1A6MA

Oxy-myoglobin, atomic resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
151
structure length
151
Chain Sequence
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of myoglobin-ligand complexes at near-atomic resolution.
pubmed rcsb
molecule tags Oxygen transport
molecule keywords MYOGLOBIN
total genus 66
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1998-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1a6mA00
102MA 1Z8UB 4NXCA 1Y0WB 5CN8A 3LQDA 3WCVC 3R5IA 1HV4A 2D2NA 3EOKA 3HHBB 1CG5B 4BJAA 1UX9A 2FALA 3AQ9A 3AQ5A 5AZRA 2HHBA 3QM5A 1RQAA 1O1LA 4MPMA 1MKOB 1I3EA 1Y83A 3A0GA 1FHJA 1XYEA 4F6IA 1DTIA 5CN5A 1O1IA 4MXLA 1FDHG 4N7OB 1SWMA 1ECNA 2W72A 1OUTB 1FAWA 5E83A 2ZWJA 4G1VA 1OFKA 1N9XA 2VYWA 2ZS1A 3V2VA 3PI9A 1G9VB 1R1XB 1OR4A 1A6GA 3WCTC 3BA2A 1LFYB 1LH1A 3HRWA 4YU4A 3NMMB 2D5XA 2RAOB 1Y8IA 1A3OA 1Y22B 4MBNA 2QSSB 1C7DA 1FSXA 1J41B 1IBEA 1YMAA 2ZFOA 2G3HA 3GKVB 1SHRB 105MA 1BBBB 1MWCA 1FCSA 1RVWA 2DN1B 3SZKB 1OR6A 1MNKA 1CG8A 4HRTB 4GZGA 1DXVB 1YOHA 1NEJB 1BZZB 1LJWA 4F4OA 1XXTB 3OO5A 3UH7A 2HHEA 1DO3A 2ZT2A 3VRFA 5EE4D 1Y4VA 1NZ3A 1GDLA 1LH5A 3NG6A 1O1NA 1HACA 1GBVB 1YG5A 4ODCB 4H0BA 1YVQB 1SHRA 1HBRA 1TU9A 1J41A 1Y0DB 1ECDA 1JEBB 3A5BA 1MDNA 4F69A 2ZSRA 3GQGB 2MGMA 3DUTB 3ARJA 3LHBA 1FSLA 2C0KA 1Y0TB 2ZSXA 3GKTA 1VXDA 3AG0A 2HZ1A 2Z85A 1QSHB 4HHBA 1Y0DA 4MXKA 1IWHB 1YEUB 2VLXA 3AT5B 3W4UB 1XCHA 1KR7A 1LTWA 1YVQA 3V2ZA 3WCUC 3UH5A 5E83B 3PI2A 1J7WB 2ZFBA 1Y4FB 3BJ2B 1O1MB 3VAUA 3H58A 1MWBA 3G46A 2MYBA 3G53A 4F6JA 1XZUA 4F4OB 3GKVA 3QMAA 2KSCA 1C7CA 1CG5A 2HBDB 111MA 2YRSA 1GCVA 5EUIA 3LQDB 107MA 1S61A 1Y0WA 4IT8A 3ZJLA 1URYA 4MU5A 1A9WA 1V4WB 3ECLA 1YCAA 1BIJA 5HY8B 2PEGB 2G0RA 2DHBB 3NFEA 3E5IA 4MQJB 2MYAA 3G4YA 1Y7DA 2HZ3A 4M4AA 2BW9M 3S65A 4NI0A 1MWDA 1O1NB 3GK9A 3LB2A 1MLGA 3NG6B 2XKGA 1FAWB 5C6YA 3S1IA 1DWSA 1Y4VB 1CBMA 1CH7A 2W72B 1JL6A 1YIHA 1HDSA 1FHJB 1Y4RB 4G51B 5JGGB 2ZFOD 1Y5JB 1V4XB 1VXEA 1K0YA 4O4TA 4O4ZA 2G11A 110MA 1XZVA 4HRRB 1BBBA 4YU3A 3ZJRA 3ECXA 1S0HA 1FSXB 1C7DB 5EV5A 1JF3A 5HU6A 3R5IB 6HBWB 1JZKA 3ZOLA 1QXDA 1S56A 3UHWA 5CHRA 3O89A 1LFLB 2ZLXB 1NS9B 1MYMA 4U8UA 1CH1A 1Y31B 2EKTA 4PNJA 3UHEA 3LB4A 3MKBB 2M6ZA 2ZS1B 1MLRA 2SPLA 2V1FA 3MOUA 1BVDA 101MA 1XZVB 3QQRA 1VXGA 1Y35B 2ZLUA 3OZVA 1YHUA 3VRGB 1LH2A 2ZS0D 3A0GB 3ONZA 1U7SA 2OLPA 4FC3B 4O1TA 2AUOA 3P5QB 4XS0B 1HDAB 1Y09A 1UC3A 1T1NB 1THBB 1YHEA 1FLPA 1Y4QB 2D2MD 4NK1A 4XDIA 1A3NA 3LR7A 3UBVA 4M4AB 1JL7A 5ILMA 3A59A 4ZVAA 5KERB 4U8UB 1Y46B 1MTIA 3S65B 1LFLA 1RPSB 5HLQA 3HC9A 1LHSA 1GLIB 4QAUA 1Y45A 2PGHB 1QXDB 1WMUA 1V75A 1DXUA 3G4WA 4M4BB 1GCVB 3KUNA 1YIEA 2W6WA 1O1JA 3OGBA 1XZ5B 1A01A 2VLYA 5MBNA 3ZJQA 1VXBA 1HLBA 1JY7B 3UHYA 1C7CB 2V1JA 3BJ2A 1CIOA 1UVYA 3WCUD 1A4FA 3BJ3B 1Y5KB 3MYMA 2DN2B 1D8UA 5C6EA 1CLSB 3D1AB 1YDZA 1YEUA 1QPWB 3AT5A 3W4UA 1DUKA 3CIUB 2OIFA 3GDJB 4L7YA 3DHTA 1Y7CA 4NI0B 1Y7DB 1RTXA 2W31A 2G0ZA 1M9PA 2CMMA 3NFEB 3UHRA 5AB8A 3WCTA 1HBHA 1VRFA 3WCTD 3K8BA 1U7RA 5EETA 1HDBA 1XZ7A 109MA 1MNJA 2D60B 1XQ5B 2MGHA 3UHIA 5F0BA 1VXCA 1B0BA 4TYXA 1ABSA 3QJDB 1HBHB 1VREA 1XZ2B 2HBDA 2O5QX 2WTHA 1LFVB 1COHB 2LH7A 2GL3A 1YEVA 1RQ3A 4ILZA 1Y2ZA 3WR1A 1J52A 1CBLA 1XZUB 1MLSA 1GVHA 4ODCA 1HABA 2O5SX 5ILPA 1CH2A 1A0UA 4O2GA 4UIQA 3QJCA 1S69A 1Y5KA 3WCTB 4LPIA 1NZ4A 3M38A 3PI4A 3UHVA 2ZFOC 5E29B 2D5ZA 1MYFA 5CNDA 3WR1B 1GDKA 1DKEB 4PQCA 1MTKA 1BUWA 1IBEB 3IA3B 4ESAA 1LFVA 1MYGA 1JY7A 1YE0A 3R0GA 1NWIA 4ROLA 2LH2A 1Y7ZB 3A9MA 1CLSA 1M6MA 1BINA 1CP5A 1A4FB 1MLHA 1RTEA 2GNVA 2QRWA 1GBUA 1NXFA 2QSSA 1K1KA 1NPFA 1YGFA 2BMMA 1LFYA 3M3AA 1DO7A 1Y8WB 3BCQA 1NQPB 3PT8B 1O1OA 1HACB 1Y7CB 2G10A 3HEPA 2BLIA 1YGDB 1MNIA 2ZLWB 2G12A 3PI1A 1ITHA 1YZIB 1MTJA 1WLAA 1AZIA 1Q1FA 2G0SA 1A3NB 4C0NA 1GZXA 2WY4A 2B7HB 4FH7A 2MGGA 1Y46A 3WTGB 3MJPA 5KERA 5SW7B 3QJEA 2GKMA 2MGDA 3UH6A 5B85A 1DM1A 1Y4PA 2DN1A 1XYEB 1SPGB 2SPNA 3MBAA 1CIKA 1Y8HA 1A9WE 1DO1A 1IRDB 2RI4A 2D2MC 1MLQA 3DR9A 2HBSA 2MGAA 4NI1B 2D2MB 3UHTA 1Y8IB 2DC3A 2ZLVA 3DHRA 2Z6SA 2M6ZB 2EB8A 3WCUB 2HHDA 3BJ1B 2BKMA 1UIWA 2IN4A 4U8UD 2VLZA 3ZJPA 1PBXA 4AVDA 2EKUA 2MHBB 2R1HA 1UT0A 3GYSA 2ZT0A 1YHEB 1O1KA 3AT6A 2V1GA 4MQHA 1S0HB 2HHDB 5HAVA 2ZLXA 1O1IB 1QSIA 4FWZA 3VREA 6HBIA 5CN6A 4NI1A 4H2LB 1K0YB 2HBSB 3QZZA 1YCBA 2DN3A 6HBWA 3AT6B 3WHMB 4HSWA 2W6YA 2ZS0B 1LH3A 2D2NC 2DXMA 3ZH0A 4L2MA 3VREB 1MLOA 1YVTB 1CO9A 1VXAA 112MA 5EYSA 2OHAA 1MLNA 3WTGA 3O7NA 1NGKA 1J40A 1A0ZA 2B7HA 1C40A 1O1KB 3HXNB 2QFKA 2QSPB 3HEOA 1LH6A 1HBSB 1EBTA 1C7BB 3FS4A 2EVKA 3D1KA 3KMFC 1H97A 4FWYA 1AJ9A 3A5GA 2XKIA 5F2AA 1YE2B 1X9FA 2AUPA 1MCYA 2QU0B 1HCOB 4N7PA 1M6CA 4HRRA 1LA6B 2MGLA 1Y4PB 2GTLC 2H8DA 1O16A 1V4XA 1HGBA 2HBFA 5EYJA 5IKSA 1G09A 3CY5B 1OJ6A 1IT3A 3EDBA 5EUIB 3PIAA 4ROMB 3PELB 3UHNA 1KFRA 4ESAB 3D17A 3UI0A 2GTLB 2VYZA 1UX8A 2NRLA 1VWTA 1V4UA 1BVCA 3D4XA 1H1XA 1UVXA 1LFTB 1YEQB 2GNWA 1HBIA 1YGFB 2ZLWA 3G4UA 1MBAA 1NPGA 2PEGA 3UHHA 2OHBA 2Z8AA 1XZ4A 1MLKA 3UHXA 2VEEA 3PT8A 4NXAA 1NQPA 1YEVB 5CN9A 1N9HA 1IWHA 1DWTA 1JPBA 5AZQA 2MGIA 3UHSA 4KMWA 1DXCA 4MQGB 4F6GA 4F6FA 1Y0TA 1YMBA 3QM9A 1XZ4B 3QZXA 1J3YA 3TM9A 1UFPA 2R50A 1O1MA 4WJGA 1J7SB 2H8FB 4F6BA 1ECAA 1J7WA 1YE0B 5JDOE 4MQIA 1V4UB 2JHOA 3ZJMA 2AV0A 3D7OB 3D17B 1N9IA 2SPOA 1O1PA 3GDJA 4FWXA 1CG8B 4ZVBA 1MOAA 4B4YA 3MJUB 1J7SA 3ECZA 1HGCA 2ZS1C 1BJEA 2MYDA 3GLNA 4MQIB 1NIHB 4X0LA 1MBIA 1Y2ZB 5ILRA 2H8DB 1XZ2A 4JYQA 3SZKA 1HBBB 1YFFB 1YHRA 1AJHA 1FN3A 3K3UA 1YDZB 3FH9A 3WI8A 2LH6A 3VRFB 1DXUB 1HLMA 3QM8A 1F63A 1LHTA 3UBCA 3UHZA 4F6DA 3OO5B 1NEJA 1J40B 1DLYA 1SDKB 2GTLA 5CHQA 4L7YB 4HRTA 1MLJA 3CIUA 3WFTA 5EU2A 1VWTB 2DN2A 3OZUA 1RSEA 1Y83B 3UGYA 5JDOD 1Y4GA 2QLSA 1KD2B 2HBEA 1BZRA 1THBA 2VYYA 2BNLA 5B84A 3EU1A 1OUTA 1CO8A 1HV4B 4M4BA 2V1EA 1Y4BA 3PI8B 1V75B 4N7NB 1LA6A 1G09B 2G0VA 3OO4A 5E6EA 1GCWA 2VEBA 1HRMA 4MQCB 1Y35A 3ZJIA 4VHBA 3UH3A 3GQPB 5M3SA 1CH3A 1Y01B 1WMUB 3E55A 2PGHA 1YH9A 1OBMA 3B75B 1A6KA 3WCPB 1LUEA 1G08A 1Y09B 1IDRA 2W6VB 1MOCA 1MLFA 3G52A 1EW6A 1GCWB 3HXNA 1BZ6A 5EQMA 2MYCA 1A6NA 3E4NA 2D2MA 1YHUB 4O35A 2HBCB 2GTLD 1Y4BB 3PI8A 1Y4QA 2OH9A 1YVTA 3G4RA 3E5OA 1X3KA 1JZLA 2W72C 2ZSOA 1DXTA 1EMYA 2HBGA 3ZJNA 1LH7A 1VXFA 1DLWA 1PMBA 3UHKA 1DWRA 1YZIA 3ZJOA 1YMCA 2ZSZA 3HENA 2AUQA 3PI3A 2FRKX 1ECOA 2Z6TA 1Y8KB 1SDLB 4JACA 2NX0A 4WCHD 3WCUA 2MHBA 3GOUB 4U8UC 5E6EB 4MQJA 1HGAA 3S66A 3BCQB 1Y5FA 2AURA 2DHBA 5CNEA 1YENA 2H35B 5KDQA 1GBUB 1Y5JA 3RGKA 3HYUA 1IRDA 1HDSB 1G0BB 3QJBB 1HGCB 1ASHA 1OFJA 3NMLA 2HBEB 3MJPB 1J3FA 2MGKA 4N8TB 2EVPA 3ODQA 3PT7B 2D5ZB 1R1YA 1CMYB 3OZWA 2D2ND 1HSYA 2W6VA 1F5OA 1IRCA 1BZPA 1A00B 3TLDA 1F65A 1CH9A 1HABB 2R4ZA 1S5XA 1V4WA 2MGEA 1F5PA 1Y8WA 2YRSB 1CP0A 4KJTA 3UHBA 2LHBA 3IC0B 3QJDA 2HCOB 1A6MA 1O1OB 1DO4A 2GRFA 2Z6NB 2LH5A 1XQ5A 2MB5A 3ARKA 1MLLA 5HLXA 2R80B 3ED9A 2VRYA 104MA 1LFZA 1CH5A 1ABWB 2ZFBB 1JEBA 3LR9A 1KD2A 1O1PB 3WCWD 1M9PB 1DKEA 1S5YB 4UZVA 1XY0A 5E29A 1EBCA 2BLHA 1Y7ZA 4PQBA 1AJGA 1BUWB 3S1JA 3MVCA 1MBNA 1BZ1B 5MBAA 2ZSYA 1J3YB 5D5RA 2HHEB 1MOHA 1XXTA 2XKHA 3LB3A 1COHA 3AQ7A 2ZSTA 3OK5A 1LFQA 1YHUD 1V5HA 1HCOA 1RQ3B 1YE2A 2D60A 1A01B 3DUTA 2ZSNA 1DXDA 1GDIA 3UHDA 1C7BA 4NS2A 1A3OB 4X0LB 1S6AA 1CMYA 2MYEA 1S5XB 1ABYB 5HLUA 1HBRB 2FRFA 2MGCA 1A00A 3K8BB 4N8TA 4KN3A 3NMMA 1SPEA 4H07A 1HJTA 1LFTA 1YEQA 2FAMA 1R1YB 5C6EB 3D7OA 1Y0CB 2ZLTB 2ZFOB 3DHTB 1MBCA 1VHBA 1LJWB 1BZZA 3D1AA 1HDAA 5KDQB 1MBSA 4HSXA 3ASEA 1MOBA 3MYNA 4KMVA 1MYTA 3RJNB 2ZS1D 3ARLA 3VRGA 1MGNA 3GOUA 4IROB 1CQ2A 2AA1B 2H35A 2HCOA 2LH1A 1SI4B 1AJ9B 2E2YA 1YIEB 1MLUA 2WTGA 1Y22A 1JP9A 4N7PB 2R1HB 3GYSB 1CH4A 1RPSA 2XYKA 1NS9A 1RQ4B 5EOHA 106MA 4AVEA 4UURA 4FH6A 3BOMA 3PI9B 2DXMB 2ZSPA 5CN7A 4C44A 3ODQB 1Y7GB 3EOKB 3WCWA 3WHMA 3ZJHA 1YEOB 4N7OA 1X46A 2HBCA 4FC3A 2ZS0A 1J3ZA 5ILEA 5JDOC 2R4YA 3G4QA 3TM3A 4XS0A 3UHQA 3OVUC 5SW7A 4HBIA 2HHBB 1JF4A 1MYZA 1BZ0A 1OUUB 1I3DA 3ONZB 3BOMB 2QU0A 1YIHB 2GKNA 1PBXB 1G0AA 4MQHB 1Y8KA 3WCWB 1G08B 2GLNA 5D1VA 2MGBA 2O58X 1HBSA 1Y7GA 4MQCA 2W6XA 1QI8B 2AV3A 4DC8A 3MKBA 1RQ4A 5KKKA 1SI4A 4SDHA 3UGZA 2AA1A 5HU6B 2FRJX 1TESA 2RI4B 1J3ZB 3AQ8A 1DXTB 1MBDA 4N7NA 2NRMA 3U3EA 1Y8HB 1YEOA 2LH3A 1X9FC 3H57A 1HBGA 3EU1B 5CN4A 5CNCA 4ROLB 2DN3B 1Y4GB 1NWNA 4IROA 1SDKA 1JWNA 2ZSQA 1SPGA 4MQKB 1GZXB 5JOMA 108MA 4DC7A 3MN0A 3WFXA 1GJNA 3QQQA 4F68A 3WCPA 2G14A 3RJ6A 3HF4A 3SDNA 4OF9A 2GRZA 5JDOF 2ZSSA 1FN3B 2ZLTA 1YH9B 1YFFA 1YHRB 1URVA 1MYIA 1Y85B 3FH9B 4G1BA 2EB9A 1YHUC 2ZT4A 1VXHA 2V1KA 1K1KB 1YOIA 4OODA 2HZ2A 2QMBA 2VM0A 4B3WA 3NL7A 3ZJJA 3IC2B 2ZT1A 1W92A 1HDBB 1B86B 3GQGA 2G0XA 1NS6A 1DUOA 3WCVD 3A2GA 2O5MX 2R4WA 1Y0AB 1MNOA 1NIHA 1CPWA 2QLSB 1HHOB 1Y0CA 3UHCA 1V9QA 1LFQB 1JW8A 1YOGA 1CQXA 3QJEB 2H8FA 3WFUA 1MNHA 1BABB 4NK2A 1J7YB 4MAXA 1A0UB 2EF2A 3EDAA 3BJ3A 1ABYA 1WVPA 1MYHA 1MODA 1BABA 3WFWA 1Y4FA 1DXVA 2O5BX 2R80A 2V1HA 3WCVB 1YGDA 1QSHA 4HHBB 2SPMA 2NSSA 2QFNA 3ZJSA 1L2KA 4MQGA 1HBBA 3ZHWA 1Y0AA 3QM7A 2BWHA 2MGFA 2IG3A 1GDJA 1MLMA 1ABWA 1XZ7B 1LFZB 3ORDA 1B86A 2V1IA 1UFJA 2MGJA 4DWUA 1GLIA 2QMBB 1BZ1A 2RAOA 2D5XB 1GBVA 1YG5B 3MJUA 4MBAA 2FRIX 3IXFA 3WCVA 3SDHA 1JP6A 2R4XA 5CNFA 4TWVA 1MYJA 1XY0B 1UMOA 1Y85A 1S5YA 3PT7A 3S48C 1NZ2A 3UHUA 3WCWC 1HHOA 1J7YA 1T1NA 3PELA 1QPWA 2HBFB 3PIAB 4ROMA 1NS6B 1MBOA 5EE4C 3QJCB 3QJBA 3CY5A 3KUOA 3NL7B 2Z6NA 3M3BA 1MKOA 3VHBA 1FDHA 2D6CA 3IC0A 1YENB 1XZ5A 3M39A 3G4VA 1RVWB 4DWTA 2MBWA 2BK9A 1JP8A 3IC2A 1X9FB 1V07A 1G0BA 2OH8A 5CNGA 3HYUB 2O5LX 1O1JB 1A0ZB 3FS4B 1Y31A 3HRWB 4YU4B 3LB1A 3D4XB 1Y5FB 2QSPA 4WJG1 2NSRA 2VHBA 4TWUA 4MQKA 3K9ZA 1C40B 1JDOA 3OJ1A 3UHGA 103MA 3HF4B 2GRHA 1EWAA 1QXEB 7HBIA 1G9VA 1R1XA 1G0AB 2O5OX 4PQ6A 2ZS0C 3A5AA 3GQRA 1X9FD 3AQ6A 4YU3B 1QSIB 2GDMA 1HGBB 1BZ0B 1OUUA 1RQAB 3P5QA 4H2LA 3HHBA 2BLJM 1IOPA 4NZIA 2D2NB 1HGAB 3S66B 1Y4RA 4G51A 5JGGA 1O1LB 3GQRB 1HBAB 2ZLUB 1SDLA 1QXEA 5HBIA 3D1KB 1IT2A 1N9FA 3B75A 3QM6A 1JZMA 3KMFA 2ZT3A 1DTMA 1Y45B 3DHRB 1QI8A 2ZLVB 1NZ5A 1NAZA 1UIWB 3ZOMA 3BJ1A 3GQPA 2O5TX 1BIJB 5HY8A 3A59B 3OO4B 5CMVA 5CNBA 1MZ0A 1HBAA
