LG1A 1MCJA 3LN4A 2Y5QA 2CCWA 3K8LA 2HH0H 2PWGA 2FH6A 3ZL2A 4JFOB 4TSBL 4FABH 3RFZA 4RGNE 4UQ3A 4QUOA 1OCZB 1PCXA 3ARFD 5HYIA 1OTSC 5ESAA 4Q9RH 5MEPB 5AVVB 3LD8B 4L4TD 4WUUE 3TESA 1HQ4A 4G9FA 1Y1DA 4J6IA 3ZDZF 3IU3B 3T0VA 5FO7B 2G0LA 3DVNA 4MD0B 3R19A 4ZK8A 2VZ3A 4ZXBB 4WTQA 4NUJB 3GSQB 3FRPG 1UWEL 1U8OB 2KZWA 4P5TC 4W4NA 5T1JA 4G8FA 5FYJE 1V7ML 4BDVB 3ECUA 7PAZA 3NFNA 4ZFGL 4KTEH 5BOPA 5JQHC 2PCXA 3ARDC 3LKQA 3Q8FA 1AAJA 3EOTL 4IJTA 1E3ZA 3I2CH 1FE8H 2F68X 3OAZH 3BGMB 3L7FB 3WN5A 2CLRA 2DM7A 4KRNA 4RGNC 1K4CA 4OGAD 4QRRE 1GZHC 2IFGA 1FYTA 5LBVA 4X4ZA 3CDZB 3BP4B 4CMHC 3NZSA 1BYPA 3IDGB 2CM6A 4AQ8C 4QXGH 5C0NC 3MUY1 4D0DB 3VGEA 5GS0H 3WNIA 2WBWB 4IIQB 4DEPB 3RY6A 2NNRA 4I18A 2JQZA 1RVFH 4MKTA 1LILA 1TQBC 3CZLA 2EIKB 4CC1A 4EPSA 3L17A 1A3LL 5KVDL 4YDLC 5JTWA 3OX8A 3BAJA 2AMGA 2Z91B 3KVDD 4PY8I 2IAMC 4B9JA 4F7CB 5F1NB 1IC4L 1Z5YD 2XIDA 1VJSA 5BO1L 3RKDD 4GSUA 5C0AB 1ACXA 1A6VH 1W9XA 4GT7A 5D8JH 5EZPA 2PN5A 3S35L 4N0YL 2HFFA 5HHQB 4O5LL 3ZZSA 5JW5A 4P5RA 3DIFA 3EJZC 3SGKC 4TUKH 1QFWL 2R4SH 2JB5L 5EIIA 1JZ8A 4AYFB 1SEQH 1JTOA 5ALCH 4E5XB 1KEGH 5DTFA 4R3SB 3GSRA 4UZGA 3FB6A 1P69B 3HG1A 2BERA 1QFUH 3TCLA 4CDHA 2EKSA 4IBSA 4DVBA 2EDJA 1OSZB 5LCVH 5D1QB 2PKDA 2E59A 5T1KB 4PLNC 3P69A 4JFFD 4DSYA 3LV3B 4NAQA 3EBHA 3H2WA 4PVMA 3QHZL 2IADB 1UD8A 4JR9H 3SPGA 1UYWL 2H0EA 4HUVA 4F93B 1IM9A 3VRJB 2UZYB 5B4MD 1KTRL 1CFVH 3HMXL 4JFVA 2QVTA 4AMWA 2C9QA 4HHGA 5K9QG 3S96A 4QRQA 1MI5A 2MNJB 4R4FH 4YSOA 4KDTA 2ADFL 3EFOB 4MAYB 3SPJA 4PJHB 1J11A 3C75A 3QUMA 1M2OA 12E8H 2X4NA 4HF5H 1KWGA 4Y7OC 1I85A 4LB8A 4QXUH 4L9LC 3AUWB 4FQCH 4BE5A 1IM3B 5D7KE 5C0BD 3SBQA 2TSAA 3BO8B 1S5HA 3K2UL 1V3JA 4KU1A 3FTGA 3PXHA 4J6RL 3UAEA 2J21A 5TDNB 3HG0A 2BXYA 4XGZB 3NVQA 4FQ1L 3EZ8A 1T83A 1R75A 1P1ZA 3VSQA 4RSVA 4M48L 4XR8C 