4YU4B

Crystal structure of mongoose (helogale parvula) hemoglobin at ph 7.0
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
VHLTAEEKAHVSGLWGKVNTEEVGGEALGRLLVVYPWTQRFFETFGDLSSANAIMNNPKVKAHGKKVLSSFSDGLKNLDNLKGTFAALSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKIVAGVANALAHKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mongoose (Helogale parvula) hemoglobin at pH 7.0
rcsb
molecule tags Oxygen transport
molecule keywords hemoglobin
total genus 48
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 4yu4B00
2EKTA 3QJBA 3UHHA 1O1IA 2G0SA 2ZSQA 2ZLTA 3MJPA 2AV3A 3WFTA 3ECLA 1MYJA 3D7OB 1Y01B 1BUWA 3PI2A 3GYSA 1YG5B 2D2MD 1HJTA 1LUEA 4F6BA 1YVTB 3PI1A 2ZSXA 2BWHA 1CMYA 1URYA 2H8FA 4H0BA 2R4WA 1CBMA 1HDAA 1TU9A 1MNJA 1Y31B 2HBCA 106MA 1YDZA 3QM9A 3P5QA 4N7NB 1JZMA 2MGHA 1NWNA 1XYEA 4ESAA 5SW7A 5HLQA 2QRWA 2DC3A 2QU0A 1F5PA 2HBFA 4G51A 1HBAA 1VRFA 1FDHG 1YFFB 4YU3B 4KJTA 2ZSOA 1DLWA 2ZS0A 1RQ4B 4XS0A 1YZIA 3OJ1A 2MGJA 3CY5B 1YCBA 2G10A 1G9VB 2ZSPA 1MOHA 1Y4RA 1HSYA 4O1TA 1BZ0A 2DXMB 1J7SB 4MXLA 1IT3A 1YHEB 2Z6NA 2HZ3A 1MLFA 1MYZA 3GDJB 3LB3A 1B86B 2FRIX 1YE0A 1QPWA 4FC3A 3VHBA 3UH3A 3M39A 1LFYA 4ESAB 2AA1B 1LJWB 2E2YA 1X46A 3WCVD 3WCWB 3EU1A 1XZVB 1MBSA 5CNFA 1QPWB 3R0GA 5ILMA 2MHBB 3BOMA 4PQBA 3R5IB 2ZFOD 4X0LA 2MGFA 3BJ2B 3GDJA 2LH3A 1BVDA 4G1BA 3D7OA 1YOGA 1YVQB 1A4FA 2DXMA 1IRCA 3D4XB 1WMUA 3WCUB 5EOHA 2XYKA 1Z8UB 3QJEB 1G9VA 1MLGA 1XXTA 1Y0WA 1OUTB 1Y0DA 2ZS0B 4M4AB 4IROA 3RGKA 1S5YB 1YENB 4MQIA 3TM9A 1HGAA 1CBLA 3WHMB 1Y0TB 1HHOB 1GDLA 1NPGA 5HLUA 1Y4BA 2GL3A 1SDLB 3NG6A 2HHEA 2VLYA 3ARJA 5CNEA 1NIHA 2MYBA 3VRFA 4NI1A 2NX0A 3ONZA 3WTGA 4MQHA 3GQGA 3EU1B 1DM1A 1BZRA 2ZS1A 2QLSB 2HBSB 5CNDA 1Y46A 1O1NA 2SPOA 2O58X 3LB2A 4HSXA 1IBEB 1JL6A 3S65A 1RQ3A 7HBIA 2EKUA 1CG5A 1YMCA 5HLXA 2V1GA 2ZFBB 1EWAA 3UHNA 3GKTA 4MQGB 3WFUA 1Y7ZA 5KKKA 3WFXA 5ILRA 1JP6A 1LH1A 1YVQA 2G12A 1YEUA 3D1AA 1BZ0B 2PGHB 1IRDB 1Y5JB 1A3NB 1Y4PA 1A3OB 3R5IA 4NZIA 1GLIA 1MKOB 1MBCA 1NS6B 3D1KB 1HBHB 2CMMA 1MLOA 4HRTB 2QSSB 4DC8A 1YEOB 5F0BA 2GKMA 2AA1A 2MYCA 1BINA 3HF4B 1K0YA 2ZT1A 4FC3B 2NSRA 1CP0A 3B75A 1G0AB 1XQ5B 1V4WB 4NK1A 3UHGA 1K1KA 2LH1A 5KERB 5JOMA 1JEBB 3OVUC 4MQJA 3PT8A 2EB9A 5EUIB 1UVYA 3WCTA 2PGHA 1OBMA 3A59A 2GTLB 2W31A 2O5TX 4HHBA 1HBIA 1MNHA 1JP8A 1U7RA 1J7SA 2XKGA 1YEVB 2MGLA 3IC0B 3UHSA 1MLHA 1AZIA 4MQGA 1Y4FA 2G3HA 1DXVA 1A6MA 3CY5A 2EB8A 2QFKA 2ZLXB 3G4YA 1THBB 1CG5B 1I3EA 1LFQB 3DUTA 4N7OB 1WVPA 2G11A 5JDOC 3OO5A 3S65B 2HBFB 1QSHB 1XZ2B 3OZWA 4ODCB 3ZJHA 4PNJA 3UHYA 105MA 2HHBB 3PIAA 1X9FD 5C6YA 1NEJB 2HBCB 5HU6A 3D17A 2BKMA 1SDLA 2D2NB 3UHEA 2V1FA 1F63A 3ASEA 4TYXA 1UVXA 4L7YB 2H8DB 3LB1A 1YG5A 3AG0A 2D2NC 1NZ4A 1MBOA 2AUPA 3A5BA 1MTKA 1MLQA 5MBAA 1TESA 1HBSB 1DKEA 5EU2A 2MB5A 3K9ZA 2GLNA 1GDIA 1O1PA 1HBSA 3AT5B 1Y8IA 1MWCA 1Y0CB 2BW9M 3AQ6A 2GKNA 3ZOMA 3UHBA 2ZSYA 1OUUB 1J7WA 1MBDA 1MBAA 1RVWB 2H8DA 3FH9B 1BJEA 1YE2B 4MQHB 5HU6B 1CLSA 3ODQB 3ONZB 3WTGB 1UMOA 4MAXA 110MA 103MA 4ZVBA 2VEBA 1GDKA 3NG6B 3ZJOA 2OH9A 3TLDA 1UC3A 2DN3A 1FDHA 1LFTB 1MLKA 1SPGA 1O1MA 2FRJX 1XZUB 3HYUA 1RTXA 3QZZA 3K8BA 1YEQB 4H2LA 1DXVB 1V75A 5E6EA 2FAMA 1HCOB 1QSIB 1YGFA 1YHUB 3GQPB 5JGGB 1Y0AA 1LTWA 3QM6A 2ZLUB 3UGYA 1HRMA 2B7HA 3HEOA 3IA3B 5E83A 4U8UA 3PI3A 4YU4A 1NS9A 4M4BA 2V1IA 4KN3A 3ZJLA 2MGGA 2G0XA 2DN1B 2Z6TA 1YFFA 2HCOA 4ILZA 2ZS0D 2HBGA 1UT0A 2PEGA 1Y35B 1NXFA 2DN3B 1OR6A 2MYAA 4HRTA 4F6FA 4UURA 4NI1B 3G46A 1NS6A 3LQDA 1Y31A 1XZ7A 1DO1A 1YE2A 3ZJNA 1A3OA 4DWUA 1GVHA 1QXEB 3WHMA 1MLSA 1JPBA 1CQ2A 3ZOLA 2NRMA 1M6CA 1YHRA 1C7DA 1Y0CA 3E5OA 4JYQA 4M4AA 1MTJA 1J3YA 2QMBA 4DC7A 5CNGA 3UGZA 3AQ8A 2D5XA 4OODA 3M3BA 3GOUA 3D4XA 1A4FB 2R50A 1COHB 2MYDA 2HBDB 1MGNA 2QU0B 1MDNA 1CG8A 5CHQA 1QXEA 3BJ2A 2D60A 4X0LB 2ZS1B 3A0GA 1DUOA 1DXUB 1Y45A 1CH4A 2ZSZA 1OFKA 3OGBA 2HHBA 3AQ7A 1V07A 4KMWA 5C6EB 2ZLVA 1IWHA 3PT7B 1HHOA 1X9FA 2HZ2A 4MBNA 1BUWB 2HHDA 1BBBB 1J7YA 4F4OA 3RJNB 1VWTA 1GZXA 3NMMB 1NQPA 4BJAA 5CN4A 1BZZA 3ZJQA 3UH7A 1XXTB 1VXHA 1A0UA 2EF2A 3HENA 3PELB 1DO7A 1LH3A 1VXDA 2R80B 1DXTB 3AT6A 5E29A 1Y2ZA 2VRYA 3HRWB 3GQPA 5JGGA 3VAUA 1ABWA 1H1XA 4G1VA 1JP9A 1LA6A 1Y4RB 2O5QX 2MGAA 1IDRA 1AJ9A 3DHRB 1FLPA 2R4XA 3A9MA 2V1HA 4HSWA 1CH1A 5KDQA 2V1KA 1A9WA 1A9WE 3HYUB 1XY0A 2Z6SA 1G0AA 3GK9A 1DXDA 3WCTD 1BVCA 2BLIA 2MGCA 4G51B 1MLNA 3WCWA 3MVCA 3PI4A 3V2VA 1RQAA 3FS4A 1C7BB 1T1NB 1A6KA 1QXDA 1KD2B 3ZHWA 2HCOB 2ZSTA 1YH9A 3WR1B 1FAWA 1SPEA 2MGMA 1HDAB 3E4NA 1Y5JA 3FH9A 2ZFOC 2ZSRA 102MA 2ZSNA 1Y0AB 3MKBB 1GCWB 4FH6A 4U8UC 3IC2A 3MJUB 1VXFA 2R80A 5E29B 1Y8IB 4U8UD 5MBNA 1RPSB 1YIEA 3SDNA 2C0KA 3PELA 1R1YA 1HABA 4MPMA 5F2AA 1YZIB 1CH2A 5EQMA 3V2ZA 1HGCA 1RQ3B 1HBAB 1CO8A 3WCPA 5EE4D 1SPGB 4OF9A 1LH2A 1IWHB 1Y8WA 1YGDB 1ASHA 5CN6A 4QAUA 1YMBA 3QM5A 3P5QB 2FRFA 3GLNA 1CH3A 1NIHB 3WFWA 1A00B 108MA 1Y85A 1QSHA 1OR4A 1LFVB 3KUOA 1COHA 1Y4GA 1LFQA 1JY7A 3MBAA 2ZWJA 1Y0DB 2ZSSA 3MJPB 1ECAA 3GOUB 112MA 2D5XB 2FRKX 1O16A 1X3KA 3G4UA 3HXNA 1J3YB 1YEVA 4N8TB 3G4VA 2YRSA 4MQKB 3MJUA 2SPLA 5B85A 2GTLA 1HBRA 4ROLA 2DHBB 1MZ0A 1SWMA 2AURA 2LH7A 4NI0B 1UIWB 1GDJA 3MYMA 1CPWA 1Y7CB 2AUOA 1FHJB 1S5XB 1LJWA 1XZ2A 1JWNA 3UHTA 1Y7GB 2BLHA 5EYSA 104MA 2LH2A 2AV0A 109MA 1R1XB 1G08A 3UHWA 4WJGA 1GLIB 3ZJMA 2ZLXA 3QJCA 1Y8KB 1AJHA 2V1JA 3EDBA 2G0RA 1S69A 2BMMA 1A0ZB 5CMVA 3HHBB 3BJ3B 3E55A 1IRDA 1O1OA 2H35A 1ECOA 1Y5FA 3A5AA 2H35B 2LH5A 3AT6B 2JHOA 3EOKA 1C40A 1XZ4B 1Y7ZB 1JF4A 5EUIA 2GRZA 3PT8B 2GNWA 4O4ZA 4ROMB 3DHTB 1S0HB 1D8UA 4PQCA 1K1KB 1FN3B 1SHRA 2NRLA 3ZJJA 1JZKA 2RI4A 1Y46B 3VREA 3GQGB 1RSEA 4F68A 1A00A 1BABB 1C7CA 1Y83A 2VYYA 1MBNA 2ZLWA 4HBIA 1NZ3A 2GDMA 3G4QA 2MGEA 3CIUB 2D5ZB 2W72C 1S5YA 1LHTA 1YENA 3SZKA 1MWDA 1HACB 1ABYB 1MYMA 4FWYA 1HABB 1J3FA 5CNCA 1V4UB 4UIQA 3BCQA 4AVEA 2M6ZB 1CO9A 1HBBB 2Z85A 2DN2A 2D2ND 1NQPB 3O7NA 4IT8A 4F6DA 1GCWA 3S66A 2W6WA 1G09A 1BZ6A 2D5ZA 1O1NB 5C6EA 2IG3A 1UFJA 5EV5A 3M38A 1KFRA 4WCHD 3NMLA 3OO4A 3S48C 1DO4A 2LH6A 1O1LA 2MGBA 3PI8B 1MCYA 3PI9B 4ODCA 2RI4B 3VREB 1LFLB 1Y09A 1BIJA 2XKIA 1Y7DA 1AJGA 1J41B 1UFPA 2NSSA 1MYIA 3QQRA 4MU5A 1Q1FA 3GKVA 1X9FC 1YIEB 1MODA 2ZLUA 1BZ1B 4MQCB 1Y4QA 3SZKB 2OLPA 3IC2B 1N9HA 1YGFB 5ILPA 1GBUB 1Y4QB 4O35A 3TM3A 1BZ1A 1WLAA 1HDSA 1J40B 1Y8HA 2OH8A 2VYZA 3AQ9A 4VHBA 5HY8A 4MQJB 2R1HA 4B4YA 4NK2A 3ECZA 1JL7A 2ZLWB 5EE4C 1Y5KA 1HV4A 1U7SA 1C7CB 1O1JB 1IT2A 3BJ1B 1CH7A 2GRFA 1XYEB 1I3DA 5CN5A 1MYFA 1O1JA 2VLXA 3D1KA 2W6VB 1HV4B 1IOPA 5KDQB 1Y45B 3UHZA 1J3ZB 4M4BB 1J52A 5HY8B 1CMYB 2H8FB 1MLRA 2QFNA 4C0NA 4GZGA 2Z6NB 1MNOA 1GBUA 1ABWB 3QJDA 3GQRB 1YHUA 2DN2B 1O1OB 1V75B 5E6EB 3S1IA 3GKVB 1MLLA 1Y8KA 1VXCA 3UHCA 3ECXA 5D5RA 3K8BB 3H57A 1ABYA 1QI8B 3NL7B 2ZS1D 3NMMA 3QM8A 1GZXB 2GNVA 2MGDA 6HBWB 1MLJA 5CHRA 1J41A 1Y7GA 1X9FB 5M3SA 3UHKA 1O1KB 1FHJA 3UHVA 2D2NA 2W72A 3OO4B 1M9PA 3ED9A 2GRHA 2VYWA 2HHEB 3O89A 1YGDA 1MNIA 3GYSB 2IN4A 4FH7A 3HC9A 4IROB 1HGCB 1N9XA 2BLJM 1OUTA 3BCQB 1Y0WB 1V4UA 3LR7A 1Y4FB 1DKEB 1RPSA 3UHDA 2ZFOB 1C7DB 1LH6A 3WI8A 1H97A 1GJNA 1OFJA 1YHUD 3A59B 1MOBA 1PBXA 3NFEB 3KMFA 1J3ZA 3QJCB 1HDBB 4WJG1 3LQDB 5CNBA 1V4WA 1MLUA 1NEJA 2W72B 2XKHA 2HZ1A 1HBGA 4SDHA 2RAOB 1K0YB 3K3UA 3G4RA 3QQQA 1CIKA 3W4UB 2EVKA 3OO5B 2QSSA 3AQ5A 2W6YA 2QSPB 1Y7CA 1Y22A 1XY0B 3LB4A 1Y5KB 4AVDA 2KSCA 1S0HA 3DHRA 2HBEA 5CN8A 4YU4B 3QMAA 1LHSA 2ZT4A 3MN0A 3EOKB 1LFZB 1RVWA 1VXBA 3D1AB 5HBIA 1YHEA 1SDKB 3G52A 3HRWA 1LH7A 5D1VA 101MA 1JDOA 4N8TA 3OZVA 1HGBB 2G0ZA 1S61A 2ZT3A 4H2LB 1JEBA 4B3WA 2OHAA 1BZZB 2O5SX 2W6VA 1JY7B 1Y4GB 3SDHA 5JDOE 3ORDA 1UX9A 1VWTB 1Y4VB 4UZVA 1O1MB 2VHBA 4XDIA 3HF4A 3W4UA 1BIJB 1LFVA 4L7YA 1B0BA 1A6GA 1RQAB 2GTLC 2QLSA 1YEOA 1N9IA 2MGKA 3BJ1A 1YIHB 1CIOA 2O5BX 4HRRB 1ECNA 3UBVA 1GBVB 2WTHA 1VXEA 3ZJRA 3KUNA 1A01A 3A0GB 3E5IA 1EBCA 2R1HB 2W6XA 1DWSA 1LA6B 2R4ZA 2WTGA 1Y0TA 1YEUB 3S66B 3WCPB 1F5OA 2V1EA 3G53A 6HBWA 5EYJA 4N7OA 5CN7A 1HBBA 4MQCA 3WCVB 3WCVC 1O1PB 1O1IB 1GCVB 3WCVA 1HACA 1MYHA 3GQRA 1FCSA 3MKBA 1Y7DB 1SI4B 2MGIA 5AZRA 1DUKA 3PT7A 2HBSA 2AUQA 1FSLA 3ARLA 3PI9A 1XZ5B 3D17B 1A01B 2MHBA 5KERA 3UH6A 1MYGA 1GBVA 1XQ5A 1N9FA 3VRGA 1NGKA 4FWXA 3B75B 4FWZA 1YIHA 4O2GA 3WCUD 1QXDB 2D60B 2O5OX 1V5HA 1LFYB 1G09B 4TWUA 2GTLD 1A6NA 3QZXA 4N7PA 1Y4VA 3MOUA 2DN1A 1MKOA 1DXCA 2LHBA 1YCAA 1YE0B 2O5MX 3DHTA 1NS9B 1R1YB 1YHUC 1A3NA 1PMBA 1Y4PB 5E83B 1J40A 1Y8HB 1HGBA 1HDSB 4O4TA 1WMUB 3WCUA 2OIFA 1MTIA 1YHRB 2BNLA 4HHBB 1MYTA 1HCOA 3UHRA 1LFZA 4C44A 3CIUA 1VXAA 1A0UB 2VEEA 1YEQA 3UI0A 3BOMB 4L2MA 4MBAA 1Y83B 1DTIA 1XZUA 1CH9A 1VREA 4YU3A 1YOIA 1XZVA 4N7PB 1J7YB 4F4OB 4PQ6A 1XCHA 4F6GA 1LFTA 1Y09B 111MA 3S1JA 2SPNA 1JW8A 2RAOA 1O1LB 4N7NA 3UHQA 1DO3A 5ILEA 5JDOF 1EW6A 3VRFB 1DTMA 3U3EA 1UIWA 1AJ9B 2D2MA 3MYNA 1XZ5A 1Y4BB 3ARKA 3M3AA 3KMFC 4F6IA 1C40B 1B86A 1XZ4A 1ITHA 1CG8B 3ZJSA 1SI4A 4MQIB 2HBDA 3UH5A 1RTEA 1QSIA 3H58A 1Y2ZB 1DWTA 3WCWD 3BJ3A 3HHBA 1LH5A 1FSXA 1YOHA 2MBWA 2ZT2A 4NXAA 3QJEA 2VLZA 4XS0B 2WY4A 5JDOD 1MLMA 1NZ2A 2HHDB 1IBEA 3QM7A 5EETA 1LFLA 3PI8A 3UHXA 4ZVAA 6HBIA 3LR9A 3VRGB 1XZ7B 4LPIA 1BABA 4F69A 1DXUA 2Z8AA 3ZJPA 1CH5A 3ZJIA 1CP5A 1HLMA 1UX8A 1YVTA 1L2KA 3OK5A 3ZH0A 2PEGB 1ABSA 3G4WA 3HEPA 3WCTC 1OUUA 1EBTA 1MOCA 1QI8A 2M6ZA 2ZLTB 5IKSA 1URVA 1GCVA 2OHBA 3QJBB 1FSXB 4H07A 2QMBB 4NS2A 2B7HB 3IXFA 4JACA 2G0VA 1NWIA 1NAZA 5B84A 3QJDB 1SDKA 3LHBA 2SPMA 2MYEA 5AZQA 2FALA 1Y85B 1A0ZA 1KR7A 2D2MB 1EMYA 1G08B 1RQ4A 1YH9B 3WR1A 2EVPA 3UBCA 4HRRA 3PIAB 2QSPA 1JF3A 1C7BA 1T1NA 1Y8WB 1Y35A 3FS4B 2O5LX 3RJ6A 4TWVA 1ECDA 1HBHA 1YDZB 3DUTB 4KMVA 1MWBA 1FN3A 1SHRB 1HDBA 1CLSB 1THBA 3ODQA 2ZS1C 3BA2A 3EDAA 1S56A 2G14A 4ROMA 4DWTA 107MA 1NZ5A 1V9QA 1MNKA 4U8UB 1PBXB 1F65A 3IC0A 1HBRB 1YMAA 4ROLB 2ZT0A 1MOAA 1W92A 2VM0A 1Y5FB 2R4YA 1DXTA 4NXCA 3WCUC 3WCTB 5HAVA 3HXNB 1VXGA 2HBEB 2ZFBA 1OJ6A 1BZPA 1JZLA 1R1XA 5AB8A 1FAWB 1Y22B 1BBBA 1KD2A 2D2MC 1G0BB 1V4XB 5SW7B 2ZLVB 1S5XA 3WCWC 3UHUA 1M6MA 3A2GA 2BK9A 4MXKA 1M9PB 1CQXA 1VHBA 4NI0A 5CN9A 1S6AA 1DWRA 2D6CA 4F6JA 3NFEA 1O1KA 1MBIA 1NPFA 3UHIA 1G0BA 1V4XA 2DHBA 2ZS0C 1HLBA 1DLYA 1J7WB 3DR9A 1HGAB 2YRSB 4MQKA 3OZUA 3NL7A 3A5GA 2ZFOA 3AT5A
