2VLZA

Crystal structure of peroxymyoglobin generated by cryoradiolytic reduction of myoglobin compound iii
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
153
structure length
153
Chain Sequence
GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Peroxymyoglobin Generated Through Cryoradiolytic Reduction of Myoglobin Compound III During Data Collection.
pubmed doi rcsb
molecule tags Oxygen transport
molecule keywords MYOGLOBIN
total genus 62
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2008-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 2vlzA00
4H2LA 4ZVAA 2YRSA 5EE4D 3WHMB 2YRSB 1X46A 1NZ2A 1O1LB 1MYIA 4YU3B 1HGCA 1LTWA 1YCBA 1Y7DB 3WI8A 1R1XA 2DN2B 3UGZA 1MOHA 1GCWB 1YOHA 1NWNA 4NI0A 1BZZA 2HHBA 1XYEB 2SPNA 1MLSA 2HBDB 3WCTD 1NEJA 4G51A 1SHRA 5EOHA 1IRDB 1BVDA 3UH3A 2ZS0C 3UH6A 3VRFB 1QI8B 2ZSNA 2BMMA 1Y0AA 1YZIA 1F63A 1Y0CB 3NG6B 3DUTB 3UHGA 1SDKB 2QSPA 3DUTA 1V75B 2V1GA 3UHYA 5SW7B 4MQJA 1MYFA 4N7PA 5C6EA 4HSXA 1RPSB 3ARLA 1HGAB 3DHTB 3OVUC 1YE2B 3PI2A 5HU6B 1U7SA 1PMBA 4L7YA 1YMBA 3IC0A 3QM5A 2QFNA 2D5XB 1Y85B 1EW6A 3GQRB 2HBCA 4ODCB 1A00A 1Y35A 1MODA 1YG5B 5CNEA 2ZT4A 3E5OA 4YU4B 1BUWB 2ZFOB 1ECDA 4F6GA 4IROB 2ZLVB 3VAUA 2MYAA 3IXFA 2MYDA 3WFXA 3RJNB 2LHBA 1CBMA 1MLJA 1LA6A 3NFEA 1YCAA 2W6VA 1LFLA 1G08A 1GLIB 1MLLA 1Y7ZA 3UHRA 1XY0A 3WCVA 1CLSA 1J3YA 2ZS1D 5EE4C 2FRFA 3G4WA 1A4FA 3ZJSA 1YH9B 1UC3A 1S5YA 1Y01B 2D2MA 3VREB 2HCOB 5AB8A 4F68A 3HF4A 1J7WB 4M4BB 2MGDA 5JDOF 1DWTA 1MLHA 2AUQA 2DN1B 1X3KA 1J41B 1DUOA 3GOUA 3GQGA 5JDOC 3G4VA 1Y8IB 2EKUA 5CN4A 1BABB 1QSIB 2ZLXB 1QSHB 1Y2ZA 1QXEB 1YGFB 1LFQA 1Y5JB 1QPWB 1IRCA 1G09A 2O5TX 3AQ7A 1V9QA 1LFZB 2LH5A 1SPGB 1HCOB 1O1PB 1SPGA 3OZWA 2LH1A 1HBAB 2ZS1B 3DHRA 1Y8KA 1XZUB 2AA1A 1Y4VA 1Y8HB 2G3HA 1O1JB 3UHSA 