4AWJC

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
135
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 30
structure length 135
sequence length 139
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4awjC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4awjC01
1LQBC 4BKTC 4W9KC 4W9FC 3ZRCC 4WQOA 3ZUNC 4BKSC 4W9EC 4B9KC 4W9JC 4W9DC 4W9CC 4W9GC 4W9IC 4AWJC 4W9HC 4AJYV 3ZRFC 1LM8V 1VCBC 3ZTDC 4W9LC 4B95C 5LLIC 3ZTCC
chains in the Genus database with same CATH superfamily
4L8SB 4EUPA 2Y72A 3CZNA 4HUMB 5TH2A 1E5YA 1ZTXE 2XN9B 3RIAK 1AHWA 3SDDA 5KVGE 4I13B 4UNTA 1IEAB 2X0UA 5DI8B 4OZGB 3L5XL 4FRWA 3U9PL 1RQ5A 4GG8A 4FLQA 1AVAA 2FAUA 2AJ3B 2DLTA 1BD2A 4MXVE 5DYOA 3QZPA 1W15A 3FN0L 2V7HA 2SODB 3NABL 2V17L 4FGMA 4N5UA 3WO4B 1KJ2H 2F5AH 3NZUA 4YBQC 3ME0B 4WUKL 4AYFA 3FB8B 1QSEB 5BO1H 2AAVA 4NQCB 4OKVB 2J6EH 1JXJA 2CNYA 5C0FB 3KYMB 2XXMB 4GINA 1A65A 1ETZB 2B7DT 4U4IA 4WLCA 2AXWA 1S7RB 3QZNA 4D9QE 2DLIA 3APMA 2IG2L 2DMCA 1J5HA 4JUTA 4S1DC 4TSBH 1MVUA 5DZOA 3ESNA 1DEEA 1CDYA 2F53D 3O8XD 3LXAA 3RFZA 4NRXA 2JKRM 4NXKA 1MDAA 4ZMTA 4N1HB 4OAWB 3KM1A 2LTQB 2VDNH 3DO3A 3VXRB 1CFVH 1I1AD 5GRWA 2RIKA 1FVDA 1E4XI 3T09A 4FKEA 3QI9D 5KBNC 1JV5B 4HKBB 4DKEH 1BQHA 4AJWA 5LNEA 3BVDB 3S4SA 4L23A 2X70B 4M43H 3RL2A 1SQMA 1YEJH 5DCCA 3VD4A 1N70A 1NLDL 2CBOA 1ANUA 2PPEA 2Z6FA 4Y4FD 3RILA 5BZDB 3GLDA 3WIFB 2IO5A 2X4SA 5SX4I 3U7YL 4U1NA 1HH9A 3EJCA 1LDSA 3B56A 5F3HA 3GD1C 4KTDH 3UOAB 4CVZB 4TSAL 2NXYC 4WEUD 2BSEA 3HC4H 3ZW3A 1JGDB 4XPAL 4GRWF 3NFPA 3QO0B 1AO7A 2NSMA 2XY1A 2HFEB 4ZO9A 1F86A 4IOIB 2ZCZA 3HE7C 5E5LA 3O3DB 4N0FA 1K72A 2XQYK 5I8KL 3VWJD 3V79C 1ZE3H 4BZ2L 5AG8A 3D50A 4G43B 1OARL 3NSXA 4IGBC 3OAZK 1RK1A 4W9HC 4HWZA 5CJOL 4YSDA 3QIWD 1TZOA 5FUZL 3ZKXB 4EN3A 5E6ZA 3WFHA 4HWZB 3CN1A 3A4EA 1UYWL 5G4MA 4DQOL 4KK9C 2AXFA 1YHPA 3JWDH 2BZDA 1A25A 3L4ZA 4Q74A 5IROC 1ZHNB 4RBPK 5ACZB 1INDH 3DX1A 4M7ZC 1IEBB 1KCBA 4MD0B 2Z4QA 3W11C 4DP8X 4HOXA 3QZMA 1EJ8A 4W9DC 2F1AA 5HTSA 1KENH 2ZCKH 5I16A 1KY7A 1OAUL 2MCG1 4KNQA 4QRRD 5HJBA 5DJCA 2VR5A 4P5TA 4APQB 1M7XA 1UXWA 4I1PA 3QRGL 1T6WA 5F1NA 4M4RA 2DLEA 1IAIL 1E9OB 2PXYA 3VAEA 4P23D 1ZOXA 5DK0A 4HIPA 4H7VA 3V6OA 1E3ZA 1P5UC 3MBEB 4X0KB 3DTDA 4YE4H 1D9KA 1EIBA 1B3JA 2JELL 1A4BA 4KJWD 4R6UA 2AK4E 2BSTB 4KKLC 3O6FA 4XNZB 3ZRSA 5HGDA 4CMMB 1BZEA 1WWWX 4JFOA 4MNGA 1MSPA 4XCFL 3II2A 2Z7ZA 4XNDA 1FV1A 3I6KB 5IQOA 4FNLL 1VAHA 4R2GD 4P3CL 5HYFA 4U1NB 3LNDA 4HSQA 4JN2B 3RVUC 3L5XH 3BDBA 4E68A 2VXQA 5ISZB 1MCSA 4ELMF 3KEHA 4HIIB 3W37A 1MCJA 1WCQA 1B0RB 3QJFB 2N0KA 4WK4B 3ILQC 3NABH 4N6QA 1JPST 1T1WA 2OLDA 1FDLH 2CO3A 3AACA 3PFUA 4UOW0 2PPCA 4OFYA 1F18A 1OB0A 3MLRH 5D1QA 5INCB 5DJ2A 4AYFB 2FQGA 2E56A 4NM4H 1CD9B 1DTUA 1JDAA 1ZXQA 4H8UA 3T1FB 4HS8L 3VRIB 4A39A 3UACA 3HBZA 1NCIA 1WJ3A 4KK6C 4IJ3B 4MA7L 5CIPB 1BD2B 3POCA 4JS7A 1XGZA 2X9WA 1NTDA 3VXSA 5BV7C 1MHEB 2OMBA 3QULA 4WTQA 4NXSA 3FT9A 3SCMC 3U4BL 3EXJA 2YD6A 3QIUA 2JIXA 2OJ1A 3TBVB 2KPNA 1E28B 2FO8A 3GHBL 5I0VA 1AQHA 3A24A 3DI2B 4GS7B 5JDSA 2E47A 2WXKA 4KK5D 5DUML 1G9ML 5SX5H 4W9ZA 4ZO6A 1H6UA 1XB3A 5KN5B 3FU8A 1ONQA 1UFGA 3B9AA 4NQEE 2VLMD 1ZGLB 4L18A 5ESAB 4FNQA 4PJ5B 1KYUA 3IAQA 4L9LB 3L6FB 5HDWA 2NY5C 4YMPA 1RJZA 1GGUA 1TQBC 3NGBB 1T2JA 2CG9X 4Z7QB 3D9AH 3IF1B 2H3XC 3JT0A 4M6NH 4ZW8A 2PTVA 3ULUH 1VEOA 1BEYL 1JHKH 1HL9A 4NN5B 4ONHA 4PD4K 4OLXH 5FM4A 5EC1A 5IHLB 4L4VD 1TJGL 5DRXB 3DROA 1JWUB 2AQ2A 5I1DB 4XP6H 3JYCA 1YPZF 1T3FA 4OSUH 2Z92B 4GMTL 3BSHA 4PSRA 2P5WE 2PCXA 2Z31C 1XGYH 4GAGH 1CUOA 4WNQA 5C0DA 4X9BA 3T4AB 3V55A 5TDNA 4NHCH 4NUGH 3U7WL 4HOZA 3MBWA 3T2QA 5CWSB 4J6IA 2C3HA 4W68A 1YECH 1M7UA 3FF8A 4NC0B 1TU2B 4ZUVA 3TA3B 1GS7A 3NN8B 4ZBJA 3VRJA 1N12A 3BZDA 2KHAA 1RZKH 2DM4A 2FDBP 3U7YH 2Q10A 3LN5A 4XO8A 4JY5L 4WJG3 1AQ8A 1AE6H 3ARDC 2R2HA 2I32A 3MV8A 5C0RL 5JIPA 4ZUVB 2G75B 1H8LA 3TEUA 2OTUA 5EEXA 2FX7H 1VEPA 1PKQA 4YDJB 2CBTA 3WG7B 4L3EE 3TS8A 3ARWA 1DQMH 4HHAA 1E67A 5GRVK 3SDAC 1DE4A 4ODXA 4MJ2A 1LMIA 2LGNA 4JO2L 3TO4B 2E4FA 4KKBD 4YDIL 5D96B 3OXRA 1KPUB 5SV3A 1CG9B 4GFXA 3QUGA 2GIMA 1XEDA 2B2XH 2EXYD 1TMCB 3AXLA 4PJDB 4MSWB 2X4OB 3AC0A 2IOIA 1M7IA 3KWWA 1D6EB 2OMUA 1X5AA 2VERA 3PWPA 1JN6A 2GY7B 3PDOB 4KKCD 2AABH 2NY6D 2NYKA 5EO0B 5GGUB 2Y5TB 1W9XA 1YNKL 3KPOA 4ZQKA 2GTZA 2VN7A 2CQVA 4LT7A 3F85A 1GPOH 4DO4A 4LLQA 2MEJB 1RLBA 3VXUB 1E8XA 2Y1YA 5I75B 4IS6A 2R1XA 3MO1A 1LJMA 1PBYA 5AB9A 2AQSA 4L8CB 4ICWA 3GSWB 4C56D 4XNUH 1NUNB 2VNCA 1EVUA 1T2QH 3PNWB 5GZOD 3QUZC 1MI5A 3CFBB 4JY6B 1OP9A 2XN9E 2YD0A 1J48A 3DMMB 2X1QA 2WHVA 4DFHA 4F2MA 3BYYA 3F7YA 2DLFL 3C8HA 4AVIA 5AW8B 2D7TL 3ZE0B 1IT9L 1S6NA 4RRPG 2XETA 4JHVA 3CVHB 4GQ9H 4Z0BL 3VX1A 8PAZA 1LEKA 2YR3A 4V11A 4M48H 5DHEA 4JO5A 2B8OT 2K9FB 3EH5B 5I66B 4MNQA 1A1OB 1D5MB 2ZYRA 3V0VA 2QADC 2V5TA 4YS4A 4ORZC 3G5XA 3P3SA 2BO0A 4I89A 3RWGA 2P42B 1RK0B 5AB2A 2P5ED 5FYJU 2ZNXA 5IMOA 1GCYA 5CBEA 3K6OA 2PO6A 1Z3GH 3Q3GB 4JRYA 3WKYA 1KLGB 4F7TB 1A1MB 3QB7C 1JZ6A 1IU1A 3MRRA 2B1OA 2FSDA 1JZHA 2Z8VC 1RFDH 3BWUF 4HK0A 1CGSH 4M8QB 4AV0A 3D18A 3NRFA 4UQ9A 4KJYA 3UTOA 4WI3A 4HX1A 