chains in the Genus database with same CATH superfamily
4A8MP 2EKTA 3QJBA 3UHHA 1O1IA 1F99A 2G0SA 1UVNA 2ZSQA 2ZLTA 3MJPA 2AV3A 3WFTA 3ECLA 4LM6B 1MYJA 3D7OB 1Y01B 1BUWA 3PI2A 3GYSA 1YG5B 2D2MD 1HJTA 1LUEA 4F6BA 1YVTB 3PI1A 2ZSXA 2BWHA 1CMYA 1URYA 2H8FA 4H0BA 2R4WA 1CBMA 1HDAA 1TU9A 1MNJA 1Y31B 2HBCA 106MA 1YDZA 3QM9A 3P5QA 4N7NB 1JZMA 2MGHA 1NWNA 1XYEA 4ESAA 5SW7A 5HLQA 2QRWA 2DC3A 2QU0A 1F5PA 2HBFA 3LQ9A 4G51A 1HBAA 1VRFA 1FDHG 1YFFB 4YU3B 4KJTA 2ZSOA 1DLWA 2ZS0A 1RQ4B 4TMAB 4XS0A 1YZIA 3OJ1A 2MGJA 1HI0P 3CY5B 1YCBA 2G10A 1G9VB 2ZSPA 1MOHA 1Y4RA 1HSYA 4O1TA 1BZ0A 2DXMB 1J7SB 4MXLA 1IT3A 1YHEB 2BV8B 2Z6NA 2HZ3A 1MLFA 1MYZA 3GDJB 4A8WA 3LB3A 1B86B 1A87A 4PO5A 3O18B 2FRIX 1YE0A 1QPWA 4FC3A 3VHBA 3UH3A 3M39A 2UULC 1LFYA 4ESAB 2AA1B 1LJWB 2E2YA 1X46A 3WCVD 3WCWB 3EU1A 1XZVB 1MBSA 5CNFA 1QPWB 2VJRB 3R0GA 5ILMA 2MHBB 3BOMA 4PQBA 3R5IB 2ZFOD 4X0LA 2MGFA 3BJ2B 3GDJA 2BV8A 2LH3A 1BVDA 4G1BA 3D7OA 1YVQB 1F0LA 1YOGA 4Z8KB 1A4FA 2DXMA 1IRCA 3D4XB 1UVMA 1WMUA 3WCUB 5EOHA 2XYKA 1Z8UB 3QJEB 1G9VA 1MLGA 1XXTA 1Y0WA 1OUTB 1LIAA 1Y0DA 2ZS0B 4M4AB 4IROA 3RGKA 3NUHB 1S5YB 1YENB 4MQIA 3TM9A 1HGAA 1CBLA 3WHMB 1Y0TB 3O2CA 1HHOB 1GDLA 1NPGA 5HLUA 1XF6C 1Y4BA 2GL3A 1SDLB 3NG6A 2HHEA 2VLYA 3ARJA 5CNEA 1NIHA 2MYBA 3VRFA 4NI1A 2NX0A 3ONZA 3WTGA 4MQHA 3GQGA 3EU1B 1DM1A 1BZRA 2ZS1A 2QLSB 1HA7A 2HBSB 5CNDA 1Y46A 1O1NA 2SPOA 2O58X 3LB2A 4HSXA 1IBEB 1JL6A 3S65A 1RQ3A 7HBIA 2EKUA 1CG5A 1YMCA 5HLXA 2V1GA 2ZFBB 2VJHA 1EWAA 3UHNA 3GKTA 4MQGB 4A8OA 3WFUA 1Y7ZA 5KKKA 3WFXA 5ILRA 1JP6A 1LH1A 1YVQA 2G12A 1YEUA 3D1AA 1BZ0B 4Q70A 2PGHB 1IRDB 1Y5JB 1A3NB 1Y4PA 1A3OB 4GY3B 3R5IA 4NZIA 1GLIA 1MKOB 1MBCA 1NS6B 3D1KB 1HBHB 4LMSB 2CMMA 1MLOA 4HRTB 2QSSB 4DC8A 4YJJA 1YEOB 5F0BA 2GKMA 2AA1A 2MYCA 1BINA 3HF4B 4XXKA 1K0YA 2ZT1A 4FC3B 2NSRA 1CP0A 3B75A 1G0AB 1XQ5B 1V4WB 4NK1A 3UHGA 1K1KA 2LH1A 5KERB 5JOMA 1JEBB 3OVUC 4PO5B 4MQJA 1UVKA 3PT8A 2EB9A 5EUIB 3MWNA 1UVYA 3WCTA 2PGHA 1OBMA 3A59A 2GTLB 2W31A 2O5TX 4HHBA 1HBIA 1MNHA 1JP8A 1U7RA 1J7SA 2XKGA 1YEVB 2MGLA 3IC0B 3UHSA 1MLHA 1AZIA 1B33A 4MQGA 1Y4FA 2G3HA 1DXVA 1A6MA 3CY5A 2EB8A 3BRPA 2QFKA 2ZLXB 3G4YA 1THBB 3V58A 1CG5B 1I3EA 1LFQB 3DUTA 4N7OB 1WVPA 2G11A 5JDOC 3OO5A 3S65B 2HBFB 1QSHB 1KN1A 1XZ2B 3OZWA 4ODCB 3ZJHA 4PNJA 4YJJB 3UHYA 105MA 2HHBB 3PIAA 1X9FD 5C6YA 1NEJB 2HBCB 5HU6A 3D17A 2BKMA 1SDLA 2D2NB 3UHEA 2V1FA 1F63A 3ASEA 4GXEA 4TYXA 1UVXA 4L7YB 2H8DB 3LB1A 1YG5A 3AG0A 2D2NC 1NZ4A 1MBOA 1B8DB 2AUPA 3A5BA 1MTKA 1MLQA 5MBAA 1TESA 1HBSB 1DKEA 5EU2A 2MB5A 3K9ZA 2GLNA 1GDIA 1O1PA 1HBSA 3AT5B 1Y8IA 1MWCA 1Y0CB 2BW9M 2UULA 3AQ6A 2GKNA 3ZOMA 3UHBA 2ZSYA 1OUUB 1J7WA 1MBDA 1MBAA 1RVWB 2H8DA 3FH9B 1BJEA 1YE2B 4MQHB 5HU6B 1CLSA 2UUNB 3ODQB 3ONZB 3WTGB 1UMOA 4MAXA 110MA 103MA 4ZVBA 2VEBA 1GDKA 3NG6B 3ZJOA 2OH9A 3TLDA 1UC3A 2DN3A 1FDHA 1KTPA 1LFTB 1MLKA 1SPGA 1O1MA 2UUMX 2FRJX 1GH0B 1XZUB 3HYUA 4HH0A 1RTXA 3QZZA 3K8BA 1YEQB 4H2LA 1DXVB 1V75A 5E6EA 2FAMA 1HCOB 1QSIB 1YGFA 1YHUB 3GQPB 5JGGB 1Y0AA 1LTWA 3QM6A 2ZLUB 3UGYA 1HRMA 2B7HA 3HEOA 3IA3B 5E83A 4U8UA 3PI3A 4YU4A 1NS9A 4M4BA 2V1IA 4KN3A 3ZJLA 2MGGA 2G0XA 2DN1B 2Z6TA 1COLA 1YFFA 2HCOA 4ILZA 2ZS0D 2HBGA 1UT0A 1ALLB 2PEGA 1Y35B 1NXFA 2DN3B 1OR6A 2MYAA 4HRTA 4F6FA 4UURA 4NI1B 3G46A 1NS6A 3LQDA 1Y31A 1XZ7A 2VJTB 1DO1A 1YE2A 3ZJNA 1A3OA 4DWUA 1GVHA 1QXEB 3O2CB 3WHMA 1MLSA 1UVIA 1JPBA 1CQ2A 1PHNA 3ZOLA 4ZIZA 4ETUA 2NRMA 1M6CA 1YHRA 1C7DA 1Y0CA 3E5OA 4JYQA 4M4AA 1MTJA 1J3YA 2C7KB 2QMBA 4DC7A 5CNGA 3UGZA 3AQ8A 2D5XA 4OODA 1HHTP 3M3BA 3GOUA 3D4XA 1A4FB 2R50A 1COHB 2MYDA 2HBDB 1MGNA 4ZIZB 2QU0B 1MDNA 1CG8A 5CHQA 1QXEA 3BJ2A 2D60A 1HA7B 4X0LB 2ZS1B 3A0GA 1DUOA 1DXUB 2VJTA 1Y45A 1CH4A 2ZSZA 1OFKA 3OGBA 2HHBA 3AQ7A 1V07A 1XDTT 4KMWA 2DKDA 2C7LA 5C6EB 2ZLVA 1IWHA 3PT7B 1HHOA 1X9FA 2HZ2A 4MBNA 1BUWB 3PMCA 2HHDA 1BBBB 1J7YA 4F4OA 3RJNB 1VWTA 5B13G 1GZXA 3NMMB 1NQPA 4BJAA 5CN4A 1BZZA 3ZJQA 3UH7A 1XXTB 3GIOA 1VXHA 1A0UA 2EF2A 3HENA 3PELB 4F0UA 1DO7A 1LH3A 1VXDA 2X4AA 2R80B 1DXTB 3AT6A 5E29A 1Y2ZA 2VRYA 3HRWB 3GQPA 5JGGA 3VAUA 1ABWA 1H1XA 4G1VA 1CPCB 4N6SB 1JP9A 1LA6A 1Y4RB 2O5QX 2MGAA 1IDRA 1UVLA 1AJ9A 3DHRB 1FLPA 2R4XA 3A9MA 2V1HA 4HSWA 1CH1A 5KDQA 2V1KA 1A9WA 1A9WE 3HYUB 1XY0A 2Z6SA 1G0AA 3GK9A 1DXDA 3WCTD 1BVCA 2BLIA 2MGCA 4G51B 1MLNA 3WCWA 3MVCA 2JLGA 3PI4A 3V2VA 1RQAA 3FS4A 1C7BB 1T1NB 4ETTA 1A6KA 1QXDA 1KD2B 3ZHWA 2HCOB 2ZSTA 1YH9A 3WR1B 1FAWA 3V57B 1SPEA 2MGMA 1HDAB 3E4NA 1Y5JA 3FH9A 2ZFOC 2ZSRA 102MA 4AE1A 2ZSNA 1Y0AB 3MKBB 1GCWB 4FH6A 4U8UC 3IC2A 3MJUB 1VXFA 2R80A 5E29B 1Y8IB 4U8UD 5MBNA 1RPSB 1YIEA 3SDNA 2C0KA 3PELA 1R1YA 1HABA 4MPMA 5F2AA 1YZIB 1CH2A 5EQMA 3V2ZA 1HGCA 1RQ3B 1HBAB 1CO8A 3WCPA 5EE4D 1SPGB 1I7YB 5FVBA 4OF9A 1LH2A 2C7JA 1IWHB 2UULH 1Y8WA 1WACA 1YGDB 1ASHA 5CN6A 4QAUA 1YMBA 3QM5A 3P5QB 2FRFA 3GLNA 4A8SA 1CH3A 1NIHB 3WFWA 1A00B 108MA 2VMLA 1Y85A 1QSHA 1OR4A 1LFVB 3KUOA 1COHA 1Y4GA 1LFQA 1JY7A 3MBAA 2ZWJA 1LIAB 1Y0DB 2ZSSA 3MJPB 1ECAA 3GOUB 112MA 2D5XB 2FRKX 1O16A 1X3KA 3G4UA 3HXNA 1J3YB 4L1EB 1YEVA 4N8TB 2WCQA 3G4VA 2YRSA 4MQKB 3MJUA 2SPLA 1PHNB 5B85A 2GTLA 1HBRA 4ROLA 2DHBB 1MZ0A 1SWMA 2AURA 4GXEB 1RH1A 2LH7A 4NI0B 1UIWB 1GDJA 3MYMA 1CPWA 1Y7CB 2AUOA 1FHJB 1S5XB 1LJWA 1XZ2A 1JWNA 3UHTA 1Y7GB 2BLHA 5EYSA 104MA 2LH2A 2AV0A 109MA 1R1XB 1G08A 3UHWA 4WJGA 1GLIB 3ZJMA 2ZLXA 3QJCA 1Y8KB 3BRPB 1AJHA 2V1JA 3EDBA 2G0RA 1S69A 3O18A 2BMMA 1A0ZB 5CMVA 3HHBB 3BJ3B 3E55A 1IRDA 1O1OA 2H35A 1ECOA 1Y5FA 3A5AA 2H35B 2LH5A 3AT6B 2JHOA 3EOKA 1C40A 1XZ4B 1Y7ZB 1JF4A 5EUIA 2GRZA 3PT8B 2GNWA 4O4ZA 4ROMB 3DHTB 1S0HB 1D8UA 4PQCA 1K1KB 1FN3B 1SHRA 2NRLA 1TOXA 3ZJJA 1JZKA 2YSKA 2RI4A 1Y46B 2VMLB 3VREA 3GQGB 1RSEA 4F68A 1A00A 1BABB 1C7CA 1Y83A 2VYYA 1MBNA 2ZLWA 4HBIA 1NZ3A 2GDMA 3G4QA 2MGEA 3CIUB 2D5ZB 3RQRA 2W72C 3KVSB 1S5YA 1LHTA 1YENA 3SZKA 2JLFA 1MWDA 1HACB 1ABYB 1CIIA 1MYMA 4FWYA 1F99B 1HABB 1J3FA 5CNCA 1V4UB 4UIQA 3BCQA 4AVEA 1JBOA 2M6ZB 1CO9A 1HBBB 2Z85A 2DN2A 2D2ND 1NQPB 3O7NA 4IT8A 4F6DA 4B02A 1GCWA 3S66A 2J96A 2X49A 2W6WA 1G09A 1BZ6A 2D5ZA 1O1NB 2C7LB 5C6EA 2IG3A 1UFJA 1XG0C 5EV5A 3M38A 1KFRA 4WCHD 3NMLA 3OO4A 3S48C 1DO4A 2LH6A 1O1LA 2MGBA 3PI8B 1MCYA 3PI9B 4LMXB 4ODCA 2RI4B 3VREB 1LFLB 1ALLA 1Y09A 1NY9A 1BIJA 2XKIA 1Y7DA 1AJGA 1J41B 1UFPA 2NSSA 5FVBM 3GUQA 1JBOB 1MYIA 3QQRA 4MU5A 1EYXA 1Q1FA 3GKVA 1X9FC 1YIEB 1MODA 2ZLUA 1BZ1B 4MQCB 1Y4QA 3SZKB 2OLPA 3IC2B 1N9HA 1YGFB 5ILPA 1GBUB 1Y4QB 4O35A 3TM3A 1BZ1A 1WLAA 1HDSA 1J40B 1Y8HA 2OH8A 2VYZA 3AQ9A 4VHBA 5HY8A 4MQJB 2R1HA 4B4YA 4NK2A 3ECZA 1JL7A 2ZLWB 4A8KA 2V8AB 5EE4C 1Y5KA 1HV4A 1U7SA 1C7CB 1O1JB 4HH1A 1IT2A 3BJ1B 1CH7A 2UUND 2GRFA 1XYEB 1DDTA 1I3DA 5CN5A 1MYFA 1O1JA 2VLXA 3D1KA 2W6VB 1HV4B 1IOPA 5KDQB 1Y45B 3UHZA 1J3ZB 4M4BB 1J52A 5HY8B 1CMYB 2H8FB 1MLRA 2QFNA 4RMPA 4Q70B 4C0NA 4GZGA 2Z6NB 1GBUA 1MNOA 1ABWB 3QJDA 3GQRB 1YHUA 2DN2B 1O1OB 1V75B 5E6EB 3S1IA 3GKVB 1MLLA 1Y8KA 1VXCA 3UHCA 3ECXA 3K8BB 5D5RA 3H57A 1ABYA 1QI8B 3NL7B 2ZS1D 3NMMA 3QM8A 1GZXB 2GNVA 2MGDA 6HBWB 1MLJA 5CHRA 1J41A 1Y7GA 1X9FB 1KTPB 5M3SA 3UHKA 1O1KB 1FHJA 3UHVA 2D2NA 2W72A 3OO4B 1M9PA 3ED9A 2GRHA 2VYWA 2HHEB 5AQDM 3O89A 1YGDA 1MNIA 3GYSB 2IN4A 4FH7A 3HC9A 4IROB 1HGCB 1N9XA 2BLJM 4XXIA 3V58B 1OUTA 3BCQB 1Y0WB 1V4UA 3LR7A 1Y4FB 1DKEB 1RPSA 3UHDA 2ZFOB 1C7DB 1LH6A 3WI8A 1B8DA 1H97A 1GJNA 1OFJA 1YHUD 3A59B 1MOBA 1PBXA 3NFEB 3KMFA 1J3ZA 3QJCB 1HDBB 4WJG1 3LQDB 1V4WA 5CNBA 1MLUA 1NEJA 2W72B 2XKHA 2HZ1A 1HBGA 4SDHA 2RAOB 1K0YB 3K3UA 4A8QA 3G4RA 3QQQA 1CIKA 3W4UB 2EVKA 3OO5B 2QSSA 3AQ5A 2W6YA 2QSPB 1Y7CA 1Y22A 1XY0B 3LB4A 1Y5KB 4AVDA 2KSCA 1S0HA 3DHRA 2HBEA 5CN8A 4YU4B 3QMAA 1LHSA 1B33B 2ZT4A 3MN0A 1QGWC 3EOKB 1LFZB 1RVWA 1VXBA 3D1AB 5HBIA 1YHEA 1SDKB 3DBJB 3G52A 3HRWA 1LH7A 5D1VA 3PMDA 101MA 1JDOA 4N8TA 3OZVA 1HGBB 2G0ZA 1S61A 2ZT3A 4H2LB 1JEBA 4B3WA 2I88A 2OHAA 1BZZB 1HI1A 2O5SX 4AE0A 2W6VA 1JY7B 1Y4GB 3ORDA 5JDOE 3SDHA 1UX9A 1VWTB 1Y4VB 4UZVA 1O1MB 2VHBA 4XDIA 3HF4A 3W4UA 1BIJB 1LFVA 3L0FB 4L7YA 1B0BA 1A6GA 1RQAB 2GTLC 2QLSA 1YEOA 1N9IA 2MGKA 3BJ1A 1YIHB 3VNCA 1CIOA 2O5BX 4HRRB 1ECNA 3UBVA 1GBVB 2WTHA 1VXEA 3ZJRA 2V8AA 3KUNA 1A01A 3A0GB 3E5IA 1UVJA 1EBCA 2R1HB 4GY3A 2W6XA 1DWSA 1LA6B 2R4ZA 2WTGA 1Y0TA 1YEUB 3S66B 1ON7A 3WCPB 1F5OA 2DKAA 2V1EA 3G53A 6HBWA 5EYJA 4N7OA 5CN7A 1HBBA 4MQCA 4L1EA 3WCVB 3WCVC 4F0UB 1O1PB 4BJUA 1O1IB 1GCVB 4ESUA 3WCVA 1HACA 1MYHA 3GQRA 3KVSA 1FCSA 3MKBA 1Y7DB 1SI4B 2MGIA 5AZRA 1DUKA 3PT7A 5B13A 4A8FA 2HBSA 2AUQA 1FSLA 3ARLA 3PI9A 1XZ5B 1MDTA 3D17B 1A01B 2MHBA 5KERA 3V57A 3UH6A 1MYGA 1GBVA 1XQ5A 1N9FA 3VRGA 1NGKA 4FWXA 3B75B 4FWZA 1YIHA 4O2GA 3WCUD 1QXDB 2D60B 2O5OX 1V5HA 1LFYB 1G09B 4TWUA 1I7YA 2GTLD 1A6NA 3QZXA 4N7PA 1Y4VA 3MOUA 2DN1A 1DXCA 1MKOA 2LHBA 1YCAA 1YE0B 2O5MX 3DHTA 1NS9B 1R1YB 1YHUC 1A3NA 