1DXVB 1JWNA 1LJWB 1ASHA 1VXBA 2W6YA 3A59B 1SDKA 3K8BA 3E5IA 1CH3A 2DHBA 3D7OA 3B75B 4TWUA 3ZOLA 3HRWB 2RAOB 1A0UA 1TU9A 1UFPA 1VXHA 2BLJM 3LB2A 1Y4RB 3BJ3A 5C6YA 1YVQA 3UHEA 1Y7CB 3GYSA 1UX9A 1Z8UB 1J7YB 2FALA 1XCHA 1M9PA 1K1KB 1OR4A 2D2MB 1NQPA 2AV0A 3UHNA 3PT8B 3PT7A 4HHBA 3VRGB 4MQIA 3PT7B 4MQKA 4MQGA 3G4YA 5IKSA 4TWVA 3QJBA 1YZIB 1A6MA 2FRIX 1A6KA 4JYQA 1A6NA 2IG3A 1DTMA 2HBFA 4F6BA 1M6MA 3BOMB 1VRFA 3VHBA 3D17B 3R5IB 1NZ4A 1NEJB 103MA 2ZLUB 4N7NA 2O5LX 3R5IA 1UIWA 1A4FB 105MA 3GLNA 1S56A 3ZJNA 4AVEA 1MBDA 1A3OB 1Y8KB 1BBBB 3PIAB 2MHBB 1THBB 1WMUA 1KR7A 2GLNA 2V1KA 1DLYA 4XDIA 3NG6A 2D2ND 5CNCA 1YEUA 1C7CB 1ECAA 1MWCA 1QXEA 1YGFA 1A0UB 3G46A 3H57A 3D1KB 4UURA 1OUTB 4G1BA 1HABA 1RQAA 2V1HA 3KMFC 2H8DB 2D5XA 1VXAA 1XZ4A 2D60A 1CQ2A 2ZS0B 1VHBA 3S65A 4N7OA 1HDSA 1YG5A 3OO4A 1UVYA 2MGEA 2HHEA 1N9FA 4FC3A 1MNIA 3OO4B 4U8UC 3CY5A 3V2VA 3BJ2A 1ITHA 3NL7B 2HBGA 3MBAA 1Y0DB 4HRRB 2HZ1A 4MQCB 1CQXA 1CBLA 1YHEB 4H0BA 1JPBA 1HBRB 1OFJA 1N9HA 1V4WB 3HXNB 1CG8B 3HYUB 1Y7CA 3GYSB 1SI4A 1CG8A 3HYUA 4WCHD 3ONZA 1LFZA 4NZIA 3WCPA 1MYTA 2VRYA 2HZ3A 1YFFA 2ZS0D 3GQPB 2Z85A 1YDZA 1JZMA 1OJ6A 4M4BA 1MBNA 4BJAA 2BKMA 3MJPB 2OH9A 1MYMA 3IC2B 4NI1A 3A0GB 4MQHB 1YHUD 4NK2A 1HBHA 1YE0B 1LH6A 2MB5A 4ROLB 1LFQB 1Y5JA 2E2YA 1JL6A 1FDHG 1Y46A 2R80A 2OHAA 2W72C 1DXUB 3M3AA 1J40B 1CG5B 5JOMA 1MWBA 3SZKA 2MGGA 1RPSA 1F5OA 1AJHA 3K9ZA 2HZ2A 1CH4A 1KD2A 3PI9A 5JGGB 1Y7GB 1V5HA 1JF4A 1Y8WA 4U8UD 1C7DB 1COHB 2D2NA 1GJNA 4XS0B 1RQ3B 3MJUA 2D2NB 3QM9A 1MTIA 1BIJA 4HBIA 1LHTA 1ABWB 1YHEA 1HGBB 1BINA 3DR9A 2GL3A 4HRTB 1O1KA 1T1NA 3ZJIA 1X9FC 1S0HA 1MWDA 1XY0B 5HY8A 3D4XA 2QLSA 3WCTB 1CH2A 3D4XB 3P5QB 2ZWJA 2HBDA 3MOUA 1CLSB 2ZS0A 1O1MB 1HV4B 1IT2A 4WJGA 1BZ1A 2VM0A 3O7NA 1L2KA 3QJCB 2GNVA 1C7BB 2HCOA 1SDLB 1GCVB 1MBOA 