1KXVC 3A5VA 4M6OH 3ZYIA 1JBJA 3RVTD 4WAFA 4QHMA 3RVWC 2ZXBA 5LBSH 2PWEA 1NDGA 5I6LA 1W72A 3K6IA 4B9KC 2AJXL 3QUZA 4JRXE 4XMPL 1U41A 2FJSA 2HT3C 3IN0A 3UERA 2VAJA 2GSGB 4LPWA 4LEXL 4JG1L 1LEGA 5IK3B 5I0DA 3MCYA 4YIQB 1MCWM 2XUWA 3HRPA 4LCWA 4YX2H 2YWYA 4FQPA 4YAQA 4JPKL 3TV3L 3MNWB 1J87A 5F9JB 3IJ7A 4NPYB 5IROA 2B9BA 1MW1A 1R3IH 5K9KB 1EHKB 2QEJA 5IJDC 3VM7A 3FU9A 2EE0A 4H0HB 1HHJB 2YGPA 3K46A 4YHZL 2QGEA 1MVFA 2WB1A 3ZGIA 2V9QA 1JFQL 4PRAB 3PGCB 3GFUA 2J1YA 1X5KA 2UWEE 3P3YA 4GUPA 4P3DB 3TP4A 3PGCA 2XZCL 3L3JB 4RAUB 4RGMB 5I1EH 5T8IA 3ARGD 5IB1A 4FQIH 3I9AA 4LCCC 2O61A 2Y9RT 4QLRA 1SHMA 2OR8A 4YXHL 3W0WA 2KI6A 1IZJA 5HJ3B 2X10A 1P6FA 2A2QT 5A2JH 3BT0A 4P9HC 5FA3B 2XXCB 5AVVB 4BFOA 1EGJA 4JY4A 4MA1B 4WHTA 4HS3A 3NJIA 2L7UA 3S35L 5C0CA 3IBEA 3HPJA 5IQLA 3E2HC 2YAFA 3MRIB 4PJIF 1TETH 1RU9H 1MCDA 4Q2ZA 1BLNA 4P5MB 3OAYH 3L3OA 4AKQA 2ZXEB 2EIZA 1O6VA 2A77L 2QQKL 3I6GA 3FU5A 4MMZB 3PABA 3VD1A 5E5MB 1Z3GL 2L7EA 1HX0A 2H26A 4PJ8A 5EV7A 2YPLB 3LQZA 5EIIA 4QXVA 4UMGA 2E9JA 3SIKA 1ET5A 1KY6A 5JYLA 4KWUA 2DBLH 2YD5A 5EU3A 4UZGA 1CGSL 4OCRL 4WK2B 1RZ7L 2JNZA 4XPTH 3D6GA 2LT9A 4TN9A 5IBTH 2FBJH 4OD1H 4JAMB 4JW3A 1A9BA 2CLZA 4KI1A 2X42A 2XWTA 3VXRD 4BQ8A 4HDIB 2CRIA 3IETA 5FUOL 7PCYA 3B34A 1HINL 1TDQA 4ELME 4LU5L 3T6VA 4M1CC 4FFZL 4C57C 1TYEB 2VLLA 1G1CA 4AIZA 4ZFFA 4L1DA 4W6WB 4WKXA 1Q94A 5E8DL 1AIFA 4ZD3H 1A3LH 4FQXC 1D5MA 1XH3B 5D96C 3OZKA 4XE5B 4AMKL 4DVBB 3DV4B 4PLOB 1L0QA 2HLFD 4A6YH 2UZXB 3GIZL 4WU7A 3S3DB 3EYSH 3IDJB 1GTFA 2DDQH 1M3JA 3LRKA 4PGCA 1DQLL 3X11A 2VLRB 1NLBH 3JV6A 1LP9A 1MFNA 2W59A 2FNWA 3CFBA 4TKWA 1J9CT 2R59A 4KGJA 3VYPA 2F7QA 4LRNL 4LARL 2NTSP 1IX2A 2IALB 1WEJH 4OJEH 2WLLA 4HUXB 4AEHL 3A6BL 3WY1A 4UT7H 5AZ2L 3AQZA 4PJ7A 5CINL 2FQFA 1HJCA 1M05A 4LSVH 2YK1H 4XH2A 2OMXA 1SMOA 3HZVB 1PG7X 4KO6A 2FWSA 1UKQA 5CFAA 5I17A 4WI0B 3B3BA 5E9DE 1PPIA 1N9PA 2JK5A 1RSYA 4ZPTB 3WFCL 5FLVA 4LRIA 3L5HA 3PWPB 2K78A 1EQWA 4RAVB 3LSOA 4UV4L 5MHSE 2QSTA 5FM5O 4F80A 5IHBA 1EJFA 5KBDA 2Z91A 4DKFH 1CG9A 2ED7A 2EYRA 4N8VB 1OM3L 3ZL4L 2I60H 3REVA 4KDTA 5E9NA 3KH4A 2JVUA 3SGJA 4A37A 2HFFB 4DOHB 3V4PL 3C60C 3VGAB 1FAIL 1WD9A 2E9BA 2F53A 3A4FA 4PMFA 5FGRA 5IFHL 2WY3B 1AACA 1G9MC 2OJEB 4JQXA 5CJQL 3T0EE 1S5IL 2Q3AA 3L7EA 3C8KA 1MFCL 5TPWL 3UYRH 4WWKD 1RIHH 1FUNA 2RD0A 1G6RL 4ZK8A 1UJTA 5MEPA 3MA7B 4KTYA 4G8IA 3ZNGA 4Q8BA 3CG8A 3MLSH 2ENPA 5A2FA 3S9DB 4HGWB 3T3MB 5EN3A 1MCPH 2VYRE 1LE9A 1U58B 3SDAA 3LRGA 1JNLH 1JRHH 4Q6IC 4X50A 3FDWA 1K9TA 4L8BA 2VITA 4NJ9L 3HUJF 3KBPA 2ZPKH 4A7VA 4F1ZA 3DOIA 3CHSA 5DJ6B 1GYUA 5MP6H 1LMKA 4RAVA 4L3AA 5C08B 5CMAA 3CU7A 4XP5H 2NY2B 3VMOA 2CIIA 1L9RA 1IBGH 1FZKB 3B9KD 5DRWA 4Z3JA 1TFPA 3DROB 3TO4D 3VD5A 4ZODA 4JZJC 5DMIL 2ITDB 4JHWH 3IJSA 2EYSA 3VW3L 4RIRB 2VDMB 4X7EC 1OQOA 2VR6A 2A9DA 3BGMB 3PJNA 2ARJQ 3QQ3B 3SDDD 3VWKB 4G6KL 1AMYA 1OGAA 2ATKB 4JGJA 2CXKA 2CLVA 3D4YA 4PRHD 1QKZH 4R8WH 5KYWA 5EH1A 3MRQB 4PJIA 4PQXA 1NFIB 4A2GA 5EDXA 4L5FE 4LSDA 3UBXA 2KS0A 4EN3C 3DX2A 1MG2C 4OUUB 5IMKB 1TYJA 4RX4D 4DPRA 2BOBA 1HXYA 3NSFA 4KY2A 4TVPE 2JJTC 4W4OA 1NBYA 5EIIG 3EOBA 4UILH 4YL9A 1E3FA 3MSPA 4MA3B 5FW7A 4KTGA 3MLRL 3SDXE 4UIKH 5C0BA 3PP3K 4XVSL 4GUQA 4S2SA 3O4LB 1FAIH 4YSAA 5IOPA 1ECZA 3VFOB 1S9XA 4G5ZL 2UZIH 1DQDH 1WWBX 3RWHB 2BIPA 3CX5J 4PCYA 2CPCA 4DWHA 1OE1A 2K8QA 5JR1H 2ZAGA 2WO3B 2XWTB 2ESVB 2XX1A 5D4IA 1F6AA 1MW2A 3FRPB 4PWKA 3I9IA 1NGQL 1ZHLB 3PCYA 3W3BA 5MEND 4TL4A 3ZKMC 3QUHA 2CUMA 4YPJA 2H8PB 5FHBL 3QDGB 4PJAB 4KNSA 4QYOA 4XC3L 3LS4H 3V95A 2OL3A 3H9ZA 2YPLA 3LQZB 5FA4B 3SO3C 3D4ZA 3CZLA 4O51B 1TCRA 1U91A 3FPXA 2DB8A 4PJBF 1JVOA 3T2LA 2H2SD 1L9TA 2QSQA 5GJTL 1B4JH 2F15A 2GI7A 3L3OB 3MACL 1P5VB 3GF8A 5I6NA 2J73A 1RVFL 3MUJA 2LHAA 4QMEA 4WO4B 3HAEG 4BWTA 2WYIA 4GSQA 4LCVA 4DGYH 3FSVA 2BC4A 3O6FD 3ZHNA 3MX0B 4Y9CA 1NLBL 3SBPA 3CBRA 2UY6A 3MQIA 3RA7H 5D9SA 4DOHE 1K6QH 4H25A 3P77B 3B83A 3OPZL 3ULVD 3GXTA 3KNBB 2E7LA 3O0RL 4JQIH 4TS6A 2VQUA 4YDKL 1QSFA 3VDAA 3ETBJ 4M02A 5EOQH 4J2QA 1KN4L 5J12C 2NCEA 5MEOA 4O2FB 4JVPA 3AU0A 1SF3A 3CJJA 2PNDA 4R7NB 3MBXH 3BVUA 1ESOA 4AENA 4OZIA 1JGUL 3FU3A 3WL9A 4N8CL 5DEGB 5DO8A 5BZZA 3CU1A 4G1MB 1EXUA 2P5EB 3IU3A 2BVUA 3FQ2A 5D6CA 5AKSA 2GY5A 4ERSH 2Y7QB 1ASPA 4UILL 4N90D 3TCLA 2H1XA 5AZUA 1JF6A 1GC1H 2H3KA 5IB4B 2A9NL 4YXLH 5GRJH 1A7RL 5I1KL 1II4E 1N64H 4F2ME 3OM3B 4O2CA 1ROCA 4J7RA 1OO2A 5D8JH 1RZJH 3HMWH 3QR2A 1KBWA 3L4YA 4JFZH 4JKPH 4U3CA 5C0AA 4FQJH 4IKJA 5C92A 5C9JA 3FO9B 1Z9LA 5F44A 3S36L 3WJLC 2BMKB 2XPGB 1JZ5A 2C9XA 4BFJA 5CUSH 1A6UH 1SEQL 3WIFA 3KBEA 3VD9A 3QEUB 3SBWC 2AXHA 3BDYL 4OZHF 3CFDA 3FTSA 1BW8A 1FNGB 3CTTA 5GGVH 5FYKH 5JUEL 4QT5A 1ZT1A 3O3AA 3AG2B 4OB5L 5BZWA 2ICEC 3L1OH 3GI9H 1MY5A 3HI5H 1RZIA 5IJVB 1I1FA 3AM8A 3L4VA 4X4MA 5I1AA 3BKYH 3BN9C 1EEYB 4MHHG 1U4FA 7FABH 2EVFA 1DVFA 3H9HA 3MXWL 1JRHI 5AW4B 2E27H 4TM9A 3ZUCA 5JW5A 4N0YH 4DFIA 3RFZB 3SGEI 4K71C 4FTDA 4DKTA 4U2YA 3OKNB 3RIFK 4BQCA 5F6IC 4ZUSA 2X2IA 4PCKA 5GS1A 3DHMA 3KLQA 3NJFA 2K3HA 4IRZL 1S3KL 2V5MA 4GKNB 4IMKC 1S7RA 5HHQA 4WTZG 4BCZA 1GH7A 2B16A 2YD1A 1UWEL 3C5ZD 4L8CA 1PX3A 