1PMBA 1Y4PB 5E83B 1J40A 1Y8HB 2C7KA 1HGBA 1HDSB 4O4TA 1WMUB 3WCUA 2OIFA 1MTIA 1YHRB 2BNLA 4HHBB 1MYTA 1HCOA 3UHRA 1LFZA 4RMPB 4C44A 3CIUA 1VXAA 1A0UB 2VEEA 1YEQA 3UI0A 3BOMB 4L2MA 4MBAA 1Y83B 1DTIA 1XZUA 1CH9A 1VREA 4YU3A 1YOIA 1XZVA 4N7PB 1J7YB 4F4OB 4PQ6A 1XCHA 4F6GA 1LFTA 1Y09B 111MA 3S1JA 2SPNA 1JW8A 2RAOA 1O1LB 4N7NA 3UHQA 1DO3A 5ILEA 5JDOF 1EW6A 2DKCA 3VRFB 1DTMA 3U3EA 1UIWA 1AJ9B 2D2MA 3MYNA 1XZ5A 1Y4BB 3ARKA 3FEWX 3M3AA 3KMFC 4F6IA 1C40B 1B86A 1XZ4A 1ITHA 1CG8B 3ZJSA 1SI4A 4MQIB 2HBDA 3UH5A 1RTEA 1QSIA 3H58A 1Y2ZB 1DWTA 2UULB 4BS9A 3WCWD 3BJ3A 3HHBA 4A8YA 1LH5A 1FSXA 1YOHA 2MBWA 2ZT2A 4NXAA 3QJEA 1EYXB 2VLZA 4XS0B 2WY4A 5JDOD 1MLMA 1NZ2A 2HHDB 1ON7B 1IBEA 3QM7A 5EETA 1LFLA 3PI8A 3UHXA 4ZVAA 6HBIA 2JL9A 3LR9A 3VRGB 2UUMB 1XZ7B 4LPIA 4F0TB 1BABA 2UUMA 4F69A 1DXUA 2Z8AA 3ZJPA 1CH5A 3ZJIA 1CP5A 1HLMA 1UX8A 1YVTA 1L2KA 3OK5A 3ZH0A 2PEGB 1ABSA 3G4WA 3L0FA 3HEPA 3WCTC 1OUUA 1HHSA 1EBTA 1MOCA 1QI8A 2M6ZA 2ZLTB 5IKSA 1URVA 4ERVA 1GCVA 2OHBA 3QJBB 1FSXB 4H0MA 4H07A 2QMBB 4NS2A 2B7HB 3IXFA 4JACA 4Z8KA 2G0VA 1NWIA 1NAZA 5B84A 3QJDB 1SDKA 3DBJA 3LHBA 2SPMA 2MYEA 5AZQA 2FALA 1Y85B 4ERTA 1A0ZA 1KR7A 2D2MB 1EMYA 1G08B 1RQ4A 2VJRA 1YH9B 3WR1A 2EVPA 3UBCA 4HRRA 3PIAB 2QSPA 1JF3A 1C7BA 1T1NA 1Y8WB 1Y35A 3FS4B 2C7JB 1KN1B 2O5LX 3RJ6A 4TWVA 1ECDA 1HBHA 1YDZB 3DUTB 4KMVA 1MWBA 1FN3A 1SHRB 1HDBA 1CLSB 1THBA 2UUNA 3ODQA 2ZS1C 3BA2A 3EDAA 1S56A 2G14A 4ROMA 4DWTA 107MA 3ZTAA 1NZ5A 1V9QA 1MNKA 4U8UB 1PBXB 1F65A 3IC0A 1HBRB 1YMAA 4ROLB 1CPCA 2ZT0A 1MOAA 1W92A 2VM0A 1Y5FB 1HI8A 2R4YA 1DXTA 4NXCA 3WCUC 3WCTB 5HAVA 3HXNB 4H0MB 5AQDA 1VXGA 2HBEB 2VJHB 2ZFBA 4ETVA 1OJ6A 1BZPA 1JZLA 1R1XA 5AB8A 1FAWB 1Y22B 1GH0A 1BBBA 1KD2A 2D2MC 1G0BB 1V4XB 5SW7B 2ZLVB 1S5XA 3WCWC 3UHUA 2UULD 1M6MA 3A2GA 4F0TA 2BK9A 4MXKA 1SGKA 1M9PB 1CQXA 1VHBA 4NI0A 5CN9A 1S6AA 1DWRA 2WCRA 2D6CA 4F6JA 3NFEA 1O1KA 1MBIA 1NPFA 3UHIA 1G0BA 1V4XA 2DHBA 2ZS0C 1HLBA 1DLYA 4N6SA 1J7WB 3DR9A 1HGAB 2YRSB 4MQKA 3OZUA 3NL7A 3A5GA 2ZFOA 3AT5A
chains in the Genus database with same CATH topology
2EKTA 3QJBA 3UHHA 1O1IA 2G0SA 2ZSQA 2ZLTA 3MJPA 2AV3A 3WFTA 3ECLA 1MYJA 3D7OB 1Y01B 1BUWA 3PI2A 3GYSA 1YG5B 2D2MD 1HJTA 1LUEA 4F6BA 1YVTB 3PI1A 2ZSXA 2BWHA 1CMYA 1URYA 2H8FA 4H0BA 2R4WA 1CBMA 1HDAA 1TU9A 1MNJA 1Y31B 2HBCA 106MA 1YDZA 3QM9A 3P5QA 4N7NB 1JZMA 2MGHA 1NWNA 1XYEA 4ESAA 5SW7A 5HLQA 2QRWA 2DC3A 2QU0A 1F5PA 2HBFA 4G51A 1HBAA 1VRFA 1FDHG 1YFFB 4YU3B 4KJTA 2ZSOA 1DLWA 2ZS0A 1RQ4B 4XS0A 1YZIA 3OJ1A 2MGJA 3CY5B 1YCBA 2G10A 1G9VB 2ZSPA 1MOHA 1Y4RA 1HSYA 4O1TA 1BZ0A 2DXMB 1J7SB 4MXLA 1IT3A 1YHEB 2Z6NA 2HZ3A 1MLFA 1MYZA 3GDJB 3LB3A 1B86B 2FRIX 1YE0A 1QPWA 4FC3A 3VHBA 3UH3A 3M39A 1LFYA 4ESAB 2AA1B 1LJWB 2E2YA 1X46A 3WCVD 3WCWB 3EU1A 1XZVB 1MBSA 5CNFA 1QPWB 3R0GA 5ILMA 2MHBB 3BOMA 4PQBA 3R5IB 2ZFOD 4X0LA 2MGFA 3BJ2B 3GDJA 2LH3A 1BVDA 4G1BA 3D7OA 1YOGA 1YVQB 1A4FA 2DXMA 1IRCA 3D4XB 1WMUA 3WCUB 5EOHA 2XYKA 1Z8UB 3QJEB 1G9VA 1MLGA 1XXTA 1Y0WA 1OUTB 1Y0DA 2ZS0B 4M4AB 4IROA 3RGKA 1S5YB 1YENB 4MQIA 3TM9A 1HGAA 1CBLA 3WHMB 1Y0TB 1HHOB 1GDLA 1NPGA 5HLUA 1Y4BA 2GL3A 1SDLB 3NG6A 2HHEA 2VLYA 3ARJA 5CNEA 1NIHA 2MYBA 3VRFA 4NI1A 2NX0A 3ONZA 3WTGA 4MQHA 3GQGA 3EU1B 1DM1A 1BZRA 2ZS1A 2QLSB 2HBSB 5CNDA 1Y46A 1O1NA 2SPOA 2O58X 3LB2A 4HSXA 1IBEB 1JL6A 3S65A 1RQ3A 7HBIA 2EKUA 1CG5A 1YMCA 5HLXA 2V1GA 2ZFBB 1EWAA 3UHNA 3GKTA 4MQGB 3WFUA 1Y7ZA 5KKKA 3WFXA 5ILRA 1JP6A 1LH1A 1YVQA 2G12A 1YEUA 3D1AA 1BZ0B 2PGHB 1IRDB 1Y5JB 1A3NB 1Y4PA 1A3OB 3R5IA 4NZIA 1GLIA 1MKOB 1MBCA 1NS6B 3D1KB 1HBHB 2CMMA 1MLOA 4HRTB 2QSSB 4DC8A 1YEOB 5F0BA 2GKMA 2AA1A 2MYCA 1BINA 3HF4B 1K0YA 2ZT1A 4FC3B 2NSRA 1CP0A 3B75A 1G0AB 1XQ5B 1V4WB 4NK1A 3UHGA 1K1KA 2LH1A 5KERB 5JOMA 1JEBB 3OVUC 4MQJA 3PT8A 2EB9A 5EUIB 1UVYA 3WCTA 2PGHA 1OBMA 3A59A 2GTLB 2W31A 2O5TX 4HHBA 1HBIA 1MNHA 1JP8A 1U7RA 1J7SA 2XKGA 1YEVB 2MGLA 3IC0B 3UHSA 1MLHA 1AZIA 4MQGA 1Y4FA 2G3HA 1DXVA 1A6MA 3CY5A 2EB8A 2QFKA 2ZLXB 3G4YA 1THBB 1CG5B 1I3EA 1LFQB 3DUTA 4N7OB 1WVPA 2G11A 5JDOC 3OO5A 3S65B 2HBFB 1QSHB 1XZ2B 3OZWA 4ODCB 3ZJHA 4PNJA 3UHYA 105MA 2HHBB 3PIAA 1X9FD 5C6YA 1NEJB 2HBCB 5HU6A 3D17A 2BKMA 1SDLA 2D2NB 3UHEA 2V1FA 1F63A 3ASEA 4TYXA 1UVXA 4L7YB 2H8DB 3LB1A 1YG5A 3AG0A 2D2NC 1NZ4A 1MBOA 2AUPA 3A5BA 1MTKA 1MLQA 5MBAA 1TESA 1HBSB 1DKEA 5EU2A 2MB5A 3K9ZA 2GLNA 1GDIA 1O1PA 1HBSA 3AT5B 1Y8IA 1MWCA 1Y0CB 2BW9M 3AQ6A 2GKNA 3ZOMA 3UHBA 2ZSYA 1OUUB 1J7WA 1MBDA 1MBAA 1RVWB 2H8DA 3FH9B 1BJEA 1YE2B 4MQHB 5HU6B 1CLSA 3ODQB 3ONZB 3WTGB 1UMOA 4MAXA 110MA 103MA 4ZVBA 2VEBA 1GDKA 3NG6B 3ZJOA 2OH9A 3TLDA 1UC3A 2DN3A 1FDHA 1LFTB 1MLKA 1SPGA 1O1MA 2FRJX 1XZUB 3HYUA 1RTXA 3QZZA 3K8BA 1YEQB 4H2LA 1DXVB 1V75A 5E6EA 2FAMA 1HCOB 1QSIB 1YGFA 1YHUB 3GQPB 5JGGB 1Y0AA 1LTWA 3QM6A 2ZLUB 3UGYA 1HRMA 2B7HA 3HEOA 3IA3B 5E83A 4U8UA 3PI3A 4YU4A 1NS9A 4M4BA 2V1IA 4KN3A 3ZJLA 2MGGA 2G0XA 2DN1B 2Z6TA 1YFFA 2HCOA 4ILZA 2ZS0D 2HBGA 1UT0A 2PEGA 1Y35B 1NXFA 2DN3B 1OR6A 2MYAA 4HRTA 4F6FA 4UURA 4NI1B 3G46A 1NS6A 3LQDA 1Y31A 1XZ7A 1DO1A 1YE2A 3ZJNA 1A3OA 4DWUA 1GVHA 1QXEB 3WHMA 1MLSA 1JPBA 1CQ2A 3ZOLA 2NRMA 1M6CA 1YHRA 1C7DA 1Y0CA 3E5OA 4JYQA 4M4AA 1MTJA 1J3YA 2QMBA 4DC7A 5CNGA 3UGZA 3AQ8A 2D5XA 4OODA 3M3BA 3GOUA 3D4XA 1A4FB 2R50A 1COHB 2MYDA 2HBDB 1MGNA 2QU0B 1MDNA 1CG8A 5CHQA 1QXEA 3BJ2A 2D60A 4X0LB 2ZS1B 3A0GA 1DUOA 1DXUB 1Y45A 1CH4A 2ZSZA 1OFKA 3OGBA 2HHBA 3AQ7A 1V07A 4KMWA 5C6EB 2ZLVA 1IWHA 3PT7B 1HHOA 1X9FA 2HZ2A 4MBNA 1BUWB 2HHDA 1BBBB 1J7YA 4F4OA 3RJNB 1VWTA 1GZXA 3NMMB 1NQPA 4BJAA 5CN4A 1BZZA 3ZJQA 3UH7A 1XXTB 1VXHA 1A0UA 2EF2A 3HENA 3PELB 1DO7A 1LH3A 1VXDA 2R80B 1DXTB 3AT6A 5E29A 1Y2ZA 2VRYA 3HRWB 3GQPA 5JGGA 3VAUA 1ABWA 1H1XA 4G1VA 1JP9A 1LA6A 1Y4RB 2O5QX 2MGAA 1IDRA 1AJ9A 3DHRB 1FLPA 2R4XA 3A9MA 2V1HA 4HSWA 1CH1A 5KDQA 2V1KA 1A9WA 1A9WE 3HYUB 1XY0A 2Z6SA 1G0AA 3GK9A 1DXDA 3WCTD 1BVCA 2BLIA 2MGCA 4G51B 1MLNA 3WCWA 3MVCA 3PI4A 3V2VA 1RQAA 3FS4A 1C7BB 1T1NB 1A6KA 1QXDA 1KD2B 3ZHWA 2HCOB 2ZSTA 1YH9A 3WR1B 1FAWA 1SPEA 2MGMA 1HDAB 3E4NA 1Y5JA 3FH9A 2ZFOC 2ZSRA 102MA 2ZSNA 1Y0AB 3MKBB 1GCWB 4FH6A 4U8UC 3IC2A 3MJUB 1VXFA 2R80A 5E29B 1Y8IB 4U8UD 5MBNA 1RPSB 1YIEA 3SDNA 2C0KA 3PELA 1R1YA 1HABA 4MPMA 5F2AA 1YZIB 1CH2A 5EQMA 3V2ZA 1HGCA 1RQ3B 1HBAB 1CO8A 3WCPA 5EE4D 1SPGB 4OF9A 1LH2A 1IWHB 1Y8WA 1YGDB 1ASHA 5CN6A 4QAUA 1YMBA 3QM5A 3P5QB 2FRFA 3GLNA 1CH3A 1NIHB 3WFWA 1A00B 108MA 1Y85A 1QSHA 1OR4A 1LFVB 3KUOA 1COHA 1Y4GA 1LFQA 1JY7A 3MBAA 2ZWJA 1Y0DB 2ZSSA 3MJPB 1ECAA 3GOUB 112MA 2D5XB 2FRKX 1O16A 1X3KA 3G4UA 3HXNA 1J3YB 1YEVA 4N8TB 3G4VA 2YRSA 4MQKB 3MJUA 2SPLA 5B85A 2GTLA 1HBRA 4ROLA 2DHBB 1MZ0A 1SWMA 2AURA 2LH7A 4NI0B 1UIWB 1GDJA 3MYMA 1CPWA 1Y7CB 2AUOA 1FHJB 1S5XB 1LJWA 1XZ2A 1JWNA 3UHTA 1Y7GB 2BLHA 5EYSA 104MA 2LH2A 2AV0A 109MA 1R1XB 1G08A 3UHWA 4WJGA 1GLIB 3ZJMA 2ZLXA 3QJCA 1Y8KB 1AJHA 2V1JA 3EDBA 2G0RA 1S69A 2BMMA 1A0ZB 5CMVA 3HHBB 3BJ3B 3E55A 1IRDA 1O1OA 2H35A 1ECOA 1Y5FA 3A5AA 2H35B 2LH5A 3AT6B 2JHOA 3EOKA 1C40A 1XZ4B 1Y7ZB 1JF4A 5EUIA 2GRZA 3PT8B 2GNWA 4O4ZA 4ROMB 3DHTB 1S0HB 1D8UA 4PQCA 1K1KB 1FN3B 1SHRA 2NRLA 3ZJJA 1JZKA 2RI4A 1Y46B 3VREA 3GQGB 1RSEA 4F68A 1A00A 1BABB 1C7CA 1Y83A 2VYYA 1MBNA 2ZLWA 4HBIA 1NZ3A 2GDMA 3G4QA 2MGEA 3CIUB 2D5ZB 2W72C 1S5YA 1LHTA 1YENA 3SZKA 1MWDA 1HACB 1ABYB 1MYMA 4FWYA 1HABB 1J3FA 5CNCA 1V4UB 4UIQA 3BCQA 4AVEA 2M6ZB 1CO9A 1HBBB 2Z85A 2DN2A 2D2ND 1NQPB 3O7NA 4IT8A 4F6DA 1GCWA 3S66A 2W6WA 1G09A 1BZ6A 2D5ZA 1O1NB 5C6EA 2IG3A 1UFJA 5EV5A 3M38A 1KFRA 4WCHD 3NMLA 3OO4A 3S48C 1DO4A 2LH6A 1O1LA 2MGBA 3PI8B 1MCYA 3PI9B 4ODCA 2RI4B 3VREB 1LFLB 1Y09A 1BIJA 2XKIA 1Y7DA 1AJGA 1J41B 1UFPA 2NSSA 1MYIA 3QQRA 4MU5A 1Q1FA 3GKVA 1X9FC 1YIEB 1MODA 2ZLUA 1BZ1B 4MQCB 1Y4QA 3SZKB 2OLPA 3IC2B 1N9HA 1YGFB 5ILPA 1GBUB 1Y4QB 4O35A 3TM3A 1BZ1A 1WLAA 1HDSA 1J40B 1Y8HA 2OH8A 2VYZA 3AQ9A 4VHBA 5HY8A 4MQJB 2R1HA 4B4YA 4NK2A 3ECZA 1JL7A 2ZLWB 5EE4C 1Y5KA 1HV4A 1U7SA 1C7CB 1O1JB 1IT2A 3BJ1B 1CH7A 2GRFA 1XYEB 1I3DA 5CN5A 1MYFA 1O1JA 2VLXA 3D1KA 2W6VB 1HV4B 1IOPA 5KDQB 1Y45B 3UHZA 1J3ZB 4M4BB 1J52A 5HY8B 1CMYB 2H8FB 1MLRA 2QFNA 4C0NA 4GZGA 2Z6NB 1MNOA 1GBUA 1ABWB 3QJDA 3GQRB 1YHUA 2DN2B 1O1OB 1V75B 5E6EB 3S1IA 3GKVB 1MLLA 1Y8KA 1VXCA 3UHCA 3ECXA 5D5RA 3K8BB 3H57A 1ABYA 1QI8B 3NL7B 2ZS1D 3NMMA 3QM8A 1GZXB 2GNVA 2MGDA 6HBWB 1MLJA 5CHRA 1J41A 1Y7GA 1X9FB 5M3SA 3UHKA 1O1KB 1FHJA 3UHVA 2D2NA 2W72A 3OO4B 1M9PA 3ED9A 2GRHA 2VYWA 2HHEB 3O89A 1YGDA 1MNIA 3GYSB 2IN4A 4FH7A 3HC9A 4IROB 1HGCB 1N9XA 2BLJM 1OUTA 3BCQB 1Y0WB 1V4UA 3LR7A 1Y4FB 1DKEB 1RPSA 3UHDA 2ZFOB 1C7DB 1LH6A 3WI8A 1H97A 1GJNA 1OFJA 1YHUD 3A59B 1MOBA 1PBXA 3NFEB 3KMFA 1J3ZA 3QJCB 1HDBB 4WJG1 3LQDB 5CNBA 1V4WA 1MLUA 1NEJA 2W72B 2XKHA 2HZ1A 1HBGA 4SDHA 2RAOB 1K0YB 3K3UA 3G4RA 3QQQA 1CIKA 3W4UB 2EVKA 3OO5B 2QSSA 3AQ5A 2W6YA 2QSPB 1Y7CA 1Y22A 1XY0B 3LB4A 1Y5KB 4AVDA 2KSCA 1S0HA 3DHRA 2HBEA 5CN8A 4YU4B 3QMAA 1LHSA 2ZT4A 3MN0A 3EOKB 1LFZB 1RVWA 1VXBA 3D1AB 5HBIA 1YHEA 1SDKB 3G52A 3HRWA 1LH7A 5D1VA 101MA 1JDOA 4N8TA 3OZVA 1HGBB 2G0ZA 1S61A 2ZT3A 4H2LB 1JEBA 4B3WA 2OHAA 1BZZB 2O5SX 2W6VA 1JY7B 1Y4GB 3SDHA 5JDOE 3ORDA 1UX9A 1VWTB 1Y4VB 4UZVA 1O1MB 2VHBA 4XDIA 3HF4A 3W4UA 1BIJB 1LFVA 4L7YA 1B0BA 1A6GA 1RQAB 2GTLC 2QLSA 1YEOA 1N9IA 2MGKA 3BJ1A 1YIHB 1CIOA 2O5BX 4HRRB 1ECNA 3UBVA 1GBVB 2WTHA 1VXEA 3ZJRA 3KUNA 1A01A 3A0GB 3E5IA 1EBCA 2R1HB 2W6XA 1DWSA 1LA6B 2R4ZA 2WTGA 1Y0TA 1YEUB 3S66B 3WCPB 1F5OA 2V1EA 3G53A 6HBWA 5EYJA 4N7OA 5CN7A 1HBBA 4MQCA 3WCVB 