2GKNA 1HLBA 3IC2A 1Y4PA 3D1AA 1RVWA 1Y0AB 2VLXA 1Y8IA 1RVWB 4YU3A 1GZXB 2XKIA 1LH7A 1VXEA 1ABYA 2QRWA 1HGAA 3GKVB 1JP6A 2D2MD 1OUTA 3AG0A 3ZJQA 1BZZB 2HHDB 3W4UA 1RQAB 1A3NB 1Y7GA 1EBCA 3SDHA 2EVKA 1G0BB 2KSCA 1F5PA 3TM9A 3GDJA 3UHZA 3LQDB 1YHUA 1Y5FA 3BJ1A 1H1XA 1YHUB 1HRMA 1MBCA 5B85A 2HBEA 2V1EA 4HSWA 1YEVB 2WTGA 1JF3A 1DO1A 1Y0DA 1YMAA 2ZSYA 5KERA 1J52A 1ABSA 2H8FB 2O5OX 3K8BB 1MLRA 2AUOA 2G0VA 2ZSQA 4KN3A 2GRHA 2PEGB 1YEQB 4O35A 1HACA 1R1YA 2QLSB 3WCWB 1HSYA 4O2GA 1MLMA 3WCWA 1XZ4B 1Y22B 2O5SX 1A9WA 2GKMA 2VYWA 3HF4B 1DKEB 4M4AA 5E29B 1AZIA 5E29A 1MTJA 1RQ3A 3MYNA 1C40A 1DWRA 1MLNA 3E55A 3WHMA 4FH7A 3UHQA 1HBRA 2G0RA 3KMFA 4B4YA 2W72B 2RI4A 3WCUC 1G9VB 1Y0WA 1F65A 5EYSA 2SPOA 4UIQA 2GTLB 1NAZA 3HXNA 2BK9A 1HBSB 5M3SA 1A6GA 1UT0A 1BZPA 3UGYA 1YMCA 5MBNA 1O1PA 5JDOD 1FLPA 5CNBA 1AJ9A 1IRDA 1J7WA 1FSXA 3WR1B 1Y4FB 1NS9A 1XZ2A 3ZJJA 3OZVA 2GDMA 1V4UA 1X9FA 2HBEB 1V4UB 2BWHA 6HBWA 4NXAA 1PBXB 5EV5A 2PGHA 3OO5A 3AQ8A 1MNKA 5ILPA 1ECNA 1YEUB 4WJG1 3D1KA 5D1VA 1MNOA 4N8TB 1GDIA 3EDAA 111MA 5JGGA 1IT3A 4O1TA 1J3ZA 1Y4BB 4FWYA 1YIHB 1OFKA 1LFTA 1DWSA 3S1JA 3MJUB 5ILRA 5AZRA 1N9XA 2HHEB 1Y0TB 1DXVA 1LH1A 1BZRA 2ZSZA 3ZJPA 1ABWA 4PQCA 1C7CA 1RQ4B 4HRTA 1HGCB 1HBGA 2NRMA 2LH7A 1EBTA 3A5GA 1S61A 3WCWD 1JZLA 1MKOB 5F2AA 3H58A 3M38A 1NZ3A 2MGIA 1DM1A 4PNJA 4KJTA 5CMVA 1MBSA 1SI4B 3PELB 1GDLA 2VEEA 4F6DA 3EOKA 2ZLTA 3OZUA 3NMMA 3ZJHA 1G0BA 4FC3B 2R4XA 5AZQA 4HHBB 2GRFA 2VLZA 3VRFA 2O5MX 1Y09A 3MKBA 3KUOA 1X9FB 2QMBA 1B86B 3HHBA 1V4XB 2OHBA 4TYXA 2C0KA 3ARJA 3BA2A 3ZHWA 4MQCA 2QSPB 1Y0CA 2DC3A 4MQJB 4OF9A 1OUUB 2D5ZB 1JP8A 2GTLD 1HDBA 1Y0WB 2D6CA 6HBIA 3D17A 2ZFOC 1CH5A 3G52A 1YVTB 5CNFA 3UHCA 1XQ5B 3O89A 1Y4QB 2EVPA 1IBEA 2G0SA 3OK5A 1Y85A 1CO8A 1MOAA 1V07A 5CN7A 3W4UB 3PI8A 1O1NB 1J3ZB 1WLAA 