4H1LA 5DA4A 2YD8A 1LXMA 3I02A 5F0JB 4X5WB 4X6DE 2WP3T 1I7UA 2DQUL 5EWIL 1DEDA 5D7EA 4P2OC 5JLZB 5FO7B 4YE0A 4Y5YC 4MCNA 4G7VH 1P2CA 3BP4B 3MCLH 2WN3A 4BQ9A 1U9KA 4ZNEE 3WHE0 3C2AL 1AQDB 3U25A 2WVSA 1ZVSB 3FSWA 5A1AA 1TLKA 3NESA 5I73C 5DFVD 5IVXF 3O3AB 2WQXA 1BV8A 1C5BL 4QHUA 1CXLA 1UKTA 2OTWB 4JN1H 5IQMA 2GITA 1ZLSH 2P8LA 2Z35B 4XVJH 3U46B 1WRFA 3PGDA 1QLFA 4JPVL 2YGVA 3FULA 4XMKL 5CGTA 4PRHB 1DQDL 1RH8A 3C75A 3DIDA 1PY9A 5EU6B 4KV5F 1J86A 1JGVL 1S8DA 4QF1B 5TK2A 2Y25A 1KNOA 1CI3M 1MN4A 1UM5L 1SQ2N 2W38A 5E70A 5HGAB 3AUVA 5FV2A 2E9IA 4PGBB 3LQAH 1WFIA 4HQQH 1ID5I 3AREB 3K2UH 3WENA 4PJEF 5CJXA 3PL6D 1XZ0B 3B7RL 4X9IA 1WGVA 5F0PB 5GS1C 1EZVY 4FEMA 3EOTH 5CU9A 5B4MD 1JGEA 1XGRA 2D3JA 2CXGA 3GBNH 5HHPB 4QRAA 2R39A 5LGJA 4Q6YA 5LGHL 3SJVA 2R83A 4OGAD 3T3PF 5I6KA 3RQ3A 3KPPB 2FWOA 5HHOD 3VRJB 3CZUB 4L0ZA 3MCKB 3NSYA 4XT1C 4EE2A 1RERA 3BH8A 4PJHE 1HESA 4LP4A 2MKWA 2XIDA 4FG6D 5F6HI 7PAZA 1U0QA 1KBVA 4OZIB 2Q9OA 1ZT7A 2QV4A 4PJCA 2B39A 1TQVA 5BO4A 3ZO9A 3FOLA 4HAGA 1P9MA 3BH4A 1FFTB 1CXEA 1IC7L 1QTYT 2VLRD 3ARRA 4K3JH 4U6YB 5I1HH 1NFAA 4OF8A 4K5PA 3BP4A 4GQRA 3EDEA 3MROA 5E08L 3C87A 3LY6A 2V2WA 4RZCA 1MREH 1TTUA 5D70H 2CBPA 3K6FA 4N2FA 4PWGA 3O3EA 2ZWSA 3FSAA 1WZ1L 5CZRA 4M5ZL 3IRZA 1YJDC 3JYBA 1CD1B 2ATPA 3TGXA 3BGFB 2FR4B 1Z9MA 4ZFOB 2JXMB 3FT4B 4H88H 2XYCA 1QHOA 4LVNB 4FQXD 5ESAA 5BS0A 3BQUA 3NPZB 3SDCC 4CVWA 5J1AB 1ZGLA 1XTLA 4JFED 3TN0C 2ATAA 4ZMXA 3U4AA 4WHDA 1AH1A 1WFJA 1DL7H 3ZT5A 4XXCC 3F8UB 4PJ9C 2YFOA 3OC5A 3T6XA 4CNIA 1IQWL 1X4YA 4I77L 3FHEA 4HPOH 1BMGA 4BSVB 1YNTA 1MHEA 3QULB 4QT5B 4B5EA 4E41D 2R7EB 3N2JA 4YXHH 3QGVA 1UCTA 5E94A 1F8TL 4O00A 2R56H 3VXUE 2E6QA 4I9XA 3VRIA 3WLWD 4CKQA 1DBAH 4LHUB 5DDHB 5BS0D 5DZJA 3STLB 1ZANL 1T4WA 3ERXA 3LEYH 4HFWA 4LCCB 43C9B 3K1KC 2WBJB 4Q7DA 4F37F 1R3HA 4JRXD 4OF6A 3RAJH 4XOAA 4ZXBC 5CKGA 2DL9A 1QP1A 5AD0B 5CBAB 1MWAB 1TJMA 1QRKA 3EJPA 5EUOA 4EQ2A 1FE8L 5CEXA 1SYSB 4R4BA 3NCMA 3OWEA 4Z7UA 3OAWA 4OZFA 5GISL 2FTAA 2HX9A 2DQTL 4JRFA 1B2WH 1G4MA 2A74C 4PR5B 1OB1A 2HXAA 4MYPA 2V8LA 1SJEA 4E9SA 5FOJA 1R6VA 3MYJB 2ISDA 2R0WL 2WOBA 2XV0A 3OXSA 2A38A 4I3SH 4ISVA 4C56A 4KK8D 4N1EA 1U8HA 2Y2YA 4KY1L 2QHLA 2A83B 1YNTF 3BRDA 4KQ3H 1PZBA 1RZGB 2CMRH 2LLGA 3CZJA 1KGYE 3EYVB 2BSRA 4NWUH 3US9A 4HFWB 4PJXB 1DBKL 3RTLA 1WA1X 1K5NB 1E27B 3ETSA 1VADB 4FNTA 4PBXA 4XMZA 5IQ9A 3VD3A 3VX0A 2V9RA 1BBJA 4PIBA 3WUWA 4I0KA 1ND0B 3RDTC 2A99A 1ZLSL 1EPFA 3A4AA 1QABA 3S37H 5K9JH 2X4TA 4M7ZB 4M4RB 2CJUL 5DVNA 3T2NL 2FBRA 1IB5A 5JHDA 3Q1EA 4HJGB 3CDGA 3WEOA 4CBZA 5KVGH 3W38A 4U7SA 1EANA 1TTGA 2OYMA 5BVPH 2E7MA 4Z7UF 3EUDA 1NCBH 1ZHKB 3U4BH 3P77A 4XBEH 1GC1L 3LVTA 2KZWA 4R26H 5BRZD 1ND0A 3GS4A 1KBGL 1YEDA 2Y07H 4HAFA 4OGXH 3EFFB 3MV9B 2EIMB 5KYUA 1LEIB 5D7IB 1MCBA 3UYPB 4AVHA 4FXGA 4NGHL 1E6JH 4DKDC 4OM0H 3WSQH 5DT1H 2JB6A 1GW0A 1TTCA 2ZWKA 4PV1C 3SQRA 3T3PB 3V4LA 1DN0B 1SXBA 5M94B 2KLSA 2ZSVB 1V55B 4L8BB 1W8EA 4I85A 5D2NB 4MJHA 2UYLA 4IK6A 2ARJA 3GBDA 4WHYG 4AK1A 4QRTB 5BMFH 1T5WA 1OB1B 4JPSA 3ESMA 4YO0A 4PJIE 2ZONA 2NY1B 2VDML 4JM4L 1G7JB 1C08B 4ZSOA 3L7EB 4HXAH 5AD0A 3GJFH 4WU5A 3CE1A 3DX9A 5DHVH 2FX9H 1JFQH 2IAMB 3CN3A 3RNQA 4P9MH 3RA7L 3GMPB 2VMJA 4B9FA 1NCWL 1E9QB 2EZ0C 7CGTA 5IVXB 1GZPB 4TLTA 4Q9RH 5DC4B 4GKZA 4GRMA 4OJYA 5HYIA 4BK8A 1MAML 2A6IB 1U3HD 2BOLA 4OB5H 1R1CA 2WPGA 3LKOB 4FMKA 4RFNB 5ANMB 3S36X 4LKXB 4TVPH 3BESR 3LJ3A 3K6NA 3F00A 1PEWA 1QSED 3QVAA 3ILPA 2EDMA 2V2XA 1MNNA 2K6WA 4Y88A 1ETA1 3UZQA 1G1KA 1MJ7L 4HKXB 1E5ZA 2DYRB 2IMMA 5GS0L 4E41A 1E4XL 1DJGA 3IS1X 2WC7A 4WDIA 5F7DB 3BXNA 3QDMD 2LR4A 3MRQA 4XWGH 3L3OC 4N0UE 1DVXA 4BWUA 4QRPB 3BZ4B 2DMKA 3BLKA 3RVVC 2E6JA 2MIZA 3N85H 2OSYA 3BGMA 3LKQA 4JG1H 5JHMA 5B1AB 4MRCA 2AQNA 3ESVF 3H9YA 1IKNC 4KX9A 4HWUA 3ENEA 1CXHA 4HCRA 5IMMB 1OXYA 1QSEA 3TWCH 4IEFB 2QLVB 5IESH 1T7VA 3ET9F 4M7LH 4NZTH 3D3VB 5D7KD 2Q8BL 5LGYA 4HHWA 1HINH 3A67L 1CE1H 4HMEA 1QEXA 3K80A 1Q0YL 5GRZA 3BEWB 4X5QA 2JCCB 3VB8A 1AMXA 1DP0A 3GXNA 4JFPB 4PP2B 4GXVL 2CBQA 5FS5A 5F7YC 4Y2DD 3NCWA 3VSUA 4AIEA 1T6VN 5LAPA 2QL1A 3L3KB 3UP6A 5F2FA 4DGYL 5FCUL 1QFWM 2IQAA 1FG2A 4IBQA 2X6MA 5ABZA 3L1GA 5CLZA 2C7FA 4Q58C 1Z2KA 2EYTB 4XCEB 3TTYA 4ES8A 3TZVD 5AW3B 2KL6A 1L5GA 2FO4B 1RIVL 2H2PD 2HLFC 3DECA 3QO1B 4GQ9L 4Z0BH 4NQDB 4HUWB 2X6CA 4OLUH 3JV0A 3PREA 3WFZA 5DQDL 2CKNA 2YZ8A 4W70A 1A3ZA 4PY8J 4N2AA 3RTQA 2DM2A 1ZLDA 1S7TB 2FH8A 4P5KB 4XC1H 5DA0B 3L9EA 4G7RB 1D5IL 1U3ZA 4AEIH 5I15H 2XHNA 4PVNA 1WAAE 5DVOA 2DWYA 2VLME 4MHHI 1SHSA 1S46A 2AEPH 4AYDC 2ZKHL 3GSUB 3LSOB 3MNVA 4A2LA 1QUNA 3AT0A 1INDL 1IMHC 3ARED 2NY3B 4OLYL 4UZSA 4NNPL 1DJYA 3KAAA 4C54A 3FO2B 1XF3A 4XC3H 5D55A 4KX7A 1QX1A 2XTJE 1EV2E 5LG6A 4GRLD 3W0WB 2I25N 1KENL 1G7JA 4Y4KB 3FU7A 1N2RB 1M1XB 1CFTB 2FGWL 3DXAD 3EFDL 4PRPE 1L3WA 4CJ1A 5L2JA 1RUAL 4IYKA 3GWJA 2IPTL 1GRWA 3MZGB 4EVNA 2BHFA 1WAEA 1HE8A 1SDAB 2IALA 3KS0J 3BRGC 4M6AA 4NQEB 2OP4L 4KROB 2IQ9L 2CHXA 1NC2D 4OGQC 5K9KA 5J1SC 2CKBH 5FYJH 3HLKA 3L48A 4UBDD 4Z8FH 2YAMA 5IFJB 2BWDA 4WKZA 2BIOA 3T65B 1YMHA 4YWGL 1CGYA 5LVEA 3FUFA 1SNRA 4LOVA 3UYPA 4RISH 1J12A 