3WCVC 1O1PB 1O1IB 1GCVB 3WCVA 1HACA 1MYHA 3GQRA 1FCSA 3MKBA 1Y7DB 1SI4B 2MGIA 5AZRA 1DUKA 3PT7A 2HBSA 2AUQA 1FSLA 3ARLA 3PI9A 1XZ5B 3D17B 1A01B 2MHBA 5KERA 3UH6A 1MYGA 1GBVA 1XQ5A 1N9FA 3VRGA 1NGKA 4FWXA 3B75B 4FWZA 1YIHA 4O2GA 3WCUD 1QXDB 2D60B 2O5OX 1V5HA 1LFYB 1G09B 4TWUA 2GTLD 1A6NA 3QZXA 4N7PA 1Y4VA 3MOUA 2DN1A 1MKOA 1DXCA 2LHBA 1YCAA 1YE0B 2O5MX 3DHTA 1NS9B 1R1YB 1YHUC 1A3NA 1PMBA 1Y4PB 5E83B 1J40A 1Y8HB 1HGBA 1HDSB 4O4TA 1WMUB 3WCUA 2OIFA 1MTIA 1YHRB 2BNLA 4HHBB 1MYTA 1HCOA 3UHRA 1LFZA 4C44A 3CIUA 1VXAA 1A0UB 2VEEA 1YEQA 3UI0A 3BOMB 4L2MA 4MBAA 1Y83B 1DTIA 1XZUA 1CH9A 1VREA 4YU3A 1YOIA 1XZVA 4N7PB 1J7YB 4F4OB 4PQ6A 1XCHA 4F6GA 1LFTA 1Y09B 111MA 3S1JA 2SPNA 1JW8A 2RAOA 1O1LB 4N7NA 3UHQA 1DO3A 5ILEA 5JDOF 1EW6A 3VRFB 1DTMA 3U3EA 1UIWA 1AJ9B 2D2MA 3MYNA 1XZ5A 1Y4BB 3ARKA 3M3AA 3KMFC 4F6IA 1C40B 1B86A 1XZ4A 1ITHA 1CG8B 3ZJSA 1SI4A 4MQIB 2HBDA 3UH5A 1RTEA 1QSIA 3H58A 1Y2ZB 1DWTA 3WCWD 3BJ3A 3HHBA 1LH5A 1FSXA 1YOHA 2MBWA 2ZT2A 4NXAA 3QJEA 2VLZA 4XS0B 2WY4A 5JDOD 1MLMA 1NZ2A 2HHDB 1IBEA 3QM7A 5EETA 1LFLA 3PI8A 3UHXA 4ZVAA 6HBIA 3LR9A 3VRGB 1XZ7B 4LPIA 1BABA 4F69A 1DXUA 2Z8AA 3ZJPA 1CH5A 3ZJIA 1CP5A 1HLMA 1UX8A 1YVTA 1L2KA 3OK5A 3ZH0A 2PEGB 1ABSA 3G4WA 3HEPA 3WCTC 1OUUA 1EBTA 1MOCA 1QI8A 2M6ZA 2ZLTB 5IKSA 1URVA 1GCVA 2OHBA 3QJBB 1FSXB 4H07A 2QMBB 4NS2A 2B7HB 3IXFA 4JACA 2G0VA 1NWIA 1NAZA 5B84A 3QJDB 1SDKA 3LHBA 2SPMA 2MYEA 5AZQA 2FALA 1Y85B 1A0ZA 1KR7A 2D2MB 1EMYA 1G08B 1RQ4A 1YH9B 3WR1A 2EVPA 3UBCA 4HRRA 3PIAB 2QSPA 1JF3A 1C7BA 1T1NA 1Y8WB 1Y35A 3FS4B 2O5LX 3RJ6A 4TWVA 1ECDA 1HBHA 1YDZB 3DUTB 4KMVA 1MWBA 1FN3A 1SHRB 1HDBA 1CLSB 1THBA 3ODQA 2ZS1C 3BA2A 3EDAA 1S56A 2G14A 4ROMA 4DWTA 107MA 1NZ5A 1V9QA 1MNKA 4U8UB 1PBXB 1F65A 3IC0A 1HBRB 1YMAA 4ROLB 2ZT0A 1MOAA 1W92A 2VM0A 1Y5FB 2R4YA 1DXTA 4NXCA 3WCUC 3WCTB 5HAVA 3HXNB 1VXGA 2HBEB 2ZFBA 1OJ6A 1BZPA 1JZLA 1R1XA 5AB8A 1FAWB 1Y22B 1BBBA 1KD2A 2D2MC 1G0BB 1V4XB 5SW7B 2ZLVB 1S5XA 3WCWC 3UHUA 1M6MA 3A2GA 2BK9A 4MXKA 1M9PB 1CQXA 1VHBA 4NI0A 5CN9A 1S6AA 1DWRA 2D6CA 4F6JA 3NFEA 1O1KA 1MBIA 1NPFA 3UHIA 1G0BA 1V4XA 2DHBA 2ZS0C 1HLBA 1DLYA 1J7WB 3DR9A 1HGAB 2YRSB 4MQKA 3OZUA 3NL7A 3A5GA 2ZFOA 3AT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKT A;  3QJB A;  3UHH A;  1O1I A;  2G0S A;  2ZSQ A;  2ZLT A;  3MJP A;  2AV3 A;  3WFT A;  3ECL A;  1MYJ A;  3D7O B;  1Y01 B;  1BUW A;  3PI2 A;  3GYS A;  1YG5 B;  2D2M D;  1HJT A;  1LUE A;  4F6B A;  1YVT B;  3PI1 A;  2ZSX A;  2BWH A;  1CMY A;  1URY A;  2H8F A;  4H0B A;  2R4W A;  1CBM A;  1HDA A;  1TU9 A;  1MNJ A;  1Y31 B;  2HBC A;  106M A;  1YDZ A;  3QM9 A;  3P5Q A;  4N7N B;  1JZM A;  2MGH A;  1NWN A;  1XYE A;  4ESA A;  5SW7 A;  5HLQ A;  2QRW A;  2DC3 A;  2QU0 A;  1F5P A;  2HBF A;  4G51 A;  1HBA A;  1VRF A;  1FDH G;  1YFF B;  4YU3 B;  4KJT A;  2ZSO A;  1DLW A;  2ZS0 A;  1RQ4 B;  4XS0 A;  1YZI A;  3OJ1 A;  2MGJ A;  3CY5 B;  1YCB A;  2G10 A;  1G9V B;  2ZSP A;  1MOH A;  1Y4R A;  1HSY A;  4O1T A;  1BZ0 A;  2DXM B;  1J7S B;  4MXL A;  1IT3 A;  1YHE B;  2Z6N A;  2HZ3 A;  1MLF A;  1MYZ A;  3GDJ B;  3LB3 A;  1B86 B;  2FRI X;  1YE0 A;  1QPW A;  4FC3 A;  3VHB A;  3UH3 A;  3M39 A;  1LFY A;  4ESA B;  2AA1 B;  1LJW B;  2E2Y A;  1X46 A;  3WCV D;  3WCW B;  3EU1 A;  1XZV B;  1MBS A;  5CNF A;  1QPW B;  3R0G A;  5ILM A;  2MHB B;  3BOM A;  4PQB A;  3R5I B;  2ZFO D;  4X0L A;  2MGF A;  3BJ2 B;  3GDJ A;  2LH3 A;  1BVD A;  4G1B A;  3D7O A;  1YOG A;  1YVQ B;  1A4F A;  2DXM A;  1IRC A;  3D4X B;  1WMU A;  3WCU B;  5EOH A;  2XYK A;  1Z8U B;  3QJE B;  1G9V A;  1MLG A;  1XXT A;  1Y0W A;  1OUT B;  1Y0D A;  2ZS0 B;  4M4A B;  4IRO A;  3RGK A;  1S5Y B;  1YEN B;  4MQI A;  3TM9 A;  1HGA A;  1CBL A;  3WHM B;  1Y0T B;  1HHO B;  1GDL A;  1NPG A;  5HLU A;  1Y4B A;  2GL3 A;  1SDL B;  3NG6 A;  2HHE A;  2VLY A;  3ARJ A;  5CNE A;  1NIH A;  2MYB A;  3VRF A;  4NI1 A;  2NX0 A;  3ONZ A;  3WTG A;  4MQH A;  3GQG A;  3EU1 B;  1DM1 A;  1BZR A;  2ZS1 A;  2QLS B;  2HBS B;  5CND A;  1Y46 A;  1O1N A;  2SPO A;  2O58 X;  3LB2 A;  4HSX A;  1IBE B;  1JL6 A;  3S65 A;  1RQ3 A;  7HBI A;  2EKU A;  1CG5 A;  1YMC A;  5HLX A;  2V1G A;  2ZFB B;  1EWA A;  3UHN A;  3GKT A;  4MQG B;  3WFU A;  1Y7Z A;  5KKK A;  3WFX A;  5ILR A;  1JP6 A;  1LH1 A;  1YVQ A;  2G12 A;  1YEU A;  3D1A A;  1BZ0 B;  2PGH B;  1IRD B;  1Y5J B;  1A3N B;  1Y4P A;  1A3O B;  3R5I A;  4NZI A;  1GLI A;  1MKO B;  1MBC A;  1NS6 B;  3D1K B;  1HBH B;  2CMM A;  1MLO A;  4HRT B;  2QSS B;  4DC8 A;  1YEO B;  5F0B A;  2GKM A;  2AA1 A;  2MYC A;  1BIN A;  3HF4 B;  1K0Y A;  2ZT1 A;  4FC3 B;  2NSR A;  1CP0 A;  3B75 A;  1G0A B;  1XQ5 B;  1V4W B;  4NK1 A;  3UHG A;  1K1K A;  2LH1 A;  5KER B;  5JOM A;  1JEB B;  3OVU C;  4MQJ A;  3PT8 A;  2EB9 A;  5EUI B;  1UVY A;  3WCT A;  2PGH A;  1OBM A;  3A59 A;  2GTL B;  2W31 A;  2O5T X;  4HHB A;  1HBI A;  1MNH A;  1JP8 A;  1U7R A;  1J7S A;  2XKG A;  1YEV B;  2MGL A;  3IC0 B;  3UHS A;  1MLH A;  1AZI A;  4MQG A;  1Y4F A;  2G3H A;  1DXV A;  1A6M A;  3CY5 A;  2EB8 A;  2QFK A;  2ZLX B;  3G4Y A;  1THB B;  1CG5 B;  1I3E A;  1LFQ B;  3DUT A;  4N7O B;  1WVP A;  2G11 A;  5JDO C;  3OO5 A;  3S65 B;  2HBF B;  1QSH B;  1XZ2 B;  3OZW A;  4ODC B;  3ZJH A;  4PNJ A;  3UHY A;  105M A;  2HHB B;  3PIA A;  1X9F D;  5C6Y A;  1NEJ B;  2HBC B;  5HU6 A;  3D17 A;  2BKM A;  1SDL A;  2D2N B;  3UHE A;  2V1F A;  1F63 A;  3ASE A;  4TYX A;  1UVX A;  4L7Y B;  2H8D B;  3LB1 A;  1YG5 A;  3AG0 A;  2D2N C;  1NZ4 A;  1MBO A;  2AUP A;  3A5B A;  1MTK A;  1MLQ A;  5MBA A;  1TES A;  1HBS B;  1DKE A;  5EU2 A;  2MB5 A;  3K9Z A;  2GLN A;  1GDI A;  1O1P A;  1HBS A;  3AT5 B;  1Y8I A;  1MWC A;  1Y0C B;  2BW9 M;  3AQ6 A;  2GKN A;  3ZOM A;  3UHB A;  2ZSY A;  1OUU B;  1J7W A;  1MBD A;  1MBA A;  1RVW B;  2H8D A;  3FH9 B;  1BJE A;  1YE2 B;  4MQH B;  5HU6 B;  1CLS A;  3ODQ B;  3ONZ B;  3WTG B;  1UMO A;  4MAX A;  110M A;  103M A;  4ZVB A;  2VEB A;  1GDK A;  3NG6 B;  3ZJO A;  2OH9 A;  3TLD A;  1UC3 A;  2DN3 A;  1FDH A;  1LFT B;  1MLK A;  1SPG A;  1O1M A;  2FRJ X;  1XZU B;  3HYU A;  1RTX A;  3QZZ A;  3K8B A;  1YEQ B;  4H2L A;  1DXV B;  1V75 A;  5E6E A;  2FAM A;  1HCO B;  1QSI B;  1YGF A;  1YHU B;  3GQP B;  5JGG B;  1Y0A A;  1LTW A;  3QM6 A;  2ZLU B;  3UGY A;  1HRM A;  2B7H A;  3HEO A;  3IA3 B;  5E83 A;  4U8U A;  3PI3 A;  4YU4 A;  1NS9 A;  4M4B A;  2V1I A;  4KN3 A;  3ZJL A;  2MGG A;  2G0X A;  2DN1 B;  2Z6T A;  1YFF A;  2HCO A;  4ILZ A;  2ZS0 D;  2HBG A;  1UT0 A;  2PEG A;  1Y35 B;  1NXF A;  2DN3 B;  1OR6 A;  2MYA A;  4HRT A;  4F6F A;  4UUR A;  4NI1 B;  3G46 A;  1NS6 A;  3LQD A;  1Y31 A;  1XZ7 A;  1DO1 A;  1YE2 A;  3ZJN A;  1A3O A;  4DWU A;  1GVH A;  1QXE B;  3WHM A;  1MLS A;  1JPB A;  1CQ2 A;  3ZOL A;  2NRM A;  1M6C A;  1YHR A;  1C7D A;  1Y0C A;  3E5O A;  4JYQ A;  4M4A A;  1MTJ A;  1J3Y A;  2QMB A;  4DC7 A;  5CNG A;  3UGZ A;  3AQ8 A;  2D5X A;  4OOD A;  3M3B A;  3GOU A;  3D4X A;  1A4F B;  2R50 A;  1COH B;  2MYD A;  2HBD B;  1MGN A;  2QU0 B;  1MDN A;  1CG8 A;  5CHQ A;  1QXE A;  3BJ2 A;  2D60 A;  4X0L B;  2ZS1 B;  3A0G A;  1DUO A;  1DXU B;  1Y45 A;  1CH4 A;  2ZSZ A;  1OFK A;  3OGB A;  2HHB A;  3AQ7 A;  1V07 A;  4KMW A;  5C6E B;  2ZLV A;  1IWH A;  3PT7 B;  1HHO A;  1X9F A;  2HZ2 A;  4MBN A;  1BUW B;  2HHD A;  1BBB B;  1J7Y A;  4F4O A;  3RJN B;  1VWT A;  1GZX A;  3NMM B;  1NQP A;  4BJA A;  5CN4 A;  1BZZ A;  3ZJQ A;  3UH7 A;  1XXT B;  1VXH A;  1A0U A;  2EF2 A;  3HEN A;  3PEL B;  1DO7 A;  1LH3 A;  1VXD A;  2R80 B;  1DXT B;  3AT6 A;  5E29 A;  1Y2Z A;  2VRY A;  3HRW B;  3GQP A;  5JGG A;  3VAU A;  1ABW A;  1H1X A;  4G1V A;  1JP9 A;  1LA6 A;  1Y4R B;  2O5Q X;  2MGA A;  1IDR A;  1AJ9 A;  3DHR B;  1FLP A;  2R4X A;  3A9M A;  2V1H A;  4HSW A;  1CH1 A;  5KDQ A;  2V1K A;  1A9W A;  1A9W E;  3HYU B;  1XY0 A;  2Z6S A;  1G0A A;  3GK9 A;  1DXD A;  3WCT D;  1BVC A;  2BLI A;  2MGC A;  4G51 B;  1MLN A;  3WCW A;  3MVC A;  3PI4 A;  3V2V A;  1RQA A;  3FS4 A;  1C7B B;  1T1N B;  1A6K A;  1QXD A;  1KD2 B;  3ZHW A;  2HCO B;  2ZST A;  1YH9 A;  3WR1 B;  1FAW A;  1SPE A;  2MGM A;  1HDA B;  3E4N A;  1Y5J A;  3FH9 A;  2ZFO C;  2ZSR A;  102M A;  2ZSN A;  1Y0A B;  3MKB B;  1GCW B;  4FH6 A;  4U8U C;  3IC2 A;  3MJU B;  1VXF A;  2R80 A;  5E29 B;  1Y8I B;  4U8U D;  5MBN A;  1RPS B;  1YIE A;  3SDN A;  2C0K A;  3PEL A;  1R1Y A;  1HAB A;  4MPM A;  5F2A A;  1YZI B;  1CH2 A;  5EQM A;  3V2Z A;  1HGC A;  1RQ3 B;  1HBA B;  1CO8 A;  3WCP A;  5EE4 D;  1SPG B;  4OF9 A;  1LH2 A;  1IWH B;  1Y8W A;  1YGD B;  1ASH A;  5CN6 A;  4QAU A;  1YMB A;  3QM5 A;  3P5Q B;  2FRF A;  3GLN A;  1CH3 A;  1NIH B;  3WFW A;  1A00 B;  108M A;  1Y85 A;  1QSH A;  1OR4 A;  1LFV B;  3KUO A;  1COH A;  1Y4G A;  1LFQ A;  1JY7 A;  3MBA A;  2ZWJ A;  1Y0D B;  2ZSS A;  3MJP B;  1ECA A;  3GOU B;  112M A;  2D5X B;  2FRK X;  1O16 A;  1X3K A;  3G4U A;  3HXN A;  1J3Y B;  1YEV A;  4N8T B;  3G4V A;  2YRS A;  4MQK B;  3MJU A;  2SPL A;  5B85 A;  2GTL A;  1HBR A;  4ROL A;  2DHB B;  1MZ0 A;  1SWM A;  2AUR A;  2LH7 A;  4NI0 B;  1UIW B;  1GDJ A;  3MYM A;  1CPW A;  1Y7C B;  2AUO A;  1FHJ B;  1S5X B;  1LJW A;  1XZ2 A;  1JWN A;  3UHT A;  1Y7G B;  2BLH A;  5EYS A;  104M A;  2LH2 A;  2AV0 A;  109M A;  1R1X B;  1G08 A;  3UHW A;  4WJG A;  1GLI B;  3ZJM A;  2ZLX A;  3QJC A;  1Y8K B;  1AJH A;  2V1J A;  3EDB A;  2G0R A;  1S69 A;  2BMM A;  1A0Z B;  5CMV A;  3HHB B;  