1YHRB 4ODCA 5CNDA 1GVHA 4ILZA 3ECLA 3AQ6A 1HBBB 2LH2A 5CN5A 1C7DA 1X9FD 1Y8HA 1MCYA 2FRJX 1IDRA 1LFYB 3A59A 1C40B 1FDHA 5HLUA 3QQQA 2EB9A 2H35A 1QXDA 1XZVB 1V75A 1LH3A 1NS6A 1O1OA 3UI0A 3WCVC 5C6EB 1O1LA 2H8FA 1Y31A 1YENB 1MLKA 5EU2A 3ZOMA 1Y31B 1YENA 2EB8A 3PI4A 4OODA 3LHBA 1JY7B 5B84A 3WCVB 4U8UB 2MYCA 1JY7A 1LFLB 1HBSA 3WCPB 3M39A 3WCTA 2VHBA 3BCQA 2AUPA 1Y8WB 1DXTA 2MGBA 2DN1A 4M4AB 1URYA 4MQGB 2Z8AA 2NX0A 2EKTA 3VRGA 1GDJA 3QJBB 3BJ2B 3MN0A 2MGHA 2MGCA 2HBSB 3TM3A 4C44A 2MYEA 4MAXA 1U7RA 1BABA 3AQ5A 1LHSA 1GZXA 2ZSTA 3OO5B 4ROMA 2ZSOA 1EMYA 2ZT0A 1HLMA 1S0HB 2G11A 1G09B 3SDNA 1YVTA 1JDOA 3DHTA 3UHUA 3GKVA 1A3NA 4L7YB 4G51B 1MLOA 2ZLUA 4N7NB 2WTHA 3S66A 4H07A 2DXMB 1A00B 1Y35B 2MHBA 1MNHA 1XZ2B 3GQPA 1NIHA 2NSRA 5HLQA 1NIHB 1Y5KB 3K3UA 1HBAA 1DUKA 1V4XA 1Y0TA 1YIEB 2IN4A 1MYHA 3U3EA 3AQ9A 1QSIA 1NXFA 5HBIA 1CO9A 1A01A 3V2ZA 1HACB 3LB1A 1YVQB 4DC8A 2FAMA 1S5XA 3ZJRA 3EU1A 1R1YB 3FH9B 2NRLA 3PI9B 1FAWA 1Y4BA 1K1KA 4UZVA 1YH9A 2MYBA 1HHOB 1XZ7B 4NS2A 4N7OB 1YIHA 1Y83B 3WFUA 1YGDA 1VREA 4IROA 2ZS1C 4KMVA 4MXLA 2AV3A 1QXDB 3NL7A 4DWTA 4MPMA 2AURA 1Y4GA 2Z6NB 2RAOA 1GCWA 3ZJLA 1GLIA 5MBAA 1J3FA 2G0XA 5EUIA 3ONZB 1J3YB 2ZFBA 1NPGA 3NMMB 4F6JA 3QZXA 1LH2A 3UBVA 2W31A 3S66B 1FHJB 1FN3A 1HJTA 3HEPA 1MOCA 1XZ5A 3GDJB 1I3EA 4AVDA 3WTGB 4MQKB 1Y4VB 1BBBA 2B7HB 1YOIA 1NS9B 2NSSA 3QJDB 6HBWB 1B86A 1QI8A 3FS4A 1CH1A 3GQGB 1VWTA 4X0LA 1PBXA 3ODQB 2D5ZA 2MGAA 2R4WA 2H35B 5SW7A 3RGKA 1CP5A 2M6ZB 2QFKA 2HBFB 1NS6B 1ECOA 1UMOA 2DN3A 3MYMA 1HDBB 5CN6A 1Y4QA 1DXUA 5HU6A 1YEQA 2FRKX 4N8TA 3G53A 2O5QX 3GQRA 2GNWA 3WFTA 1O1NA 3IC0B 2HBCB 1HCOA 1FAWB 2G0ZA 2G12A 5E6EB 3UHBA 1BZ0B 1HHOA 1NGKA 1NQPB 3A9MA 1XZUA 2AA1B 3QM8A 1LFTB 1VXDA 1EWAA 2V1JA 3E4NA 2DHBB 3S48C 2GRZA 1AJGA 5KDQB 1MDNA 3ZJOA 1XZVA 5CN8A 