chains in the Genus database with same CATH superfamily
102MA 1Z8UB 4NXCA 1Y0WB 5CN8A 3LQDA 3WCVC 3R5IA 1HV4A 2D2NA 3EOKA 3HHBB 1CG5B 4BJAA 1UX9A 2FALA 3AQ9A 3AQ5A 5AZRA 2HHBA 3QM5A 1ON7B 1RQAA 1O1LA 4MPMA 1MKOB 1I3EA 1Y83A 3A0GA 1FHJA 1XYEA 4F6IA 1DTIA 5CN5A 1O1IA 4MXLA 1FDHG 4N7OB 1SWMA 1ECNA 2W72A 1OUTB 1FAWA 5E83A 2ZWJA 4G1VA 3DBJA 1OFKA 1N9XA 1LIAA 2VYWA 2ZS1A 3V2VA 3PI9A 1G9VB 1R1XB 1OR4A 1A6GA 3WCTC 3BA2A 1LFYB 1LH1A 3HRWA 4YU4A 3NMMB 2D5XA 2RAOB 1Y8IA 2C7KA 1A3OA 1HA7B 1Y22B 4MBNA 2QSSB 1C7DA 1FSXA 3VNCA 1J41B 1IBEA 1YMAA 2ZFOA 2G3HA 3GKVB 1SHRB 105MA 1BBBB 1MWCA 1FCSA 1RVWA 2DN1B 3SZKB 1OR6A 1MNKA 1CG8A 4HRTB 4GZGA 1DXVB 1YOHA 1NEJB 1BZZB 1LJWA 4F4OA 1XXTB 3OO5A 3UH7A 2HHEA 1DO3A 2ZT2A 2WCQA 3VRFA 5EE4D 1Y4VA 1NZ3A 1GDLA 1LH5A 3NG6A 1O1NA 1HACA 1GBVB 1YG5A 4ODCB 4H0BA 1GH0A 1YVQB 1SHRA 1HBRA 1TU9A 1J41A 1Y0DB 1ECDA 1JEBB 3A5BA 1MDNA 4F69A 2ZSRA 3GQGB 2MGMA 3DUTB 1HA7A 3ARJA 3LHBA 1FSLA 2VMLA 2C0KA 1Y0TB 2ZSXA 4ZIZB 3GKTA 1VXDA 3AG0A 2HZ1A 4A8QA 2Z85A 1QSHB 4HHBA 1Y0DA 4MXKA 1IWHB 1YEUB 2VLXA 3AT5B 3W4UB 1XCHA 1KR7A 1LTWA 1GH0B 1YVQA 3V2ZA 3WCUC 3UH5A 2C7JB 5E83B 3PI2A 1J7WB 2ZFBA 1Y4FB 3BJ2B 1O1MB 3VAUA 3H58A 1MWBA 3G46A 2MYBA 3G53A 4F6JA 1XZUA 4F4OB 2UULD 3GKVA 3QMAA 2KSCA 4AE0A 1C7CA 1CG5A 2HBDB 111MA 2YRSA 1GCVA 5EUIA 1HI8A 3LQDB 107MA 1S61A 1Y0WA 3V58A 4IT8A 3ZJLA 1URYA 4MU5A 1A9WA 1V4WB 3ECLA 2VMLB 1YCAA 1BIJA 5HY8B 2PEGB 4LMSB 2G0RA 2DHBB 4L1EA 3NFEA 3E5IA 4MQJB 2MYAA 3G4YA 1JBOA 1Y7DA 2HZ3A 4M4AA 2BW9M 3S65A 4NI0A 1MWDA 1O1NB 3GK9A 3LB2A 1MLGA 3NG6B 2XKGA 1FAWB 5C6YA 3S1IA 1DWSA 4XXKA 1Y4VB 1CBMA 1CH7A 2W72B 1JL6A 1YIHA 1HDSA 1FHJB 1Y4RB 2X49A 4G51B 5JGGB 2ZFOD 1Y5JB 1V4XB 1VXEA 1UVIA 1K0YA 4O4TA 4O4ZA 2G11A 110MA 1XZVA 4HRRB 1BBBA 4YU3A 1COLA 3ZJRA 3ECXA 1S0HA 1FSXB 1C7DB 5EV5A 1JF3A 5HU6A 3R5IB 6HBWB 1JZKA 3ZOLA 1QXDA 1S56A 3UHWA 5CHRA 3O89A 1LFLB 2ZLXB 1NS9B 1HI1A 1MYMA 4U8UA 4A8SA 1CH1A 1Y31B 2EKTA 4PNJA 3UHEA 3LB4A 3MKBB 2M6ZA 4ETVA 3PMDA 2ZS1B 3NUHB 1MLRA 2SPLA 2V1FA 3DBJB 3MOUA 1BVDA 101MA 1KTPA 1XZVB 3QQRA 1VXGA 1Y35B 2C7LA 5B13A 2ZLUA 1XDTT 3OZVA 1YHUA 3VRGB 1LH2A 2ZS0D 3A0GB 4Q70B 3ONZA 1U7SA 2OLPA 4FC3B 4O1TA 2AUOA 4BJUA 3P5QB 4XS0B 1HDAB 1Y09A 1UC3A 1T1NB 1THBB 1YHEA 1FLPA 1Y4QB 2D2MD 4NK1A 4XDIA 1A3NA 3LR7A 3UBVA 1I7YB 4M4AB 1JL7A 5ILMA 4A8FA 3A59A 4ZVAA 1KN1A 5KERB 4U8UB 1UVJA 1Y46B 1MTIA 3S65B 1LFLA 1RPSB 5HLQA 3HC9A 1LHSA 1GLIB 4QAUA 1Y45A 2PGHB 1QXDB 1WMUA 1V75A 1DXUA 3G4WA 2UUMB 4M4BB 1GCVB 5FVBA 3KUNA 1YIEA 2W6WA 1O1JA 5AQDM 3OGBA 1XZ5B 1A01A 2VLYA 5MBNA 3ZJQA 1VXBA 1B8DA 1HLBA 3MWNA 1JY7B 3UHYA 1C7CB 2V1JA 3BJ2A 1CIOA 1UVYA 3WCUD 1A4FA 3BJ3B 1Y5KB 3MYMA 2DN2B 1D8UA 5C6EA 1CLSB 3D1AB 1YDZA 1YEUA 1QPWB 3AT5A 3W4UA 1DUKA 3CIUB 2OIFA 3GDJB 4L7YA 3DHTA 1Y7CA 4NI0B 1JBOB 1Y7DB 1RTXA 2DKAA 2W31A 2G0ZA 1M9PA 2CMMA 3NFEB 1DDTA 1HHTP 3UHRA 5AB8A 3WCTA 1HBHA 1VRFA 3WCTD 3K8BA 1U7RA 5EETA 1HDBA 4GY3B 1XZ7A 109MA 1UVMA 1MNJA 2D60B 1XQ5B 2MGHA 3UHIA 4GY3A 5F0BA 1VXCA 1B0BA 4TYXA 1ABSA 3QJDB 1HBHB 1VREA 1XZ2B 2HBDA 2O5QX 2WTHA 1LFVB 1COHB 2LH7A 2GL3A 1YEVA 1RQ3A 4ILZA 1Y2ZA 3WR1A 1J52A 1F99A 1CBLA 1XZUB 1MLSA 1GVHA 4ODCA 1HABA 2O5SX 2UULB 5ILPA 1CH2A 1A0UA 4O2GA 4UIQA 3QJCA 1S69A 1Y5KA 3WCTB 4LPIA 1NZ4A 3M38A 3PI4A 3UHVA 2ZFOC 5E29B 4H0MB 2D5ZA 1MYFA 5CNDA 3WR1B 1GDKA 1DKEB 1B33A 4PQCA 4A8WA 1MTKA 1BUWA 1IBEB 3IA3B 4ESAA 1LFVA 1MYGA 1JY7A 1YE0A 3R0GA 1NWIA 4ROLA 2LH2A 1Y7ZB 3A9MA 1CLSA 1M6MA 1A87A 1BINA 1CP5A 1A4FB 1MLHA 1RTEA 2GNVA 2QRWA 1GBUA 1NXFA 2QSSA 1K1KA 1NPFA 1YGFA 2BMMA 1LFYA 2C7KB 3M3AA 1DO7A 1Y8WB 3BCQA 1NQPB 3PT8B 1O1OA 1HACB 1Y7CB 2G10A 3HEPA 3BRPB 2I88A 2BLIA 1YGDB 1MNIA 2ZLWB 2G12A 3PI1A 1ITHA 1YZIB 1MTJA 1WLAA 1AZIA 1Q1FA 2G0SA 1A3NB 4C0NA 1GZXA 2WY4A 2B7HB 4FH7A 2MGGA 1Y46A 3WTGB 1HHSA 3MJPA 5KERA 5SW7B 3QJEA 2GKMA 2MGDA 3UH6A 5B85A 1DM1A 1Y4PA 2DN1A 1XYEB 3O2CA 1SPGB 2SPNA 3MBAA 1CIKA 1Y8HA 1I7YA 1A9WE 1DO1A 1IRDB 2RI4A 2UULC 4N6SA 2D2MC 1MLQA 3DR9A 2HBSA 2MGAA 1EYXA 4NI1B 2D2MB 3UHTA 1Y8IB 2DC3A 2ZLVA 3DHRA 2Z6SA 2M6ZB 2EB8A 3WCUB 2HHDA 3BJ1B 1TOXA 2BKMA 1UIWA 2IN4A 4U8UD 2VLZA 3ZJPA 1PBXA 4AVDA 2EKUA 2MHBB 5B13G 2R1HA 1UT0A 3GYSA 2ZT0A 1YHEB 1O1KA 3KVSA 3AT6A 2V1GA 4MQHA 1S0HB 2HHDB 5HAVA 2ZLXA 1O1IB 1QSIA 4FWZA 3VREA 6HBIA 4Q70A 5CN6A 4NI1A 4H2LB 1ALLB 1K0YB 2HBSB 3QZZA 1YCBA 2DN3A 6HBWA 3AT6B 3WHMB 4HSWA 2W6YA 2ZS0B 1LH3A 1SGKA 2D2NC 2DXMA 3ZH0A 4L2MA 2YSKA 3VREB 1MLOA 1YVTB 1CO9A 1VXAA 112MA 5EYSA 2OHAA 1MLNA 3WTGA 3O7NA 1NGKA 1J40A 1A0ZA 2B7HA 1CIIA 1C40A 1O1KB 3HXNB 2QFKA 2QSPB 3HEOA 1LH6A 1HBSB 2V8AA 1EBTA 1C7BB 3FS4A 2EVKA 3D1KA 3KMFC 3O18B 1H97A 4FWYA 1AJ9A 3A5GA 2XKIA 5F2AA 1YE2B 1X9FA 2AUPA 1MCYA 2QU0B 1HCOB 4N7PA 1M6CA 4HRRA 3O2CB 1LA6B 2DKCA 2MGLA 1Y4PB 4YJJB 4Z8KB 2GTLC 2H8DA 1O16A 1V4XA 1HGBA 2HBFA 5EYJA 5IKSA 1G09A 3CY5B 1OJ6A 1IT3A 3EDBA 5EUIB 3PIAA 4ROMB 2JL9A 3PELB 3UHNA 1KFRA 4ESAB 4A8YA 3D17A 3UI0A 1QGWC 2GTLB 2VYZA 1UX8A 4XXIA 2NRLA 1VWTA 1V4UA 1BVCA 3D4XA 1H1XA 1UVXA 1LFTB 1YEQB 2GNWA 1HBIA 1YGFB 2ZLWA 3G4UA 1MBAA 1NPGA 2PEGA 3UHHA 3BRPA 2OHBA 2Z8AA 1XZ4A 1MLKA 3UHXA 2VJTB 2VEEA 2UUMX 3PT8A 4NXAA 1NQPA 1YEVB 5CN9A 1N9HA 1IWHA 1DWTA 1JPBA 3L0FA 4ETUA 5AZQA 2MGIA 3UHSA 4KMWA 1DXCA 1B33B 4MQGB 4F6GA 4F6FA 4BS9A 1Y0TA 1YMBA 3QM9A 1XZ4B 3QZXA 1J3YA 3TM9A 1UFPA 2R50A 1O1MA 4WJGA 1J7SB 2H8FB 4F6BA 1ECAA 1J7WA 1YE0B 5JDOE 4MQIA 1V4UB 2JHOA 2JLGA 3ZJMA 2AV0A 3D7OB 3D17B 1N9IA 2SPOA 1O1PA 3GDJA 4FWXA 1CG8B 4ZVBA 1MOAA 4B4YA 3MJUB 3RQRA 1J7SA 3ECZA 4TMAB 1HGCA 2ZS1C 1BJEA 2MYDA 2UULA 3GLNA 4MQIB 1NIHB 1HI0P 4X0LA 4PO5B 1F99B 1MBIA 1Y2ZB 5ILRA 2H8DB 1XF6C 1XZ2A 4JYQA 3SZKA 1HBBB 2UUNB 1YFFB 1YHRA 1AJHA 1FN3A 3K3UA 1YDZB 3FH9A 3WI8A 2LH6A 3VRFB 1DXUB 1HLMA 3QM8A 2VJTA 1F63A 1LHTA 3UBCA 3UHZA 4F6DA 3OO5B 1NEJA 1J40B 1DLYA 1SDKB 2GTLA 5CHQA 1UVKA 4L7YB 4HRTA 1MLJA 3CIUA 3WFTA 5EU2A 1VWTB 2DN2A 3OZUA 1RSEA 1Y83B 3UGYA 2BV8A 5JDOD 1Y4GA 2QLSA 1ON7A 1KD2B 2HBEA 1BZRA 1THBA 2VYYA 2BNLA 5B84A 3EU1A 1OUTA 1CO8A 1HV4B 2UUMA 4M4BA 2V1EA 1Y4BA 3PI8B 1V75B 4N7NB 1LA6A 1G09B 2G0VA 3OO4A 5E6EA 1GCWA 2VEBA 1HRMA 4MQCB 4YJJA 1Y35A 3ZJIA 4VHBA 3UH3A 3GQPB 5M3SA 4RMPB 1CH3A 1Y01B 1WMUB 3E55A 2PGHA 1YH9A 1OBMA 3B75B 1A6KA 3WCPB 1LUEA 1G08A 1Y09B 1IDRA 2W6VB 1MOCA 1MLFA 3G52A 1EW6A 1GCWB 3HXNA 1BZ6A 5EQMA 2MYCA 1A6NA 3E4NA 4F0TB 2D2MA 1YHUB 4O35A 2HBCB 2GTLD 1Y4BB 3PI8A 1Y4QA 2OH9A 1YVTA 3G4RA 3E5OA 1X3KA 1JZLA 2W72C 2ZSOA 1DXTA 2VJHB 1EMYA 2HBGA 3ZJNA 1LH7A 1VXFA 1DLWA 1PMBA 3UHKA 1DWRA 1YZIA 3ZJOA 1YMCA 2ZSZA 3HENA 2AUQA 3PI3A 3KVSB 2FRKX 1ECOA 2Z6TA 1PHNB 1Y8KB 1SDLB 4JACA 2NX0A 4WCHD 3WCUA 2MHBA 3GOUB 4U8UC 5E6EB 4MQJA 1HGAA 3S66A 3BCQB 1Y5FA 2AURA 2DHBA 5CNEA 1YENA 2H35B 5KDQA 1GBUB 1Y5JA 3RGKA 3HYUA 1IRDA 1HDSB 1G0BB 3QJBB 1HGCB 5AQDA 1ASHA 1OFJA 3NMLA 4N6SB 2HBEB 3MJPB 1J3FA 2MGKA 4N8TB 2EVPA 3ODQA 3PT7B 2D5ZB 1R1YA 1CMYB 3OZWA 2D2ND 1HSYA 2W6VA 1F5OA 1F0LA 1IRCA 1BZPA 1A00B 3TLDA 1F65A 1UVLA 1CH9A 1HABB 2R4ZA 1S5XA 1V4WA 2MGEA 1F5PA 3V58B 1Y8WA 2YRSB 1CP0A 4KJTA 3UHBA 2LHBA 3IC0B 3QJDA 2HCOB 4GXEA 1A6MA 1O1OB 2GRFA 1DO4A 4ZIZA 2Z6NB 2LH5A 1XQ5A 2MB5A 3ARKA 1MLLA 5HLXA 2R80B 3ED9A 2VRYA 104MA 1LFZA 1CH5A 1ABWB 1WACA 2ZFBB 1JEBA 3LR9A 1KD2A 1O1PB 3WCWD 1M9PB 1DKEA 1S5YB 4UZVA 1XY0A 5E29A 1EBCA 2BLHA 1Y7ZA 4PQBA 1AJGA 1BUWB 3S1JA 3GUQA 3MVCA 1MBNA 1BZ1B 5MBAA 2ZSYA 1J3YB 4HH1A 5D5RA 2HHEB 1MOHA 1XXTA 2XKHA 3LB3A 1COHA 3AQ7A 4Z8KA 2ZSTA 3OK5A 1LFQA 1YHUD 1V5HA 1HCOA 1RQ3B 1YE2A 2D60A 1A01B 4ETTA 5FVBM 3DUTA 3L0FB 2ZSNA 1DXDA 1GDIA 3UHDA 1C7BA 4NS2A 1A3OB 4PO5A 4X0LB 1S6AA 1CMYA 2MYEA 1S5XB 1ABYB 5HLUA 1HBRB 2FRFA 2MGCA 1A00A 3K8BB 4N8TA 4KN3A 1XG0C 3NMMA 2DKDA 1SPEA 4H07A 1HJTA 1LFTA 1YEQA 2FAMA 1R1YB 5C6EB 3D7OA 1Y0CB 2ZLTB 2ZFOB 3DHTB 1MBCA 1VHBA 1LJWB 1BZZA 3D1AA 1HDAA 5KDQB 1MBSA 4HSXA 3ASEA 1MOBA 3MYNA 4KMVA 1MYTA 3RJNB 2ZS1D 3ARLA 3VRGA 1MGNA 3GOUA 4IROB 1CQ2A 4AE1A 2AA1B 2H35A 2HCOA 4GXEB 2LH1A 1SI4B 1AJ9B 2E2YA 1YIEB 1MLUA 2WTGA 1B8DB 1Y22A 1JP9A 4N7PB 2R1HB 3GYSB 1CH4A 1LIAB 4LMXB 1RPSA 3ZTAA 2XYKA 1NS9A 1RQ4B 5EOHA 106MA 4AVEA 4UURA 4FH6A 3BOMA 3PI9B 2DXMB 2ZSPA 5CN7A 4C44A 3ODQB 1Y7GB 1CPCA 3EOKB 3WCWA 3WHMA 2WCRA 3ZJHA 1YEOB 4F0UA 1ALLA 4N7OA 1X46A 2HBCA 4FC3A 2ZS0A 1J3ZA 5ILEA 5JDOC 2R4YA 3G4QA 3TM3A 4XS0A 3UHQA 3OVUC 5SW7A 1CPCB 4HBIA 2HHBB 1JF4A 2C7LB 1MYZA 1BZ0A 1OUUB 1I3DA 2X4AA 3ONZB 3BOMB 2QU0A 1YIHB 3LQ9A 2GKNA 1PBXB 1G0AA 4MQHB 1PHNA 1Y8KA 3WCWB 1G08B 2GLNA 5D1VA 2MGBA 2O58X 1HBSA 2V8AB 1Y7GA 4MQCA 2VJRB 2W6XA 1QI8B 2AV3A 4DC8A 4RMPA 3MKBA 1RQ4A 5KKKA 1SI4A 1EYXB 4SDHA 3UGZA 2AA1A 5HU6B 2FRJX 1TESA 2RI4B 1J3ZB 3AQ8A 1DXTB 1MBDA 4N7NA 2BV8B 2NRMA 3U3EA 1Y8HB 1YEOA 2LH3A 4F0UB 1X9FC 3H57A 1HBGA 3EU1B 5CN4A 5CNCA 4ROLB 4A8KA 2DN3B 1Y4GB 1NWNA 4IROA 1SDKA 1JWNA 2ZSQA 1SPGA 4MQKB 