3BJ3 B;  3E55 A;  1IRD A;  1O1O A;  2H35 A;  1ECO A;  1Y5F A;  3A5A A;  2H35 B;  2LH5 A;  3AT6 B;  2JHO A;  3EOK A;  1C40 A;  1XZ4 B;  1Y7Z B;  1JF4 A;  5EUI A;  2GRZ A;  3PT8 B;  2GNW A;  4O4Z A;  4ROM B;  3DHT B;  1S0H B;  1D8U A;  4PQC A;  1K1K B;  1FN3 B;  1SHR A;  2NRL A;  3ZJJ A;  1JZK A;  2RI4 A;  1Y46 B;  3VRE A;  3GQG B;  1RSE A;  4F68 A;  1A00 A;  1BAB B;  1C7C A;  1Y83 A;  2VYY A;  1MBN A;  2ZLW A;  4HBI A;  1NZ3 A;  2GDM A;  3G4Q A;  2MGE A;  3CIU B;  2D5Z B;  2W72 C;  1S5Y A;  1LHT A;  1YEN A;  3SZK A;  1MWD A;  1HAC B;  1ABY B;  1MYM A;  4FWY A;  1HAB B;  1J3F A;  5CNC A;  1V4U B;  4UIQ A;  3BCQ A;  4AVE A;  2M6Z B;  1CO9 A;  1HBB B;  2Z85 A;  2DN2 A;  2D2N D;  1NQP B;  3O7N A;  4IT8 A;  4F6D A;  1GCW A;  3S66 A;  2W6W A;  1G09 A;  1BZ6 A;  2D5Z A;  1O1N B;  5C6E A;  2IG3 A;  1UFJ A;  5EV5 A;  3M38 A;  1KFR A;  4WCH D;  3NML A;  3OO4 A;  3S48 C;  1DO4 A;  2LH6 A;  1O1L A;  2MGB A;  3PI8 B;  1MCY A;  3PI9 B;  4ODC A;  2RI4 B;  3VRE B;  1LFL B;  1Y09 A;  1BIJ A;  2XKI A;  1Y7D A;  1AJG A;  1J41 B;  1UFP A;  2NSS A;  1MYI A;  3QQR A;  4MU5 A;  1Q1F A;  3GKV A;  1X9F C;  1YIE B;  1MOD A;  2ZLU A;  1BZ1 B;  4MQC B;  1Y4Q A;  3SZK B;  2OLP A;  3IC2 B;  1N9H A;  1YGF B;  5ILP A;  1GBU B;  1Y4Q B;  4O35 A;  3TM3 A;  1BZ1 A;  1WLA A;  1HDS A;  1J40 B;  1Y8H A;  2OH8 A;  2VYZ A;  3AQ9 A;  4VHB A;  5HY8 A;  4MQJ B;  2R1H A;  4B4Y A;  4NK2 A;  3ECZ A;  1JL7 A;  2ZLW B;  5EE4 C;  1Y5K A;  1HV4 A;  1U7S A;  1C7C B;  1O1J B;  1IT2 A;  3BJ1 B;  1CH7 A;  2GRF A;  1XYE B;  1I3D A;  5CN5 A;  1MYF A;  1O1J A;  2VLX A;  3D1K A;  2W6V B;  1HV4 B;  1IOP A;  5KDQ B;  1Y45 B;  3UHZ A;  1J3Z B;  4M4B B;  1J52 A;  5HY8 B;  1CMY B;  2H8F B;  1MLR A;  2QFN A;  4C0N A;  4GZG A;  2Z6N B;  1MNO A;  1GBU A;  1ABW B;  3QJD A;  3GQR B;  1YHU A;  2DN2 B;  1O1O B;  1V75 B;  5E6E B;  3S1I A;  3GKV B;  1MLL A;  1Y8K A;  1VXC A;  3UHC A;  3ECX A;  5D5R A;  3K8B B;  3H57 A;  1ABY A;  1QI8 B;  3NL7 B;  2ZS1 D;  3NMM A;  3QM8 A;  1GZX B;  2GNV A;  2MGD A;  6HBW B;  1MLJ A;  5CHR A;  1J41 A;  1Y7G A;  1X9F B;  5M3S A;  3UHK A;  1O1K B;  1FHJ A;  3UHV A;  2D2N A;  2W72 A;  3OO4 B;  1M9P A;  3ED9 A;  2GRH A;  2VYW A;  2HHE B;  3O89 A;  1YGD A;  1MNI A;  3GYS B;  2IN4 A;  4FH7 A;  3HC9 A;  4IRO B;  1HGC B;  1N9X A;  2BLJ M;  1OUT A;  3BCQ B;  1Y0W B;  1V4U A;  3LR7 A;  1Y4F B;  1DKE B;  1RPS A;  3UHD A;  2ZFO B;  1C7D B;  1LH6 A;  3WI8 A;  1H97 A;  1GJN A;  1OFJ A;  1YHU D;  3A59 B;  1MOB A;  1PBX A;  3NFE B;  3KMF A;  1J3Z A;  3QJC B;  1HDB B;  4WJG 1;  3LQD B;  5CNB A;  1V4W A;  1MLU A;  1NEJ A;  2W72 B;  2XKH A;  2HZ1 A;  1HBG A;  4SDH A;  2RAO B;  1K0Y B;  3K3U A;  3G4R A;  3QQQ A;  1CIK A;  3W4U B;  2EVK A;  3OO5 B;  2QSS A;  3AQ5 A;  2W6Y A;  2QSP B;  1Y7C A;  1Y22 A;  1XY0 B;  3LB4 A;  1Y5K B;  4AVD A;  2KSC A;  1S0H A;  3DHR A;  2HBE A;  5CN8 A;  4YU4 B;  3QMA A;  1LHS A;  2ZT4 A;  3MN0 A;  3EOK B;  1LFZ B;  1RVW A;  1VXB A;  3D1A B;  5HBI A;  1YHE A;  1SDK B;  3G52 A;  3HRW A;  1LH7 A;  5D1V A;  101M A;  1JDO A;  4N8T A;  3OZV A;  1HGB B;  2G0Z A;  1S61 A;  2ZT3 A;  4H2L B;  1JEB A;  4B3W A;  2OHA A;  1BZZ B;  2O5S X;  2W6V A;  1JY7 B;  1Y4G B;  3SDH A;  5JDO E;  3ORD A;  1UX9 A;  1VWT B;  1Y4V B;  4UZV A;  1O1M B;  2VHB A;  4XDI A;  3HF4 A;  3W4U A;  1BIJ B;  1LFV A;  4L7Y A;  1B0B A;  1A6G A;  1RQA B;  2GTL C;  2QLS A;  1YEO A;  1N9I A;  2MGK A;  3BJ1 A;  1YIH B;  1CIO A;  2O5B X;  4HRR B;  1ECN A;  3UBV A;  1GBV B;  2WTH A;  1VXE A;  3ZJR A;  3KUN A;  1A01 A;  3A0G B;  3E5I A;  1EBC A;  2R1H B;  2W6X A;  1DWS A;  1LA6 B;  2R4Z A;  2WTG A;  1Y0T A;  1YEU B;  3S66 B;  3WCP B;  1F5O A;  2V1E A;  3G53 A;  6HBW A;  5EYJ A;  4N7O A;  5CN7 A;  1HBB A;  4MQC A;  3WCV B;  3WCV C;  1O1P B;  1O1I B;  1GCV B;  3WCV A;  1HAC A;  1MYH A;  3GQR A;  1FCS A;  3MKB A;  1Y7D B;  1SI4 B;  2MGI A;  5AZR A;  1DUK A;  3PT7 A;  2HBS A;  2AUQ A;  1FSL A;  3ARL A;  3PI9 A;  1XZ5 B;  3D17 B;  1A01 B;  2MHB A;  5KER A;  3UH6 A;  1MYG A;  1GBV A;  1XQ5 A;  1N9F A;  3VRG A;  1NGK A;  4FWX A;  3B75 B;  4FWZ A;  1YIH A;  4O2G A;  3WCU D;  1QXD B;  2D60 B;  2O5O X;  1V5H A;  1LFY B;  1G09 B;  4TWU A;  2GTL D;  1A6N A;  3QZX A;  4N7P A;  1Y4V A;  3MOU A;  2DN1 A;  1MKO A;  1DXC A;  2LHB A;  1YCA A;  1YE0 B;  2O5M X;  3DHT A;  1NS9 B;  1R1Y B;  1YHU C;  1A3N A;  1PMB A;  1Y4P B;  5E83 B;  1J40 A;  1Y8H B;  1HGB A;  1HDS B;  4O4T A;  1WMU B;  3WCU A;  2OIF A;  1MTI A;  1YHR B;  2BNL A;  4HHB B;  1MYT A;  1HCO A;  3UHR A;  1LFZ A;  4C44 A;  3CIU A;  1VXA A;  1A0U B;  2VEE A;  1YEQ A;  3UI0 A;  3BOM B;  4L2M A;  4MBA A;  1Y83 B;  1DTI A;  1XZU A;  1CH9 A;  1VRE A;  4YU3 A;  1YOI A;  1XZV A;  4N7P B;  1J7Y B;  4F4O B;  4PQ6 A;  1XCH A;  4F6G A;  1LFT A;  1Y09 B;  111M A;  3S1J A;  2SPN A;  1JW8 A;  2RAO A;  1O1L B;  4N7N A;  3UHQ A;  1DO3 A;  5ILE A;  5JDO F;  1EW6 A;  3VRF B;  1DTM A;  3U3E A;  1UIW A;  1AJ9 B;  2D2M A;  3MYN A;  1XZ5 A;  1Y4B B;  3ARK A;  3M3A A;  3KMF C;  4F6I A;  1C40 B;  1B86 A;  1XZ4 A;  1ITH A;  1CG8 B;  3ZJS A;  1SI4 A;  4MQI B;  2HBD A;  3UH5 A;  1RTE A;  1QSI A;  3H58 A;  1Y2Z B;  1DWT A;  3WCW D;  3BJ3 A;  3HHB A;  1LH5 A;  1FSX A;  1YOH A;  2MBW A;  2ZT2 A;  4NXA A;  3QJE A;  2VLZ A;  4XS0 B;  2WY4 A;  5JDO D;  1MLM A;  1NZ2 A;  2HHD B;  1IBE A;  3QM7 A;  5EET A;  1LFL A;  3PI8 A;  3UHX A;  4ZVA A;  6HBI A;  3LR9 A;  3VRG B;  1XZ7 B;  4LPI A;  1BAB A;  4F69 A;  1DXU A;  2Z8A A;  3ZJP A;  1CH5 A;  3ZJI A;  1CP5 A;  1HLM A;  1UX8 A;  1YVT A;  1L2K A;  3OK5 A;  3ZH0 A;  2PEG B;  1ABS A;  3G4W A;  3HEP A;  3WCT C;  1OUU A;  1EBT A;  1MOC A;  1QI8 A;  2M6Z A;  2ZLT B;  5IKS A;  1URV A;  1GCV A;  2OHB A;  3QJB B;  1FSX B;  4H07 A;  2QMB B;  4NS2 A;  2B7H B;  3IXF A;  4JAC A;  2G0V A;  1NWI A;  1NAZ A;  5B84 A;  3QJD B;  1SDK A;  3LHB A;  2SPM A;  2MYE A;  5AZQ A;  2FAL A;  1Y85 B;  1A0Z A;  1KR7 A;  2D2M B;  1EMY A;  1G08 B;  1RQ4 A;  1YH9 B;  3WR1 A;  2EVP A;  3UBC A;  4HRR A;  3PIA B;  2QSP A;  1JF3 A;  1C7B A;  1T1N A;  1Y8W B;  1Y35 A;  3FS4 B;  2O5L X;  3RJ6 A;  4TWV A;  1ECD A;  1HBH A;  1YDZ B;  3DUT B;  4KMV A;  1MWB A;  1FN3 A;  1SHR B;  1HDB A;  1CLS B;  1THB A;  3ODQ A;  2ZS1 C;  3BA2 A;  3EDA A;  1S56 A;  2G14 A;  4ROM A;  4DWT A;  107M A;  1NZ5 A;  1V9Q A;  1MNK A;  4U8U B;  1PBX B;  1F65 A;  3IC0 A;  1HBR B;  1YMA A;  4ROL B;  2ZT0 A;  1MOA A;  1W92 A;  2VM0 A;  1Y5F B;  2R4Y A;  1DXT A;  4NXC A;  3WCU C;  3WCT B;  5HAV A;  3HXN B;  1VXG A;  2HBE B;  2ZFB A;  1OJ6 A;  1BZP A;  1JZL A;  1R1X A;  5AB8 A;  1FAW B;  1Y22 B;  1BBB A;  1KD2 A;  2D2M C;  1G0B B;  1V4X B;  5SW7 B;  2ZLV B;  1S5X A;  3WCW C;  3UHU A;  1M6M A;  3A2G A;  2BK9 A;  4MXK A;  1M9P B;  1CQX A;  1VHB A;  4NI0 A;  5CN9 A;  1S6A A;  1DWR A;  2D6C A;  4F6J A;  3NFE A;  1O1K A;  1MBI A;  1NPF A;  3UHI A;  1G0B A;  1V4X A;  2DHB A;  2ZS0 C;  1HLB A;  1DLY A;  1J7W B;  3DR9 A;  1HGA B;  2YRS B;  4MQK A;  3OZU A;  3NL7 A;  3A5G A;  2ZFO A;  3AT5 A; 
#chains in the Genus database with same CATH topology
 4A8M P;  2EKT A;  3QJB A;  3UHH A;  1O1I A;  1F99 A;  2G0S A;  1UVN A;  2ZSQ A;  2ZLT A;  3MJP A;  2AV3 A;  3WFT A;  3ECL A;  4LM6 B;  1MYJ A;  3D7O B;  1Y01 B;  1BUW A;  3PI2 A;  3GYS A;  1YG5 B;  2D2M D;  1HJT A;  1LUE A;  4F6B A;  1YVT B;  3PI1 A;  2ZSX A;  2BWH A;  1CMY A;  1URY A;  2H8F A;  4H0B A;  2R4W A;  1CBM A;  1HDA A;  1TU9 A;  1MNJ A;  1Y31 B;  2HBC A;  106M A;  1YDZ A;  3QM9 A;  3P5Q A;  4N7N B;  1JZM A;  2MGH A;  1NWN A;  1XYE A;  4ESA A;  5SW7 A;  5HLQ A;  2QRW A;  2DC3 A;  2QU0 A;  1F5P A;  2HBF A;  3LQ9 A;  4G51 A;  1HBA A;  1VRF A;  1FDH G;  1YFF B;  4YU3 B;  4KJT A;  2ZSO A;  1DLW A;  2ZS0 A;  1RQ4 B;  4TMA B;  4XS0 A;  1YZI A;  3OJ1 A;  2MGJ A;  1HI0 P;  3CY5 B;  1YCB A;  2G10 A;  1G9V B;  2ZSP A;  1MOH A;  1Y4R A;  1HSY A;  4O1T A;  1BZ0 A;  2DXM B;  1J7S B;  4MXL A;  1IT3 A;  1YHE B;  2BV8 B;  2Z6N A;  2HZ3 A;  1MLF A;  1MYZ A;  3GDJ B;  4A8W A;  3LB3 A;  1B86 B;  1A87 A;  4PO5 A;  3O18 B;  2FRI X;  1YE0 A;  1QPW A;  4FC3 A;  3VHB A;  3UH3 A;  3M39 A;  2UUL C;  1LFY A;  4ESA B;  2AA1 B;  1LJW B;  2E2Y A;  1X46 A;  3WCV D;  3WCW B;  3EU1 A;  1XZV B;  1MBS A;  5CNF A;  1QPW B;  2VJR B;  3R0G A;  5ILM A;  2MHB B;  3BOM A;  4PQB A;  3R5I B;  2ZFO D;  4X0L A;  2MGF A;  3BJ2 B;  3GDJ A;  2BV8 A;  2LH3 A;  1BVD A;  4G1B A;  3D7O A;  1YVQ B;  1F0L A;  1YOG A;  4Z8K B;  1A4F A;  2DXM A;  1IRC A;  3D4X B;  1UVM A;  1WMU A;  3WCU B;  5EOH A;  2XYK A;  1Z8U B;  3QJE B;  1G9V A;  1MLG A;  1XXT A;  1Y0W A;  1OUT B;  1LIA A;  1Y0D A;  2ZS0 B;  4M4A B;  4IRO A;  3RGK A;  3NUH B;  1S5Y B;  1YEN B;  4MQI A;  3TM9 A;  1HGA A;  1CBL A;  3WHM B;  1Y0T B;  3O2C A;  1HHO B;  1GDL A;  1NPG A;  5HLU A;  1XF6 C;  1Y4B A;  2GL3 A;  1SDL B;  3NG6 A;  2HHE A;  2VLY A;  3ARJ A;  5CNE A;  1NIH A;  2MYB A;  3VRF A;  4NI1 A;  2NX0 A;  3ONZ A;  3WTG A;  4MQH A;  3GQG A;  3EU1 B;  1DM1 A;  1BZR A;  2ZS1 A;  2QLS B;  1HA7 A;  2HBS B;  5CND A;  1Y46 A;  1O1N A;  2SPO A;  2O58 X;  3LB2 A;  4HSX A;  1IBE B;  1JL6 A;  3S65 A;  1RQ3 A;  7HBI A;  2EKU A;  1CG5 A;  1YMC A;  5HLX A;  2V1G A;  2ZFB B;  2VJH A;  1EWA A;  3UHN A;  3GKT A;  4MQG B;  4A8O A;  3WFU A;  1Y7Z A;  