2ZLWB 4DC7A 7HBIA 3ECXA 2WY4A 1Y4RA 2R4ZA 1LUEA 1J7YA 3G4UA 3QJEA 3UHWA 3QJEB 2H8DA 1G08B 1Y7ZB 4QAUA 1RSEA 1IWHB 4PQ6A 1O1MA 1C7BA 2QU0A 3UH5A 2VEBA 1J7SA 3ECZA 1BJEA 1CP0A 1J7SB 2R1HB 1SDLA 3HHBB 3AT6A 3D1AB 5KKKA 2Z6SA 4LPIA 1JW8A 4HRRA 1W92A 3ODQA 1DLWA 1RTXA 3HENA 3QQRA 3WCVD 1OUUA 1Y46B 2R80B 3ASEA 101MA 1CG5A 1UX8A 1MYJA 4C0NA 1JP9A 3UBCA 1DO4A 4NXCA 1FSLA 3UHHA 3EOKB 3QMAA 1SHRB 3M3BA 2MBWA 2ZT2A 4ZVBA 1Y5FB 4MBNA 3WR1A 1Y09B 3MKBB 1THBA 3LQDA 4O4TA 1Y5KA 1UVXA 1CIOA 3LB3A 3BJ1B 1LJWA 4NK1A 3G4RA 3PI3A 1RQ4A 2CMMA 1OBMA 1LA6B 3UHVA 1FCSA 1A01B 1S69A 5CHRA 1LFVA 1XQ5A 3UHTA 2O58X 2ZSRA 1BZ6A 5EUIB 4GZGA 3ZH0A 3PI8B 3PELA 1YFFB 1SWMA 1Y45A 4F4OB 3S1IA 1FN3B 1GCVA 1MLQA 1CPWA 3IA3B 1Y83A 3UHXA 1LH5A 1DXCA 3TLDA 3UHKA 1G0AB 2HBSA 4MU5A 5F0BA 1YEOB 2ZFOD 1YEOA 2JHOA 2GTLC 2VYYA 2G10A 2Z6NA 1A0ZA 3WCUB 4ROMB 4ROLA 3LR7A 1QSHA 1JZKA 1QPWA 2MGFA 102MA 1T1NB 1MYZA 1OR6A 1MTKA 3SZKB 4VHBA 2ZFBB 2GTLA 1XXTA 1N9IA 1BVCA 1HDAB 4FWZA 5HLXA 1YHUC 1AJ9B 4MBAA 2HHDA 2MGMA 1NZ5A 3WCTC 2MGJA 1WMUB 1XZ5B 1URVA 1A3OA 1GBUB 1DO3A 1I3DA 3AT6B 3ZJMA 1CIKA 4B3WA 1YIEA 1COHA 1VWTB 3WCWC 1LFYA 4NI1B 2XYKA 1B0BA 1JEBB 2V1IA 1MLGA 1O1IB 2SPMA 4ESAA 2ZSXA 1K0YA 3D7OB 2ZSSA 4ESAB 4O4ZA 5KERB 3HRWA 4N7PB 1O1KB 107MA 1H97A 5E83B 5HY8B 5D5RA 3P5QA 1BZ0A 2V1FA 1VXFA 1HV4A 1MBIA 3VREA 2OH8A 4DWUA 1XZ7A 3A5BA 5ILEA 3CIUB 2ZFOA 3NMLA 3ED9A 1BIJB 1JL7A 4JACA 1CH9A 1YOGA 5ILMA 2W6VB 3B75A 2ZLWA 1Y7DA 3AT5A 1NPFA 2XKGA 2D2NC 2QSSB 1CH7A 1HDAA 1BZ1B 2QU0B 4FWXA 2OLPA 3UHIA 2DXMA 2LH6A 2ZLTB 3G4QA 3GK9A 3WFWA 1FHJA 1Y4FA 3DHRB 4MQIB 2R1HA 1UFJA 3HEOA 3WTGA 5EETA 1DO7A 3FS4B 1MOBA 1KFRA 3PI1A 3MVCA 4F69A 5HAVA 3WCUD 3A0GA 2BNLA 2PGHB 4MQHA 1Y4GB 1Y2ZB 1K0YB 2O5BX 2RI4B 1J40A 3KUNA 2PEGA 4F6FA 1D8UA 1GBVB 4F6IA 1MZ0A 