3RBGA 4X6DB 2IGFL 2FYYA 5G4NA 5J7CC 1JF1A 1P4BH 4PJ8C 5B3SB 1MCCA 2DQGH 1OTTD 3FCTB 5D1XB 1TT6A 3OMAB 3FTGA 5GHWL 5KS9E 4NZTL 2VIRB 2K6YA 2OSLA 2YPVA 3D3VE 3K5SA 3FUJA 3K2MC 3IKKA 1YEJL 2JJUA 3RX7A 2EDEA 2HKFL 3Q0HA 4C55A 1G94A 3IU4L 3QORA 2KBGA 2V7NA 4R96B 2D3NA 3QZLA 3SE3A 3MRKB 2NR6D 4IOSD 5FF6B 3MREB 1LE5B 1NCDH 2PPFA 3JWDC 3R7QA 3QRLA 1E27A 2BC4B 3WS6A 1DQJB 4NHCL 3VYOA 2C9SA 2J44A 3TXAA 1U8IA 2D7NA 1C7SA 5F8QC 1DLFH 4ZX5A 3PF2A 2J8UB 1X3DA 2EDTA 2VR3A 3A6CH 4PSPA 5IOKA 1NAMB 4J4PA 4B95C 1E2VA 2EINB 3DYMA 3CFKB 3FCSB 4ICXA 3QISA 4YC2B 3FAWA 2VLJD 4JB9H 4TTGA 3EGDB 1XF5B 4R83A 5A7EA 3L3DB 1HAUA 3K0YA 1P6WA 5DC0A 3UTZA 5AB0A 4PHXA 3T0XA 3PJSB 1MFCH 3O9WB 1D7DA 5HHNB 1PYWA 4EF3A 1EO8L 2R0KH 5LQBH 1Q90A 2XA3A 1OCCB 1THAA 2I69A 4BM7A 3HN5A 4WHTB 3AS0A 2BX5A 3IEAA 3KPQA 4O2FA 2V3DA 3SHSA 1NCJA 3QIUD 5D5MA 2NR6C 4HJIA 5ERWA 2IDSA 3MRNA 1HIML 2PCFA 1CE6A 3QIWB 1A47A 3PV6A 5DSCA 2NQ3A 4GW4B 5FUCE 2FO1A 2Q8AL 1J8HE 3VXNB 3QPXL 2ZKXA 1BXUA 1OP4A 1TQUA 3GRBA 1PX4A 4LLQB 3F58L 3ULUD 5KYYA 2R2EA 3DYOA 4TUKH 2V7NB 1QD0A 3DGCR 5DLLA 1FC2D 4YZFF 1A5FH 5SWSE 4PJ6A 3A6BH 4KDTC 3ARDD 4IRZH 2QVMA 4O9HL 1XF4B 5EZJB 3BGFC 1SLUA 2R1WB 3V4VA 2C5DC 2VL5B 4X7SL 3OXRB 1N5AB 3O45A 4XE0A 1RZ8A 3NZ8B 2ARWA 1WHOA 3IMUA 4OV5B 3CXDH 3QUZB 3W9EB 1DUYB 1O7VA 1CBVL 3VNZA 3LPWA 4FKKA 4PJFA 3EF7A 1C8QA 4FJ6A 2BIIA 2WO4A 3M8OL 4R7DA 3TIDA 3S96A 3U1PA 2VUYA 4G6ML 1DVSA 3SQOL 4KKAD 1OK0A 2A1WH 2HVJA 4JO8A 4N2IA 2VDOL 4HIHB 4NQED 3FQ4A 4AQEA 3HNSH 3P73A 3ESOA 4KJPC 3SQBA 3UAJD 3F62A 4FN0A 4K5LA 4YK4C 1R47A 2H0EA 3IXAA 4HJJH 5EG6C 3Q1SH 4XAKE 4EXPX 3ARPA 4MJIA 5TE4L 5IMOB 1VFAA 3QH3A 4QUOA 1URZA 1TU2A 4M93B 1J5CA 4AMKH 3FT2B 5BO0D 1RZPA 2CJSA 5HHVH 1GYCA 2E0PA 3BISA 4JG5A 4KAQH 1KJ2L 4XP1L 3D5OF 4OLVH 3DGGA 4NKDA 4PRHE 4Z7QE 1NINA 2NY3D 1MNUH 5ICXA 5GGTH 1SJMA 4HQQL 4NT6A 1KCLA 3K2UL 4B9PA 3WLWC 1F58H 3FQRA 2AVGA 2FRGP 3UIYA 1GJUA 4R96A 3RFRA 1FSKC 4L1SA 3LYRA 4BFEA 5IBUG 5INDB 5F7UA 4I4WA 4Z7UE 1NFIA 5LHDA 3KYOB 4TNVF 3CZGA 1SM3H 1BREA 5E8NA 5TE7H 2CALA 4O58H 5JTWA 4PJ9B 2VQTA 2FO4A 2JE8A 2A9NH 1BECA 3UZEC 4NSKB 1KCSH 3V9CA 1U8CB 3QQ3A 3L6FA 3LH9A 2CJTA 2WVVB 3SDYH 4BUHA 1NMAL 2GITB 4NEHB 3BUTA 4TUKL 4MDIA 5FPIA 4RRPM 3EOAB 1NCHA 2IQAB 1TNNA 1FGVL 4N6RA 5DMJB 4JL1A 2DMHA 2J8UF 4UAOC 1SOKA 1P4IH 2EDQA 3SPVA 3FMGL 1NIEA 3EYUL 5GJSL 3ZR6A 4PYGA 1P1VA 2OMXB 2XZCH 1KXQE 1NDTA 1AI1L 3LEVH 2F61A 1HHHA 2EDOA 3LH2L 4ZS6C 1A7NL 4Z7AA 5D1ZC 2C8NA 2IDTA 3DV6A 4DP6X 3BPLC 1T22A 3RIKA 4MQTB 4FA7B 2C9RA 2V3FA 3KPSA 4NDMB 2QGDA 4X7DC 3KHOA 4NO3B 4XC1L 1E0OB 2EE3A 3H7BA 3DBXA 4ADIA 1HSBA 2IH8A 4JZNA 4TVPL 5CEYB 3APCA 3SQOH 3O11B 3O2VL 3PYCA 1NZRA 4ODBD 2NY7H 2VSCA 2AJVL 2XXFA 1LGVA 4J3TA 1EJOL 2C1PB 3O8XA 4H5SB 3WKQA 2FD6L 3FRPG 4DK3A 3H42L 1O9VA 2JKTM 4KFMA 4IRSC 4HC1L 4OD3L 4QRPD 3LKNA 1BMZA 5INDA 2RH0A 1CL7L 4NQDA 4PCSA 2WUBL 5BQDA 4U1SB 2V2XB 5D2LF 5I0XA 4ELKA 4K8RD 1U2YA 2CR3A 1G7QB 4EAEA 3E1F1 3T4AC 4EZMA 3RIAF 3S8FB 1FG2B 4Y9EA 1ZPUA 1V10A 4UNVA 1OOWA 4PW4A 4HMDA 4LOUC 2NY0D 2O6EA 4UDUB 3UXFA 4GAYA 1CL7I 2CUAA 2JK5B 1E9PA 4N2NA 3QNFA 5HPMB 4GRWE 4O2CB 4OH2A 3MZTA 4UNUA 4P46A 1Z7JA 1UUNA 3V5HB 4APQD 2V37A 3QUML 1P4BL 4BFFA 2QMKA 1NMAH 4MMZA 1NCCL 3FW6A 3K3QA 5HDOA 1KFAH 4M93C 4PBDA 4Y7MA 4N90E 1X7QA 5AVRB 1B0GA 3UTTB 2KQMA 1KB9J 5AUMB 2FJFB 1FFNA 1MRCL 3HS8A 3QORD 5FYJL 4ANXA 3RWDA 2VE6A 3VWJA 1Y7VA 3S96B 2YAHA 1EHNA 2DLFH 3ELAT 1DZ0A 4AXWA 2NY1D 3LD8B 5IMMA 2AQ1A 4GMTH 4BSWB 4GO9A 4F93B 1JP5A 2GTWA 2XU9A 2ARJB 1UEMA 1MF2L 2W0LA 4E41E 4LK4A 3L5WA 4WU7B 4EN3B 3L95A 2HKHH 4O02A 2X09A 2YPLD 2W1NA 3NJVA 3P4NA 3G5YB 3JUYA 4UT7L 3WNMA 4DPAX 4YH6A 5AQ0A 5KG9A 1XGQA 3D06A 3IMRA 4PJAF 3ZTJH 4I0PC 5DD6B 3DPDA 3N06B 2UXFA 1AOHA 1OCRB 2B59B 2E7CA 3BVNB 1GGCH 3RX9A 3DC0A 2DQUH 5EWIH 1T89A 4JNXA 2JCCF 4KKCC 3V0WL 3EH4B 2AEPL 3PHAA 3D39A 2W9DL 2ITCA 2WWNA 4OCNC 1CFNA 1BSIA 2XKSA 2VR7A 3BP6A 3MRBA 4GNKB 3MNWA 1AGEA 4YR6A 2H32H 1KJMB 1ZGLM 5HGHA 3MKKA 2CJ3A 3W57A 2QDVA 5EU3B 5F71A 2NY2C 5HYEA 5GJTH 1LEGB 1WBZB 4JO2H 5IK3A 4X8GA 3QXAB 3E6FA 5B1CA 5JIIA 4DGIH 1G9MH 2HJFB 5AYUH 1AKJB 5E5MA 2GG1A 1F00I 5KUKA 3PABB 4QHMB 1G6RH 4PBVC 5D7JA 2VMEA 4HJUA 4IBLT 3D08A 3DYPA 4FL4C 3B5GA 3NJLA 5DK3A 5HGDB 4CMMA 3I3EA 4P4KA 3U1SL 5AAWA 2BERA 5A6IA 1XH1A 3AGVA 3RTQD 1JXKA 5ICUA 1OLZA 4XNZC 3N6YA 3BEVB 3OB0K 4PS8A 3U0TA 1KGCE 1BVOA 3BIBX 5E2VH 1GKOA 4AJ0A 3OJDA 4MQ7A 1UKSA 3VU1A 1G6RB 4YLQT 3QAZC 3IDMA 1CGTA 4OZFB 4XMPH 3U36B 1X9RA 5IW3A 1Y6MR 5EU4B 5H37H 5C0BD 3F6JA 3RWEB 3QUXB 2XNAB 1NAMA 1K2DA 1FRGL 1XB8A 4PTUA 4U05A 5FEBA 2OK0H 3B9KB 4WFHD 1RI8A 3V7AE 4FABL 2P45B 3GBML 4KTEH 2B1HH 2NNFA 1YN7A 4XOBA 1HN1A 4MJ6A 2DW5A 2P44B 3AGWA 4WW1A 1VDGA 4B60A 4HJ0D 3G5VA 1IEBA 2X88A 2OW7A 4K3DH 1JYVA 4ZW6A 3MRHA 4PY7A 2XIIA 1MRCH 2DRUA 2PXYC 2Z64C 1I7ZB 2H0FA 1R3KA 2G9KA 5JOFB 1AC0A 1NGZA 2WVTA 2VMFA 5FECB 5CSBA 3EKCA 5IR1A 2EH7L 2WGXA 3K74B 4C47A 3P9LB 5JPNA 3AWGA 1Q8MA 3BW9A 4JFTA 4A7SA 4BK5A 4XI5D 5HI4C 1HQ4B 1KTDB 1TR7A 1JYWA 4F2FA 4EZLA 4FHKA 5G55A 2JKXA 4NKIL 2NZ9C 2OMYA 3GHEH 