1GZXB 5JOMA 108MA 4DC7A 3MN0A 3WFXA 1GJNA 3QQQA 4F68A 3WCPA 4B02A 2G14A 3RJ6A 3HF4A 3SDNA 4OF9A 2GRZA 5JDOF 2ZSSA 4ERTA 1FN3B 2C7JA 2ZLTA 1YH9B 1YFFA 1YHRB 3GIOA 4A8OA 1URVA 1MYIA 1Y85B 3FH9B 4G1BA 2EB9A 1YHUC 2ZT4A 1VXHA 2V1KA 1K1KB 1YOIA 4OODA 2HZ2A 2QMBA 2JLFA 2VM0A 4B3WA 3NL7A 3ZJJA 4L1EB 3IC2B 2ZT1A 3FEWX 1W92A 1HDBB 1B86B 3GQGA 2G0XA 1NS6A 4A8MP 1DUOA 3WCVD 3A2GA 2O5MX 2R4WA 1Y0AB 1MNOA 1NIHA 1CPWA 2QLSB 3PMCA 1HHOB 2J96A 1Y0CA 3UHCA 1V9QA 1LFQB 3V57A 1JW8A 1YOGA 1CQXA 3QJEB 2H8FA 3WFUA 1MNHA 1BABB 4NK2A 1J7YB 4MAXA 1A0UB 4H0MA 2EF2A 3EDAA 3BJ3A 1ABYA 1WVPA 1MYHA 1MODA 1BABA 3WFWA 1Y4FA 1DXVA 2O5BX 2R80A 2V1HA 3WCVB 1YGDA 3V57B 1QSHA 4HHBB 2SPMA 2NSSA 2QFNA 2UUNA 3ZJSA 1L2KA 4MQGA 1HBBA 3ZHWA 1Y0AA 3QM7A 2BWHA 2MGFA 2IG3A 1GDJA 1MLMA 1ABWA 1XZ7B 1LFZB 3ORDA 1B86A 2V1IA 1UFJA 2MGJA 4DWUA 4ESUA 1GLIA 2QMBB 1BZ1A 1MDTA 2RAOA 2D5XB 1GBVA 1YG5B 3MJUA 4MBAA 2FRIX 3IXFA 1KN1B 3WCVA 3SDHA 1JP6A 2R4XA 5CNFA 4TWVA 1MYJA 1XY0B 1UMOA 1Y85A 1S5YA 4ERVA 3PT7A 3S48C 1NZ2A 3UHUA 3WCWC 2UUND 1HHOA 1J7YA 1T1NA 3PELA 1QPWA 2HBFB 3PIAB 4ROMA 1NS6B 1MBOA 5EE4C 3QJCB 3QJBA 3CY5A 3KUOA 3NL7B 2Z6NA 3M3BA 1MKOA 3VHBA 1FDHA 4LM6B 2D6CA 3IC0A 1YENB 1XZ5A 3M39A 3O18A 3G4VA 1RVWB 4DWTA 2MBWA 1KTPB 2BK9A 1JP8A 3IC2A 1X9FB 1V07A 1G0BA 2OH8A 5CNGA 3HYUB 2O5LX 1O1JB 1A0ZB 4HH0A 3FS4B 1Y31A 3HRWB 4YU4B 3LB1A 3D4XB 1Y5FB 2QSPA 4WJG1 2NSRA 2VHBA 4TWUA 4MQKA 3K9ZA 1C40B 2UULH 1JDOA 3OJ1A 3UHGA 103MA 3HF4B 2GRHA 1EWAA 1QXEB 7HBIA 1UVNA 1G9VA 1R1XA 2VJHA 1G0AB 2O5OX 4PQ6A 2ZS0C 3A5AA 3GQRA 1X9FD 3AQ6A 4YU3B 1QSIB 2GDMA 1HGBB 1BZ0B 1OUUA 1RQAB 3P5QA 4H2LA 3HHBA 2BLJM 1IOPA 4NZIA 2D2NB 1HGAB 3S66B 1Y4RA 4G51A 5JGGA 1O1LB 3GQRB 1HBAB 2VJRA 2ZLUB 1SDLA 1QXEA 5HBIA 3D1KB 1IT2A 1N9FA 3B75A 3QM6A 1JZMA 3KMFA 2ZT3A 4F0TA 1DTMA 1Y45B 3DHRB 1QI8A 2ZLVB 1NZ5A 1NAZA 1UIWB 3ZOMA 3BJ1A 3GQPA 1NY9A 2O5TX 1BIJB 1RH1A 3A59B 5HY8A 3OO4B 5CMVA 5CNBA 1MZ0A 1HBAA
chains in the Genus database with same CATH topology
102MA 1Z8UB 4NXCA 1Y0WB 5CN8A 3LQDA 3WCVC 3R5IA 1HV4A 2D2NA 3EOKA 3HHBB 1CG5B 4BJAA 1UX9A 2FALA 3AQ9A 3AQ5A 5AZRA 2HHBA 3QM5A 1RQAA 1O1LA 4MPMA 1MKOB 1I3EA 1Y83A 3A0GA 1FHJA 1XYEA 4F6IA 1DTIA 5CN5A 1O1IA 4MXLA 1FDHG 4N7OB 1SWMA 1ECNA 2W72A 1OUTB 1FAWA 5E83A 2ZWJA 4G1VA 1OFKA 1N9XA 2VYWA 2ZS1A 3V2VA 3PI9A 1G9VB 1R1XB 1OR4A 1A6GA 3WCTC 3BA2A 1LFYB 1LH1A 3HRWA 4YU4A 3NMMB 2D5XA 2RAOB 1Y8IA 1A3OA 1Y22B 4MBNA 2QSSB 1C7DA 1FSXA 1J41B 1IBEA 1YMAA 2ZFOA 2G3HA 3GKVB 1SHRB 105MA 1BBBB 1MWCA 1FCSA 1RVWA 2DN1B 3SZKB 1OR6A 1MNKA 1CG8A 4HRTB 4GZGA 1DXVB 1YOHA 1NEJB 1BZZB 1LJWA 4F4OA 1XXTB 3OO5A 3UH7A 2HHEA 1DO3A 2ZT2A 3VRFA 5EE4D 1Y4VA 1NZ3A 1GDLA 1LH5A 3NG6A 1O1NA 1HACA 1GBVB 1YG5A 4ODCB 4H0BA 1YVQB 1SHRA 1HBRA 1TU9A 1J41A 1Y0DB 1ECDA 1JEBB 3A5BA 1MDNA 4F69A 2ZSRA 3GQGB 2MGMA 3DUTB 3ARJA 3LHBA 1FSLA 2C0KA 1Y0TB 2ZSXA 3GKTA 1VXDA 3AG0A 2HZ1A 2Z85A 1QSHB 4HHBA 1Y0DA 4MXKA 1IWHB 1YEUB 2VLXA 3AT5B 3W4UB 1XCHA 1KR7A 1LTWA 1YVQA 3V2ZA 3WCUC 3UH5A 5E83B 3PI2A 1J7WB 2ZFBA 1Y4FB 3BJ2B 1O1MB 3VAUA 3H58A 1MWBA 3G46A 2MYBA 3G53A 4F6JA 1XZUA 4F4OB 3GKVA 3QMAA 2KSCA 1C7CA 1CG5A 2HBDB 111MA 2YRSA 1GCVA 5EUIA 3LQDB 107MA 1S61A 1Y0WA 4IT8A 3ZJLA 1URYA 4MU5A 1A9WA 1V4WB 3ECLA 1YCAA 1BIJA 5HY8B 2PEGB 2G0RA 2DHBB 3NFEA 3E5IA 4MQJB 2MYAA 3G4YA 1Y7DA 2HZ3A 4M4AA 2BW9M 3S65A 4NI0A 1MWDA 1O1NB 3GK9A 3LB2A 1MLGA 3NG6B 2XKGA 1FAWB 5C6YA 3S1IA 1DWSA 1Y4VB 1CBMA 1CH7A 2W72B 1JL6A 1YIHA 1HDSA 1FHJB 1Y4RB 4G51B 5JGGB 2ZFOD 1Y5JB 1V4XB 1VXEA 1K0YA 4O4TA 4O4ZA 2G11A 110MA 1XZVA 4HRRB 1BBBA 4YU3A 3ZJRA 3ECXA 1S0HA 1FSXB 1C7DB 5EV5A 1JF3A 5HU6A 3R5IB 6HBWB 1JZKA 3ZOLA 1QXDA 1S56A 3UHWA 5CHRA 3O89A 1LFLB 2ZLXB 1NS9B 1MYMA 4U8UA 1CH1A 1Y31B 2EKTA 4PNJA 3UHEA 3LB4A 3MKBB 2M6ZA 2ZS1B 1MLRA 2SPLA 2V1FA 3MOUA 1BVDA 101MA 1XZVB 3QQRA 1VXGA 1Y35B 2ZLUA 3OZVA 1YHUA 3VRGB 1LH2A 2ZS0D 3A0GB 3ONZA 1U7SA 2OLPA 4FC3B 4O1TA 2AUOA 3P5QB 4XS0B 1HDAB 1Y09A 1UC3A 1T1NB 1THBB 1YHEA 1FLPA 1Y4QB 2D2MD 4NK1A 4XDIA 1A3NA 3LR7A 3UBVA 4M4AB 1JL7A 5ILMA 3A59A 4ZVAA 5KERB 4U8UB 1Y46B 1MTIA 3S65B 1LFLA 1RPSB 5HLQA 3HC9A 1LHSA 1GLIB 4QAUA 1Y45A 2PGHB 1QXDB 1WMUA 1V75A 1DXUA 3G4WA 4M4BB 1GCVB 3KUNA 1YIEA 2W6WA 1O1JA 3OGBA 1XZ5B 1A01A 2VLYA 5MBNA 3ZJQA 1VXBA 1HLBA 1JY7B 3UHYA 1C7CB 2V1JA 3BJ2A 1CIOA 1UVYA 3WCUD 1A4FA 3BJ3B 1Y5KB 3MYMA 2DN2B 1D8UA 5C6EA 1CLSB 3D1AB 1YDZA 1YEUA 1QPWB 3AT5A 3W4UA 1DUKA 3CIUB 2OIFA 3GDJB 4L7YA 3DHTA 1Y7CA 4NI0B 1Y7DB 1RTXA 2W31A 2G0ZA 1M9PA 2CMMA 3NFEB 3UHRA 5AB8A 3WCTA 1HBHA 1VRFA 3WCTD 3K8BA 1U7RA 5EETA 1HDBA 1XZ7A 109MA 1MNJA 2D60B 1XQ5B 2MGHA 3UHIA 5F0BA 1VXCA 1B0BA 4TYXA 1ABSA 3QJDB 1HBHB 1VREA 1XZ2B 2HBDA 2O5QX 2WTHA 1LFVB 1COHB 2LH7A 2GL3A 1YEVA 1RQ3A 4ILZA 1Y2ZA 3WR1A 1J52A 1CBLA 1XZUB 1MLSA 1GVHA 4ODCA 1HABA 2O5SX 5ILPA 1CH2A 1A0UA 4O2GA 4UIQA 3QJCA 1S69A 1Y5KA 3WCTB 4LPIA 1NZ4A 3M38A 3PI4A 3UHVA 2ZFOC 5E29B 2D5ZA 1MYFA 5CNDA 3WR1B 1GDKA 1DKEB 4PQCA 1MTKA 1BUWA 1IBEB 3IA3B 4ESAA 1LFVA 1MYGA 1JY7A 1YE0A 3R0GA 1NWIA 4ROLA 2LH2A 1Y7ZB 3A9MA 1CLSA 1M6MA 1BINA 1CP5A 1A4FB 1MLHA 1RTEA 2GNVA 2QRWA 1GBUA 1NXFA 2QSSA 1K1KA 1NPFA 1YGFA 2BMMA 1LFYA 3M3AA 1DO7A 1Y8WB 3BCQA 1NQPB 3PT8B 1O1OA 1HACB 1Y7CB 2G10A 3HEPA 2BLIA 1YGDB 1MNIA 2ZLWB 2G12A 3PI1A 1ITHA 1YZIB 1MTJA 1WLAA 1AZIA 1Q1FA 2G0SA 1A3NB 4C0NA 1GZXA 2WY4A 2B7HB 4FH7A 2MGGA 1Y46A 3WTGB 3MJPA 5KERA 5SW7B 3QJEA 2GKMA 2MGDA 3UH6A 5B85A 1DM1A 1Y4PA 2DN1A 1XYEB 1SPGB 2SPNA 3MBAA 1CIKA 1Y8HA 1A9WE 1DO1A 1IRDB 2RI4A 2D2MC 1MLQA 3DR9A 2HBSA 2MGAA 4NI1B 2D2MB 3UHTA 1Y8IB 2DC3A 2ZLVA 3DHRA 2Z6SA 2M6ZB 2EB8A 3WCUB 2HHDA 3BJ1B 2BKMA 1UIWA 2IN4A 4U8UD 2VLZA 3ZJPA 1PBXA 4AVDA 2EKUA 2MHBB 2R1HA 1UT0A 3GYSA 2ZT0A 1YHEB 1O1KA 3AT6A 2V1GA 4MQHA 1S0HB 2HHDB 5HAVA 2ZLXA 1O1IB 1QSIA 4FWZA 3VREA 6HBIA 5CN6A 4NI1A 4H2LB 1K0YB 2HBSB 3QZZA 1YCBA 2DN3A 6HBWA 3AT6B 3WHMB 4HSWA 2W6YA 2ZS0B 1LH3A 2D2NC 2DXMA 3ZH0A 4L2MA 3VREB 1MLOA 1YVTB 1CO9A 1VXAA 112MA 5EYSA 2OHAA 1MLNA 3WTGA 3O7NA 1NGKA 1J40A 1A0ZA 2B7HA 1C40A 1O1KB 3HXNB 2QFKA 2QSPB 3HEOA 1LH6A 1HBSB 1EBTA 1C7BB 3FS4A 2EVKA 3D1KA 3KMFC 1H97A 4FWYA 1AJ9A 3A5GA 2XKIA 5F2AA 1YE2B 1X9FA 2AUPA 1MCYA 2QU0B 1HCOB 4N7PA 1M6CA 4HRRA 1LA6B 2MGLA 1Y4PB 2GTLC 2H8DA 1O16A 1V4XA 1HGBA 2HBFA 5EYJA 5IKSA 1G09A 3CY5B 1OJ6A 1IT3A 3EDBA 5EUIB 3PIAA 4ROMB 3PELB 3UHNA 1KFRA 4ESAB 3D17A 3UI0A 2GTLB 2VYZA 1UX8A 2NRLA 1VWTA 1V4UA 1BVCA 3D4XA 1H1XA 1UVXA 1LFTB 1YEQB 2GNWA 1HBIA 1YGFB 2ZLWA 3G4UA 1MBAA 1NPGA 2PEGA 3UHHA 2OHBA 2Z8AA 1XZ4A 1MLKA 3UHXA 2VEEA 3PT8A 4NXAA 1NQPA 1YEVB 5CN9A 1N9HA 1IWHA 1DWTA 1JPBA 5AZQA 2MGIA 3UHSA 4KMWA 1DXCA 4MQGB 4F6GA 4F6FA 1Y0TA 1YMBA 3QM9A 1XZ4B 3QZXA 1J3YA 3TM9A 1UFPA 2R50A 1O1MA 4WJGA 1J7SB 2H8FB 4F6BA 1ECAA 1J7WA 1YE0B 5JDOE 4MQIA 1V4UB 2JHOA 3ZJMA 2AV0A 3D7OB 3D17B 1N9IA 2SPOA 1O1PA 3GDJA 4FWXA 1CG8B 4ZVBA 1MOAA 4B4YA 3MJUB 1J7SA 3ECZA 1HGCA 2ZS1C 1BJEA 2MYDA 3GLNA 4MQIB 1NIHB 4X0LA 1MBIA 1Y2ZB 5ILRA 2H8DB 1XZ2A 4JYQA 3SZKA 1HBBB 1YFFB 1YHRA 1AJHA 1FN3A 3K3UA 1YDZB 3FH9A 3WI8A 2LH6A 3VRFB 1DXUB 1HLMA 3QM8A 1F63A 1LHTA 3UBCA 3UHZA 4F6DA 3OO5B 1NEJA 1J40B 1DLYA 1SDKB 2GTLA 5CHQA 4L7YB 4HRTA 1MLJA 3CIUA 3WFTA 5EU2A 1VWTB 2DN2A 3OZUA 1RSEA 1Y83B 3UGYA 5JDOD 1Y4GA 2QLSA 1KD2B 2HBEA 1BZRA 1THBA 2VYYA 2BNLA 5B84A 3EU1A 1OUTA 1CO8A 1HV4B 4M4BA 2V1EA 1Y4BA 3PI8B 1V75B 4N7NB 1LA6A 1G09B 2G0VA 3OO4A 5E6EA 1GCWA 2VEBA 1HRMA 4MQCB 1Y35A 3ZJIA 4VHBA 3UH3A 3GQPB 5M3SA 1CH3A 1Y01B 1WMUB 3E55A 2PGHA 1YH9A 1OBMA 3B75B 1A6KA 3WCPB 1LUEA 1G08A 1Y09B 1IDRA 2W6VB 1MOCA 1MLFA 3G52A 1EW6A 1GCWB 3HXNA 1BZ6A 5EQMA 2MYCA 1A6NA 3E4NA 2D2MA 1YHUB 4O35A 2HBCB 2GTLD 1Y4BB 3PI8A 1Y4QA 2OH9A 1YVTA 3G4RA 3E5OA 1X3KA 1JZLA 2W72C 2ZSOA 1DXTA 1EMYA 2HBGA 3ZJNA 1LH7A 1VXFA 1DLWA 1PMBA 3UHKA 1DWRA 1YZIA 3ZJOA 1YMCA 2ZSZA 3HENA 2AUQA 3PI3A 2FRKX 1ECOA 2Z6TA 1Y8KB 1SDLB 4JACA 2NX0A 4WCHD 3WCUA 2MHBA 3GOUB 4U8UC 5E6EB 4MQJA 1HGAA 3S66A 3BCQB 1Y5FA 2AURA 2DHBA 5CNEA 1YENA 2H35B 5KDQA 1GBUB 1Y5JA 3RGKA 3HYUA 1IRDA 1HDSB 1G0BB 3QJBB 1HGCB 1ASHA 1OFJA 3NMLA 2HBEB 3MJPB 1J3FA 2MGKA 4N8TB 2EVPA 3ODQA 3PT7B 2D5ZB 1R1YA 1CMYB 3OZWA 2D2ND 1HSYA 2W6VA 1F5OA 1IRCA 1BZPA 1A00B 3TLDA 1F65A 1CH9A 1HABB 2R4ZA 1S5XA 1V4WA 2MGEA 1F5PA 1Y8WA 2YRSB 1CP0A 4KJTA 3UHBA 2LHBA 3IC0B 3QJDA 2HCOB 1A6MA 1O1OB 1DO4A 2GRFA 2Z6NB 2LH5A 1XQ5A 2MB5A 3ARKA 1MLLA 5HLXA 2R80B 3ED9A 2VRYA 104MA 1LFZA 1CH5A 1ABWB 2ZFBB 1JEBA 3LR9A 1KD2A 1O1PB 3WCWD 1M9PB 1DKEA 1S5YB 4UZVA 1XY0A 5E29A 1EBCA 2BLHA 1Y7ZA 4PQBA 1AJGA 1BUWB 3S1JA 3MVCA 1MBNA 1BZ1B 5MBAA 2ZSYA 1J3YB 5D5RA 2HHEB 1MOHA 1XXTA 2XKHA 3LB3A 1COHA 3AQ7A 2ZSTA 3OK5A 1LFQA 1YHUD 1V5HA 1HCOA 1RQ3B 1YE2A 2D60A 1A01B 3DUTA 2ZSNA 1DXDA 1GDIA 3UHDA 1C7BA 4NS2A 1A3OB 4X0LB 1S6AA 1CMYA 2MYEA 1S5XB 1ABYB 5HLUA 1HBRB 2FRFA 2MGCA 1A00A 3K8BB 4N8TA 4KN3A 3NMMA 1SPEA 4H07A 1HJTA 1LFTA 1YEQA 2FAMA 1R1YB 5C6EB 3D7OA 1Y0CB 2ZLTB 2ZFOB 3DHTB 1MBCA 1VHBA 1LJWB 1BZZA 3D1AA 1HDAA 5KDQB 1MBSA 4HSXA 3ASEA 1MOBA 3MYNA 4KMVA 1MYTA 3RJNB 2ZS1D 3ARLA 3VRGA 1MGNA 3GOUA 4IROB 1CQ2A 2AA1B 2H35A 2HCOA 2LH1A 1SI4B 1AJ9B 2E2YA 1YIEB 1MLUA 2WTGA 1Y22A 1JP9A 4N7PB 2R1HB 3GYSB 1CH4A 1RPSA 2XYKA 1NS9A 1RQ4B 5EOHA 106MA 4AVEA 4UURA 4FH6A 3BOMA 3PI9B 2DXMB 2ZSPA 5CN7A 4C44A 3ODQB 1Y7GB 3EOKB 3WCWA 3WHMA 3ZJHA 1YEOB 4N7OA 1X46A 2HBCA 4FC3A 2ZS0A 1J3ZA 5ILEA 5JDOC 2R4YA 3G4QA 3TM3A 4XS0A 3UHQA 3OVUC 5SW7A 4HBIA 2HHBB 1JF4A 1MYZA 1BZ0A 1OUUB 