5KKK A;  3WFX A;  5ILR A;  1JP6 A;  1LH1 A;  1YVQ A;  2G12 A;  1YEU A;  3D1A A;  1BZ0 B;  4Q70 A;  2PGH B;  1IRD B;  1Y5J B;  1A3N B;  1Y4P A;  1A3O B;  4GY3 B;  3R5I A;  4NZI A;  1GLI A;  1MKO B;  1MBC A;  1NS6 B;  3D1K B;  1HBH B;  4LMS B;  2CMM A;  1MLO A;  4HRT B;  2QSS B;  4DC8 A;  4YJJ A;  1YEO B;  5F0B A;  2GKM A;  2AA1 A;  2MYC A;  1BIN A;  3HF4 B;  4XXK A;  1K0Y A;  2ZT1 A;  4FC3 B;  2NSR A;  1CP0 A;  3B75 A;  1G0A B;  1XQ5 B;  1V4W B;  4NK1 A;  3UHG A;  1K1K A;  2LH1 A;  5KER B;  5JOM A;  1JEB B;  3OVU C;  4PO5 B;  4MQJ A;  1UVK A;  3PT8 A;  2EB9 A;  5EUI B;  3MWN A;  1UVY A;  3WCT A;  2PGH A;  1OBM A;  3A59 A;  2GTL B;  2W31 A;  2O5T X;  4HHB A;  1HBI A;  1MNH A;  1JP8 A;  1U7R A;  1J7S A;  2XKG A;  1YEV B;  2MGL A;  3IC0 B;  3UHS A;  1MLH A;  1AZI A;  1B33 A;  4MQG A;  1Y4F A;  2G3H A;  1DXV A;  1A6M A;  3CY5 A;  2EB8 A;  3BRP A;  2QFK A;  2ZLX B;  3G4Y A;  1THB B;  3V58 A;  1CG5 B;  1I3E A;  1LFQ B;  3DUT A;  4N7O B;  1WVP A;  2G11 A;  5JDO C;  3OO5 A;  3S65 B;  2HBF B;  1QSH B;  1KN1 A;  1XZ2 B;  3OZW A;  4ODC B;  3ZJH A;  4PNJ A;  4YJJ B;  3UHY A;  105M A;  2HHB B;  3PIA A;  1X9F D;  5C6Y A;  1NEJ B;  2HBC B;  5HU6 A;  3D17 A;  2BKM A;  1SDL A;  2D2N B;  3UHE A;  2V1F A;  1F63 A;  3ASE A;  4GXE A;  4TYX A;  1UVX A;  4L7Y B;  2H8D B;  3LB1 A;  1YG5 A;  3AG0 A;  2D2N C;  1NZ4 A;  1MBO A;  1B8D B;  2AUP A;  3A5B A;  1MTK A;  1MLQ A;  5MBA A;  1TES A;  1HBS B;  1DKE A;  5EU2 A;  2MB5 A;  3K9Z A;  2GLN A;  1GDI A;  1O1P A;  1HBS A;  3AT5 B;  1Y8I A;  1MWC A;  1Y0C B;  2BW9 M;  2UUL A;  3AQ6 A;  2GKN A;  3ZOM A;  3UHB A;  2ZSY A;  1OUU B;  1J7W A;  1MBD A;  1MBA A;  1RVW B;  2H8D A;  3FH9 B;  1BJE A;  1YE2 B;  4MQH B;  5HU6 B;  1CLS A;  2UUN B;  3ODQ B;  3ONZ B;  3WTG B;  1UMO A;  4MAX A;  110M A;  103M A;  4ZVB A;  2VEB A;  1GDK A;  3NG6 B;  3ZJO A;  2OH9 A;  3TLD A;  1UC3 A;  2DN3 A;  1FDH A;  1KTP A;  1LFT B;  1MLK A;  1SPG A;  1O1M A;  2UUM X;  2FRJ X;  1GH0 B;  1XZU B;  3HYU A;  4HH0 A;  1RTX A;  3QZZ A;  3K8B A;  1YEQ B;  4H2L A;  1DXV B;  1V75 A;  5E6E A;  2FAM A;  1HCO B;  1QSI B;  1YGF A;  1YHU B;  3GQP B;  5JGG B;  1Y0A A;  1LTW A;  3QM6 A;  2ZLU B;  3UGY A;  1HRM A;  2B7H A;  3HEO A;  3IA3 B;  5E83 A;  4U8U A;  3PI3 A;  4YU4 A;  1NS9 A;  4M4B A;  2V1I A;  4KN3 A;  3ZJL A;  2MGG A;  2G0X A;  2DN1 B;  2Z6T A;  1COL A;  1YFF A;  2HCO A;  4ILZ A;  2ZS0 D;  2HBG A;  1UT0 A;  1ALL B;  2PEG A;  1Y35 B;  1NXF A;  2DN3 B;  1OR6 A;  2MYA A;  4HRT A;  4F6F A;  4UUR A;  4NI1 B;  3G46 A;  1NS6 A;  3LQD A;  1Y31 A;  1XZ7 A;  2VJT B;  1DO1 A;  1YE2 A;  3ZJN A;  1A3O A;  4DWU A;  1GVH A;  1QXE B;  3O2C B;  3WHM A;  1MLS A;  1UVI A;  1JPB A;  1CQ2 A;  1PHN A;  3ZOL A;  4ZIZ A;  4ETU A;  2NRM A;  1M6C A;  1YHR A;  1C7D A;  1Y0C A;  3E5O A;  4JYQ A;  4M4A A;  1MTJ A;  1J3Y A;  2C7K B;  2QMB A;  4DC7 A;  5CNG A;  3UGZ A;  3AQ8 A;  2D5X A;  4OOD A;  1HHT P;  3M3B A;  3GOU A;  3D4X A;  1A4F B;  2R50 A;  1COH B;  2MYD A;  2HBD B;  1MGN A;  4ZIZ B;  2QU0 B;  1MDN A;  1CG8 A;  5CHQ A;  1QXE A;  3BJ2 A;  2D60 A;  1HA7 B;  4X0L B;  2ZS1 B;  3A0G A;  1DUO A;  1DXU B;  2VJT A;  1Y45 A;  1CH4 A;  2ZSZ A;  1OFK A;  3OGB A;  2HHB A;  3AQ7 A;  1V07 A;  1XDT T;  4KMW A;  2DKD A;  2C7L A;  5C6E B;  2ZLV A;  1IWH A;  3PT7 B;  1HHO A;  1X9F A;  2HZ2 A;  4MBN A;  1BUW B;  3PMC A;  2HHD A;  1BBB B;  1J7Y A;  4F4O A;  3RJN B;  1VWT A;  5B13 G;  1GZX A;  3NMM B;  1NQP A;  4BJA A;  5CN4 A;  1BZZ A;  3ZJQ A;  3UH7 A;  1XXT B;  3GIO A;  1VXH A;  1A0U A;  2EF2 A;  3HEN A;  3PEL B;  4F0U A;  1DO7 A;  1LH3 A;  1VXD A;  2X4A A;  2R80 B;  1DXT B;  3AT6 A;  5E29 A;  1Y2Z A;  2VRY A;  3HRW B;  3GQP A;  5JGG A;  3VAU A;  1ABW A;  1H1X A;  4G1V A;  1CPC B;  4N6S B;  1JP9 A;  1LA6 A;  1Y4R B;  2O5Q X;  2MGA A;  1IDR A;  1UVL A;  1AJ9 A;  3DHR B;  1FLP A;  2R4X A;  3A9M A;  2V1H A;  4HSW A;  1CH1 A;  5KDQ A;  2V1K A;  1A9W A;  1A9W E;  3HYU B;  1XY0 A;  2Z6S A;  1G0A A;  3GK9 A;  1DXD A;  3WCT D;  1BVC A;  2BLI A;  2MGC A;  4G51 B;  1MLN A;  3WCW A;  3MVC A;  2JLG A;  3PI4 A;  3V2V A;  1RQA A;  3FS4 A;  1C7B B;  1T1N B;  4ETT A;  1A6K A;  1QXD A;  1KD2 B;  3ZHW A;  2HCO B;  2ZST A;  1YH9 A;  3WR1 B;  1FAW A;  3V57 B;  1SPE A;  2MGM A;  1HDA B;  3E4N A;  1Y5J A;  3FH9 A;  2ZFO C;  2ZSR A;  102M A;  4AE1 A;  2ZSN A;  1Y0A B;  3MKB B;  1GCW B;  4FH6 A;  4U8U C;  3IC2 A;  3MJU B;  1VXF A;  2R80 A;  5E29 B;  1Y8I B;  4U8U D;  5MBN A;  1RPS B;  1YIE A;  3SDN A;  2C0K A;  3PEL A;  1R1Y A;  1HAB A;  4MPM A;  5F2A A;  1YZI B;  1CH2 A;  5EQM A;  3V2Z A;  1HGC A;  1RQ3 B;  1HBA B;  1CO8 A;  3WCP A;  5EE4 D;  1SPG B;  1I7Y B;  5FVB A;  4OF9 A;  1LH2 A;  2C7J A;  1IWH B;  2UUL H;  1Y8W A;  1WAC A;  1YGD B;  1ASH A;  5CN6 A;  4QAU A;  1YMB A;  3QM5 A;  3P5Q B;  2FRF A;  3GLN A;  4A8S A;  1CH3 A;  1NIH B;  3WFW A;  1A00 B;  108M A;  2VML A;  1Y85 A;  1QSH A;  1OR4 A;  1LFV B;  3KUO A;  1COH A;  1Y4G A;  1LFQ A;  1JY7 A;  3MBA A;  2ZWJ A;  1LIA B;  1Y0D B;  2ZSS A;  3MJP B;  1ECA A;  3GOU B;  112M A;  2D5X B;  2FRK X;  1O16 A;  1X3K A;  3G4U A;  3HXN A;  1J3Y B;  4L1E B;  1YEV A;  4N8T B;  2WCQ A;  3G4V A;  2YRS A;  4MQK B;  3MJU A;  2SPL A;  1PHN B;  5B85 A;  2GTL A;  1HBR A;  4ROL A;  2DHB B;  1MZ0 A;  1SWM A;  2AUR A;  4GXE B;  1RH1 A;  2LH7 A;  4NI0 B;  1UIW B;  1GDJ A;  3MYM A;  1CPW A;  1Y7C B;  2AUO A;  1FHJ B;  1S5X B;  1LJW A;  1XZ2 A;  1JWN A;  3UHT A;  1Y7G B;  2BLH A;  5EYS A;  104M A;  2LH2 A;  2AV0 A;  109M A;  1R1X B;  1G08 A;  3UHW A;  4WJG A;  1GLI B;  3ZJM A;  2ZLX A;  3QJC A;  1Y8K B;  3BRP B;  1AJH A;  2V1J A;  3EDB A;  2G0R A;  1S69 A;  3O18 A;  2BMM A;  1A0Z B;  5CMV A;  3HHB B;  3BJ3 B;  3E55 A;  1IRD A;  1O1O A;  2H35 A;  1ECO A;  1Y5F A;  3A5A A;  2H35 B;  2LH5 A;  3AT6 B;  2JHO A;  3EOK A;  1C40 A;  1XZ4 B;  1Y7Z B;  1JF4 A;  5EUI A;  2GRZ A;  3PT8 B;  2GNW A;  4O4Z A;  4ROM B;  3DHT B;  1S0H B;  1D8U A;  4PQC A;  1K1K B;  1FN3 B;  1SHR A;  2NRL A;  1TOX A;  3ZJJ A;  1JZK A;  2YSK A;  2RI4 A;  1Y46 B;  2VML B;  3VRE A;  3GQG B;  1RSE A;  4F68 A;  1A00 A;  1BAB B;  1C7C A;  1Y83 A;  2VYY A;  1MBN A;  2ZLW A;  4HBI A;  1NZ3 A;  2GDM A;  3G4Q A;  2MGE A;  3CIU B;  2D5Z B;  3RQR A;  2W72 C;  3KVS B;  1S5Y A;  1LHT A;  1YEN A;  3SZK A;  2JLF A;  1MWD A;  1HAC B;  1ABY B;  1CII A;  1MYM A;  4FWY A;  1F99 B;  1HAB B;  1J3F A;  5CNC A;  1V4U B;  4UIQ A;  3BCQ A;  4AVE A;  1JBO A;  2M6Z B;  1CO9 A;  1HBB B;  2Z85 A;  2DN2 A;  2D2N D;  1NQP B;  3O7N A;  4IT8 A;  4F6D A;  4B02 A;  1GCW A;  3S66 A;  2J96 A;  2X49 A;  2W6W A;  1G09 A;  1BZ6 A;  2D5Z A;  1O1N B;  2C7L B;  5C6E A;  2IG3 A;  1UFJ A;  1XG0 C;  5EV5 A;  3M38 A;  1KFR A;  4WCH D;  3NML A;  3OO4 A;  3S48 C;  1DO4 A;  2LH6 A;  1O1L A;  2MGB A;  3PI8 B;  1MCY A;  3PI9 B;  4LMX B;  4ODC A;  2RI4 B;  3VRE B;  1LFL B;  1ALL A;  1Y09 A;  1NY9 A;  1BIJ A;  2XKI A;  1Y7D A;  1AJG A;  1J41 B;  1UFP A;  2NSS A;  5FVB M;  3GUQ A;  1JBO B;  1MYI A;  3QQR A;  4MU5 A;  1EYX A;  1Q1F A;  3GKV A;  1X9F C;  1YIE B;  1MOD A;  2ZLU A;  1BZ1 B;  4MQC B;  1Y4Q A;  3SZK B;  2OLP A;  3IC2 B;  1N9H A;  1YGF B;  5ILP A;  1GBU B;  1Y4Q B;  4O35 A;  3TM3 A;  1BZ1 A;  1WLA A;  1HDS A;  1J40 B;  1Y8H A;  2OH8 A;  2VYZ A;  3AQ9 A;  4VHB A;  5HY8 A;  4MQJ B;  2R1H A;  4B4Y A;  4NK2 A;  3ECZ A;  1JL7 A;  2ZLW B;  4A8K A;  2V8A B;  5EE4 C;  1Y5K A;  1HV4 A;  1U7S A;  1C7C B;  1O1J B;  4HH1 A;  1IT2 A;  3BJ1 B;  1CH7 A;  2UUN D;  2GRF A;  1XYE B;  1DDT A;  1I3D A;  5CN5 A;  1MYF A;  1O1J A;  2VLX A;  3D1K A;  2W6V B;  1HV4 B;  1IOP A;  5KDQ B;  1Y45 B;  3UHZ A;  1J3Z B;  4M4B B;  1J52 A;  5HY8 B;  1CMY B;  2H8F B;  1MLR A;  2QFN A;  4RMP A;  4Q70 B;  4C0N A;  4GZG A;  2Z6N B;  1GBU A;  1MNO A;  1ABW B;  3QJD A;  3GQR B;  1YHU A;  2DN2 B;  1O1O B;  1V75 B;  5E6E B;  3S1I A;  3GKV B;  1MLL A;  1Y8K A;  1VXC A;  3UHC A;  3ECX A;  3K8B B;  5D5R A;  3H57 A;  1ABY A;  1QI8 B;  3NL7 B;  2ZS1 D;  3NMM A;  3QM8 A;  1GZX B;  2GNV A;  2MGD A;  6HBW B;  1MLJ A;  5CHR A;  1J41 A;  1Y7G A;  1X9F B;  1KTP B;  5M3S A;  3UHK A;  1O1K B;  1FHJ A;  3UHV A;  2D2N A;  2W72 A;  3OO4 B;  1M9P A;  3ED9 A;  2GRH A;  2VYW A;  2HHE B;  5AQD M;  3O89 A;  1YGD A;  1MNI A;  3GYS B;  2IN4 A;  4FH7 A;  3HC9 A;  4IRO B;  1HGC B;  1N9X A;  2BLJ M;  4XXI A;  3V58 B;  1OUT A;  3BCQ B;  1Y0W B;  1V4U A;  3LR7 A;  1Y4F B;  1DKE B;  1RPS A;  3UHD A;  2ZFO B;  1C7D B;  1LH6 A;  3WI8 A;  1B8D A;  1H97 A;  1GJN A;  1OFJ A;  1YHU D;  3A59 B;  1MOB A;  1PBX A;  3NFE B;  3KMF A;  1J3Z A;  3QJC B;  1HDB B;  4WJG 1;  3LQD B;  1V4W A;  5CNB A;  1MLU A;  1NEJ A;  2W72 B;  2XKH A;  2HZ1 A;  1HBG A;  4SDH A;  2RAO B;  1K0Y B;  3K3U A;  4A8Q A;  3G4R A;  3QQQ A;  1CIK A;  3W4U B;  2EVK A;  3OO5 B;  2QSS A;  3AQ5 A;  2W6Y A;  2QSP B;  1Y7C A;  1Y22 A;  1XY0 B;  3LB4 A;  1Y5K B;  4AVD A;  2KSC A;  1S0H A;  3DHR A;  2HBE A;  5CN8 A;  4YU4 B;  3QMA A;  1LHS A;  1B33 B;  2ZT4 A;  3MN0 A;  1QGW C;  3EOK B;  1LFZ B;  1RVW A;  1VXB A;  3D1A B;  5HBI A;  1YHE A;  1SDK B;  3DBJ B;  3G52 A;  3HRW A;  1LH7 A;  5D1V A;  3PMD A;  101M A;  1JDO A;  4N8T A;  3OZV A;  1HGB B;  2G0Z A;  1S61 A;  2ZT3 A;  4H2L B;  1JEB A;  4B3W A;  2I88 A;  2OHA A;  1BZZ B;  1HI1 A;  2O5S