5C2BL 1PU0A 3S6CA 5DQ9A 3ZMEA 3KR3L 2D8KA 5CJXC 1U95B 3BLPX 1D5IH 3KDPB 4AEIL 1T20A 2VMCA 3RNKA 2HUEA 3ARUA 3TEZA 5AAMA 4BELD 4UT6L 1BM3L 3W56A 1XR9A 1KCWA 2AEQL 4LCYB 4X80H 1H19A 1JGDA 4W4OC 2ZCKL 3KJ6H 4OD2A 2MFNA 4BFBD 5T33H 3WE6A 3ZZLA 3PDOA 2ZP0T 1KG0A 3RUGA 3IGAA 3CH1B 3HZKA 3RGHA 5HSFA 1M1SA 3CDZB 3CC5A 4LVHC 5DRNA 1BYOA 2WTRB 4B9GA 2OXGA 4NJ9H 2CDFB 5KSUB 2ZUXA 2IDQA 3TZVC 1G7LA 3HVDA 3VFUA 4B3VA 4MCZB 2ZOWA 3QZWA 4I0PB 3DVGB 4YHLL 1VKXA 4IDJH 4HKJB 1S9KC 4GAJL 4H8QA 4PG9A 4JFSA 3UJJH 1CICD 4XX5A 1IM9D 4M29A 1ZPLA 4PJCB 1YEEH 5EZLA 1ZT7B 4E9XA 2PUQT 2AMGA 5DGRA 5EORH 1YEHH 1HILB 2XTSA 3K91A 4NQQA 1HCZA 1BZ7B 5I6MA 3NFSH 4RMVA 1UA6H 1ZCRA 1XSJA 3HE7D 3L4WA 2AQQA 4BE6A 1FVCA 2HT2C 2WWKT 4AK2A 3AU1A 3F7YB 2H3NB 4XXWA 4HJSA 15C8L 2GIXA 4TUJB 2HJLA 3UBXI 4W9CC 3CN0A 4TUOA 3NDZE 5DZVA 1FH5H 1S9WB 1IEHA 3PL6B 1PZSA 5CGYD 5IM7A 5D7KE 3BHBA 4DN4L 4QRUA 4WWPA 1R5IB 4LKCB 3WFBH 4KRNA 1S7XA 2PW1A 3FQUB 3PIQA 4D0CA 3ALXA 5IT2H 4KVPA 1JV2B 4FADA 4NIYE 3VXTA 1R0AL 4OCXL 2FHFA 4P5RA 4K3JL 1V5JA 1R24B 3M1BB 3J8F7 2WKGA 4XP4H 2JTYA 1NCNA 2JCCA 3BMVA 3K71A 4PLNC 4LBAA 3DJZA 5FYLE 2AQPA 5J6HB 3EG9B 3TA3D 3FUDA 2WLLB 1SFHA 3UGEA 4X6CF 1JPFA 3U4KA 5DHXB 3N42F 1RJZB 4MXWH 1KPUA 1OSPL 1MH5B 3O2VH 4LF3A 1T7ZA 2FLBT 2UX7A 2DJ4A 1UWXK 5GGTL 2ADYA 4NCC2 1CZ8H 3WN5B 1D5XA 1PZ2A 1SY6L 3RB5A 3H0TA 3HI6L 3GMNA 1ZIAA 5IVOA 3A22A 3NUKA 1DFBL 1S9WA 4NYLB 4XOEA 5CGYC 4YGVB 5D7JC 5KSAD 3DXAA 3QYNA 4RMTA 4GBXC 1OTUC 2C7UA 1J1XH 5F9DC 4P4KC 4KDWA 1NIBA 4AL8L 1Q9OB 4QHKI 5KBMA 5C0EB 4OR1A 4JMNA 4ZZKA 2HN7A 1YNKH 3VNYA 5JXEA 5DFAA 4QHLB 1DVFB 2IGLA 2NNAB 1WG3A 2YFNA 4ZFFB 4LVOB 3GSXA 4JM2C 5L0QC 1P5UB 3BPLB 4PJFE 2YEZA 4L29B 5CU5A 4KKPA 4XNMB 2EECA 2PP9A 5B39G 5B38G 1AS6A 4NQXB 3WO4C 4DESA 4NERA 2OKMA 3HTLX 3OB8A 1GVIA 1CLOH 4F7KA 3QXTA 3T8XB 1OSYA 4GKZB 4XNYL 2DQFB 4B9CA 3JWOC 1JK8B 1Z9SB 5L7XH 3VGDA 4AE0A 1GJIA 1YYMH 1LK2B 2IFFL 4WUUD 4PRDB 3KPRE 1ECYA 5JXED 1ICTA 4LLVA 3WDHA 4OQTA 4K7PH 4NQVB 5IQNA 2CR6A 4MNGB 5BQ7A 1MVYA 1DBKH 4V1DD 1BLNB 4P5MA 1D5BB 3BAYA 5TQ2H 3UG5A 4L4VA 2CM5A 2XC8A 2EE6A 1UXLA 5HYJA 4KQ3L 1VFUA 2KC0A 4KJWC 5ESVB 3JTTA 5SWZB 3D85A 4AQ1B 3ZT6A 4Y5VB 4P0DA 3HC2A 2JSFA 3GUTB 3ULVH 3Q5OA 1O6SB 2J2ZA 2VDQL 2HP4A 3P9LA 3QI9C 5JPNB 4E5XB 4JM2A 5DF0A 2W9EL 3ARDB 5LLIC 3QCVH 2I9LB 5I6OA 2QQLH 4G8FA 3BC9A 1LL1A 1YEEL 3RAJL 2ZXDA 2B5IB 2VN4A 2Y6TE 4Z9KB 2PO6D 2Q6WA 3ZDZB 1OE3A 3DPBB 4QHPA 1QLRA 2R15A 2ZQKA 5GISH 4D9RE 3D0AA 1UA3A 1YLBB 4NI3A 5FGBA 5T3ZE 2OTPA 3ZE1E 4EI6B 3ULVF 1RAMA 4OI8A 2QFPA 2DI8A 5DFTA 1QRNA 1PY4A 2AK4D 2G4GA 4S1SL 2BY2A 3MNMA 4XB7A 5FYKL 1BQUA 1AANA 4M6ML 2EABA 3II1A 4KRLB 3TNNA 3AS3A 1L3NA 1AGFB 2O5ZH 3F7LA 1QR1B 4EOWH 1A22B 1JZJA 1P84J 4XVTH 3UO1H 4HUVA 4D8PB 4LLDB 1INEH 1A6PA 2B77A 1KCSL 4NQSB 4FAAB 2W95A 2P3YA 4JFXB 3G5ZB 3HKFA 1RY7B 2DMGA 4ONGL 1WC7B 1FL5A 3OXSB 1Q4NX 4ISVB 3RGVD 4JANA 5F3HB 4HUVB 4APXB 3ZQWA 1NUFA 1X5LA 3GSNB 5C0NC 1LK2A 4HH8A 4K7FA 1OD9A 2XVGA 2ORBH 3QHZL 1WS8A 2JQMA 2YEVB 5BZDA 5CD5C 3MV7E 3V5DB 2G2PA 2EEFA 4ABQA 4GSRA 4OCWL 4B97A 3UEZA 4EI6A 3N42B 5I1LA 3RBSA 4G7VL 4HKBA 3ECUA 5L8LB 4NJAL 5C3LD 1ZEAL 1RKRA 3RL1B 3ZDXE 4P3WA 1KJVB 1BPLB 4D3CL 4AH2A 3QJHA 3QCUH 3SGKA 3TJHC 1S9XB 2PN5A 3O4LA 1BLIA 4NZDA 5IOPB 3FONA 4UT6A 4X6CA 3NCFB 2AI0L 3IFPB 2YPKA 2OXHB 3OLDA 2ICCA 3QQNA 4E5XA 3BAEH 4JY6A 3H4HA 3ASNB 1A6ZA 1V3JA 3AZUA 3L95B 4O02B 2AV7B 4E9WA 1TPXB 1DDTA 4FLRA 4JHZA 3L5WB 1BYPA 5C2BH 1ETZA 2XWBB 1CXIA 2XQ0A 3UBXB 1G87A 4GXUN 1FI8C 2VC2L 2BDNL 4EDXB 3WI9A 4GMSH 2WKOA 1BM3H 2X6BA 3FH7A 3GMMA 4LL9A 1JRHL 3FNKA 3DRTB 1LWRA 1NCWH 3EOTL 1MCKA 2ZKMX 3GM8A 2YAPA 3GLAA 1TIUA 1UD8A 1SEBB 1QHPA 3O3EB 3DIFB 1IEAA 4GRWH 4M1DH 4R5TA 4HS6B 4AV4A 2R56L 2R29H 2E46A 3AXLB 1G6VK 1FO0L 1DBML 2YAQA 4YNYB 4UDUA 1CDCA 4QTHB 3ZDYE 3PS6A 2D7PA 5D8JL 2LU7A 3MODL 4AT6A 3FQNB 3WLBA 3PIQB 4I18C 1LNUB 4D0CB 3AITA 4F57L 1YQ2A 1BQHB 2CD0A 1P84K 4G8GA 3NTCL 4KMQA 3A47A 1VPOL 4J8RB 2QMJA 3LHPH 4X9YA 4OAWA 1BFVL 4QHLA 2FECL 4PCTA 1U36A 5HD8D 2E8ZA 1AAJA 3PHOA 3TN0D 5HHPA 1UM6H 4N2DA 1XGRB 5AOJA 3SGDI 4PEEA 4MA3A 3U6RB 1IBZA 2X53A 2ZX5A 4NNPH 4O2EA 4XN5A 5IHZB 3C9NA 1EH9A 3QNZA 4EUPG 1XIWC 4DUWA 4NCDA 3DDFA 3E2HB 4NM8L 4MRBA 5DTFA 2RJMA 5IVZA 2WANA 7FABL 2ILLA 4WWKB 4ANUA 2HFFA 4GXUM 2HA1A 4R0LC 3J7HA 4TLUA 4XO5A 3H9SB 3WEXB 3VFUB 1OF2B 2NUPB 4Z7VE 3T04D 2ICWB 3QE5A 4BFKA 3SYQA 3WJLA 3SE3C 4TSBL 3CZEA 1JXDA 1U8QA 1AQDA 1KB9K 2HAZA 2JKLA 5CLXA 4A6YL 3M1BA 4BK4A 2WBWB 2ZCLH 1MFBL 1MKFA 2FUTA 3DURA 1M3IA 1A66A 2J25A 3GO1H 4MLSA 3BCFA 4GRLA 5E2TH 1INQA 4JFZL 4JKPL 3T8MA 4JREB 5DQ9B 3LIZA 2FVNA 4DCQA 5KVDE 5T3ZD 1NCAL 3EBHA 1U8CA 1QATA 3WTXA 2YGQA 4OZGE 1NOAA 1JNNL 2CRYA 3S3SA 5GS1B 3I2CH 4GS7C 1EWHA 3GM0A 1OT4A 3H2PA 3IDUA 1I3RB 2O30A 5JIQA 4I4WB 3WKML 4JVUA 2FL5A 4RA0C 5DJDB 1W0YT 3D34A 1GYVA 1OARH 3QUMA 5MEPB 1AGDA 3HNTH 3LKSB 4UTAL 4P23B 3WYRA 2XWZA 1FHGA 4RLDA 1CICB 2J71A 4XGZA 4A7GA 4KITB 4MNHB 2GC7C 4DK5A 2ZSWA 1HQRA 4XCYA 2EO1A 1QPKA 1R5WB 4NBYB 1Z1WA 4PG9B 1KEGH 3ILEA 5H94B 2VLLB 4X5XB 4JCMA 3RUGE 