1I3DA 3ONZB 3BOMB 2QU0A 1YIHB 2GKNA 1PBXB 1G0AA 4MQHB 1Y8KA 3WCWB 1G08B 2GLNA 5D1VA 2MGBA 2O58X 1HBSA 1Y7GA 4MQCA 2W6XA 1QI8B 2AV3A 4DC8A 3MKBA 1RQ4A 5KKKA 1SI4A 4SDHA 3UGZA 2AA1A 5HU6B 2FRJX 1TESA 2RI4B 1J3ZB 3AQ8A 1DXTB 1MBDA 4N7NA 2NRMA 3U3EA 1Y8HB 1YEOA 2LH3A 1X9FC 3H57A 1HBGA 3EU1B 5CN4A 5CNCA 4ROLB 2DN3B 1Y4GB 1NWNA 4IROA 1SDKA 1JWNA 2ZSQA 1SPGA 4MQKB 1GZXB 5JOMA 108MA 4DC7A 3MN0A 3WFXA 1GJNA 3QQQA 4F68A 3WCPA 2G14A 3RJ6A 3HF4A 3SDNA 4OF9A 2GRZA 5JDOF 2ZSSA 1FN3B 2ZLTA 1YH9B 1YFFA 1YHRB 1URVA 1MYIA 1Y85B 3FH9B 4G1BA 2EB9A 1YHUC 2ZT4A 1VXHA 2V1KA 1K1KB 1YOIA 4OODA 2HZ2A 2QMBA 2VM0A 4B3WA 3NL7A 3ZJJA 3IC2B 2ZT1A 1W92A 1HDBB 1B86B 3GQGA 2G0XA 1NS6A 1DUOA 3WCVD 3A2GA 2O5MX 2R4WA 1Y0AB 1MNOA 1NIHA 1CPWA 2QLSB 1HHOB 1Y0CA 3UHCA 1V9QA 1LFQB 1JW8A 1YOGA 1CQXA 3QJEB 2H8FA 3WFUA 1MNHA 1BABB 4NK2A 1J7YB 4MAXA 1A0UB 2EF2A 3EDAA 3BJ3A 1ABYA 1WVPA 1MYHA 1MODA 1BABA 3WFWA 1Y4FA 1DXVA 2O5BX 2R80A 2V1HA 3WCVB 1YGDA 1QSHA 4HHBB 2SPMA 2NSSA 2QFNA 3ZJSA 1L2KA 4MQGA 1HBBA 3ZHWA 1Y0AA 3QM7A 2BWHA 2MGFA 2IG3A 1GDJA 1MLMA 1ABWA 1XZ7B 1LFZB 3ORDA 1B86A 2V1IA 1UFJA 2MGJA 4DWUA 1GLIA 2QMBB 1BZ1A 2RAOA 2D5XB 1GBVA 1YG5B 3MJUA 4MBAA 2FRIX 3IXFA 3WCVA 3SDHA 1JP6A 2R4XA 5CNFA 4TWVA 1MYJA 1XY0B 1UMOA 1Y85A 1S5YA 3PT7A 3S48C 1NZ2A 3UHUA 3WCWC 1HHOA 1J7YA 1T1NA 3PELA 1QPWA 2HBFB 3PIAB 4ROMA 1NS6B 1MBOA 5EE4C 3QJCB 3QJBA 3CY5A 3KUOA 3NL7B 2Z6NA 3M3BA 1MKOA 3VHBA 1FDHA 2D6CA 3IC0A 1YENB 1XZ5A 3M39A 3G4VA 1RVWB 4DWTA 2MBWA 2BK9A 1JP8A 3IC2A 1X9FB 1V07A 1G0BA 2OH8A 5CNGA 3HYUB 2O5LX 1O1JB 1A0ZB 3FS4B 1Y31A 3HRWB 4YU4B 3LB1A 3D4XB 1Y5FB 2QSPA 4WJG1 2NSRA 2VHBA 4TWUA 4MQKA 3K9ZA 1C40B 1JDOA 3OJ1A 3UHGA 103MA 3HF4B 2GRHA 1EWAA 1QXEB 7HBIA 1G9VA 1R1XA 1G0AB 2O5OX 4PQ6A 2ZS0C 3A5AA 3GQRA 1X9FD 3AQ6A 4YU3B 1QSIB 2GDMA 1HGBB 1BZ0B 1OUUA 1RQAB 3P5QA 4H2LA 3HHBA 2BLJM 1IOPA 4NZIA 2D2NB 1HGAB 3S66B 1Y4RA 4G51A 5JGGA 1O1LB 3GQRB 1HBAB 2ZLUB 1SDLA 1QXEA 5HBIA 3D1KB 1IT2A 1N9FA 3B75A 3QM6A 1JZMA 3KMFA 2ZT3A 1DTMA 1Y45B 3DHRB 1QI8A 2ZLVB 1NZ5A 1NAZA 1UIWB 3ZOMA 3BJ1A 3GQPA 2O5TX 1BIJB 5HY8A 3A59B 3OO4B 5CMVA 5CNBA 1MZ0A 1HBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 102M A;  1Z8U B;  4NXC A;  1Y0W B;  5CN8 A;  3LQD A;  3WCV C;  3R5I A;  1HV4 A;  2D2N A;  3EOK A;  3HHB B;  1CG5 B;  4BJA A;  1UX9 A;  2FAL A;  3AQ9 A;  3AQ5 A;  5AZR A;  2HHB A;  3QM5 A;  1RQA A;  1O1L A;  4MPM A;  1MKO B;  1I3E A;  1Y83 A;  3A0G A;  1FHJ A;  1XYE A;  4F6I A;  1DTI A;  5CN5 A;  1O1I A;  4MXL A;  1FDH G;  4N7O B;  1SWM A;  1ECN A;  2W72 A;  1OUT B;  1FAW A;  5E83 A;  2ZWJ A;  4G1V A;  1OFK A;  1N9X A;  2VYW A;  2ZS1 A;  3V2V A;  3PI9 A;  1G9V B;  1R1X B;  1OR4 A;  1A6G A;  3WCT C;  3BA2 A;  1LFY B;  1LH1 A;  3HRW A;  4YU4 A;  3NMM B;  2D5X A;  2RAO B;  1Y8I A;  1A3O A;  1Y22 B;  4MBN A;  2QSS B;  1C7D A;  1FSX A;  1J41 B;  1IBE A;  1YMA A;  2ZFO A;  2G3H A;  3GKV B;  1SHR B;  105M A;  1BBB B;  1MWC A;  1FCS A;  1RVW A;  2DN1 B;  3SZK B;  1OR6 A;  1MNK A;  1CG8 A;  4HRT B;  4GZG A;  1DXV B;  1YOH A;  1NEJ B;  1BZZ B;  1LJW A;  4F4O A;  1XXT B;  3OO5 A;  3UH7 A;  2HHE A;  1DO3 A;  2ZT2 A;  3VRF A;  5EE4 D;  1Y4V A;  1NZ3 A;  1GDL A;  1LH5 A;  3NG6 A;  1O1N A;  1HAC A;  1GBV B;  1YG5 A;  4ODC B;  4H0B A;  1YVQ B;  1SHR A;  1HBR A;  1TU9 A;  1J41 A;  1Y0D B;  1ECD A;  1JEB B;  3A5B A;  1MDN A;  4F69 A;  2ZSR A;  3GQG B;  2MGM A;  3DUT B;  3ARJ A;  3LHB A;  1FSL A;  2C0K A;  1Y0T B;  2ZSX A;  3GKT A;  1VXD A;  3AG0 A;  2HZ1 A;  2Z85 A;  1QSH B;  4HHB A;  1Y0D A;  4MXK A;  1IWH B;  1YEU B;  2VLX A;  3AT5 B;  3W4U B;  1XCH A;  1KR7 A;  1LTW A;  1YVQ A;  3V2Z A;  3WCU C;  3UH5 A;  5E83 B;  3PI2 A;  1J7W B;  2ZFB A;  1Y4F B;  3BJ2 B;  1O1M B;  3VAU A;  3H58 A;  1MWB A;  3G46 A;  2MYB A;  3G53 A;  4F6J A;  1XZU A;  4F4O B;  3GKV A;  3QMA A;  2KSC A;  1C7C A;  1CG5 A;  2HBD B;  111M A;  2YRS A;  1GCV A;  5EUI A;  3LQD B;  107M A;  1S61 A;  1Y0W A;  4IT8 A;  3ZJL A;  1URY A;  4MU5 A;  1A9W A;  1V4W B;  3ECL A;  1YCA A;  1BIJ A;  5HY8 B;  2PEG B;  2G0R A;  2DHB B;  3NFE A;  3E5I A;  4MQJ B;  2MYA A;  3G4Y A;  1Y7D A;  2HZ3 A;  4M4A A;  2BW9 M;  3S65 A;  4NI0 A;  1MWD A;  1O1N B;  3GK9 A;  3LB2 A;  1MLG A;  3NG6 B;  2XKG A;  1FAW B;  5C6Y A;  3S1I A;  1DWS A;  1Y4V B;  1CBM A;  1CH7 A;  2W72 B;  1JL6 A;  1YIH A;  1HDS A;  1FHJ B;  1Y4R B;  4G51 B;  5JGG B;  2ZFO D;  1Y5J B;  1V4X B;  1VXE A;  1K0Y A;  4O4T A;  4O4Z A;  2G11 A;  110M A;  1XZV A;  4HRR B;  1BBB A;  4YU3 A;  3ZJR A;  3ECX A;  1S0H A;  1FSX B;  1C7D B;  5EV5 A;  1JF3 A;  5HU6 A;  3R5I B;  6HBW B;  1JZK A;  3ZOL A;  1QXD A;  1S56 A;  3UHW A;  5CHR A;  3O89 A;  1LFL B;  2ZLX B;  1NS9 B;  1MYM A;  4U8U A;  1CH1 A;  1Y31 B;  2EKT A;  4PNJ A;  3UHE A;  3LB4 A;  3MKB B;  2M6Z A;  2ZS1 B;  1MLR A;  2SPL A;  2V1F A;  3MOU A;  1BVD A;  101M A;  1XZV B;  3QQR A;  1VXG A;  1Y35 B;  2ZLU A;  3OZV A;  1YHU A;  3VRG B;  1LH2 A;  2ZS0 D;  3A0G B;  3ONZ A;  1U7S A;  2OLP A;  4FC3 B;  4O1T A;  2AUO A;  3P5Q B;  4XS0 B;  1HDA B;  1Y09 A;  1UC3 A;  1T1N B;  1THB B;  1YHE A;  1FLP A;  1Y4Q B;  2D2M D;  4NK1 A;  4XDI A;  1A3N A;  3LR7 A;  3UBV A;  4M4A B;  1JL7 A;  5ILM A;  3A59 A;  4ZVA A;  5KER B;  4U8U B;  1Y46 B;  1MTI A;  3S65 B;  1LFL A;  1RPS B;  5HLQ A;  3HC9 A;  1LHS A;  1GLI B;  4QAU A;  1Y45 A;  2PGH B;  1QXD B;  1WMU A;  1V75 A;  1DXU A;  3G4W A;  4M4B B;  1GCV B;  3KUN A;  1YIE A;  2W6W A;  1O1J A;  3OGB A;  1XZ5 B;  1A01 A;  2VLY A;  5MBN A;  3ZJQ A;  1VXB A;  1HLB A;  1JY7 B;  3UHY A;  1C7C B;  2V1J A;  3BJ2 A;  1CIO A;  1UVY A;  3WCU D;  1A4F A;  3BJ3 B;  1Y5K B;  3MYM A;  2DN2 B;  1D8U A;  5C6E A;  1CLS B;  3D1A B;  1YDZ A;  1YEU A;  1QPW B;  3AT5 A;  3W4U A;  1DUK A;  3CIU B;  2OIF A;  3GDJ B;  4L7Y A;  3DHT A;  1Y7C A;  4NI0 B;  1Y7D B;  1RTX A;  2W31 A;  2G0Z A;  1M9P A;  2CMM A;  3NFE B;  3UHR A;  5AB8 A;  3WCT A;  1HBH A;  1VRF A;  3WCT D;  3K8B A;  1U7R A;  5EET A;  1HDB A;  1XZ7 A;  109M A;  1MNJ A;  2D60 B;  1XQ5 B;  2MGH A;  3UHI A;  5F0B A;  1VXC A;  1B0B A;  4TYX A;  1ABS A;  3QJD B;  1HBH B;  1VRE A;  1XZ2 B;  2HBD A;  2O5Q X;  2WTH A;  1LFV B;  1COH B;  2LH7 A;  2GL3 A;  1YEV A;  1RQ3 A;  4ILZ A;  1Y2Z A;  3WR1 A;  1J52 A;  1CBL A;  1XZU B;  1MLS A;  1GVH A;  4ODC A;  1HAB A;  2O5S X;  5ILP A;  1CH2 A;  1A0U A;  4O2G A;  4UIQ A;  3QJC A;  1S69 A;  1Y5K A;  3WCT B;  4LPI A;  1NZ4 A;  3M38 A;  3PI4 A;  3UHV A;  2ZFO C;  5E29 B;  2D5Z A;  1MYF A;  5CND A;  3WR1 B;  1GDK A;  1DKE B;  4PQC A;  1MTK A;  1BUW A;  1IBE B;  3IA3 B;  4ESA A;  1LFV A;  1MYG A;  1JY7 A;  1YE0 A;  3R0G A;  1NWI A;  4ROL A;  2LH2 A;  1Y7Z B;  3A9M A;  1CLS A;  1M6M A;  1BIN A;  1CP5 A;  1A4F B;  1MLH A;  1RTE A;  2GNV A;  2QRW A;  1GBU A;  1NXF A;  2QSS A;  1K1K A;  1NPF A;  1YGF A;  2BMM A;  1LFY A;  3M3A A;  1DO7 A;  1Y8W B;  3BCQ A;  1NQP B;  3PT8 B;  1O1O A;  1HAC B;  1Y7C B;  2G10 A;  3HEP A;  2BLI A;  1YGD B;  1MNI A;  2ZLW B;  2G12 A;  3PI1 A;  1ITH A;  1YZI B;  1MTJ A;  1WLA A;  1AZI A;  1Q1F A;  2G0S A;  1A3N B;  4C0N A;  1GZX A;  2WY4 A;  2B7H B;  4FH7 A;  2MGG A;  1Y46 A;  3WTG B;  3MJP A;  5KER A;  5SW7 B;  3QJE A;  2GKM A;  2MGD A;  3UH6 A;  5B85 A;  1DM1 A;  1Y4P A;  2DN1 A;  1XYE B;  1SPG B;  2SPN A;  3MBA A;  1CIK A;  1Y8H A;  1A9W E;  1DO1 A;  1IRD B;  2RI4 A;  2D2M C;  1MLQ A;  3DR9 A;  2HBS A;  2MGA A;  4NI1 B;  2D2M B;  3UHT A;  1Y8I B;  2DC3 A;  2ZLV A;  3DHR A;  2Z6S A;  2M6Z B;  2EB8 A;  3WCU B;  2HHD A;  3BJ1 B;  2BKM A;  1UIW A;  2IN4 A;  4U8U D;  2VLZ A;  3ZJP A;  1PBX A;  4AVD A;  2EKU A;  2MHB B;  2R1H A;  1UT0 A;  3GYS A;  2ZT0 A;  1YHE B;  1O1K A;  3AT6 A;  2V1G A;  4MQH A;  1S0H B;  2HHD B;  5HAV A;  2ZLX A;  1O1I B;  1QSI A;  4FWZ A;  3VRE A;  6HBI A;  5CN6 A;  4NI1 A;  4H2L B;  1K0Y B;  2HBS B;  3QZZ A;  1YCB A;  2DN3 A;  6HBW A;  3AT6 B;  3WHM B;  4HSW A;  2W6Y A;  2ZS0 B;  1LH3 A;  2D2N C;  2DXM A;  3ZH0 A;  4L2M A;  3VRE B;  1MLO A;  1YVT B;  1CO9 A;  1VXA A;  112M A;  5EYS A;  2OHA A;  1MLN A;  3WTG A;  3O7N A;  1NGK A;  1J40 A;  1A0Z A;  2B7H A;  1C40 A;  1O1K B;  3HXN B;  2QFK A;  2QSP B;  3HEO A;  1LH6 A;  1HBS B;  1EBT A;  1C7B B;  3FS4 A;  2EVK A;  3D1K A;  3KMF C;  1H97 A;  4FWY A;  1AJ9 A;  3A5G A;  2XKI A;  5F2A A;  1YE2 B;  1X9F A;  2AUP A;  1MCY A;  2QU0 B;  1HCO B;  4N7P A;  1M6C A;  4HRR A;  1LA6 B;  2MGL A;  1Y4P B;  2GTL C;  2H8D A;  1O16 A;  1V4X A;  1HGB A;  2HBF A;  5EYJ A;  5IKS A;  1G09 A;  3CY5 B;  1OJ6 A;  1IT3 A;  3EDB A;  5EUI B;  3PIA A;  4ROM B;  3PEL B;  3UHN A;  1KFR A;  4ESA B;  3D17 A;  3UI0 A;  2GTL B;  2VYZ A;  1UX8 A;  2NRL A;  1VWT A;  1V4U A;  1BVC A;  3D4X A;  1H1X A;  1UVX A;  1LFT B;  1YEQ B;  2GNW A;  1HBI A;  1YGF B;  2ZLW A;  3G4U A;  1MBA A;  1NPG A;  2PEG A;  3UHH A;  2OHB A;  2Z8A A;  1XZ4 A;  1MLK A;  3UHX A;  2VEE A;  3PT8 A;  4NXA A;  1NQP A;  1YEV B;  5CN9 A;  1N9H A;  1IWH A;  1DWT A;  1JPB A;  5AZQ A;  2MGI A;  3UHS A;  4KMW A;  1DXC A;  4MQG B;  4F6G A;  4F6F A;  1Y0T A;  1YMB A;  3QM9 A;  1XZ4 B;  3QZX A;  1J3Y A;  3TM9 A;  1UFP A;  2R50 A;  1O1M A;  4WJG A;  1J7S B;  2H8F B;  4F6B A;  1ECA A;  1J7W A;  1YE0 B;  5JDO E;  4MQI A;  1V4U B;  2JHO A;  3ZJM A;  2AV0 A;  3D7O B;  3D17 B;  1N9I A;  2SPO A;  1O1P A;  3GDJ A;  4FWX