X;  4AE0 A;  2W6V A;  1JY7 B;  1Y4G B;  3ORD A;  5JDO E;  3SDH A;  1UX9 A;  1VWT B;  1Y4V B;  4UZV A;  1O1M B;  2VHB A;  4XDI A;  3HF4 A;  3W4U A;  1BIJ B;  1LFV A;  3L0F B;  4L7Y A;  1B0B A;  1A6G A;  1RQA B;  2GTL C;  2QLS A;  1YEO A;  1N9I A;  2MGK A;  3BJ1 A;  1YIH B;  3VNC A;  1CIO A;  2O5B X;  4HRR B;  1ECN A;  3UBV A;  1GBV B;  2WTH A;  1VXE A;  3ZJR A;  2V8A A;  3KUN A;  1A01 A;  3A0G B;  3E5I A;  1UVJ A;  1EBC A;  2R1H B;  4GY3 A;  2W6X A;  1DWS A;  1LA6 B;  2R4Z A;  2WTG A;  1Y0T A;  1YEU B;  3S66 B;  1ON7 A;  3WCP B;  1F5O A;  2DKA A;  2V1E A;  3G53 A;  6HBW A;  5EYJ A;  4N7O A;  5CN7 A;  1HBB A;  4MQC A;  4L1E A;  3WCV B;  3WCV C;  4F0U B;  1O1P B;  4BJU A;  1O1I B;  1GCV B;  4ESU A;  3WCV A;  1HAC A;  1MYH A;  3GQR A;  3KVS A;  1FCS A;  3MKB A;  1Y7D B;  1SI4 B;  2MGI A;  5AZR A;  1DUK A;  3PT7 A;  5B13 A;  4A8F A;  2HBS A;  2AUQ A;  1FSL A;  3ARL A;  3PI9 A;  1XZ5 B;  1MDT A;  3D17 B;  1A01 B;  2MHB A;  5KER A;  3V57 A;  3UH6 A;  1MYG A;  1GBV A;  1XQ5 A;  1N9F A;  3VRG A;  1NGK A;  4FWX A;  3B75 B;  4FWZ A;  1YIH A;  4O2G A;  3WCU D;  1QXD B;  2D60 B;  2O5O X;  1V5H A;  1LFY B;  1G09 B;  4TWU A;  1I7Y A;  2GTL D;  1A6N A;  3QZX A;  4N7P A;  1Y4V A;  3MOU A;  2DN1 A;  1DXC A;  1MKO A;  2LHB A;  1YCA A;  1YE0 B;  2O5M X;  3DHT A;  1NS9 B;  1R1Y B;  1YHU C;  1A3N A;  1PMB A;  1Y4P B;  5E83 B;  1J40 A;  1Y8H B;  2C7K A;  1HGB A;  1HDS B;  4O4T A;  1WMU B;  3WCU A;  2OIF A;  1MTI A;  1YHR B;  2BNL A;  4HHB B;  1MYT A;  1HCO A;  3UHR A;  1LFZ A;  4RMP B;  4C44 A;  3CIU A;  1VXA A;  1A0U B;  2VEE A;  1YEQ A;  3UI0 A;  3BOM B;  4L2M A;  4MBA A;  1Y83 B;  1DTI A;  1XZU A;  1CH9 A;  1VRE A;  4YU3 A;  1YOI A;  1XZV A;  4N7P B;  1J7Y B;  4F4O B;  4PQ6 A;  1XCH A;  4F6G A;  1LFT A;  1Y09 B;  111M A;  3S1J A;  2SPN A;  1JW8 A;  2RAO A;  1O1L B;  4N7N A;  3UHQ A;  1DO3 A;  5ILE A;  5JDO F;  1EW6 A;  2DKC A;  3VRF B;  1DTM A;  3U3E A;  1UIW A;  1AJ9 B;  2D2M A;  3MYN A;  1XZ5 A;  1Y4B B;  3ARK A;  3FEW X;  3M3A A;  3KMF C;  4F6I A;  1C40 B;  1B86 A;  1XZ4 A;  1ITH A;  1CG8 B;  3ZJS A;  1SI4 A;  4MQI B;  2HBD A;  3UH5 A;  1RTE A;  1QSI A;  3H58 A;  1Y2Z B;  1DWT A;  2UUL B;  4BS9 A;  3WCW D;  3BJ3 A;  3HHB A;  4A8Y A;  1LH5 A;  1FSX A;  1YOH A;  2MBW A;  2ZT2 A;  4NXA A;  3QJE A;  1EYX B;  2VLZ A;  4XS0 B;  2WY4 A;  5JDO D;  1MLM A;  1NZ2 A;  2HHD B;  1ON7 B;  1IBE A;  3QM7 A;  5EET A;  1LFL A;  3PI8 A;  3UHX A;  4ZVA A;  6HBI A;  2JL9 A;  3LR9 A;  3VRG B;  2UUM B;  1XZ7 B;  4LPI A;  4F0T B;  1BAB A;  2UUM A;  4F69 A;  1DXU A;  2Z8A A;  3ZJP A;  1CH5 A;  3ZJI A;  1CP5 A;  1HLM A;  1UX8 A;  1YVT A;  1L2K A;  3OK5 A;  3ZH0 A;  2PEG B;  1ABS A;  3G4W A;  3L0F A;  3HEP A;  3WCT C;  1OUU A;  1HHS A;  1EBT A;  1MOC A;  1QI8 A;  2M6Z A;  2ZLT B;  5IKS A;  1URV A;  4ERV A;  1GCV A;  2OHB A;  3QJB B;  1FSX B;  4H0M A;  4H07 A;  2QMB B;  4NS2 A;  2B7H B;  3IXF A;  4JAC A;  4Z8K A;  2G0V A;  1NWI A;  1NAZ A;  5B84 A;  3QJD B;  1SDK A;  3DBJ A;  3LHB A;  2SPM A;  2MYE A;  5AZQ A;  2FAL A;  1Y85 B;  4ERT A;  1A0Z A;  1KR7 A;  2D2M B;  1EMY A;  1G08 B;  1RQ4 A;  2VJR A;  1YH9 B;  3WR1 A;  2EVP A;  3UBC A;  4HRR A;  3PIA B;  2QSP A;  1JF3 A;  1C7B A;  1T1N A;  1Y8W B;  1Y35 A;  3FS4 B;  2C7J B;  1KN1 B;  2O5L X;  3RJ6 A;  4TWV A;  1ECD A;  1HBH A;  1YDZ B;  3DUT B;  4KMV A;  1MWB A;  1FN3 A;  1SHR B;  1HDB A;  1CLS B;  1THB A;  2UUN A;  3ODQ A;  2ZS1 C;  3BA2 A;  3EDA A;  1S56 A;  2G14 A;  4ROM A;  4DWT A;  107M A;  3ZTA A;  1NZ5 A;  1V9Q A;  1MNK A;  4U8U B;  1PBX B;  1F65 A;  3IC0 A;  1HBR B;  1YMA A;  4ROL B;  1CPC A;  2ZT0 A;  1MOA A;  1W92 A;  2VM0 A;  1Y5F B;  1HI8 A;  2R4Y A;  1DXT A;  4NXC A;  3WCU C;  3WCT B;  5HAV A;  3HXN B;  4H0M B;  5AQD A;  1VXG A;  2HBE B;  2VJH B;  2ZFB A;  4ETV A;  1OJ6 A;  1BZP A;  1JZL A;  1R1X A;  5AB8 A;  1FAW B;  1Y22 B;  1GH0 A;  1BBB A;  1KD2 A;  2D2M C;  1G0B B;  1V4X B;  5SW7 B;  2ZLV B;  1S5X A;  3WCW C;  3UHU A;  2UUL D;  1M6M A;  3A2G A;  4F0T A;  2BK9 A;  4MXK A;  1SGK A;  1M9P B;  1CQX A;  1VHB A;  4NI0 A;  5CN9 A;  1S6A A;  1DWR A;  2WCR A;  2D6C A;  4F6J A;  3NFE A;  1O1K A;  1MBI A;  1NPF A;  3UHI A;  1G0B A;  1V4X A;  2DHB A;  2ZS0 C;  1HLB A;  1DLY A;  4N6S A;  1J7W B;  3DR9 A;  1HGA B;  2YRS B;  4MQK A;  3OZU A;  3NL7 A;  3A5G A;  2ZFO A;  3AT5 A; 
#chains in the Genus database with same CATH homology
 2EKT A;  3QJB A;  3UHH A;  1O1I A;  2G0S A;  2ZSQ A;  2ZLT A;  3MJP A;  2AV3 A;  3WFT A;  3ECL A;  1MYJ A;  3D7O B;  1Y01 B;  1BUW A;  3PI2 A;  3GYS A;  1YG5 B;  2D2M D;  1HJT A;  1LUE A;  4F6B A;  1YVT B;  3PI1 A;  2ZSX A;  2BWH A;  1CMY A;  1URY A;  2H8F A;  4H0B A;  2R4W A;  1CBM A;  1HDA A;  1TU9 A;  1MNJ A;  1Y31 B;  2HBC A;  106M A;  1YDZ A;  3QM9 A;  3P5Q A;  4N7N B;  1JZM A;  2MGH A;  1NWN A;  1XYE A;  4ESA A;  5SW7 A;  5HLQ A;  2QRW A;  2DC3 A;  2QU0 A;  1F5P A;  2HBF A;  4G51 A;  1HBA A;  1VRF A;  1FDH G;  1YFF B;  4YU3 B;  4KJT A;  2ZSO A;  1DLW A;  2ZS0 A;  1RQ4 B;  4XS0 A;  1YZI A;  3OJ1 A;  2MGJ A;  3CY5 B;  1YCB A;  2G10 A;  1G9V B;  2ZSP A;  1MOH A;  1Y4R A;  1HSY A;  4O1T A;  1BZ0 A;  2DXM B;  1J7S B;  4MXL A;  1IT3 A;  1YHE B;  2Z6N A;  2HZ3 A;  1MLF A;  1MYZ A;  3GDJ B;  3LB3 A;  1B86 B;  2FRI X;  1YE0 A;  1QPW A;  4FC3 A;  3VHB A;  3UH3 A;  3M39 A;  1LFY A;  4ESA B;  2AA1 B;  1LJW B;  2E2Y A;  1X46 A;  3WCV D;  3WCW B;  3EU1 A;  1XZV B;  1MBS A;  5CNF A;  1QPW B;  3R0G A;  5ILM A;  2MHB B;  3BOM A;  4PQB A;  3R5I B;  2ZFO D;  4X0L A;  2MGF A;  3BJ2 B;  3GDJ A;  2LH3 A;  1BVD A;  4G1B A;  3D7O A;  1YOG A;  1YVQ B;  1A4F A;  2DXM A;  1IRC A;  3D4X B;  1WMU A;  3WCU B;  5EOH A;  2XYK A;  1Z8U B;  3QJE B;  1G9V A;  1MLG A;  1XXT A;  1Y0W A;  1OUT B;  1Y0D A;  2ZS0 B;  4M4A B;  4IRO A;  3RGK A;  1S5Y B;  1YEN B;  4MQI A;  3TM9 A;  1HGA A;  1CBL A;  3WHM B;  1Y0T B;  1HHO B;  1GDL A;  1NPG A;  5HLU A;  1Y4B A;  2GL3 A;  1SDL B;  3NG6 A;  2HHE A;  2VLY A;  3ARJ A;  5CNE A;  1NIH A;  2MYB A;  3VRF A;  4NI1 A;  2NX0 A;  3ONZ A;  3WTG A;  4MQH A;  3GQG A;  3EU1 B;  1DM1 A;  1BZR A;  2ZS1 A;  2QLS B;  2HBS B;  5CND A;  1Y46 A;  1O1N A;  2SPO A;  2O58 X;  3LB2 A;  4HSX A;  1IBE B;  1JL6 A;  3S65 A;  1RQ3 A;  7HBI A;  2EKU A;  1CG5 A;  1YMC A;  5HLX A;  2V1G A;  2ZFB B;  1EWA A;  3UHN A;  3GKT A;  4MQG B;  3WFU A;  1Y7Z A;  5KKK A;  3WFX A;  5ILR A;  1JP6 A;  1LH1 A;  1YVQ A;  2G12 A;  1YEU A;  3D1A A;  1BZ0 B;  2PGH B;  1IRD B;  1Y5J B;  1A3N B;  1Y4P A;  1A3O B;  3R5I A;  4NZI A;  1GLI A;  1MKO B;  1MBC A;  1NS6 B;  3D1K B;  1HBH B;  2CMM A;  1MLO A;  4HRT B;  2QSS B;  4DC8 A;  1YEO B;  5F0B A;  2GKM A;  2AA1 A;  2MYC A;  1BIN A;  3HF4 B;  1K0Y A;  2ZT1 A;  4FC3 B;  2NSR A;  1CP0 A;  3B75 A;  1G0A B;  1XQ5 B;  1V4W B;  4NK1 A;  3UHG A;  1K1K A;  2LH1 A;  5KER B;  5JOM A;  1JEB B;  3OVU C;  4MQJ A;  3PT8 A;  2EB9 A;  5EUI B;  1UVY A;  3WCT A;  2PGH A;  1OBM A;  3A59 A;  2GTL B;  2W31 A;  2O5T X;  4HHB A;  1HBI A;  1MNH A;  1JP8 A;  1U7R A;  1J7S A;  2XKG A;  1YEV B;  2MGL A;  3IC0 B;  3UHS A;  1MLH A;  1AZI A;  4MQG A;  1Y4F A;  2G3H A;  1DXV A;  1A6M A;  3CY5 A;  2EB8 A;  2QFK A;  2ZLX B;  3G4Y A;  1THB B;  1CG5 B;  1I3E A;  1LFQ B;  3DUT A;  4N7O B;  1WVP A;  2G11 A;  5JDO C;  3OO5 A;  3S65 B;  2HBF B;  1QSH B;  1XZ2 B;  3OZW A;  4ODC B;  3ZJH A;  4PNJ A;  3UHY A;  105M A;  2HHB B;  3PIA A;  1X9F D;  5C6Y A;  1NEJ B;  2HBC B;  5HU6 A;  3D17 A;  2BKM A;  1SDL A;  2D2N B;  3UHE A;  2V1F A;  1F63 A;  3ASE A;  4TYX A;  1UVX A;  4L7Y B;  2H8D B;  3LB1 A;  1YG5 A;  3AG0 A;  2D2N C;  1NZ4 A;  1MBO A;  2AUP A;  3A5B A;  1MTK A;  1MLQ A;  5MBA A;  1TES A;  1HBS B;  1DKE A;  5EU2 A;  2MB5 A;  3K9Z A;  2GLN A;  1GDI A;  1O1P A;  1HBS A;  3AT5 B;  1Y8I A;  1MWC A;  1Y0C B;  2BW9 M;  3AQ6 A;  2GKN A;  3ZOM A;  3UHB A;  2ZSY A;  1OUU B;  1J7W A;  1MBD A;  1MBA A;  1RVW B;  2H8D A;  3FH9 B;  1BJE A;  1YE2 B;  4MQH B;  5HU6 B;  1CLS A;  3ODQ B;  3ONZ B;  3WTG B;  1UMO A;  4MAX A;  110M A;  103M A;  4ZVB A;  2VEB A;  1GDK A;  3NG6 B;  3ZJO A;  2OH9 A;  3TLD A;  1UC3 A;  2DN3 A;  1FDH A;  1LFT B;  1MLK A;  1SPG A;  1O1M A;  2FRJ X;  1XZU B;  3HYU A;  1RTX A;  3QZZ A;  3K8B A;  1YEQ B;  4H2L A;  1DXV B;  1V75 A;  5E6E A;  2FAM A;  1HCO B;  1QSI B;  1YGF A;  1YHU B;  3GQP B;  5JGG B;  1Y0A A;  1LTW A;  3QM6 A;  2ZLU B;  3UGY A;  1HRM A;  2B7H A;  3HEO A;  3IA3 B;  5E83 A;  4U8U A;  3PI3 A;  4YU4 A;  1NS9 A;  4M4B A;  2V1I A;  4KN3 A;  3ZJL A;  2MGG A;  2G0X A;  2DN1 B;  2Z6T A;  1YFF A;  2HCO A;  4ILZ A;  2ZS0 D;  2HBG A;  1UT0 A;  2PEG A;  1Y35 B;  1NXF A;  2DN3 B;  1OR6 A;  2MYA A;  4HRT A;  4F6F A;  4UUR A;  4NI1 B;  3G46 A;  1NS6 A;  3LQD A;  1Y31 A;  1XZ7 A;  1DO1 A;  1YE2 A;  3ZJN A;  1A3O A;  4DWU A;  1GVH A;  1QXE B;  3WHM A;  1MLS A;  1JPB A;  1CQ2 A;  3ZOL A;  2NRM A;  1M6C A;  1YHR A;  1C7D A;  1Y0C A;  3E5O A;  4JYQ A;  4M4A A;  1MTJ A;  1J3Y A;  2QMB A;  4DC7 A;  5CNG A;  3UGZ A;  3AQ8 A;  2D5X A;  4OOD A;  3M3B A;  3GOU A;  3D4X A;  1A4F B;  2R50 A;  1COH B;  2MYD A;  2HBD B;  1MGN A;  2QU0 B;  1MDN A;  1CG8 A;  5CHQ A;  1QXE A;  3BJ2 A;  2D60 A;  4X0L B;  2ZS1 B;  3A0G A;  1DUO A;  1DXU B;  1Y45 A;  1CH4 A;  2ZSZ A;  1OFK A;  3OGB A;  2HHB A;  3AQ7 A;  