4AIZB 3MRLA 1E2ZA 3L16A 3UCRA 2BNRD 4P05A 3R19A 4I3RH 4WW2C 1PCXA 2PTUA 4ZZFA 5F1OB 4HBCL 4D9QD 4NIKB 4FZEL 1JG9A 1UWEH 1IVTA 3OKLA 2P5WA 3RPBA 3MOAH 4AW4A 4I5BA 1PLGL 2EDNA 2YBRB 2APSA 1Z6JT 1XR9B 5HVWA 2KLTA 3AG3B 3ATDA 3H6JA 1E2WA 4HS6A 2NNCA 1E5CA 3N1GC 3UABA 1DJWA 3GK8H 3WNOA 4JFDE 4HCGA 4XXWC 3TPKA 4G9FE 2OMYB 1PX8A 3QJZA 4HUXA 1B9ZA 1MFMA 1YA5A 2EIZB 3AAZB 25C8H 4X0KA 5E00B 3QUYB 5DYFA 3SPIA 2C3WA 4M7JL 2IAAC 1FVEB 3A23A 3DJ9A 4XAKD 3CFIC 3FUIA 1XF4A 2Q5BA 2CWRA 5E2UH 1U8LA 4OGZA 4V2BA 5F1NB 4YN3A 4CBPA 2GFBA 2MTAA 1UATA 2ENQA 3E8UH 3EZ8A 3UH8A 5K5YA 2F54E 2QSCL 1MQKH 4J12A 2OMWB 4MS8D 5CUSL 1J9RA 5DD5H 3NIFE 3B6SB 3ZE2B 3BT2H 3GIVA 4PV8B 4YDNA 2OBGA 4F91B 3ROOB 2R2BA 3HW7A 2GVYA 4R0LB 5KVEH 3KLKA 2AXGA 2A9BA 5CN1A 5C2UB 3GRWL 4YHKH 4YBLB 2K8MA 5FDYA 4HGKC 2PWHA 5DHMC 5KJRH 4XX1E 1DDHB 3KLAA 3BQUD 4MLIA 3MLUH 1JZ8A 1GA2A 4WK0B 2YJQA 5D71H 3W81A 4ABWA 3I9PA 4OLWH 4OCWH 4ADGA 4DSYA 3GBEA 1PYWB 4JRLA 32C2B 5HHNA 1A7PL 4JJ5A 5C0BE 5IBLC 3D4CA 2FJFA 5FGCB 1I7TB 5BUPA 4UCFA 3INUH 1G7IB 1SZNA 2H1LM 4PUBL 3K7UA 3GSNA 5E1GA 1XF5A 2H26B 3TL5A 4CVZA 3TNMA 5F9OL 1BJ1H 1CC3A 1LO3H 3HIZA 5TPWH 5FWQA 1KJ3H 4N0RA 3S3JA 1GZHA 2LAGB 1M2OA 1R3JB 1JE6A 3CVHH 4Q2ZB 2X89D 3MNZB 1FGNL 3MJ6A 5D7LE 5AB1A 2R27A 1NCUA 4WO0A 3HBGA 3WXVH 3FTYA 1OTSD 1EJ6A 1W2KT 2NY4B 5C0CB 1KB5L 1HAWA 5A2AA 1XGPB 1T4KA 2IPKB 3EO0B 4OCYH 2Q0ZX 4JDZA 1EFXA 3HHSB 3QXUA 4LSPH 4LHUD 1LILA 1P7QD 4W1TA 3KVDD 2WNKA 2NY4C 4FXKA 4N3UA 2Z7YA 1HXMA 1H6EA 1UHVA 4NI6A 4IW4C 3UEQA 1A7QL 2OR9L 1CT8A 1IJNA 4QRPE 1JZ7A 5AFAA 1HHJA 1B6UA 4W81A 4WI5A 3OPUA 3GXMA 2X2YA 4FFWC 2RA1A 2IPUK 1KV3A 5LXGH 2F7IA 1AZZC 3V0DA 3V8OA 2NTFB 3KWXA 1FNEB 2GTWB 4K9JA 4L9DA 1AJ7H 3ARDA 4R90L 3NCBB 2HT4C 4OZ4A 4JM2B 5L0QB 2XACC 5CEYA 3MC0A 1EERB 1H5BA 1N10A 1THCA 1RZFH 3ATBA 3VGGA 3NCJL 5LAXA 4NDMA 1FFNB 3KEDA 5F6IB 2CRZA 3NACL 1F11A 3X3GH 5I76B 1CBVH 1VEMA 2P5EE 4LSUL 4OFKA 2EXYC 2K9UA 2BFVH 4H2CA 4HLJA 3OKOB 1GL4B 4AKOA 1GSKA 1SYVA 2EYSB 2VR9A 2X1XR 5L7XL 3ZRCC 1JWSA 1NMBH 3RVVD 5B8CB 2GEQA 1OEZW 3KPOB 3UC0H 3MGOB 4L8SA 3LVEA 2KYIA 1CFSB 5AALA 4I5BB 1HHGB 4M7KH 4M1GH 4B96A 1J5IA 5LXVA 2WXGA 1IE5A 1PVHA 3F6LA 4PGZA 4F7TA 4MDIB 4PJDA 2ADIB 2CO1A 3NGBC 5L2KB 2D03L 4F7CB 3H56A 4F2EA 3X1EA 3T08A 1OF2A 5HHOB 1C12B 2YWZA 2VRAA 1FZMA 1BYNA 3QC6X 4XBEL 1ZTMA 3IFLH 3CVHL 1S78D 3KS0H 4B3EA 4DTGL 4X5XA 5HI5D 4YHML 5A3ID 1TNMA 4Q9QH 1XVSA 5JA9A 3MOBL 4DZBA 35C8L 1XXDC 5J8OA 5I28A 3Q13A 4I3GA 4Y4FC 3QEHB 3WJMB 3OJVC 3QHTC 1I8IA 5T1MA 4F3FB 3WNJA 1KEMH 1QR4A 4MMXC 4NT6B 1MW0A 3NJHA 5F7BA 3BUBA 4P46D 4ZX3A 1U8JA 3PWUB 4JHBA 4BZ2A 3DMMA 2WXHA 4JFDD 2C7UB 3VI4E 1XTMA 2OX5B 3FFCE 2EYRB 4XZ4A 5K39B 3H0TB 4LP5A 2ID5A 5TDNB 2K70A 3EYSL 4F7EB 2VR4A 4E0RB 2QHRL 2NRDA 3NQIA 3N1MC 1ES0B 2Q3ZA 4AJVA 5DUPH 1JWUA 5I1DA 4OM1H 3KYNA 3MXWH 4HIXH 2OYPA 1WBXA 1M6UA 1Z5YD 1EJOH 2D9QB 3CC1A 5E6YA 3G5WA 4IEFA 2N0MA 3FZUC 4XMUA 3CN4A 5I23A 5DLMH 1KGUA 4X4XA 1YEFL 3PWJB 4TSCH 3KGUA 5EIQA 1KACB 3BIAX 4PWEA 2P24A 4MSWA 4WWKC 3NZ8A 1KB5B 1KGCD 1RJYB 1R24A 2FX9L 4X7SH 3ZE0F 2WVVA 4H2AA 2NUPA 2VDRH 4E9TA 2GJPA 3BSGA 3E80A 3Q48A 1CGUA 1MCWW 1TQCC 2YUWA 3O8XC 5CJ8A 4ODVH 3TH4T 3IVKB 1ZKAA 3KYOA 3EJJX 4QHKJ 3QHZH 4JGUA 1YG9A 3KPSD 3ZU8A 1J8SA 2NZ1A 1U8KB 4B6ZA 4NN7C 3C9NB 2R2EB 4Z3FA 2XA8L 3EJYC 4WGVB 3WIHL 1HJBC 1BQHG 1A14L 4PHZA 2DI7A 4QNPF 3WGUB 5IUSA 5GRJL 2IDUA 4X6CB 2CPUA 1AS8A 1FORH 4N8PA 3WV0A 3RGVB 5DGQA 1FYHB 1BGXL 3FYIB 1GCFA 1WZAA 1IFGA 4HDIA 4JDEA 5CR8A 3CQPA 5H35B 3TEWA 1UZ6F 4ZJ9A 4GAJH 3HS0C 4MAYB 2E3VA 1W6LA 3WXWL 1UWFA 1CFBA 5DC2A 1FHNA 4Z7VF 3PJSA 4OLYH 3GMOA 1Y0LA 1TQBB 1Z32X 3OKMA 3VFVA 4DUXA 2YSSA 3WHXA 2VJ0A 4G3YL 5E8PA 3FFCB 3CHPA 3QPQD 4QXTA 3DIFA 1CTOA 1KTJA 4ZW3A 5C8JA 1XZWA 3MAWA 1SMAA 2XN2A 3L2MA 4YSOA 1N8OE 4FFYA 3QEGH 3I2CL 3RWCA 5AW1B 5FYKU 1H15A 5GGQL 5C3TA 4XMLL 1QFOA 2E5EA 1NMCB 4UQ2A 2F7RA 1BAFH 3HA0A 3DI3B 3P0YH 3APNA 2ADIA 5CFHA 5E6UB 1CDJA 1KTLA 5DJXB 2YRZA 3EGXA 2ZP8A 3ZTDC 1A2YA 2VRQA 4NAMA 3ESUF 2N01B 3HOGA 4HXBL 3MBEA 1I9JH 1UTDA 3MV9A 5FA3A 3HZYA 2VXVH 3ARFC 4S0HA 1OAYL 1PG7L 3LZNA 4JM0A 5JDSB 2EDXA 1UWYA 4BE5A 4F20A 1Q72H 4PUBH 4Z7VA 4AWJC 1XBRA 4K15A 2EIEA 2WLJA 4OFDA 4QRRB 3KXFA 2B9AA 4PGDA 4YK4B 4K7PL 4ZYKA 3DJSA 3DJRA 5CP3A 1BBJB 2K0RA 1MELA 3T1FA 2HTLC 4CAGA 5D71L 1KIUB 1SJXA 4WFED 5CN3A 4EBQL 3WEMA 4FF9A 3OKEB 5DS8A 3ZYJA 2YAOA 3HN3A 2WLMA 5I0WA 3IDYC 5L88L 4YJZL 5DRZB 4K94C 3FF7A 1ZLWK 1QI5A 2BSCA 1FVEA 2HRHA 2QGCA 4HIIA 4EXKA 4Q56A 2O6PA 3IGLA 4KZEH 4R2GC 3TBBA 3EH2A 4QXUL 5T1LD 2FHCA 2YKLL 3S97C 3WMQA 4DEPB 1DUZB 1PSKL 3V4PH 4U1MA 1N2RA 3CFKA 1FL5B 1H3PH 3CZFA 4HMCA 5CEXB 3GDCA 4EI5D 5MENB 4Z76B 2O6DA 3V0EA 2XZZA 1A7BA 3HAEH 4NQVA 1A1MA 4B9JA 2WXPA 4KH9A 4AV5A 4H1LG 4UT9A 1XL4A 3NSCA 2DQJL 3ATFA 1AXSB 3M88A 1RZJC 1C5CL 1OGTA 3QXVA 4LQFL 4AQZA 2GI0A 2JJVA 2W07A 3TO2B 2O5XL 5HGHB 1CLVA 1H3GA 2IAMC 2X70A 3O3UN 4YSUA 2WUCH 2F0CA 1QSFD 2OM5A 3TPUB 1DQQA 1W6WA 5JDJA 3QIUC 1K5WA 2ITCB 1ZT4A 1FVDB 1E5BA 4AM0B 3CFUA 4X9GA 3QUMB 2VDRB 2VJXA 3M7OA 4N4YB 1DQML 3KGTA 3BSZA 