2CNZA 2NTSP 4FOMA 4B7LA 4WZ9A 2EDOA 1K3IA 2AEQH 2YEZA 3LS4L 1XR9A 3PWPD 2OW6A 3UTPE 1AD0B 3NRPA 5K9OB 1TETH 1R24A 3T2NH 1TQCC 3NZ8A 5C9KA 1RULH 2F53A 1JHTB 4YHNA 4KI1A 5JW4N 3FUEA 4JZNB 3CSPA 4R84A 3K8KA 2BVPB 3QIBC 4MNGA 1FAKT 1PZAA 3G5YB 4IGBD 1UD6A 3L3DB 4EF3A 1AGCB 1MCCA 3LZQA 4YH6A 2X4UA 5LGYA 4Z76B 1ZD6A 1CL7H 3GMRA 3K0WA 3TN0D 5ISZD 4MQXC 1SY6L 4Z7UE 2JJUA 1T21B 1NIDA 1T5XB 3CDFA 4J3OH 1H5BB 4QJ5B 5HHOD 3QYCA 3TFKC 3BT2L 1NDMA 4TPRL 1BW8A 2O6EA 2VZ1A 4JFOA 4DVRL 2ZAHA 2PW2B 4XC3L 1WIOA 1A0QL 4FTVA 5HHME 4FMKA 5MEPA 5IQ7L 3PGFL 2YN3A 4DN3L 3HNVL 2FLRT 5BJTB 2D0GA 2ZE0A 5ANME 2E8ZA 2EIDA 2RGSA 4LRIA 3IU3A 4YDJB 4JDVB 4PPTA 5FO7A 3U4AA 2X53A 4WEBL 4MD0A 2DDQH 2GG1A 4ZXBA 1BEYH 4UUJB 2ZQKA 4NUJA 3GSQA 1J0KA 3JYCA 1U8OA 3L1OH 5BZXA 1ZGLM 2VDPL 3BFWA 4FNQA 1T89C 2VZVA 4YLBA 4BDVA 4Z3IA 4M56A 1RHFA 3NFSL 3ILQC 1E4HA 2ZOWA 4ONOA 5EZOL 1S46A 5B7MA 4XPHH 2OMBA 4HUUB 5CD5D 1DJXA 2CO6B 5E8OB 1YEJL 5I6KA 1YEFH 2A4CA 4GAJH 4MMZB 3BGMA 3L7FA 2Y06L 3EYFB 5IJDC 1R17A 2ARJB 3WNKA 2F54D 4M6OH 4ZAKB 1PKQB 1RZKL 3VG9C 3BP4A 4TQIA 2OR7A 3K7UA 4NN7B 3P73B 4IM8A 3IJSA 2NY2B 4FLRA 2VQ1A 4D0DA 1IVLA 2YJQA 3Q1EA 1MFDL 4IIQA 4YHYC 1JMXA 1F6AB 3ZYJA 3QJHA 5CO1A 3L5WB 4AZ8A 3CVIH 5E5UB 4K15A 4IRJC 3ZDXF 3WNLA 2C9VA 2ESVA 2Z91A 5EEUA 4IU2B 4U7SA 2ALWA 2DQIH 5F1NA 3BHBA 4F7CA 3NCMA 3TBYB 2O5NA 3D87B 3EUUA 1J8HB 2OL3L 5JO5A 4ABVA 5HHQA 1FSKB 1HCFX 2BNRB 3NIFF 5F7FA 1OQXA 5IB5B 2GCYB 3PS6A 4RGMC 3V95A 2L0DA 4AYFA 5CCJA 1GC1L 1ZLEA 1R0AL 4MXWH 2ZWYA 3P3TA 2Y69B 3PF2A 4R3SA 5BS0A 3PPEA 4PS4L 2AJVL 1FJ1A 1ZWIB 1JNNH 4EN3D 4HXAH 1INEL 3STLB 3GI9H 2NY1C 1OSZA 3HLAA 5EOQH 3X14B 3APCA 3KDMA 5D1QA 2KZBA 5T1KA 3ETBJ 4RNRB 2ZUVA 3ALXA 3LV3A 4M02A 5CEYB 4L1SA 4PRPD 3QISA 2IADA 3ETTA 2VQTA 3LIUA 3LDBC 3MRFB 5IVOA 3VRJA 