1V07 A;  4KMW A;  5C6E B;  2ZLV A;  1IWH A;  3PT7 B;  1HHO A;  1X9F A;  2HZ2 A;  4MBN A;  1BUW B;  2HHD A;  1BBB B;  1J7Y A;  4F4O A;  3RJN B;  1VWT A;  1GZX A;  3NMM B;  1NQP A;  4BJA A;  5CN4 A;  1BZZ A;  3ZJQ A;  3UH7 A;  1XXT B;  1VXH A;  1A0U A;  2EF2 A;  3HEN A;  3PEL B;  1DO7 A;  1LH3 A;  1VXD A;  2R80 B;  1DXT B;  3AT6 A;  5E29 A;  1Y2Z A;  2VRY A;  3HRW B;  3GQP A;  5JGG A;  3VAU A;  1ABW A;  1H1X A;  4G1V A;  1JP9 A;  1LA6 A;  1Y4R B;  2O5Q X;  2MGA A;  1IDR A;  1AJ9 A;  3DHR B;  1FLP A;  2R4X A;  3A9M A;  2V1H A;  4HSW A;  1CH1 A;  5KDQ A;  2V1K A;  1A9W A;  1A9W E;  3HYU B;  1XY0 A;  2Z6S A;  1G0A A;  3GK9 A;  1DXD A;  3WCT D;  1BVC A;  2BLI A;  2MGC A;  4G51 B;  1MLN A;  3WCW A;  3MVC A;  3PI4 A;  3V2V A;  1RQA A;  3FS4 A;  1C7B B;  1T1N B;  1A6K A;  1QXD A;  1KD2 B;  3ZHW A;  2HCO B;  2ZST A;  1YH9 A;  3WR1 B;  1FAW A;  1SPE A;  2MGM A;  1HDA B;  3E4N A;  1Y5J A;  3FH9 A;  2ZFO C;  2ZSR A;  102M A;  2ZSN A;  1Y0A B;  3MKB B;  1GCW B;  4FH6 A;  4U8U C;  3IC2 A;  3MJU B;  1VXF A;  2R80 A;  5E29 B;  1Y8I B;  4U8U D;  5MBN A;  1RPS B;  1YIE A;  3SDN A;  2C0K A;  3PEL A;  1R1Y A;  1HAB A;  4MPM A;  5F2A A;  1YZI B;  1CH2 A;  5EQM A;  3V2Z A;  1HGC A;  1RQ3 B;  1HBA B;  1CO8 A;  3WCP A;  5EE4 D;  1SPG B;  4OF9 A;  1LH2 A;  1IWH B;  1Y8W A;  1YGD B;  1ASH A;  5CN6 A;  4QAU A;  1YMB A;  3QM5 A;  3P5Q B;  2FRF A;  3GLN A;  1CH3 A;  1NIH B;  3WFW A;  1A00 B;  108M A;  1Y85 A;  1QSH A;  1OR4 A;  1LFV B;  3KUO A;  1COH A;  1Y4G A;  1LFQ A;  1JY7 A;  3MBA A;  2ZWJ A;  1Y0D B;  2ZSS A;  3MJP B;  1ECA A;  3GOU B;  112M A;  2D5X B;  2FRK X;  1O16 A;  1X3K A;  3G4U A;  3HXN A;  1J3Y B;  1YEV A;  4N8T B;  3G4V A;  2YRS A;  4MQK B;  3MJU A;  2SPL A;  5B85 A;  2GTL A;  1HBR A;  4ROL A;  2DHB B;  1MZ0 A;  1SWM A;  2AUR A;  2LH7 A;  4NI0 B;  1UIW B;  1GDJ A;  3MYM A;  1CPW A;  1Y7C B;  2AUO A;  1FHJ B;  1S5X B;  1LJW A;  1XZ2 A;  1JWN A;  3UHT A;  1Y7G B;  2BLH A;  5EYS A;  104M A;  2LH2 A;  2AV0 A;  109M A;  1R1X B;  1G08 A;  3UHW A;  4WJG A;  1GLI B;  3ZJM A;  2ZLX A;  3QJC A;  1Y8K B;  1AJH A;  2V1J A;  3EDB A;  2G0R A;  1S69 A;  2BMM A;  1A0Z B;  5CMV A;  3HHB B;  3BJ3 B;  3E55 A;  1IRD A;  1O1O A;  2H35 A;  1ECO A;  1Y5F A;  3A5A A;  2H35 B;  2LH5 A;  3AT6 B;  2JHO A;  3EOK A;  1C40 A;  1XZ4 B;  1Y7Z B;  1JF4 A;  5EUI A;  2GRZ A;  3PT8 B;  2GNW A;  4O4Z A;  4ROM B;  3DHT B;  1S0H B;  1D8U A;  4PQC A;  1K1K B;  1FN3 B;  1SHR A;  2NRL A;  3ZJJ A;  1JZK A;  2RI4 A;  1Y46 B;  3VRE A;  3GQG B;  1RSE A;  4F68 A;  1A00 A;  1BAB B;  1C7C A;  1Y83 A;  2VYY A;  1MBN A;  2ZLW A;  4HBI A;  1NZ3 A;  2GDM A;  3G4Q A;  2MGE A;  3CIU B;  2D5Z B;  2W72 C;  1S5Y A;  1LHT A;  1YEN A;  3SZK A;  1MWD A;  1HAC B;  1ABY B;  1MYM A;  4FWY A;  1HAB B;  1J3F A;  5CNC A;  1V4U B;  4UIQ A;  3BCQ A;  4AVE A;  2M6Z B;  1CO9 A;  1HBB B;  2Z85 A;  2DN2 A;  2D2N D;  1NQP B;  3O7N A;  4IT8 A;  4F6D A;  1GCW A;  3S66 A;  2W6W A;  1G09 A;  1BZ6 A;  2D5Z A;  1O1N B;  5C6E A;  2IG3 A;  1UFJ A;  5EV5 A;  3M38 A;  1KFR A;  4WCH D;  3NML A;  3OO4 A;  3S48 C;  1DO4 A;  2LH6 A;  1O1L A;  2MGB A;  3PI8 B;  1MCY A;  3PI9 B;  4ODC A;  2RI4 B;  3VRE B;  1LFL B;  1Y09 A;  1BIJ A;  2XKI A;  1Y7D A;  1AJG A;  1J41 B;  1UFP A;  2NSS A;  1MYI A;  3QQR A;  4MU5 A;  1Q1F A;  3GKV A;  1X9F C;  1YIE B;  1MOD A;  2ZLU A;  1BZ1 B;  4MQC B;  1Y4Q A;  3SZK B;  2OLP A;  3IC2 B;  1N9H A;  1YGF B;  5ILP A;  1GBU B;  1Y4Q B;  4O35 A;  3TM3 A;  1BZ1 A;  1WLA A;  1HDS A;  1J40 B;  1Y8H A;  2OH8 A;  2VYZ A;  3AQ9 A;  4VHB A;  5HY8 A;  4MQJ B;  2R1H A;  4B4Y A;  4NK2 A;  3ECZ A;  1JL7 A;  2ZLW B;  5EE4 C;  1Y5K A;  1HV4 A;  1U7S A;  1C7C B;  1O1J B;  1IT2 A;  3BJ1 B;  1CH7 A;  2GRF A;  1XYE B;  1I3D A;  5CN5 A;  1MYF A;  1O1J A;  2VLX A;  3D1K A;  2W6V B;  1HV4 B;  1IOP A;  5KDQ B;  1Y45 B;  3UHZ A;  1J3Z B;  4M4B B;  1J52 A;  5HY8 B;  1CMY B;  2H8F B;  1MLR A;  2QFN A;  4C0N A;  4GZG A;  2Z6N B;  1MNO A;  1GBU A;  1ABW B;  3QJD A;  3GQR B;  1YHU A;  2DN2 B;  1O1O B;  1V75 B;  5E6E B;  3S1I A;  3GKV B;  1MLL A;  1Y8K A;  1VXC A;  3UHC A;  3ECX A;  5D5R A;  3K8B B;  3H57 A;  1ABY A;  1QI8 B;  3NL7 B;  2ZS1 D;  3NMM A;  3QM8 A;  1GZX B;  2GNV A;  2MGD A;  6HBW B;  1MLJ A;  5CHR A;  1J41 A;  1Y7G A;  1X9F B;  5M3S A;  3UHK A;  1O1K B;  1FHJ A;  3UHV A;  2D2N A;  2W72 A;  3OO4 B;  1M9P A;  3ED9 A;  2GRH A;  2VYW A;  2HHE B;  3O89 A;  1YGD A;  1MNI A;  3GYS B;  2IN4 A;  4FH7 A;  3HC9 A;  4IRO B;  1HGC B;  1N9X A;  2BLJ M;  1OUT A;  3BCQ B;  1Y0W B;  1V4U A;  3LR7 A;  1Y4F B;  1DKE B;  1RPS A;  3UHD A;  2ZFO B;  1C7D B;  1LH6 A;  3WI8 A;  1H97 A;  1GJN A;  1OFJ A;  1YHU D;  3A59 B;  1MOB A;  1PBX A;  3NFE B;  3KMF A;  1J3Z A;  3QJC B;  1HDB B;  4WJG 1;  3LQD B;  5CNB A;  1V4W A;  1MLU A;  1NEJ A;  2W72 B;  2XKH A;  2HZ1 A;  1HBG A;  4SDH A;  2RAO B;  1K0Y B;  3K3U A;  3G4R A;  3QQQ A;  1CIK A;  3W4U B;  2EVK A;  3OO5 B;  2QSS A;  3AQ5 A;  2W6Y A;  2QSP B;  1Y7C A;  1Y22 A;  1XY0 B;  3LB4 A;  1Y5K B;  4AVD A;  2KSC A;  1S0H A;  3DHR A;  2HBE A;  5CN8 A;  4YU4 B;  3QMA A;  1LHS A;  2ZT4 A;  3MN0 A;  3EOK B;  1LFZ B;  1RVW A;  1VXB A;  3D1A B;  5HBI A;  1YHE A;  1SDK B;  3G52 A;  3HRW A;  1LH7 A;  5D1V A;  101M A;  1JDO A;  4N8T A;  3OZV A;  1HGB B;  2G0Z A;  1S61 A;  2ZT3 A;  4H2L B;  1JEB A;  4B3W A;  2OHA A;  1BZZ B;  2O5S X;  2W6V A;  1JY7 B;  1Y4G B;  3SDH A;  5JDO E;  3ORD A;  1UX9 A;  1VWT B;  1Y4V B;  4UZV A;  1O1M B;  2VHB A;  4XDI A;  3HF4 A;  3W4U A;  1BIJ B;  1LFV A;  4L7Y A;  1B0B A;  1A6G A;  1RQA B;  2GTL C;  2QLS A;  1YEO A;  1N9I A;  2MGK A;  3BJ1 A;  1YIH B;  1CIO A;  2O5B X;  4HRR B;  1ECN A;  3UBV A;  1GBV B;  2WTH A;  1VXE A;  3ZJR A;  3KUN A;  1A01 A;  3A0G B;  3E5I A;  1EBC A;  2R1H B;  2W6X A;  1DWS A;  1LA6 B;  2R4Z A;  2WTG A;  1Y0T A;  1YEU B;  3S66 B;  3WCP B;  1F5O A;  2V1E A;  3G53 A;  6HBW A;  5EYJ A;  4N7O A;  5CN7 A;  1HBB A;  4MQC A;  3WCV B;  3WCV C;  1O1P B;  1O1I B;  1GCV B;  3WCV A;  1HAC A;  1MYH A;  3GQR A;  1FCS A;  3MKB A;  1Y7D B;  1SI4 B;  2MGI A;  5AZR A;  1DUK A;  3PT7 A;  2HBS A;  2AUQ A;  1FSL A;  3ARL A;  3PI9 A;  1XZ5 B;  3D17 B;  1A01 B;  2MHB A;  5KER A;  3UH6 A;  1MYG A;  1GBV A;  1XQ5 A;  1N9F A;  3VRG A;  1NGK A;  4FWX A;  3B75 B;  4FWZ A;  1YIH A;  4O2G A;  3WCU D;  1QXD B;  2D60 B;  2O5O X;  1V5H A;  1LFY B;  1G09 B;  4TWU A;  2GTL D;  1A6N A;  3QZX A;  4N7P A;  1Y4V A;  3MOU A;  2DN1 A;  1MKO A;  1DXC A;  2LHB A;  1YCA A;  1YE0 B;  2O5M X;  3DHT A;  1NS9 B;  1R1Y B;  1YHU C;  1A3N A;  1PMB A;  1Y4P B;  5E83 B;  1J40 A;  1Y8H B;  1HGB A;  1HDS B;  4O4T A;  1WMU B;  3WCU A;  2OIF A;  1MTI A;  1YHR B;  2BNL A;  4HHB B;  1MYT A;  1HCO A;  3UHR A;  1LFZ A;  4C44 A;  3CIU A;  1VXA A;  1A0U B;  2VEE A;  1YEQ A;  3UI0 A;  3BOM B;  4L2M A;  4MBA A;  1Y83 B;  1DTI A;  1XZU A;  1CH9 A;  1VRE A;  4YU3 A;  1YOI A;  1XZV A;  4N7P B;  1J7Y B;  4F4O B;  4PQ6 A;  1XCH A;  4F6G A;  1LFT A;  1Y09 B;  111M A;  3S1J A;  2SPN A;  1JW8 A;  2RAO A;  1O1L B;  4N7N A;  3UHQ A;  1DO3 A;  5ILE A;  5JDO F;  1EW6 A;  3VRF B;  1DTM A;  3U3E A;  1UIW A;  1AJ9 B;  2D2M A;  3MYN A;  1XZ5 A;  1Y4B B;  3ARK A;  3M3A A;  3KMF C;  4F6I A;  1C40 B;  1B86 A;  1XZ4 A;  1ITH A;  1CG8 B;  3ZJS A;  1SI4 A;  4MQI B;  2HBD A;  3UH5 A;  1RTE A;  1QSI A;  3H58 A;  1Y2Z B;  1DWT A;  3WCW D;  3BJ3 A;  3HHB A;  1LH5 A;  1FSX A;  1YOH A;  2MBW A;  2ZT2 A;  4NXA A;  3QJE A;  2VLZ A;  4XS0 B;  2WY4 A;  5JDO D;  1MLM A;  1NZ2 A;  2HHD B;  1IBE A;  3QM7 A;  5EET A;  1LFL A;  3PI8 A;  3UHX A;  4ZVA A;  6HBI A;  3LR9 A;  3VRG B;  1XZ7 B;  4LPI A;  1BAB A;  4F69 A;  1DXU A;  2Z8A A;  3ZJP A;  1CH5 A;  3ZJI A;  1CP5 A;  1HLM A;  1UX8 A;  1YVT A;  1L2K A;  3OK5 A;  3ZH0 A;  2PEG B;  1ABS A;  3G4W A;  3HEP A;  3WCT C;  1OUU A;  1EBT A;  1MOC A;  1QI8 A;  2M6Z A;  2ZLT B;  5IKS A;  1URV A;  1GCV A;  2OHB A;  3QJB B;  1FSX B;  4H07 A;  2QMB B;  4NS2 A;  2B7H B;  3IXF A;  4JAC A;  2G0V A;  1NWI A;  1NAZ A;  5B84 A;  3QJD B;  1SDK A;  3LHB A;  2SPM A;  2MYE A;  5AZQ A;  2FAL A;  1Y85 B;  1A0Z A;  1KR7 A;  2D2M B;  1EMY A;  1G08 B;  1RQ4 A;  1YH9 B;  3WR1 A;  2EVP A;  3UBC A;  4HRR A;  3PIA B;  2QSP A;  1JF3 A;  1C7B A;  1T1N A;  1Y8W B;  1Y35 A;  3FS4 B;  2O5L X;  3RJ6 A;  4TWV A;  1ECD A;  1HBH A;  1YDZ B;  3DUT B;  4KMV A;  1MWB A;  1FN3 A;  1SHR B;  1HDB A;  1CLS B;  1THB A;  3ODQ A;  2ZS1 C;  3BA2 A;  3EDA A;  1S56 A;  2G14 A;  4ROM A;  4DWT A;  107M A;  1NZ5 A;  1V9Q A;  1MNK A;  4U8U B;  1PBX B;  1F65 A;  3IC0 A;  1HBR B;  1YMA A;  4ROL B;  2ZT0 A;  1MOA A;  1W92 A;  2VM0 A;  1Y5F B;  2R4Y A;  1DXT A;  4NXC A;  3WCU C;  3WCT B;  5HAV A;  3HXN B;  1VXG A;  2HBE B;  2ZFB A;  1OJ6 A;  1BZP A;  1JZL A;  1R1X A;  5AB8 A;  1FAW B;  1Y22 B;  1BBB A;  1KD2 A;  2D2M C;  1G0B B;  1V4X B;  5SW7 B;  2ZLV B;  1S5X A;  3WCW C;  3UHU A;  1M6M A;  3A2G A;  2BK9 A;  4MXK A;  1M9P B;  1CQX A;  1VHB A;  4NI0 A;  5CN9 A;  1S6A A;  1DWR A;  2D6C A;  4F6J A;  3NFE A;  1O1K A;  1MBI A;  1NPF A;  3UHI A;  1G0B A;  1V4X A;  2DHB A;  2ZS0 C;  1HLB A;  1DLY A;  1J7W B;  3DR9 A;  1HGA B;  2YRS B;  4MQK A;  3OZU A;  3NL7 A;  3A5G A;  2ZFO A;  3AT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...