5CHNA 2AVFA 3A6CL 5I8CB 1XSIA 4U1GB 2VQ4A 2AEQH 2J3SA 3KH3A 5BRPA 3N43F 2I9LA 3AB0B 2WO2B 4EIZC 4JUSA 5IVNA 3SCMD 3QUYC 5ICZA 5LUMA 1LQSR 3G6DL 4XN7A 4YHPB 3VFSA 4UOZA 4ATTA 1IVLA 3G5YA 1T1ZB 1ET8A 2HLAA 2YXVA 3GSWA 4NYLA 4G8EB 3AUWB 3L54A 1AXTH 3FUMA 1M42A 3DHUA 5FFGA 2JH2A 4ANKA 3S4SG 2Q7NA 2W0PA 4DUVA 5I71C 5DR5H 3AABA 4RGNE 4R0LA 3WAKA 4J5VA 2QVIA 1SBSH 1QO3B 2BSDA 2WNWA 2FCBA 4PLJD 5D2LA 5F7LB 4LF3B 5JOPD 5B3JF 3Q8EA 4P06A 1CFTA 3ETBF 3MRGA 5KVFL 5IESL 3FCBA 2PLTA 3GTNA 3QQ4B 4XWOC 4YDKH 3NPSC 1I9EA 4UIMB 3STZB 1UG9A 1V3MA 4OM0L 3WSQL 2O26U 2BP0A 2XA8H 3ZDZF 3VH8B 1VSCA 3WELA 4QOKD 3NEEA 3D39D 5H2BB 2F1EA 1JCKA 1URIA 5EZPA 5D7LD 1MJUL 3IJ9A 5ES4B 2Z0UA 5TDPA 1V7MH 3CH8A 2EDHA 3VXTB 3ULUL 3UJJL 2WINB 3UZVB 5KSAB 2XOTA 2IOOA 1IC5L 1D9KC 1NC2A 3QUYD 1LQBC 1KUMA 5HHVL 2VTFA 2OMNA 3S37X 1PKQB 2KZ1B 4HKXA 1L5GB 3QO1A 1Y6NR 3VXRA 1Y1DA 4OQ1A 3HBPA 4KKAC 5B22A 1KNOB 5HGAA 4GG6A 2L8AA 5KYNA 3VH8G 2VLKB 4J3UA 1GYAA 4MWFB 1UA7A 2WXMA 4L4TA 4ETQA 4GUOA 5EOCJ 3T4YB 2Y2TA 5G2NA 2DQJH 5EC2A 2EEXA 1YC8A 3MBWB 4XO3A 5IKCA 4F8QA 5EZLB 5CCGE 5F7NC 1SHXA 3TM6A 1FNFA 1SUJA 3G6AB 1LO0H 2XWRA 1OPOA 4MNHA 2ZG3A 1VKXB 2UV3A 2NW3A 3L5JA 4XPBL 4P23A 4L3CB 2P7TA 4HF5L 2ITEA 2CGYA 4KXCA 3R4RA 3X14A 1CR9L 4NC1C 2VZVA 2Z8WC 3EG9A 3BP7A 5C0GA 5JLZA 3LHPL 2CO6A 1CD0A 4TQPA 2HG0A 3BFQG 1JXGA 3B9DA 2BM3A 2WOYA 4LCYA 3RVXD 2F1BA 2FLRT 3QWOB 4QRPA 1UASA 3CXHK 4D0DB 1T20B 1RD6A 3A0OA 5HHXH 5TDOA 1PIFA 4ZS7L 2J72A 5DJ0A 3HPLA 4F5CE 2PYED 3EOAA 1UH4A 2JB5H 4TPRL 1HH6B 3HG3A 4QRUB 1FL3A 1KBGH 4RGNC 4A7UA 1N6QL 1QFWI 3CHQA 1ZRUA 5IHHA 2AJYL 3PL6A 2Y22A 4M6OL 4P2AA 3LTVA 4XVUC 1KWGA 2AV7A 4PJ9A 4JO3H 1EHAA 1MLCB 2ESVE 4EZJA 3ASWA 1PS3A 3K2IA 1XO8A 4WEBH 3SDAD 1OPGH 2VT0A 2X3AA 4XB3A 5JOFA 4NHUB 2WLYA 2X4TB 3EYFA 4N5ED 4JE4B 4BDVA 1QEWA 2XG4B 3MLUL 3WDIA 2LE9A 1FA4A 2L0DA 4PW3A 3SCMB 3BUQA 3ASOB 4PJXA 2YPVL 4FTVA 3UGXA 3VFGL 1EAOA 3P0YL 4LLYB 2P8MB 2YRLA 1XT5A 2WXFA 4JHUA 2G2RA 3CFNA 5JIHA 2PP7A 3LIUA 2BVPA 3DTXA 3KPRB 5F8RC 5IHZA 1NCTA 4JRYE 5EU4A 4IRJB 2TAAA 1IGFL 1MEXL 2N59A 4Z7WA 3EF4A 3LD8C 4U1MB 1H0DB 5AVXB 4X7FC 4YO0B 2A74A 1J8KA 4R4FL 1U3HA 3CDZA 4J1UA 2UWEF 3MNDA 2GJZB 4I1NB 2WIMA 3NCYP 3HG1B 4MD4A 5AAWC 4FKHA 4Z0XB 1OZUA 5T1DL 1CDGA 1HOCB 1L6ZA 2NY4D 1ODAA 3T77A 1EAPA 4I48A 4X6FA 4U6HA 1F90H 2J1KA 5C07D 1HEJC 2OZNA 1X5HA 3FQNA 4RAHA 3WLBB 2BINA 5C0IB 3TT1L 1JHLH 5MI0C 3ZL4H 5AVUB 5TE6L 5E6ID 5I1CH 4XBPA 4Y1AA 3WIHH 2YQ2A 4LFHG 5MERA 5DK0B 2NW2A 3KLHD 4YUEH 2UX6A 3KW7A 5E56A 1JF5A 2B4CC 3L7FA 2D2OA 1KJ2B 1QRNB 3LH8A 3HR5B 4H8VA 4KV5E 4XR8C 5DEFB 5DURD 5T1LB 2W5PA 1SOQA 1C5DB 4LEXH 1EZLA 2J5WA 1SEBA 2F5BH 4TVPD 1E6OH 2OP4H 1A9VA 2I60L 4HEMA 5D1XC 2EDJA 4R7VA 2Y6SD 3G5VB 1UADC 1SFDA 2V9TA 4MA8H 4OJFL 1TZGH 2P80A 2J56A 1FZJB 3ALPA 1NGPH 5DWPA 3BQUB 1IE4A 4QGYA 1AG0A 1SXSA 4GW4A 3VXNA 4LSRL 3W0WE 1A4JB 1UT1A 3N91A 4MKMA 4NRZB 3RB7A 2H47C 4OTXL 1O6SA 2J2ZB 1KTBA 3EAKA 1HOCA 4P2QB 1XCQB 4CUCA 1NCAH 3QUKB 1N6VA 1FO0A 1NGXA 4HU2A 2QDWA 3NIGE 2RGSA 3DDGA 1KCRL 4K07A 4LPVA 4QXTB 3SKMB 5C8JB 1EHXA 1OLLA 4RSVA 3BEVA 3EHBB 2MNUA 5D1QD 1FBIL 1UWXH 4K3HA 5L2KE 4PLKD 4G9FB 2AK1H 1IGCL 5GS3A 4ZFQA 1QG3A 4R7XA 1BXXA 3IJHA 5IW6B 3PAYA 4HXBH 1VESA 2ZUVA 4C58B 5H35A 4BHUI 3K8MA 43CAA 2XVLA 2HX8A 3ZK0A 1LYQA 1GGCL 2WW8A 4JHWL 5E4OA 4EN2A 5LBGA 4AC2A 4HT1L 2P80D 4DIXA 3ES6B 3LDBB 4P04A 3SBQA 4U1HB 4Y5YB 4LSSH 2EEBA 2OYLA 4BSVA 2LFEA 5IHUL 2EUVA 3QZOA 1CFNB 4FHJA 4N8UA 3JTSA 1WC7A 2F8OA 4ORGA 4CADB 1UB5A 1AD0A 1HCYA 4A7TA 2DLGA 4UBDC 5I8KH 2NUTB 5FB8B 1KZYA 2MOVA 3INUL 1TVHB 5ITFB 2WLZA 1BZ8A 3IDGA 3W5MA 5J1AA 1OAKH 2BZCA 3VXMD 3KL0A 3IVKA 2MTPA 4WEBL 2WQRA 5EU6A 4FQLL 5CAYB 4BH7A 2ADJB 4ZUUA 1ML0A 2P9RA 5E2WL 4CSTA 1XX9C 3I50H 1KB5A 1RJYA 2ZYIA 2OTWA 4ODTL 1YMHB 4WHYH 5FYJE 3SDYL 4Y2OB 1A9EA 4BCXA 1MG3C 3NJXA 1RUKL 3BAWA 2WMPA 2IQ9H 1JDDA 4NO3A 5J1TC 4AX3A 3OF6A 4PGEA 3E6HB 4HPHA 1TJXA 3M45A 5D1XE 4I18B 1NCGA 2GUOA 2JQZA 3N0AA 4EVNB 1ODUA 1MFDH 4M1DL 4OZHB 1HHHB 3IBOA 5D7LB 4Z78A 3MJ9H 5GGSY 5JHDE 4KTEL 2GTQA 3P4OB 3MV7D 3VA2C 3FU7B 1QYGH 1JNHB 5HHQB 2CGZA 4GO6B 4OF3A 3L4XA 2OSXA 4FXLA 1IZKA 4NB7A 1ID2A 1HCFX 4BD4A 1BQ5A 2WUCL 1P7HL 1N0XH 2YLKA 5T5FH 2QJDA 3AS2A 2NT1A 4TF4A 3RDJA 4RNRA 3FB5A 1J88A 1MFAH 1WSST 3WKMH 4GKSA 1ZJAA 1EEYA 3HG2A 4R3SB 2IDFA 4XCFH 3GRWA 1H9DA 2B1AL 4TUOB 5EBWA 3SKNB 3QWRD 2NOYA 2QPEB 3FB7A 3NH7H 4LARH 5KW9H 3T0EA 3I6SA 1ILSA 2F74B 3OX8B 4G6AC 2B15A 5EU6D 5IB5B 1YVLA 3C60D 3QEQA 4EEEA 4OCXH 1ZA6A 3HC0B 5IG7A 5FK9A 2APTA 2WNGA 2A73A 4PRHA 3CVIL 2I9TA 2WWKO 1Z9SA 2CCWA 3JV5A 4PJ8D 4S1DD 2C1PA 2IH1B 1M56B 2PYEA 3VXQB 2O1AA 1GZQA 4NJAH 4ZSOE 2RR3A 5EN2B 1NEZG 5TF1H 3GSNL 4HWBA 1RSFA 1AHWC 4YXKH 5H2BA 5FKPB 4AQOA 1BOYA 2X7LA 3O0LA 4AEEA 3RY6C 3ZHDA 3S48A 1JPSH 3MOAL 4EI5C 4UQ3A 5B8CA 3EZJB 1TUPA 1RFDL 3QH3B 3IWUA 3TVMD 1WT5C 4ZFZB 3WD5L 1CF8L 1U8MB 5I2IA 1SGKA 2QPDB 3VD0A 3UTPD 3KVQA 1CK0L 3F7QA 4OZHA 4RMWA 5C0EA 1CLYH 1T66C 2DQCL 1OPGL 3E7JA 4KHXL 5I76A 1F4YL 1AP2B 4XCNA 1EXUB 2Z1PA 5D1QE 2EXWD 5AKVA 1IT9H 3SPVB 1PTZA 