A;  1CG8 B;  4ZVB A;  1MOA A;  4B4Y A;  3MJU B;  1J7S A;  3ECZ A;  1HGC A;  2ZS1 C;  1BJE A;  2MYD A;  3GLN A;  4MQI B;  1NIH B;  4X0L A;  1MBI A;  1Y2Z B;  5ILR A;  2H8D B;  1XZ2 A;  4JYQ A;  3SZK A;  1HBB B;  1YFF B;  1YHR A;  1AJH A;  1FN3 A;  3K3U A;  1YDZ B;  3FH9 A;  3WI8 A;  2LH6 A;  3VRF B;  1DXU B;  1HLM A;  3QM8 A;  1F63 A;  1LHT A;  3UBC A;  3UHZ A;  4F6D A;  3OO5 B;  1NEJ A;  1J40 B;  1DLY A;  1SDK B;  2GTL A;  5CHQ A;  4L7Y B;  4HRT A;  1MLJ A;  3CIU A;  3WFT A;  5EU2 A;  1VWT B;  2DN2 A;  3OZU A;  1RSE A;  1Y83 B;  3UGY A;  5JDO D;  1Y4G A;  2QLS A;  1KD2 B;  2HBE A;  1BZR A;  1THB A;  2VYY A;  2BNL A;  5B84 A;  3EU1 A;  1OUT A;  1CO8 A;  1HV4 B;  4M4B A;  2V1E A;  1Y4B A;  3PI8 B;  1V75 B;  4N7N B;  1LA6 A;  1G09 B;  2G0V A;  3OO4 A;  5E6E A;  1GCW A;  2VEB A;  1HRM A;  4MQC B;  1Y35 A;  3ZJI A;  4VHB A;  3UH3 A;  3GQP B;  5M3S A;  1CH3 A;  1Y01 B;  1WMU B;  3E55 A;  2PGH A;  1YH9 A;  1OBM A;  3B75 B;  1A6K A;  3WCP B;  1LUE A;  1G08 A;  1Y09 B;  1IDR A;  2W6V B;  1MOC A;  1MLF A;  3G52 A;  1EW6 A;  1GCW B;  3HXN A;  1BZ6 A;  5EQM A;  2MYC A;  1A6N A;  3E4N A;  2D2M A;  1YHU B;  4O35 A;  2HBC B;  2GTL D;  1Y4B B;  3PI8 A;  1Y4Q A;  2OH9 A;  1YVT A;  3G4R A;  3E5O A;  1X3K A;  1JZL A;  2W72 C;  2ZSO A;  1DXT A;  1EMY A;  2HBG A;  3ZJN A;  1LH7 A;  1VXF A;  1DLW A;  1PMB A;  3UHK A;  1DWR A;  1YZI A;  3ZJO A;  1YMC A;  2ZSZ A;  3HEN A;  2AUQ A;  3PI3 A;  2FRK X;  1ECO A;  2Z6T A;  1Y8K B;  1SDL B;  4JAC A;  2NX0 A;  4WCH D;  3WCU A;  2MHB A;  3GOU B;  4U8U C;  5E6E B;  4MQJ A;  1HGA A;  3S66 A;  3BCQ B;  1Y5F A;  2AUR A;  2DHB A;  5CNE A;  1YEN A;  2H35 B;  5KDQ A;  1GBU B;  1Y5J A;  3RGK A;  3HYU A;  1IRD A;  1HDS B;  1G0B B;  3QJB B;  1HGC B;  1ASH A;  1OFJ A;  3NML A;  2HBE B;  3MJP B;  1J3F A;  2MGK A;  4N8T B;  2EVP A;  3ODQ A;  3PT7 B;  2D5Z B;  1R1Y A;  1CMY B;  3OZW A;  2D2N D;  1HSY A;  2W6V A;  1F5O A;  1IRC A;  1BZP A;  1A00 B;  3TLD A;  1F65 A;  1CH9 A;  1HAB B;  2R4Z A;  1S5X A;  1V4W A;  2MGE A;  1F5P A;  1Y8W A;  2YRS B;  1CP0 A;  4KJT A;  3UHB A;  2LHB A;  3IC0 B;  3QJD A;  2HCO B;  1A6M A;  1O1O B;  1DO4 A;  2GRF A;  2Z6N B;  2LH5 A;  1XQ5 A;  2MB5 A;  3ARK A;  1MLL A;  5HLX A;  2R80 B;  3ED9 A;  2VRY A;  104M A;  1LFZ A;  1CH5 A;  1ABW B;  2ZFB B;  1JEB A;  3LR9 A;  1KD2 A;  1O1P B;  3WCW D;  1M9P B;  1DKE A;  1S5Y B;  4UZV A;  1XY0 A;  5E29 A;  1EBC A;  2BLH A;  1Y7Z A;  4PQB A;  1AJG A;  1BUW B;  3S1J A;  3MVC A;  1MBN A;  1BZ1 B;  5MBA A;  2ZSY A;  1J3Y B;  5D5R A;  2HHE B;  1MOH A;  1XXT A;  2XKH A;  3LB3 A;  1COH A;  3AQ7 A;  2ZST A;  3OK5 A;  1LFQ A;  1YHU D;  1V5H A;  1HCO A;  1RQ3 B;  1YE2 A;  2D60 A;  1A01 B;  3DUT A;  2ZSN A;  1DXD A;  1GDI A;  3UHD A;  1C7B A;  4NS2 A;  1A3O B;  4X0L B;  1S6A A;  1CMY A;  2MYE A;  1S5X B;  1ABY B;  5HLU A;  1HBR B;  2FRF A;  2MGC A;  1A00 A;  3K8B B;  4N8T A;  4KN3 A;  3NMM A;  1SPE A;  4H07 A;  1HJT A;  1LFT A;  1YEQ A;  2FAM A;  1R1Y B;  5C6E B;  3D7O A;  1Y0C B;  2ZLT B;  2ZFO B;  3DHT B;  1MBC A;  1VHB A;  1LJW B;  1BZZ A;  3D1A A;  1HDA A;  5KDQ B;  1MBS A;  4HSX A;  3ASE A;  1MOB A;  3MYN A;  4KMV A;  1MYT A;  3RJN B;  2ZS1 D;  3ARL A;  3VRG A;  1MGN A;  3GOU A;  4IRO B;  1CQ2 A;  2AA1 B;  2H35 A;  2HCO A;  2LH1 A;  1SI4 B;  1AJ9 B;  2E2Y A;  1YIE B;  1MLU A;  2WTG A;  1Y22 A;  1JP9 A;  4N7P B;  2R1H B;  3GYS B;  1CH4 A;  1RPS A;  2XYK A;  1NS9 A;  1RQ4 B;  5EOH A;  106M A;  4AVE A;  4UUR A;  4FH6 A;  3BOM A;  3PI9 B;  2DXM B;  2ZSP A;  5CN7 A;  4C44 A;  3ODQ B;  1Y7G B;  3EOK B;  3WCW A;  3WHM A;  3ZJH A;  1YEO B;  4N7O A;  1X46 A;  2HBC A;  4FC3 A;  2ZS0 A;  1J3Z A;  5ILE A;  5JDO C;  2R4Y A;  3G4Q A;  3TM3 A;  4XS0 A;  3UHQ A;  3OVU C;  5SW7 A;  4HBI A;  2HHB B;  1JF4 A;  1MYZ A;  1BZ0 A;  1OUU B;  1I3D A;  3ONZ B;  3BOM B;  2QU0 A;  1YIH B;  2GKN A;  1PBX B;  1G0A A;  4MQH B;  1Y8K A;  3WCW B;  1G08 B;  2GLN A;  5D1V A;  2MGB A;  2O58 X;  1HBS A;  1Y7G A;  4MQC A;  2W6X A;  1QI8 B;  2AV3 A;  4DC8 A;  3MKB A;  1RQ4 A;  5KKK A;  1SI4 A;  4SDH A;  3UGZ A;  2AA1 A;  5HU6 B;  2FRJ X;  1TES A;  2RI4 B;  1J3Z B;  3AQ8 A;  1DXT B;  1MBD A;  4N7N A;  2NRM A;  3U3E A;  1Y8H B;  1YEO A;  2LH3 A;  1X9F C;  3H57 A;  1HBG A;  3EU1 B;  5CN4 A;  5CNC A;  4ROL B;  2DN3 B;  1Y4G B;  1NWN A;  4IRO A;  1SDK A;  1JWN A;  2ZSQ A;  1SPG A;  4MQK B;  1GZX B;  5JOM A;  108M A;  4DC7 A;  3MN0 A;  3WFX A;  1GJN A;  3QQQ A;  4F68 A;  3WCP A;  2G14 A;  3RJ6 A;  3HF4 A;  3SDN A;  4OF9 A;  2GRZ A;  5JDO F;  2ZSS A;  1FN3 B;  2ZLT A;  1YH9 B;  1YFF A;  1YHR B;  1URV A;  1MYI A;  1Y85 B;  3FH9 B;  4G1B A;  2EB9 A;  1YHU C;  2ZT4 A;  1VXH A;  2V1K A;  1K1K B;  1YOI A;  4OOD A;  2HZ2 A;  2QMB A;  2VM0 A;  4B3W A;  3NL7 A;  3ZJJ A;  3IC2 B;  2ZT1 A;  1W92 A;  1HDB B;  1B86 B;  3GQG A;  2G0X A;  1NS6 A;  1DUO A;  3WCV D;  3A2G A;  2O5M X;  2R4W A;  1Y0A B;  1MNO A;  1NIH A;  1CPW A;  2QLS B;  1HHO B;  1Y0C A;  3UHC A;  1V9Q A;  1LFQ B;  1JW8 A;  1YOG A;  1CQX A;  3QJE B;  2H8F A;  3WFU A;  1MNH A;  1BAB B;  4NK2 A;  1J7Y B;  4MAX A;  1A0U B;  2EF2 A;  3EDA A;  3BJ3 A;  1ABY A;  1WVP A;  1MYH A;  1MOD A;  1BAB A;  3WFW A;  1Y4F A;  1DXV A;  2O5B X;  2R80 A;  2V1H A;  3WCV B;  1YGD A;  1QSH A;  4HHB B;  2SPM A;  2NSS A;  2QFN A;  3ZJS A;  1L2K A;  4MQG A;  1HBB A;  3ZHW A;  1Y0A A;  3QM7 A;  2BWH A;  2MGF A;  2IG3 A;  1GDJ A;  1MLM A;  1ABW A;  1XZ7 B;  1LFZ B;  3ORD A;  1B86 A;  2V1I A;  1UFJ A;  2MGJ A;  4DWU A;  1GLI A;  2QMB B;  1BZ1 A;  2RAO A;  2D5X B;  1GBV A;  1YG5 B;  3MJU A;  4MBA A;  2FRI X;  3IXF A;  3WCV A;  3SDH A;  1JP6 A;  2R4X A;  5CNF A;  4TWV A;  1MYJ A;  1XY0 B;  1UMO A;  1Y85 A;  1S5Y A;  3PT7 A;  3S48 C;  1NZ2 A;  3UHU A;  3WCW C;  1HHO A;  1J7Y A;  1T1N A;  3PEL A;  1QPW A;  2HBF B;  3PIA B;  4ROM A;  1NS6 B;  1MBO A;  5EE4 C;  3QJC B;  3QJB A;  3CY5 A;  3KUO A;  3NL7 B;  2Z6N A;  3M3B A;  1MKO A;  3VHB A;  1FDH A;  2D6C A;  3IC0 A;  1YEN B;  1XZ5 A;  3M39 A;  3G4V A;  1RVW B;  4DWT A;  2MBW A;  2BK9 A;  1JP8 A;  3IC2 A;  1X9F B;  1V07 A;  1G0B A;  2OH8 A;  5CNG A;  3HYU B;  2O5L X;  1O1J B;  1A0Z B;  3FS4 B;  1Y31 A;  3HRW B;  4YU4 B;  3LB1 A;  3D4X B;  1Y5F B;  2QSP A;  4WJG 1;  2NSR A;  2VHB A;  4TWU A;  4MQK A;  3K9Z A;  1C40 B;  1JDO A;  3OJ1 A;  3UHG A;  103M A;  3HF4 B;  2GRH A;  1EWA A;  1QXE B;  7HBI A;  1G9V A;  1R1X A;  1G0A B;  2O5O X;  4PQ6 A;  2ZS0 C;  3A5A A;  3GQR A;  1X9F D;  3AQ6 A;  4YU3 B;  1QSI B;  2GDM A;  1HGB B;  1BZ0 B;  1OUU A;  1RQA B;  3P5Q A;  4H2L A;  3HHB A;  2BLJ M;  1IOP A;  4NZI A;  2D2N B;  1HGA B;  3S66 B;  1Y4R A;  4G51 A;  5JGG A;  1O1L B;  3GQR B;  1HBA B;  2ZLU B;  1SDL A;  1QXE A;  5HBI A;  3D1K B;  1IT2 A;  1N9F A;  3B75 A;  3QM6 A;  1JZM A;  3KMF A;  2ZT3 A;  1DTM A;  1Y45 B;  3DHR B;  1QI8 A;  2ZLV B;  1NZ5 A;  1NAZ A;  1UIW B;  3ZOM A;  3BJ1 A;  3GQP A;  2O5T X;  1BIJ B;  5HY8 A;  3A59 B;  3OO4 B;  5CMV A;  5CNB A;  1MZ0 A;  1HBA A; 
#chains in the Genus database with same CATH topology
 102M A;  1Z8U B;  4NXC A;  1Y0W B;  5CN8 A;  3LQD A;  3WCV C;  3R5I A;  1HV4 A;  2D2N A;  3EOK A;  3HHB B;  1CG5 B;  4BJA A;  1UX9 A;  2FAL A;  3AQ9 A;  3AQ5 A;  5AZR A;  2HHB A;  3QM5 A;  1ON7 B;  1RQA A;  1O1L A;  4MPM A;  1MKO B;  1I3E A;  1Y83 A;  3A0G A;  1FHJ A;  1XYE A;  4F6I A;  1DTI A;  5CN5 A;  1O1I A;  4MXL A;  1FDH G;  4N7O B;  1SWM A;  1ECN A;  2W72 A;  1OUT B;  1FAW A;  5E83 A;  2ZWJ A;  4G1V A;  3DBJ A;  1OFK A;  1N9X A;  1LIA A;  2VYW A;  2ZS1 A;  3V2V A;  3PI9 A;  1G9V B;  1R1X B;  1OR4 A;  1A6G A;  3WCT C;  3BA2 A;  1LFY B;  1LH1 A;  3HRW A;  4YU4 A;  3NMM B;  2D5X A;  2RAO B;  1Y8I A;  2C7K A;  1A3O A;  1HA7 B;  1Y22 B;  4MBN A;  2QSS B;  1C7D A;  1FSX A;  3VNC A;  1J41 B;  1IBE A;  1YMA A;  2ZFO A;  2G3H A;  3GKV B;  1SHR B;  105M A;  1BBB B;  1MWC A;  1FCS A;  1RVW A;  2DN1 B;  3SZK B;  1OR6 A;  1MNK A;  1CG8 A;  4HRT B;  4GZG A;  1DXV B;  1YOH A;  1NEJ B;  1BZZ B;  1LJW A;  4F4O A;  1XXT B;  3OO5 A;  3UH7 A;  2HHE A;  1DO3 A;  2ZT2 A;  2WCQ A;  3VRF A;  5EE4 D;  1Y4V A;  1NZ3 A;  1GDL A;  1LH5 A;  3NG6 A;  1O1N A;  1HAC A;  1GBV B;  1YG5 A;  4ODC B;  4H0B A;  1GH0 A;  1YVQ B;  1SHR A;  1HBR A;  1TU9 A;  1J41 A;  1Y0D B;  1ECD A;  1JEB B;  3A5B A;  1MDN A;  4F69 A;  2ZSR A;  3GQG B;  2MGM A;  3DUT B;  1HA7 A;  3ARJ A;  3LHB A;  1FSL A;  2VML A;  2C0K A;  1Y0T B;  2ZSX A;  4ZIZ B;  3GKT A;  1VXD A;  3AG0 A;  2HZ1 A;  4A8Q A;  2Z85 A;  1QSH B;  4HHB A;  1Y0D A;  4MXK A;  1IWH B;  1YEU B;  2VLX A;  3AT5 B;  3W4U B;  1XCH A;  1KR7 A;  1LTW A;  1GH0 B;  1YVQ A;  3V2Z A;  3WCU C;  3UH5 A;  2C7J B;  5E83 B;  3PI2 A;  1J7W B;  2ZFB A;  1Y4F B;  3BJ2 B;  1O1M B;  3VAU A;  3H58 A;  1MWB A;  3G46 A;  2MYB A;  3G53 A;  4F6J A;  1XZU A;  4F4O B;  2UUL D;  3GKV A;  3QMA A;  2KSC A;  4AE0 A;  1C7C A;  1CG5 A;  2HBD B;  111M A;  2YRS A;  1GCV A;  5EUI A;  1HI8 A;  3LQD B;  107M A;  1S61 A;  1Y0W A;  3V58 A;  4IT8 A;  3ZJL A;  1URY A;  4MU5 A;  1A9W A;  1V4W B;  3ECL A;  2VML B;  1YCA A;  1BIJ A;  5HY8 B;  2PEG B;  4LMS B;  2G0R A;  2DHB B;  4L1E A;  3NFE A;  3E5I A;  4MQJ B;  2MYA A;  3G4Y A;  1JBO A;  1Y7D A;  2HZ3 A;  4M4A A;  2BW9 M;  3S65 A;  4NI0 A;  1MWD A;  1O1N B;  3GK9 A;  