2UZYA 3O4LB 4X4XB 2FAUA 2Z8VC 3WJJC 3P2TA 5MEQB 5ICZB 4MMXC 4B95C 4ESKA 4FNLH 1BZDA 2Y5EA 2EVIA 4QD2E 3G5XB 3EFOA 4PJHA 3IGLA 1IIIA 2GY5A 1YHPA 3SE4C 5AFAA 3N1GC 3U1QA 2DQMA 2Y3AA 5CS7A 2O30A 2JKSA 2WLKA 1J5DA 3D3VD 3UEQA 3QQ9C 1UT9A 4W93A 1IM3A 3T9WA 2WQXA 1HC1A 1KGIA 2VXVH 2QADD 2BP3A 2YD9A 3R8QA 3V0WL 5ADOH 3U25A 4WU5B 2FX7L 3PHQB 4ZOCA 3UEZA 1HFUA 3KJ6L 4KROD 2B4CH 1URZA 1J1XL 1A8ZA 4NQCB 4ODSH 4Z7NE 3G5VB 1KJ3L 3SJVE 4HJ1A 3SYOA 2IPUK 3MXWH 2Y6SD 5TDNA 1KC5H 4XGZA 2AJYH 4MNQD 2E0PA 5EH1A 2X0WA 4XHJD 3Q1SH 3F65A 5DD3H 2NSMA 3D9AH 4K3JH 1A1NB 3KPMB 2K9FB 2BRQA 2WYZA 4XPAL 1FDLL 5DT1H 4AIZB 3LHPL 5K9OA 4PR5B 5JW4Q 2YKKA 1NBCA 4G6ML 4LSVL 3CHSA 2NY4D 4JZNA 2FATH 2BVPA 1JUFB 4GH7B 3BKML 3L3DA 4PBDA 1AGCA 2UVFA 2W59A 1OE3A 4Z76A 3NABH 2YLKA 4TNVF 1T21A 4YJZL 1T5XA 3BPLC 1H5BA 3FTVA 5GSRB 2BDNH 2M1KA 1IMHC 3QUYC 3FL7A 5H94B 5ITFB 1L5GB 2CBPA 2UVEA 1F3RB 1J5IA 1JPTH 5B38B 3LQMA 1S78C 2PABA 4K3EL 5BJTA 4TLKA 2DH3A 3NCBB 4M5ZL 1YEHH 4PLOB 5CILL 4YDJA 4JDVA 5HYJE 4N1HB 1DSYA 4UBDD 1UXSA 5BQ7B 4UUJA 5KVEL 5BMFH 1M1XB 4HK0B 1NEUA 1I8KB 1QA9B 3TNMB 3EF7A 4LOVA 4L8SC 2H6PB 2WQ8A 3BSZL 2XVKA 3E1F1 3K4AA 4MXVF 1YJDL 4WY7L 1E9PB 4C56E 1TVDA 4D9LL 1S9XB 3MBED 5C09E 2CPUA 1IKNA 4HUUA 1W0YT 4WWKC 2Y4SA 5LNEA 2CO6A 5E8OA 2Z9TA 4CSTA 1KN2L 3EYFA 1HAWA 2X7LA 4E41B 5B3SB 1GJIA 1NSNL 3G5ZA 2GHWB 5AVXB 4ZAKA 1PKQA 4L3FA 3VMOA 5LGHH 3M1BA 4OJFL 3P73A 4HXBL 2VQ4A 2AKRA 3RU8H 4Y2DD 2EC8A 1QBLH 3MJ9H 2YQGA 4LDOB 3U0WH 4C55A 3V0VA 1RK1B 2ZP9A 4CSZA 5FIEA 5HHNB 3D12B 1F6AA 1XCQA 1I1AC 4NNYB 3DA0A 3H7LA 5EWIH 3HHRB 1EO8H 4HIEB 4JFDE 5K39B 3TZVD 2DWDB 2O6PA 4P46C 2P28B 1E4KA 5GRYA 2VMCA 1IU1A 4IU2A 5HI4C 3PYCA 5E6ID 2I60L 4GYBA 3TBYA 4KKCC 4PJHF 4OJYA 1M7XA 3F5WB 3HMWH 1TJMA 4L3ED 2BNRA 4U3SB 1JXFA 2K4AA 1N8ZB 