1KIRA 4D0BA 4FE9A 4ZUWA 2WMPB 5CR1A 5ALBL 3TIDB 4M7LL 2Y7SA 4S10A 1TTBA 1TZIB 4F33A 1EFQA 3HMXH 4OZ4B 2DWXA 5T1KB 4F7MB 3B2PA 3GEFA 2ZUQB 3APFA 2C9UA 1S5HB 1F0LA 1AZBA 4PJBB 1OAYH 3VXSE 4XNUL 5E1HB 4V1DE 3PP4L 3B7UX 3BI9X 5JW4M 5C09E 1E5AA 2OMVB 3CSFA 5I1AB 3NVQA 5KVFE 4KMTL 2VN6A 1DJXA 1N59B 4MJ5B 3C6LC 1AD9A 1UXSB 3LPOA 3EGSB 4ACTA 3CPLB 3NSJA 2OR7A 4WDIB 1MAMH 1BFTA 4ANWA 4HOMA 5B1BB 3UCQA 1M6OB 4UTAA 4Y2DA 5CINH 4KOCA 2CGRL 1GGTA 1QSEE 3Q2NA 3SB3A 4I3SL 4RRPA 3I84A 1KBPA 3BH9A 5ICXB 1A9BB 1NDMA 2J21A 2GSIA 5DMIH 5ANMA 2CK2A 2AJZA 3FO9A 1OV8A 1FJ1B 1YEKH 4MQSB 1H6TA 3OJMB 2BWIA 3CSTA 1ZA3A 4HZLA 4TLSA 3SEPA 1U21A 5DQDH 3UO8B 4BQBA 4TRPL 1EEZB 1I3GL 4D9LH 3NBNA 4BUQA 2EUXA 1E5UI 4L3FA 3IDNB 1WIUA 1F6LL 4RFEB 2NCMA 8FABB 2YJLA 5ADOL 1CL7H 1KC5L 3I9GL 3BAEL 2UZYB 4A2DA 3S0PA 4WCYL 4RZKA 2HVJB 1IAOA 4XZUA 2XN1A 5F21B 1YN6A 1MIML 2YOCA 3CK0L 2R23A 4FL4B 5JO5B 2XCMC 3QR0A 3D25A 1ZIBA 3EGDA 1MJUH 1XSKA 2GBVA 4NGHH 4JCLA 5IGXL 1D7CA 2XZAL 2JI1A 5MEOB 3QUKA 2VZUA 2XVBA 4I0PA 3SKUD 3S5LG 5TGBA 4P2QA 4MCZA 4YSRA 1IBBA 3WNLA 2O61B 1MCRA 5FUZH 4GP4B 4FYTA 3TEXA 2GJ6B 3TFKD 3KBHE 2IBZX 4WEMB 4MAYD 4P3DA 2GSIB 2CDEB 3HN8A 1ZGLP 3VXMB 5L4JA 1NBYB 2YUVA 3GIVB 4YGAB 2NSQA 3ECQA 4PU2A 1QTPA 4KROD 5IEHB 4ZPVB 4J3OD 1E4HA 2QZ5A 3JWNE 1OOAA 4EI0A 2MNWA 2WWMC 4NO5A 2VQ1B 3GNML 4NPJA 3QHFH 1LTXA 2GHWB 5FYLD 1JNNH 4M61A 2IAND 1L7TH 1BZQK 2PCFB 3WMPA 2GT9A 1OALA 2NW2B 2FYYB 4Z3GA 1HDMA 5E4IA 4FXTA 1FLRH 1PZAA 3PGFH 2IEPA 2APFA 1G1YA 3V0GA 2R0LH 3UGUA 4U6HB 2CCLA 1NGZB 4KUZL 3ABMB 2QKIC 1ACYH 5TF1L 1P7QB 1U93B 4AUYA 4HX1B 1SVBA 3MRPA 3FTWA 3TTSA 4QDGA 1NICA 2W88A 4FFZA 1B0GB 3UTTA 5D7IF 4MDJB 1AGCA 1FN4B 4OGYH 4WTZA 5EPMB 3ZYOA 3MYJA 4FLHA 2WZPD 5ACLA 5LNDA 2G60L 1J18A 4JPWH 1LDPH 2A74B 2DWTA 4Y7OC 4BH8A 3RG1C 2VDLL 4Z5RB 3ZZSA 3V5HA 3BJLA 4WVRA 4Z7UB 5KJ7E 4Q0XH 3O4LD 4YOKA 1NIAA 4ZFGH 1JTPA 5A2KH 3RWEA 3TZVB 5IBTL 1JDCA 3FBQA 2X7LB 4S2SB 3VFMA 4FDWA 3ROLB 1R5WA 3LNEA 4NUJB 4LCCA 5ALBH 43C9A 2WTOA 2AABL 4L8DB 3WNKA 1KPRA 2X38A 2DJMA 3CSBA 4N5EC 5HDQL 1NBZA 5I66A 2TSAA 1E8WA 2ZAIA 1AKPA 3EOBB 3O2WH 3BMWA 3DX7A 1AGDB 3LKSA 1PW3A 3MRKA 2BZ7A 2YS4A 4OF0A 2G0KA 4JZOB 3US0A 3P2DA 3RTQB 3AQDA 3HC0A 1F56A 3C60A 3QEQD 4Y2DB 4ZRGA 5IG7B 5JA8B 1UB6A 3M7FB 3QRBA 5AL8A 2X3CA 3RJOA 2IANA 2FATH 2HJFA 4GSDH 4U3XA 1AD9B 2VIRA 3Q2WA 4Y4HC 4KKBC 4NENA 3BAKA 3RVUD 3MUGB 2BVQB 2MKLC 1QRND 4QD2E 4NAJA 3RIFF 3W0WD 1NSNH 4IMKA 1ZA3B 4HZLB 3MO1B 4GLRI 4BINA 3ISRA 2WK2A 5I6XC 4CU7A 3BLBA 2WQ8A 3II3A 1DJIA 3BH9B 1FO0H 1KBBA 3GC3A 2WN2A 4LCIH 3Q2CA 3S3PA 3ARBA 3MLVH 1CFMA 2GTZB 4ODSH 4JRXA 2FHBA 5CXPA 3LXBA 4DKFL 2ZIDA 4L37B 5D5ME 2GBTA 1SJVA 3P4OA 1U8OA 4N3TA 1G7HA 1M7IB 1T80A 3KWWB 4KQ4H 2XFXA 4CU6A 5DJ6A 3VACA 4HIJB 1WICA 1EZUA 3G04B 2DM3A 2DS4A 3QIBD 4G2AA 4MZIA 5JZ7D 2I85A 1YAIA 3RDTD 5D7SH 2XN9D 2HFGL 4NQUA 4LVHB 3FO2A 4KZDH 5EF0A 1IBFA 1N26A 2BXYA 4TLKA 5FKPA 5F88A 1XH2A 5IV2A 1F45A 4G8GD 4LB8A 4X6DF 4WI6A 4DP9X 5ILTH 5IKCB 2EXTA 1SOSA 4TVSa 1BZ9A 2D4DA 2HMID 1DSYA 1Q9LB 4OV6F 4BKLB 2VO5A 5AVTB 1TMQA 4P57A 5T33L 2X9XA 1Y6KR 1BQLL 5C6PB 2VDQH 1H8SA 3UTTD 4EJ1C 3SE4C 2O6FA 5E8OB 4OT1L 1Q94B 2YGOA 3HNSL 2R69A 2BNRE 2BNRB 2VLKD 4X0NA 2LU4A 4XMKH 2RAMA 1MJ8H 5I24A 2PR4L 2LQRA 1CTNA 1QOKA 4N0CC 4YXLL 1P7KB 4CGTA 1KYFA 4CVXB 5CWSA 2A6JA 3D0LA 3ABZA 3W9DB 3TBTA 3VCLA 4PYHA 1UD4A 5GGRB 1LD9A 4QWWD 3DGGB 4NKDB 4OTXH 4LNVA 4NO2B 5D1QC 2Y7NA 3CGTA 5F97E 2IH1A 2PYEB 1FRGH 4G6FD 4P2RB 4FFZH 1GZPA 1P7KA 5JOEA 1E9QA 5IVXA 2O5YL 2N7SA 4MJIE 4P4RA 5EIIB 4RWHA 2DKUA 3RNQB 1N67A 4JFWA 3SQBB 3OL2A 1HI6A 3HLAA 4J4PC 5E9DD 4RQQA 4TNEA 3K4ZA 3NA9H 3HNVH 3IGUA 1INEL 4UTBH 5FW6A 4P57B 3L08A 4EQ3A 2LFGA 1U3HC 2M8XA 3B8YA 2ZZUT 4LCUA 1XIWD 4NZJA 5D7IE 1T5WB 4MS6A 2YD3A 3HPJB 5TE6H 4W9GC 4U6XB 2XWBA 4XN4A 3GSVB 1QASA 2H6PA 4G8EA 2ETWA 3WHE1 4QO1A 5E6IA 5DJ8B 4KK5C 5KVGL 3IM1A 5KS9B 4ZOCA 5KOMC 3CLEH 2OXHA 1YEGH 1I1YA 2M83A 1KC5H 3I9GH 2F08A 1A1NB 4JK0D 2WSDA 4QGTA 5IWLC 1UURA 1W80A 5EMYA 4GI9A 4AM0A 4L8SC 5EU7C 1CLZH 3KCPB 4AVKA 2QQQA 1ZXKA 5INCA 2MCPH 5E95B 2VZOA 4X4ZA 2YD2A 3S2AA 3LN9A 5F7EL 4MVBC 1BA9A 5DMKB 1PSKH 1VIWA 4PJ7E 4KFZC 1SY6A 2EADA 1OGTB 1R3JA 1VADA 43CAB 3TFBA 2J43A 4CSPA 5HDBE 2FUQA 2L7QA 4G7YL 1F42A 1F8TH 3DX9B 4MNQE 2BY0A 4MB3A 2NUTA 4F8NA 2WYHA 3GI8H 3VTAA 3GXDA 3HJEA 4RA3A 3EO9L 3G5ZA 4JFXA 4TMPA 4M8QA 2VKXA 5GSVB 2XKUA 1N64L 5AW0B 3D7PA 1HKLL 5I30H 1HKFA 3E8VA 4IM8A 4Y19A 5FKAB 2PP8A 3QNXA 2ENJA 5D6CB 3Q3GA 1OWRM 4AUJA 4D94A 1JUFA 1MJJB 5FO2A 3ARGB 5DS1A 3DBSA 4O58L 1MCQA 3CAFA 4UV7H 5F7AA 4CN4A 1DN0A 1KXTB 1ZDQA 5AG9A 3IE4A 1S3RA 5DJCB 4APQA 4LVEA 3SE8H 1A3QA 4ECNA 2R2BB 5DK2B 4GT7A 5DDHA 4GIOA 3FUEA 2VLJE 5IBUB 5KYUB 4IHOA 2Z4QB 3OLGA 5FF6A 3U7WH 1LE5A 2H6UA 4HCFA 2XG4A 4M7KL 2QSCH 1T04B 4IIQC 3SYAA 2DEWX 3T2PA 3ZRFC 3S5LB 4R7DB 2H45A 2DQDL 4XWGL 4TNWF 4ACPA 2GJ6D 3BUPA 3O0RH 1Q0EA 4NP9A 5E5UB 3HI1A 1MCOL 5DR5L 2CRMA 4KZCA 1HL4A 5LCVA 5D2NC 3H8NA 3WFHB 5E4AA 5FR3A 4NRYA 4OZHE 4HUNB 1VERA 2YUZA 5TE4H 3WGVB 2DWDB 2VWEC 3IMVA 4NX0A 3ZHLA 1QHQA 2