3LB2 A;  1MLG A;  3NG6 B;  2XKG A;  1FAW B;  5C6Y A;  3S1I A;  1DWS A;  4XXK A;  1Y4V B;  1CBM A;  1CH7 A;  2W72 B;  1JL6 A;  1YIH A;  1HDS A;  1FHJ B;  1Y4R B;  2X49 A;  4G51 B;  5JGG B;  2ZFO D;  1Y5J B;  1V4X B;  1VXE A;  1UVI A;  1K0Y A;  4O4T A;  4O4Z A;  2G11 A;  110M A;  1XZV A;  4HRR B;  1BBB A;  4YU3 A;  1COL A;  3ZJR A;  3ECX A;  1S0H A;  1FSX B;  1C7D B;  5EV5 A;  1JF3 A;  5HU6 A;  3R5I B;  6HBW B;  1JZK A;  3ZOL A;  1QXD A;  1S56 A;  3UHW A;  5CHR A;  3O89 A;  1LFL B;  2ZLX B;  1NS9 B;  1HI1 A;  1MYM A;  4U8U A;  4A8S A;  1CH1 A;  1Y31 B;  2EKT A;  4PNJ A;  3UHE A;  3LB4 A;  3MKB B;  2M6Z A;  4ETV A;  3PMD A;  2ZS1 B;  3NUH B;  1MLR A;  2SPL A;  2V1F A;  3DBJ B;  3MOU A;  1BVD A;  101M A;  1KTP A;  1XZV B;  3QQR A;  1VXG A;  1Y35 B;  2C7L A;  5B13 A;  2ZLU A;  1XDT T;  3OZV A;  1YHU A;  3VRG B;  1LH2 A;  2ZS0 D;  3A0G B;  4Q70 B;  3ONZ A;  1U7S A;  2OLP A;  4FC3 B;  4O1T A;  2AUO A;  4BJU A;  3P5Q B;  4XS0 B;  1HDA B;  1Y09 A;  1UC3 A;  1T1N B;  1THB B;  1YHE A;  1FLP A;  1Y4Q B;  2D2M D;  4NK1 A;  4XDI A;  1A3N A;  3LR7 A;  3UBV A;  1I7Y B;  4M4A B;  1JL7 A;  5ILM A;  4A8F A;  3A59 A;  4ZVA A;  1KN1 A;  5KER B;  4U8U B;  1UVJ A;  1Y46 B;  1MTI A;  3S65 B;  1LFL A;  1RPS B;  5HLQ A;  3HC9 A;  1LHS A;  1GLI B;  4QAU A;  1Y45 A;  2PGH B;  1QXD B;  1WMU A;  1V75 A;  1DXU A;  3G4W A;  2UUM B;  4M4B B;  1GCV B;  5FVB A;  3KUN A;  1YIE A;  2W6W A;  1O1J A;  5AQD M;  3OGB A;  1XZ5 B;  1A01 A;  2VLY A;  5MBN A;  3ZJQ A;  1VXB A;  1B8D A;  1HLB A;  3MWN A;  1JY7 B;  3UHY A;  1C7C B;  2V1J A;  3BJ2 A;  1CIO A;  1UVY A;  3WCU D;  1A4F A;  3BJ3 B;  1Y5K B;  3MYM A;  2DN2 B;  1D8U A;  5C6E A;  1CLS B;  3D1A B;  1YDZ A;  1YEU A;  1QPW B;  3AT5 A;  3W4U A;  1DUK A;  3CIU B;  2OIF A;  3GDJ B;  4L7Y A;  3DHT A;  1Y7C A;  4NI0 B;  1JBO B;  1Y7D B;  1RTX A;  2DKA A;  2W31 A;  2G0Z A;  1M9P A;  2CMM A;  3NFE B;  1DDT A;  1HHT P;  3UHR A;  5AB8 A;  3WCT A;  1HBH A;  1VRF A;  3WCT D;  3K8B A;  1U7R A;  5EET A;  1HDB A;  4GY3 B;  1XZ7 A;  109M A;  1UVM A;  1MNJ A;  2D60 B;  1XQ5 B;  2MGH A;  3UHI A;  4GY3 A;  5F0B A;  1VXC A;  1B0B A;  4TYX A;  1ABS A;  3QJD B;  1HBH B;  1VRE A;  1XZ2 B;  2HBD A;  2O5Q X;  2WTH A;  1LFV B;  1COH B;  2LH7 A;  2GL3 A;  1YEV A;  1RQ3 A;  4ILZ A;  1Y2Z A;  3WR1 A;  1J52 A;  1F99 A;  1CBL A;  1XZU B;  1MLS A;  1GVH A;  4ODC A;  1HAB A;  2O5S X;  2UUL B;  5ILP A;  1CH2 A;  1A0U A;  4O2G A;  4UIQ A;  3QJC A;  1S69 A;  1Y5K A;  3WCT B;  4LPI A;  1NZ4 A;  3M38 A;  3PI4 A;  3UHV A;  2ZFO C;  5E29 B;  4H0M B;  2D5Z A;  1MYF A;  5CND A;  3WR1 B;  1GDK A;  1DKE B;  1B33 A;  4PQC A;  4A8W A;  1MTK A;  1BUW A;  1IBE B;  3IA3 B;  4ESA A;  1LFV A;  1MYG A;  1JY7 A;  1YE0 A;  3R0G A;  1NWI A;  4ROL A;  2LH2 A;  1Y7Z B;  3A9M A;  1CLS A;  1M6M A;  1A87 A;  1BIN A;  1CP5 A;  1A4F B;  1MLH A;  1RTE A;  2GNV A;  2QRW A;  1GBU A;  1NXF A;  2QSS A;  1K1K A;  1NPF A;  1YGF A;  2BMM A;  1LFY A;  2C7K B;  3M3A A;  1DO7 A;  1Y8W B;  3BCQ A;  1NQP B;  3PT8 B;  1O1O A;  1HAC B;  1Y7C B;  2G10 A;  3HEP A;  3BRP B;  2I88 A;  2BLI A;  1YGD B;  1MNI A;  2ZLW B;  2G12 A;  3PI1 A;  1ITH A;  1YZI B;  1MTJ A;  1WLA A;  1AZI A;  1Q1F A;  2G0S A;  1A3N B;  4C0N A;  1GZX A;  2WY4 A;  2B7H B;  4FH7 A;  2MGG A;  1Y46 A;  3WTG B;  1HHS A;  3MJP A;  5KER A;  5SW7 B;  3QJE A;  2GKM A;  2MGD A;  3UH6 A;  5B85 A;  1DM1 A;  1Y4P A;  2DN1 A;  1XYE B;  3O2C A;  1SPG B;  2SPN A;  3MBA A;  1CIK A;  1Y8H A;  1I7Y A;  1A9W E;  1DO1 A;  1IRD B;  2RI4 A;  2UUL C;  4N6S A;  2D2M C;  1MLQ A;  3DR9 A;  2HBS A;  2MGA A;  1EYX A;  4NI1 B;  2D2M B;  3UHT A;  1Y8I B;  2DC3 A;  2ZLV A;  3DHR A;  2Z6S A;  2M6Z B;  2EB8 A;  3WCU B;  2HHD A;  3BJ1 B;  1TOX A;  2BKM A;  1UIW A;  2IN4 A;  4U8U D;  2VLZ A;  3ZJP A;  1PBX A;  4AVD A;  2EKU A;  2MHB B;  5B13 G;  2R1H A;  1UT0 A;  3GYS A;  2ZT0 A;  1YHE B;  1O1K A;  3KVS A;  3AT6 A;  2V1G A;  4MQH A;  1S0H B;  2HHD B;  5HAV A;  2ZLX A;  1O1I B;  1QSI A;  4FWZ A;  3VRE A;  6HBI A;  4Q70 A;  5CN6 A;  4NI1 A;  4H2L B;  1ALL B;  1K0Y B;  2HBS B;  3QZZ A;  1YCB A;  2DN3 A;  6HBW A;  3AT6 B;  3WHM B;  4HSW A;  2W6Y A;  2ZS0 B;  1LH3 A;  1SGK A;  2D2N C;  2DXM A;  3ZH0 A;  4L2M A;  2YSK A;  3VRE B;  1MLO A;  1YVT B;  1CO9 A;  1VXA A;  112M A;  5EYS A;  2OHA A;  1MLN A;  3WTG A;  3O7N A;  1NGK A;  1J40 A;  1A0Z A;  2B7H A;  1CII A;  1C40 A;  1O1K B;  3HXN B;  2QFK A;  2QSP B;  3HEO A;  1LH6 A;  1HBS B;  2V8A A;  1EBT A;  1C7B B;  3FS4 A;  2EVK A;  3D1K A;  3KMF C;  3O18 B;  1H97 A;  4FWY A;  1AJ9 A;  3A5G A;  2XKI A;  5F2A A;  1YE2 B;  1X9F A;  2AUP A;  1MCY A;  2QU0 B;  1HCO B;  4N7P A;  1M6C A;  4HRR A;  3O2C B;  1LA6 B;  2DKC A;  2MGL A;  1Y4P B;  4YJJ B;  4Z8K B;  2GTL C;  2H8D A;  1O16 A;  1V4X A;  1HGB A;  2HBF A;  5EYJ A;  5IKS A;  1G09 A;  3CY5 B;  1OJ6 A;  1IT3 A;  3EDB A;  5EUI B;  3PIA A;  4ROM B;  2JL9 A;  3PEL B;  3UHN A;  1KFR A;  4ESA B;  4A8Y A;  3D17 A;  3UI0 A;  1QGW C;  2GTL B;  2VYZ A;  1UX8 A;  4XXI A;  2NRL A;  1VWT A;  1V4U A;  1BVC A;  3D4X A;  1H1X A;  1UVX A;  1LFT B;  1YEQ B;  2GNW A;  1HBI A;  1YGF B;  2ZLW A;  3G4U A;  1MBA A;  1NPG A;  2PEG A;  3UHH A;  3BRP A;  2OHB A;  2Z8A A;  1XZ4 A;  1MLK A;  3UHX A;  2VJT B;  2VEE A;  2UUM X;  3PT8 A;  4NXA A;  1NQP A;  1YEV B;  5CN9 A;  1N9H A;  1IWH A;  1DWT A;  1JPB A;  3L0F A;  4ETU A;  5AZQ A;  2MGI A;  3UHS A;  4KMW A;  1DXC A;  1B33 B;  4MQG B;  4F6G A;  4F6F A;  4BS9 A;  1Y0T A;  1YMB A;  3QM9 A;  1XZ4 B;  3QZX A;  1J3Y A;  3TM9 A;  1UFP A;  2R50 A;  1O1M A;  4WJG A;  1J7S B;  2H8F B;  4F6B A;  1ECA A;  1J7W A;  1YE0 B;  5JDO E;  4MQI A;  1V4U B;  2JHO A;  2JLG A;  3ZJM A;  2AV0 A;  3D7O B;  3D17 B;  1N9I A;  2SPO A;  1O1P A;  3GDJ A;  4FWX A;  1CG8 B;  4ZVB A;  1MOA A;  4B4Y A;  3MJU B;  3RQR A;  1J7S A;  3ECZ A;  4TMA B;  1HGC A;  2ZS1 C;  1BJE A;  2MYD A;  2UUL A;  3GLN A;  4MQI B;  1NIH B;  1HI0 P;  4X0L A;  4PO5 B;  1F99 B;  1MBI A;  1Y2Z B;  5ILR A;  2H8D B;  1XF6 C;  1XZ2 A;  4JYQ A;  3SZK A;  1HBB B;  2UUN B;  1YFF B;  1YHR A;  1AJH A;  1FN3 A;  3K3U A;  1YDZ B;  3FH9 A;  3WI8 A;  2LH6 A;  3VRF B;  1DXU B;  1HLM A;  3QM8 A;  2VJT A;  1F63 A;  1LHT A;  3UBC A;  3UHZ A;  4F6D A;  3OO5 B;  1NEJ A;  1J40 B;  1DLY A;  1SDK B;  2GTL A;  5CHQ A;  1UVK A;  4L7Y B;  4HRT A;  1MLJ A;  3CIU A;  3WFT A;  5EU2 A;  1VWT B;  2DN2 A;  3OZU A;  1RSE A;  1Y83 B;  3UGY A;  2BV8 A;  5JDO D;  1Y4G A;  2QLS A;  1ON7 A;  1KD2 B;  2HBE A;  1BZR A;  1THB A;  2VYY A;  2BNL A;  5B84 A;  3EU1 A;  1OUT A;  1CO8 A;  1HV4 B;  2UUM A;  4M4B A;  2V1E A;  1Y4B A;  3PI8 B;  1V75 B;  4N7N B;  1LA6 A;  1G09 B;  2G0V A;  3OO4 A;  5E6E A;  1GCW A;  2VEB A;  1HRM A;  4MQC B;  4YJJ A;  1Y35 A;  3ZJI A;  4VHB A;  3UH3 A;  3GQP B;  5M3S A;  4RMP B;  1CH3 A;  1Y01 B;  1WMU B;  3E55 A;  2PGH A;  1YH9 A;  1OBM A;  3B75 B;  1A6K A;  3WCP B;  1LUE A;  1G08 A;  1Y09 B;  1IDR A;  2W6V B;  1MOC A;  1MLF A;  3G52 A;  1EW6 A;  1GCW B;  3HXN A;  1BZ6 A;  5EQM A;  2MYC A;  1A6N A;  3E4N A;  4F0T B;  2D2M A;  1YHU B;  4O35 A;  2HBC B;  2GTL D;  1Y4B B;  3PI8 A;  1Y4Q A;  2OH9 A;  1YVT A;  3G4R A;  3E5O A;  1X3K A;  1JZL A;  2W72 C;  2ZSO A;  1DXT A;  2VJH B;  1EMY A;  2HBG A;  3ZJN A;  1LH7 A;  1VXF A;  1DLW A;  1PMB A;  3UHK A;  1DWR A;  1YZI A;  3ZJO A;  1YMC A;  2ZSZ A;  3HEN A;  2AUQ A;  3PI3 A;  3KVS B;  2FRK X;  1ECO A;  2Z6T A;  1PHN B;  1Y8K B;  1SDL B;  4JAC A;  2NX0 A;  4WCH D;  3WCU A;  2MHB A;  3GOU B;  4U8U C;  5E6E B;  4MQJ A;  1HGA A;  3S66 A;  3BCQ B;  1Y5F A;  2AUR A;  2DHB A;  5CNE A;  1YEN A;  2H35 B;  5KDQ A;  1GBU B;  1Y5J A;  3RGK A;  3HYU A;  1IRD A;  1HDS B;  1G0B B;  3QJB B;  1HGC B;  5AQD A;  1ASH A;  1OFJ A;  3NML A;  4N6S B;  2HBE B;  3MJP B;  1J3F A;  2MGK A;  4N8T B;  2EVP A;  3ODQ A;  3PT7 B;  2D5Z B;  1R1Y A;  1CMY B;  3OZW A;  2D2N D;  1HSY A;  2W6V A;  1F5O A;  1F0L A;  1IRC A;  1BZP A;  1A00 B;  3TLD A;  1F65 A;  1UVL A;  1CH9 A;  1HAB B;  2R4Z A;  1S5X A;  1V4W A;  2MGE A;  1F5P A;  3V58 B;  1Y8W A;  2YRS B;  1CP0 A;  4KJT A;  3UHB A;  2LHB A;  3IC0 B;  3QJD A;  2HCO B;  4GXE A;  1A6M A;  1O1O B;  2GRF A;  1DO4 A;  4ZIZ A;  2Z6N B;  2LH5 A;  1XQ5 A;  2MB5 A;  3ARK A;  1MLL A;  5HLX A;  2R80 B;  3ED9 A;  2VRY A;  104M A;  1LFZ A;  1CH5 A;  1ABW B;  1WAC A;  2ZFB B;  1JEB A;  3LR9 A;  1KD2 A;  1O1P B;  3WCW D;  1M9P B;  1DKE A;  1S5Y B;  4UZV A;  1XY0 A;  5E29 A;  1EBC A;  2BLH A;  1Y7Z A;  4PQB A;  1AJG A;  1BUW B;  3S1J A;  3GUQ A;  3MVC A;  1MBN A;  1BZ1 B;  5MBA A;  2ZSY A;  1J3Y B;  4HH1 A;  5D5R A;  2HHE B;  1MOH A;  1XXT A;  2XKH A;  3LB3 A;  1COH A;  3AQ7 A;  4Z8K A;  2ZST A;  3OK5 A;  1LFQ A;  1YHU D;  1V5H A;  1HCO A;  1RQ3 B;  1YE2 A;  2D60 A;  1A01 B;  4ETT A;  5FVB M;  3DUT A;  3L0F B;  2ZSN A;  1DXD A;  1GDI A;  3UHD A;  1C7B A;  4NS2 A;  1A3O B;  4PO5 A;  4X0L B;  1S6A A;  1CMY A;  2MYE A;  1S5X B;  1ABY B;  5HLU A;  1HBR B;  2FRF A;  2MGC A;  1A00 A;  3K8B B;  4N8T A;  4KN3 A;  1XG0 C;  3NMM A;  2DKD A;  1SPE A;  4H07 A;  1HJT A;  1LFT A;  1YEQ A;  2FAM A;  1R1Y B;  5C6E B;  3D7O A;  1Y0C B;  2ZLT B;  2ZFO B;  3DHT B;  1MBC A;  1VHB A;  1LJW B;  1BZZ A;  3D1A A;  1HDA A;  5KDQ B;  1MBS A;  4HSX A;  3ASE A;  