5IB5A 2DIEA 2HRHA 2GCYA 3ULVL 3LKSB 2BSED 1MIEH 2ATPA 3ZKND 5L9DH 4A2MA 5SWSD 4ELKB 2W0PA 2Y24A 4WTZA 3CHOA 3CHRA 4Z23A 1FLRH 3OJDB 1A1OB 1ZWIA 2WQSA 2PPCA 4PGBA 5H37A 5DSCB 4PJ9C 3GSNA 3STLA 1N7ML 1KXHA 3X14A 4N68A 4HJGA 3VSTA 5F7EH 3GDCA 1YEDB 5IVZB 4A55A 2OM5A 1ZLSL 2YGPA 4RNRA 1D9KA 5CEYA 3FBKA 1HH6B 3PAYA 1BMZA 1HVXA 3DIDA 4UTAH 1KCWA 2FJFB 1RIUH 3MRFA 4WNQB 2BY1A 2C4FT 3NIGE 3WTXA 4QDGA 5IUCA 5DI8B 3LNFA 3O4LA 4LL4A 1CO1A 2XPZA 5D71L 4ZPTB 2GKIA 4M7LH 3QAZB 1QABA 5DJDB 3HRPA 1HIML 3OKNB 4G1EB 4N86A 1YEKH 4A7UA 2OZ4L 3QWRD 2F1AA 4K3HA 4MA1B 5LDSA 5D7HA 3GZPA 3APMA 2AI0L 3N1FC 1ANUA 5D7IE 4Z7OE 2G3NA 4UT6L 4GQQA 3PHSA 1UENA 4WU5A 3VI3B 5DRNB 3C6SB 5I18L 1ETA1 4NQCA 4ADIA 4TN9A 2V5SA 1MLCB 3L4UA 4NWTH 1MIMH 3WJLC 2DWTA 5AQ0A 2WQUA 3TH2T 5LJYH 1RK0B 2ENYA 4LCWB 4YSUA 5DGQA 4UILH 3AG2B 4L1HA 2A6DB 2FQFA 3T2QA 4HS3A 1A1NA 1OB0A 1G7LB 3O6FD 4J4PD 1SN5A 3A6CL 3QPQD 2QZ5A 1XCXA 3E9UA 3PQYB 4HT1H 4AIZA 4AJVA 4PR5A 5FGBA 1SM3L 4G6AD 1HYRC 1RZ8B 5KOMC 2XRAH 4Q0XL 4JCWA 2C9SA 1ECZA 4F37K 4G71B 4YBHA 1R6VA 2Y07L 1JUFA 2BVQB 1FI8C 1YO4A 4QRFA 3QDMB 1FN4B 2VABA 4OLWL 2R29H 2C1PB 1NCDL 4IDLA 3IEAA 3TT3H 5GGQH 1LP9B 4GUCA 3IJHB 1FZMB 1L6ZA 1YYCA 4LT7A 5GZNC 1E4JA 5GSRA 4F8QA 3ARED 5GRUH 1G6VK 5H94A 4Z7QB 1GA2A 1L5GA 5FYKH 3S88H 3A4EA 4U6XB 1H3PH 3QC6X 3RYMA 3WENA 3P3SA 2ZPKL 5GGUB 5A7BA 2HT2D 5B38A 1TFPA 1MW2A 3H9SE 4K94C 4GI8A 5DVPA 2VR4A 4UQAA 3DUHA 3JWNH 4FNRA 4Z3TA 1P9MA 5CGTA 3X17A 4AL8C 3MZTA 3AY4C 1XL4A 2D7PA 1M1XA 1Z5LB 4XTRC 3S3CB 5KSVB 1I8KA 1QA9A 3SKJL 3TNMA 1FZJA 5T3XD 5ICYB 3LSOB 2D0FA 2H6PA 1H0DA 1BMGA 1F6LL 3WI9A 1WAPA 1E9PA 3BFOA 3H55A 2Q10A 4KJQD 4QOKD 3UTSD 5HSFA 1S9XA 4J12A 5FKPB 4WI8A 3VXMD 5JOPD 4AYSA 5EU6B 5IB1B 4JFHE 3VFUB 1T1YB 3EJYD 4R7NB 3AFLA 1LO3H 1KN4H 2UZPA 1DJHA