1MOB A;  3MYN A;  4KMV A;  1MYT A;  3RJN B;  2ZS1 D;  3ARL A;  3VRG A;  1MGN A;  3GOU A;  4IRO B;  1CQ2 A;  4AE1 A;  2AA1 B;  2H35 A;  2HCO A;  4GXE B;  2LH1 A;  1SI4 B;  1AJ9 B;  2E2Y A;  1YIE B;  1MLU A;  2WTG A;  1B8D B;  1Y22 A;  1JP9 A;  4N7P B;  2R1H B;  3GYS B;  1CH4 A;  1LIA B;  4LMX B;  1RPS A;  3ZTA A;  2XYK A;  1NS9 A;  1RQ4 B;  5EOH A;  106M A;  4AVE A;  4UUR A;  4FH6 A;  3BOM A;  3PI9 B;  2DXM B;  2ZSP A;  5CN7 A;  4C44 A;  3ODQ B;  1Y7G B;  1CPC A;  3EOK B;  3WCW A;  3WHM A;  2WCR A;  3ZJH A;  1YEO B;  4F0U A;  1ALL A;  4N7O A;  1X46 A;  2HBC A;  4FC3 A;  2ZS0 A;  1J3Z A;  5ILE A;  5JDO C;  2R4Y A;  3G4Q A;  3TM3 A;  4XS0 A;  3UHQ A;  3OVU C;  5SW7 A;  1CPC B;  4HBI A;  2HHB B;  1JF4 A;  2C7L B;  1MYZ A;  1BZ0 A;  1OUU B;  1I3D A;  2X4A A;  3ONZ B;  3BOM B;  2QU0 A;  1YIH B;  3LQ9 A;  2GKN A;  1PBX B;  1G0A A;  4MQH B;  1PHN A;  1Y8K A;  3WCW B;  1G08 B;  2GLN A;  5D1V A;  2MGB A;  2O58 X;  1HBS A;  2V8A B;  1Y7G A;  4MQC A;  2VJR B;  2W6X A;  1QI8 B;  2AV3 A;  4DC8 A;  4RMP A;  3MKB A;  1RQ4 A;  5KKK A;  1SI4 A;  1EYX B;  4SDH A;  3UGZ A;  2AA1 A;  5HU6 B;  2FRJ X;  1TES A;  2RI4 B;  1J3Z B;  3AQ8 A;  1DXT B;  1MBD A;  4N7N A;  2BV8 B;  2NRM A;  3U3E A;  1Y8H B;  1YEO A;  2LH3 A;  4F0U B;  1X9F C;  3H57 A;  1HBG A;  3EU1 B;  5CN4 A;  5CNC A;  4ROL B;  4A8K A;  2DN3 B;  1Y4G B;  1NWN A;  4IRO A;  1SDK A;  1JWN A;  2ZSQ A;  1SPG A;  4MQK B;  1GZX B;  5JOM A;  108M A;  4DC7 A;  3MN0 A;  3WFX A;  1GJN A;  3QQQ A;  4F68 A;  3WCP A;  4B02 A;  2G14 A;  3RJ6 A;  3HF4 A;  3SDN A;  4OF9 A;  2GRZ A;  5JDO F;  2ZSS A;  4ERT A;  1FN3 B;  2C7J A;  2ZLT A;  1YH9 B;  1YFF A;  1YHR B;  3GIO A;  4A8O A;  1URV A;  1MYI A;  1Y85 B;  3FH9 B;  4G1B A;  2EB9 A;  1YHU C;  2ZT4 A;  1VXH A;  2V1K A;  1K1K B;  1YOI A;  4OOD A;  2HZ2 A;  2QMB A;  2JLF A;  2VM0 A;  4B3W A;  3NL7 A;  3ZJJ A;  4L1E B;  3IC2 B;  2ZT1 A;  3FEW X;  1W92 A;  1HDB B;  1B86 B;  3GQG A;  2G0X A;  1NS6 A;  4A8M P;  1DUO A;  3WCV D;  3A2G A;  2O5M X;  2R4W A;  1Y0A B;  1MNO A;  1NIH A;  1CPW A;  2QLS B;  3PMC A;  1HHO B;  2J96 A;  1Y0C A;  3UHC A;  1V9Q A;  1LFQ B;  3V57 A;  1JW8 A;  1YOG A;  1CQX A;  3QJE B;  2H8F A;  3WFU A;  1MNH A;  1BAB B;  4NK2 A;  1J7Y B;  4MAX A;  1A0U B;  4H0M A;  2EF2 A;  3EDA A;  3BJ3 A;  1ABY A;  1WVP A;  1MYH A;  1MOD A;  1BAB A;  3WFW A;  1Y4F A;  1DXV A;  2O5B X;  2R80 A;  2V1H A;  3WCV B;  1YGD A;  3V57 B;  1QSH A;  4HHB B;  2SPM A;  2NSS A;  2QFN A;  2UUN A;  3ZJS A;  1L2K A;  4MQG A;  1HBB A;  3ZHW A;  1Y0A A;  3QM7 A;  2BWH A;  2MGF A;  2IG3 A;  1GDJ A;  1MLM A;  1ABW A;  1XZ7 B;  1LFZ B;  3ORD A;  1B86 A;  2V1I A;  1UFJ A;  2MGJ A;  4DWU A;  4ESU A;  1GLI A;  2QMB B;  1BZ1 A;  1MDT A;  2RAO A;  2D5X B;  1GBV A;  1YG5 B;  3MJU A;  4MBA A;  2FRI X;  3IXF A;  1KN1 B;  3WCV A;  3SDH A;  1JP6 A;  2R4X A;  5CNF A;  4TWV A;  1MYJ A;  1XY0 B;  1UMO A;  1Y85 A;  1S5Y A;  4ERV A;  3PT7 A;  3S48 C;  1NZ2 A;  3UHU A;  3WCW C;  2UUN D;  1HHO A;  1J7Y A;  1T1N A;  3PEL A;  1QPW A;  2HBF B;  3PIA B;  4ROM A;  1NS6 B;  1MBO A;  5EE4 C;  3QJC B;  3QJB A;  3CY5 A;  3KUO A;  3NL7 B;  2Z6N A;  3M3B A;  1MKO A;  3VHB A;  1FDH A;  4LM6 B;  2D6C A;  3IC0 A;  1YEN B;  1XZ5 A;  3M39 A;  3O18 A;  3G4V A;  1RVW B;  4DWT A;  2MBW A;  1KTP B;  2BK9 A;  1JP8 A;  3IC2 A;  1X9F B;  1V07 A;  1G0B A;  2OH8 A;  5CNG A;  3HYU B;  2O5L X;  1O1J B;  1A0Z B;  4HH0 A;  3FS4 B;  1Y31 A;  3HRW B;  4YU4 B;  3LB1 A;  3D4X B;  1Y5F B;  2QSP A;  4WJG 1;  2NSR A;  2VHB A;  4TWU A;  4MQK A;  3K9Z A;  1C40 B;  2UUL H;  1JDO A;  3OJ1 A;  3UHG A;  103M A;  3HF4 B;  2GRH A;  1EWA A;  1QXE B;  7HBI A;  1UVN A;  1G9V A;  1R1X A;  2VJH A;  1G0A B;  2O5O X;  4PQ6 A;  2ZS0 C;  3A5A A;  3GQR A;  1X9F D;  3AQ6 A;  4YU3 B;  1QSI B;  2GDM A;  1HGB B;  1BZ0 B;  1OUU A;  1RQA B;  3P5Q A;  4H2L A;  3HHB A;  2BLJ M;  1IOP A;  4NZI A;  2D2N B;  1HGA B;  3S66 B;  1Y4R A;  4G51 A;  5JGG A;  1O1L B;  3GQR B;  1HBA B;  2VJR A;  2ZLU B;  1SDL A;  1QXE A;  5HBI A;  3D1K B;  1IT2 A;  1N9F A;  3B75 A;  3QM6 A;  1JZM A;  3KMF A;  2ZT3 A;  4F0T A;  1DTM A;  1Y45 B;  3DHR B;  1QI8 A;  2ZLV B;  1NZ5 A;  1NAZ A;  1UIW B;  3ZOM A;  3BJ1 A;  3GQP A;  1NY9 A;  2O5T X;  1BIJ B;  1RH1 A;  3A59 B;  5HY8 A;  3OO4 B;  5CMV A;  5CNB A;  1MZ0 A;  1HBA A; 
#chains in the Genus database with same CATH homology
 102M A;  1Z8U B;  4NXC A;  1Y0W B;  5CN8 A;  3LQD A;  3WCV C;  3R5I A;  1HV4 A;  2D2N A;  3EOK A;  3HHB B;  1CG5 B;  4BJA A;  1UX9 A;  2FAL A;  3AQ9 A;  3AQ5 A;  5AZR A;  2HHB A;  3QM5 A;  1RQA A;  1O1L A;  4MPM A;  1MKO B;  1I3E A;  1Y83 A;  3A0G A;  1FHJ A;  1XYE A;  4F6I A;  1DTI A;  5CN5 A;  1O1I A;  4MXL A;  1FDH G;  4N7O B;  1SWM A;  1ECN A;  2W72 A;  1OUT B;  1FAW A;  5E83 A;  2ZWJ A;  4G1V A;  1OFK A;  1N9X A;  2VYW A;  2ZS1 A;  3V2V A;  3PI9 A;  1G9V B;  1R1X B;  1OR4 A;  1A6G A;  3WCT C;  3BA2 A;  1LFY B;  1LH1 A;  3HRW A;  4YU4 A;  3NMM B;  2D5X A;  2RAO B;  1Y8I A;  1A3O A;  1Y22 B;  4MBN A;  2QSS B;  1C7D A;  1FSX A;  1J41 B;  1IBE A;  1YMA A;  2ZFO A;  2G3H A;  3GKV B;  1SHR B;  105M A;  1BBB B;  1MWC A;  1FCS A;  1RVW A;  2DN1 B;  3SZK B;  1OR6 A;  1MNK A;  1CG8 A;  4HRT B;  4GZG A;  1DXV B;  1YOH A;  1NEJ B;  1BZZ B;  1LJW A;  4F4O A;  1XXT B;  3OO5 A;  3UH7 A;  2HHE A;  1DO3 A;  2ZT2 A;  3VRF A;  5EE4 D;  1Y4V A;  1NZ3 A;  1GDL A;  1LH5 A;  3NG6 A;  1O1N A;  1HAC A;  1GBV B;  1YG5 A;  4ODC B;  4H0B A;  1YVQ B;  1SHR A;  1HBR A;  1TU9 A;  1J41 A;  1Y0D B;  1ECD A;  1JEB B;  3A5B A;  1MDN A;  4F69 A;  2ZSR A;  3GQG B;  2MGM A;  3DUT B;  3ARJ A;  3LHB A;  1FSL A;  2C0K A;  1Y0T B;  2ZSX A;  3GKT A;  1VXD A;  3AG0 A;  2HZ1 A;  2Z85 A;  1QSH B;  4HHB A;  1Y0D A;  4MXK A;  1IWH B;  1YEU B;  2VLX A;  3AT5 B;  3W4U B;  1XCH A;  1KR7 A;  1LTW A;  1YVQ A;  3V2Z A;  3WCU C;  3UH5 A;  5E83 B;  3PI2 A;  1J7W B;  2ZFB A;  1Y4F B;  3BJ2 B;  1O1M B;  3VAU A;  3H58 A;  1MWB A;  3G46 A;  2MYB A;  3G53 A;  4F6J A;  1XZU A;  4F4O B;  3GKV A;  3QMA A;  2KSC A;  1C7C A;  1CG5 A;  2HBD B;  111M A;  2YRS A;  1GCV A;  5EUI A;  3LQD B;  107M A;  1S61 A;  1Y0W A;  4IT8 A;  3ZJL A;  1URY A;  4MU5 A;  1A9W A;  1V4W B;  3ECL A;  1YCA A;  1BIJ A;  5HY8 B;  2PEG B;  2G0R A;  2DHB B;  3NFE A;  3E5I A;  4MQJ B;  2MYA A;  3G4Y A;  1Y7D A;  2HZ3 A;  4M4A A;  2BW9 M;  3S65 A;  4NI0 A;  1MWD A;  1O1N B;  3GK9 A;  3LB2 A;  1MLG A;  3NG6 B;  2XKG A;  1FAW B;  5C6Y A;  3S1I A;  1DWS A;  1Y4V B;  1CBM A;  1CH7 A;  2W72 B;  1JL6 A;  1YIH A;  1HDS A;  1FHJ B;  1Y4R B;  4G51 B;  5JGG B;  2ZFO D;  1Y5J B;  1V4X B;  1VXE A;  1K0Y A;  4O4T A;  4O4Z A;  2G11 A;  110M A;  1XZV A;  4HRR B;  1BBB A;  4YU3 A;  3ZJR A;  3ECX A;  1S0H A;  1FSX B;  1C7D B;  5EV5 A;  1JF3 A;  5HU6 A;  3R5I B;  6HBW B;  1JZK A;  3ZOL A;  1QXD A;  1S56 A;  3UHW A;  5CHR A;  3O89 A;  1LFL B;  2ZLX B;  1NS9 B;  1MYM A;  4U8U A;  1CH1 A;  1Y31 B;  2EKT A;  4PNJ A;  3UHE A;  3LB4 A;  3MKB B;  2M6Z A;  2ZS1 B;  1MLR A;  2SPL A;  2V1F A;  3MOU A;  1BVD A;  101M A;  1XZV B;  3QQR A;  1VXG A;  1Y35 B;  2ZLU A;  3OZV A;  1YHU A;  3VRG B;  1LH2 A;  2ZS0 D;  3A0G B;  3ONZ A;  1U7S A;  2OLP A;  4FC3 B;  4O1T A;  2AUO A;  3P5Q B;  4XS0 B;  1HDA B;  1Y09 A;  1UC3 A;  1T1N B;  1THB B;  1YHE A;  1FLP A;  1Y4Q B;  2D2M D;  4NK1 A;  4XDI A;  1A3N A;  3LR7 A;  3UBV A;  4M4A B;  1JL7 A;  5ILM A;  3A59 A;  4ZVA A;  5KER B;  4U8U B;  1Y46 B;  1MTI A;  3S65 B;  1LFL A;  1RPS B;  5HLQ A;  3HC9 A;  1LHS A;  1GLI B;  4QAU A;  1Y45 A;  2PGH B;  1QXD B;  1WMU A;  1V75 A;  1DXU A;  3G4W A;  4M4B B;  1GCV B;  3KUN A;  1YIE A;  2W6W A;  1O1J A;  3OGB A;  1XZ5 B;  1A01 A;  2VLY A;  5MBN A;  3ZJQ A;  1VXB A;  1HLB A;  1JY7 B;  3UHY A;  1C7C B;  2V1J A;  3BJ2 A;  1CIO A;  1UVY A;  3WCU D;  1A4F A;  3BJ3 B;  1Y5K B;  3MYM A;  2DN2 B;  1D8U A;  5C6E A;  1CLS B;  3D1A B;  1YDZ A;  1YEU A;  1QPW B;  3AT5 A;  3W4U A;  1DUK A;  3CIU B;  2OIF A;  3GDJ B;  4L7Y A;  3DHT A;  1Y7C A;  4NI0 B;  1Y7D B;  1RTX A;  2W31 A;  2G0Z A;  1M9P A;  2CMM A;  3NFE B;  3UHR A;  5AB8 A;  3WCT A;  1HBH A;  1VRF A;  3WCT D;  3K8B A;  1U7R A;  5EET A;  1HDB A;  1XZ7 A;  109M A;  1MNJ A;  2D60 B;  1XQ5 B;  2MGH A;  3UHI A;  5F0B A;  1VXC A;  1B0B A;  4TYX A;  1ABS A;  3QJD B;  1HBH B;  1VRE A;  1XZ2 B;  2HBD A;  2O5Q X;  2WTH A;  1LFV B;  1COH B;  2LH7 A;  2GL3 A;  1YEV A;  1RQ3 A;  4ILZ A;  1Y2Z A;  3WR1 A;  1J52 A;  1CBL A;  1XZU B;  1MLS A;  1GVH A;  4ODC A;  1HAB A;  2O5S X;  5ILP A;  1CH2 A;  1A0U A;  4O2G A;  4UIQ A;  3QJC A;  1S69 A;  1Y5K A;  3WCT B;  4LPI A;  1NZ4 A;  3M38 A;  3PI4 A;  3UHV A;  2ZFO C;  5E29 B;  2D5Z A;  1MYF A;  5CND A;  3WR1 B;  1GDK A;  1DKE B;  4PQC A;  1MTK A;  1BUW A;  1IBE B;  3IA3 B;  4ESA A;  1LFV A;  1MYG A;  1JY7 A;  1YE0 A;  3R0G A;  1NWI A;  4ROL A;  2LH2 A;  1Y7Z B;  3A9M A;  1CLS A;  1M6M A;  1BIN A;  1CP5 A;  1A4F B;  1MLH A;  1RTE A;  2GNV A;  2QRW A;  1GBU A;  1NXF A;  2QSS A;  1K1K A;  1NPF A;  1YGF A;  2BMM A;  1LFY A;  3M3A A;  1DO7 A;  1Y8W B;  3BCQ A;  1NQP B;  3PT8 B;  1O1O A;  1HAC B;  1Y7C B;  2G10 A;  3HEP A;  2BLI A;  1YGD B;  1MNI A;  2ZLW B;  2G12 A;  3PI1 A;  1ITH A;  1YZI B;  1MTJ A;  1WLA A;  1AZI A;  1Q1F A;  2G0S A;  1A3N B;  4C0N A;  1GZX A;  2WY4 A;  2B7H B;  4FH7 A;  2MGG A;  1Y46 A;  3WTG B;  3MJP A;  5KER A;  5SW7 B;  3QJE A;  2GKM A;  2MGD A;  3UH6 A;  5B85 A;  1DM1 A;  1Y4P A;  2DN1 A;  1XYE B;  1SPG B;  2SPN A;  3MBA A;  1CIK A;  1Y8H A;  1A9W E;  1DO1 A;  1IRD B;  2RI4 A;  2D2M C;  1MLQ A;  3DR9 A;  2HBS A;  2MGA A;  4NI1 B;  2D2M B;  3UHT A;  1Y8I B;  2DC3 A;  2ZLV A;  3DHR A;  2Z6S A;  2M6Z B;  2EB8 A;  3WCU B;  2HHD A;  3BJ1 B;  2BKM A;  1UIW A;  2IN4 A;  4U8U D;  2VLZ A;  3ZJP A;  1PBX A;  4AVD A;  2EKU A;  2MHB B;  2R1H A;  1UT0 A;  3GYS A;  2ZT0 A;  1YHE B;  1O1K A;  3AT6 A;  2V1G A;  4MQH A;  1S0H B;  2HHD B;  5HAV A;  2ZLX A;  1O1I B;  1QSI A;  4FWZ A;  3VRE A;  6HBI A;  5CN6 A;  4NI1 A;  4H2L B;  1K0Y B;  2HBS B;  3QZZ A;  1YCB A;  2DN3 A;  6HBW A;  3AT6 B;  3WHM B;  4HSW A;  2W6Y A;  2ZS0 B;  1LH3 A;  2D2N C;  2DXM A;  3ZH0 A;  4L2M A;  3VRE B;  1MLO A;  1YVT B;  1CO9 A;  1VXA A;  112M A;  5EYS A;  2OHA A;  1MLN A;  3WTG A;  3O7N A;  1NGK A;  1J40 A;  1A0Z A;  2B7H A;  1C40 A;  1O1K B;  3HXN B;  2QFK A;  2QSP B;  3HEO A;  1LH6 A;  1HBS B;  1EBT A;  1C7B B;  3FS4 A;  2EVK A;  3D1K A;  3KMF C;  1H97 A;  4FWY A;  1AJ9 A;  3A5G A;  2XKI A;  5F2A A;  1YE2 B;  1X9F A;  2AUP A;  1MCY A;  2QU0 B;  1HCO B;  4N7P A;  1M6C A;  4HRR A;  1LA6 B;  2MGL A;  1Y4P B;  2GTL C;  2H8D A;  1O16 A;  1V4X A;  1HGB A;  2HBF A;  5EYJ A;  5IKS A;  1G09 A;  3CY5 B;  1OJ6 A;  1IT3 A;  3EDB A;  5EUI B;  3PIA A;  4ROM B;  3PEL B;  3UHN A;  1KFR A;  4ESA B;  3D17 A;  3UI0 A;  2GTL B;  2VYZ A;  1UX8 A;  2NRL A;  1VWT A;  1V4U A;  1BVC A;  3D4X A;  1H1X A;  1UVX A;  1LFT B;  1YEQ B;  2GNW A;  1HBI A;  1YGF B;  2ZLW A;  3G4U A;  1MBA A;  1NPG A;  2PEG A;  3UHH A;  2OHB A;  2Z8A A;  1XZ4 A;  1MLK A;  3UHX A;  2VEE A;  3PT8 A;  4NXA A;  1NQP A;  1YEV B;  5CN9 A;  1N9H A;  1IWH A;  1DWT A;  1JPB A;  5AZQ A;  2MGI A;  3UHS A;  4KMW A;  1DXC A;  4MQG B;  4F6G A;  4F6F A;  1Y0T A;  1YMB A;  3QM9 A;  1XZ4 B;  3QZX A;  1J3Y A;  3TM9 A;  1UFP A;  2R50 A;  1O1M A;  4WJG A;  1J7S B;  2H8F B;  4F6B A;  1ECA A;  1J7W A;  1YE0 B;  5JDO E;  4MQI A;  1V4U B;  2JHO A;  3ZJM A;  2AV0 A;  3D7O B;  3D17 B;  1N9I A;  2SPO A;  1O1P A;  3GDJ A;  4FWX A;  1CG8 B;  4ZVB A;  1MOA A;  4B4Y A;  3MJU B;  1J7S A;  3ECZ A;  1HGC A;  2ZS1 C;  1BJE A;  2MYD A;  3GLN A;  4MQI B;  1NIH B;  4X0L A;  1MBI A;  1Y2Z B;  5ILR A;  2H8D B;  1XZ2 A;  4JYQ A;  3SZK A;  1HBB B;  1YFF B;  1YHR A;  1AJH A;  1FN3 A;  3K3U A;  1YDZ B;  3FH9 A;  3WI8 A;  2LH6 A;  3VRF B;  1DXU B;  1HLM A;  3QM8 A;  1F63 A;  1LHT A;  3UBC A;  3UHZ A;  4F6D A;  3OO5 B;  1NEJ A;  1J40 B;  1DLY A;  1SDK B;  2GTL A;  5CHQ A;  4L7Y B;  4HRT A;  1MLJ A;  3CIU A;  3WFT A;  5EU2 A;  1VWT B;  2DN2 A;  3OZU A;  1RSE A;  1Y83 B;  3UGY A;  5JDO D;  1Y4G A;  2QLS A;  1KD2 B;  2HBE A;  1BZR A;  1THB A;  2VYY A;  2BNL A;  5B84 A;  3EU1 A;  1OUT A;  1CO8 A;  1HV4 B;  4M4B A;  2V1E A;  1Y4B A;  3PI8 B;  1V75 B;  4N7N B;  1LA6 A;  1G09 B;  2G0V A;  3OO4 A;  5E6E A;  1GCW A;  2VEB A;  1HRM A;  4MQC B;  1Y35 A;  3ZJI A;  4VHB A;  3UH3 A;  3GQP B;  5M3S A;  1CH3 A;  1Y01 B;  1WMU B;  3E55 A;  2PGH A;  1YH9 A;  1OBM A;  3B75 B;  1A6K A;  3WCP B;  1LUE A;  1G08 A;  1Y09 B;  1IDR A;  2W6V B;  1MOC A;  1MLF A;  3G52 A;  1EW6 A;  1GCW B;  3HXN A;  1BZ6 A;  5EQM A;  2MYC A;  1A6N A;  3E4N A;  2D2M A;  1YHU B;  4O35 A;  2HBC B;  2GTL D;  1Y4B B;  3PI8 A;  1Y4Q A;  2OH9 A;  1YVT A;  3G4R A;  3E5O A;  1X3K A;  1JZL A;  2W72 C;  2ZSO A;  1DXT A;  1EMY A;  2HBG A;  3ZJN A;  1LH7 A;  1VXF A;  1DLW A;  1PMB A;  3UHK A;  1DWR A;  1YZI A;  3ZJO A;  1YMC A;  2ZSZ A;  3HEN A;  2AUQ A;  3PI3 A;  2FRK X;  1ECO A;  2Z6T A;  1Y8K B;  1SDL B;  4JAC A;  2NX0 A;  4WCH D;  3WCU A;  2MHB A;  3GOU B;  4U8U C;  5E6E B;  4MQJ A;  1HGA A;  3S66 A;  3BCQ B;  1Y5F A;  2AUR A;  2DHB A;  5CNE A;  1YEN A;  2H35 B;  5KDQ A;  1GBU B;  1Y5J A;  3RGK A;  3HYU A;  1IRD A;  1HDS B;  1G0B B;  3QJB B;  1HGC B;  1ASH A;  1OFJ A;  3NML A;  2HBE B;  3MJP B;  1J3F A;  2MGK A;  4N8T B;  2EVP A;  3ODQ A;  3PT7 B;  2D5Z B;  1R1Y A;  1CMY B;  3OZW A;  2D2N D;  1HSY A;  2W6V A;  1F5O A;  1IRC A;  1BZP A;  1A00 B;  3TLD A;  1F65 A;  1CH9 A;  1HAB B;  2R4Z A;  1S5X A;  1V4W A;  2MGE A;  1F5P A;  1Y8W A;  2YRS B;  1CP0 A;  4KJT A;  3UHB A;  2LHB A;  3IC0 B;  3QJD A;  2HCO B;  1A6M A;  1O1O B;  1DO4 A;  2GRF A;  2Z6N B;  2LH5 A;  1XQ5 A;  2MB5 A;  3ARK A;  1MLL A;  5HLX A;  2R80 B;  3ED9 A;  2VRY A;  104M A;  1LFZ A;  1CH5 A;  1ABW B;  2ZFB B;  1JEB A;  3LR9 A;  1KD2 A;  1O1P B;  3WCW D;  1M9P B;  1DKE A;  1S5Y B;  4UZV A;  1XY0 A;  5E29 A;  1EBC A;  2BLH A;  1Y7Z A;  4PQB A;  1AJG A;  1BUW B;  3S1J A;  3MVC A;  1MBN A;  1BZ1 B;  5MBA A;  2ZSY A;  1J3Y B;  5D5R A;  2HHE B;  1MOH A;  1XXT A;  2XKH A;  3LB3 A;  1COH A;  3AQ7 A;  2ZST A;  3OK5 A;  1LFQ A;  1YHU D;  1V5H A;  1HCO A;  1RQ3 B;  1YE2 A;  2D60 A;  1A01 B;  3DUT A;  2ZSN A;  1DXD A;  1GDI A;  3UHD A;  1C7B A;  4NS2 A;  1A3O B;  4X0L B;  1S6A A;  1CMY A;  2MYE A;  1S5X B;  1ABY B;  5HLU A;  1HBR B;  2FRF A;  2MGC A;  1A00 A;  3K8B B;  4N8T A;  4KN3 A;  3NMM A;  1SPE A;  4H07 A;  1HJT A;  1LFT A;  1YEQ A;  2FAM A;  1R1Y B;  5C6E B;  3D7O A;  1Y0C B;  2ZLT B;  2ZFO B;  3DHT B;  1MBC A;  1VHB A;  1LJW B;  1BZZ A;  3D1A A;  1HDA A;  5KDQ B;  1MBS A;  4HSX A;  3ASE A;  1MOB A;  3MYN A;  4KMV A;  1MYT A;  3RJN B;  2ZS1 D;  3ARL A;  3VRG A;  1MGN A;  3GOU A;  4IRO B;  1CQ2 A;  2AA1 B;  2H35 A;  2HCO A;  2LH1 A;  1SI4 B;  1AJ9 B;  2E2Y A;  1YIE B;  1MLU A;  2WTG A;  1Y22 A;  1JP9 A;  4N7P B;  2R1H B;  3GYS B;  1CH4 A;  1RPS A;  2XYK A;  1NS9 A;  1RQ4 B;  5EOH A;  106M A;  4AVE A;  4UUR A;  4FH6 A;  3BOM A;  3PI9 B;  2DXM B;  2ZSP A;  5CN7 A;  4C44 A;  3ODQ B;  1Y7G B;  3EOK B;  3WCW A;  3WHM A;  3ZJH A;  1YEO B;  4N7O A;  1X46 A;  2HBC A;  4FC3 A;  2ZS0 A;  1J3Z A;  5ILE A;  5JDO C;  2R4Y A;  3G4Q A;  3TM3 A;  4XS0 A;  3UHQ A;  3OVU C;  5SW7 A;  4HBI A;  2HHB B;  1JF4 A;  1MYZ A;  1BZ0 A;  1OUU B;  1I3D A;  3ONZ B;  3BOM B;  2QU0 A;  1YIH B;  2GKN A;  1PBX B;  1G0A A;  4MQH B;  1Y8K A;  3WCW B;  1G08 B;  2GLN A;  5D1V A;  2MGB A;  2O58 X;  1HBS A;  1Y7G A;  4MQC A;  2W6X A;  1QI8 B;  2AV3 A;  4DC8 A;  3MKB A;  1RQ4 A;  5KKK A;  1SI4 A;  4SDH A;  3UGZ A;  2AA1 A;  5HU6 B;  2FRJ X;  1TES A;  2RI4 B;  1J3Z B;  3AQ8 A;  1DXT B;  1MBD A;  4N7N A;  2NRM A;  3U3E A;  1Y8H B;  1YEO A;  2LH3 A;  1X9F C;  3H57 A;  1HBG A;  3EU1 B;  5CN4 A;  5CNC A;  4ROL B;  2DN3 B;  1Y4G B;  1NWN A;  4IRO A;  1SDK A;  1JWN A;  2ZSQ A;  1SPG A;  4MQK B;  1GZX B;  5JOM A;  108M A;  4DC7 A;  3MN0 A;  3WFX A;  1GJN A;  3QQQ A;  4F68 A;  3WCP A;  2G14 A;  3RJ6 A;  3HF4 A;  3SDN A;  4OF9 A;  2GRZ A;  5JDO F;  2ZSS A;  1FN3 B;  2ZLT A;  1YH9 B;  1YFF A;  1YHR B;  1URV A;  1MYI A;  1Y85 B;  3FH9 B;  4G1B A;  2EB9 A;  1YHU C;  2ZT4 A;  1VXH A;  2V1K A;  1K1K B;  1YOI A;  4OOD A;  2HZ2 A;  2QMB A;  2VM0 A;  4B3W A;  3NL7 A;  3ZJJ A;  3IC2 B;  2ZT1 A;  1W92 A;  1HDB B;  1B86 B;  3GQG A;  2G0X A;  1NS6 A;  1DUO A;  3WCV D;  3A2G A;  2O5M X;  2R4W A;  1Y0A B;  1MNO A;  1NIH A;  1CPW A;  2QLS B;  1HHO B;  1Y0C A;  3UHC A;  1V9Q A;  1LFQ B;  1JW8 A;  1YOG A;  1CQX A;  3QJE B;  2H8F A;  3WFU A;  1MNH A;  1BAB B;  4NK2 A;  1J7Y B;  4MAX A;  1A0U B;  2EF2 A;  3EDA A;  3BJ3 A;  1ABY A;  1WVP A;  1MYH A;  1MOD A;  1BAB A;  3WFW A;  1Y4F A;  1DXV A;  2O5B X;  2R80 A;  2V1H A;  3WCV B;  1YGD A;  1QSH A;  4HHB B;  2SPM A;  2NSS A;  2QFN A;  3ZJS A;  1L2K A;  4MQG A;  1HBB A;  3ZHW A;  1Y0A A;  3QM7 A;  2BWH A;  2MGF A;  2IG3 A;  1GDJ A;  1MLM A;  1ABW A;  1XZ7 B;  1LFZ B;  3ORD A;  1B86 A;  2V1I A;  1UFJ A;  2MGJ A;  4DWU A;  1GLI A;  2QMB B;  1BZ1 A;  2RAO A;  2D5X B;  1GBV A;  1YG5 B;  3MJU A;  4MBA A;  2FRI X;  3IXF A;  3WCV A;  3SDH A;  1JP6 A;  2R4X A;  5CNF A;  4TWV A;  1MYJ A;  1XY0 B;  1UMO A;  1Y85 A;  1S5Y A;  3PT7 A;  3S48 C;  1NZ2 A;  3UHU A;  3WCW C;  1HHO A;  1J7Y A;  1T1N A;  3PEL A;  1QPW A;  2HBF B;  3PIA B;  4ROM A;  1NS6 B;  1MBO A;  5EE4 C;  3QJC B;  3QJB A;  3CY5 A;  3KUO A;  3NL7 B;  2Z6N A;  3M3B A;  1MKO A;  3VHB A;  1FDH A;  2D6C A;  3IC0 A;  1YEN B;  1XZ5 A;  3M39 A;  3G4V A;  1RVW B;  4DWT A;  2MBW A;  2BK9 A;  1JP8 A;  3IC2 A;  1X9F B;  1V07 A;  1G0B A;  2OH8 A;  5CNG A;  3HYU B;  2O5L X;  1O1J B;  1A0Z B;  3FS4 B;  1Y31 A;  3HRW B;  4YU4 B;  3LB1 A;  3D4X B;  1Y5F B;  2QSP A;  4WJG 1;  2NSR A;  2VHB A;  4TWU A;  4MQK A;  3K9Z A;  1C40 B;  1JDO A;  3OJ1 A;  3UHG A;  103M A;  3HF4 B;  2GRH A;  1EWA A;  1QXE B;  7HBI A;  1G9V A;  1R1X A;  1G0A B;  2O5O X;  4PQ6 A;  2ZS0 C;  3A5A A;  3GQR A;  1X9F D;  3AQ6 A;  4YU3 B;  1QSI B;  2GDM A;  1HGB B;  1BZ0 B;  1OUU A;  1RQA B;  3P5Q A;  4H2L A;  3HHB A;  2BLJ M;  1IOP A;  4NZI A;  2D2N B;  1HGA B;  3S66 B;  1Y4R A;  4G51 A;  5JGG A;  1O1L B;  3GQR B;  1HBA B;  2ZLU B;  1SDL A;  1QXE A;  5HBI A;  3D1K B;  1IT2 A;  1N9F A;  3B75 A;  3QM6 A;  1JZM A;  3KMF A;  2ZT3 A;  1DTM A;  1Y45 B;  3DHR B;  1QI8 A;  2ZLV B;  1NZ5 A;  1NAZ A;  1UIW B;  3ZOM A;  3BJ1 A;  3GQP A;  2O5T X;  1BIJ B;  5HY8 A;  3A59 B;  3OO4 B;  5CMV A;  5CNB A;  1MZ0 A;  1HBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...