1MYGA 1XXTB 1XYEA 5CN9A 1YE2A 2W6WA 3FH9A 4FH6A 5CHQA 1M6CA 1KD2B 1DXDA 1M9PB 1HDSB 2VLYA 1MNJA 3A2GA 3PT8A 2BLIA 4XS0A 3QJDA 4KMWA 3CIUA 5CNGA 4H2LB 1BUWA 1CMYB 2ZT3A 2D2MC 3OJ1A 1CMYA 5KDQA 1JEBA 2M6ZA 2ZT1A 4SDHA 4MXKA 3EDBA 1A9WE 2DN3B 2VYZA 3A5AA 1O1OB 3GKTA 2W72A 1R1XB 2DN2A 1S6AA 3UHDA 4L2MA 1SPEA 2W6XA 1HABB 2XKHA 1HBIA 1S5XB 1MKOA 1MLUA 4U8UA 3ORDA 2HHBB 109MA 2G14A 3LR9A 3QZZA 3BCQB 1S5YB 1NWIA 1Y22A 1MBAA 1IWHA 2ZSPA 4YU4A 3OGBA 5EQMA 1FSXB 1G0AA 3QJCA 1GDKA 2ZLVA 2MGKA 1J41A 4G1VA 2QMBB 1A0ZB 1Y4PB 2BLHA 3WCUA 4X0LB 2ZLXA 1DTIA 2SPLA 3NFEB 3AT5B 1G9VA 2OIFA 1V4WA 1ABYB 2EF2A 3BOMA 3QM6A 3R0GA 2Z6TA 4NI0B 5E83A 1MGNA 1UIWB 4IT8A 3RJ6A 1YHRA 1O16A 3PIAA 1Q1FA 3ARKA 3MJPA 1GBUA 2B7HA 2LH3A 112MA 1O1JA 2R4YA 104MA 1RTEA 3GOUB 1O1IA 106MA 2R50A 1HBHB 1YE0A 5JDOE 1YEVA 1HGBA 3QM7A 1LFVB 108MA 110MA 1GBVA 3EU1B 1IBEB 1VXGA 4PQBA 2D60B 2MGLA 3BJ3B 3LB4A 2QSSA 3S65B 1IOPA 1VXCA 5E6EA 1MLFA 2BW9M 5EYJA 1DXTB 1DKEA 2ZS1A 3UH7A 1WVPA 3HC9A 1TESA 3CY5B 1Y45B 4F4OA 1YDZB 1YGDB 1HBBA
chains in the Genus database with same CATH superfamily
4H2LA 4ZVAA 2YRSA 5EE4D 3WHMB 4H0MA 2YRSB 1X46A 2JLFA 1NZ2A 1O1LB 1MYIA 4YU3B 1HHSA 1HGCA 1LTWA 1YCBA 1Y7DB 3WI8A 1R1XA 2DN2B 3UGZA 1MOHA 1GCWB 1YOHA 3NUHB 3L0FB 1NWNA 4NI0A 1BZZA 2HHBA 1XYEB 2SPNA 1MLSA 2HBDB 3WCTD 1NEJA 4G51A 1SHRA 5EOHA 3V58A 1IRDB 1BVDA 2UUMB 3UH3A 2ZS0C 3UH6A 4PO5B 3VRFB 1QI8B 2ZSNA 2BMMA 1Y0AA 1YZIA 1F63A 1Y0CB 3NG6B 3DUTB 3UHGA 1SDKB 2QSPA 3DUTA 1V75B 2V1GA 3UHYA 5SW7B 4MQJA 1MYFA 4N7PA 5C6EA 4ETVA 4HSXA 1RPSB 3ARLA 1HGAB 3DHTB 3OVUC 1YE2B 3PI2A 5HU6B 1U7SA 1PMBA 4XXIA 4L7YA 1YMBA 3IC0A 3QM5A 2QFNA 2D5XB 1Y85B 1EW6A 3GQRB 2HBCA 4ODCB 1A00A 1Y35A 4F0UB 1MODA 1YG5B 5CNEA 2ZT4A 3E5OA 4YU4B 1BUWB 2ZFOB 1ECDA 4F6GA 4IROB 2V8AB 2ZLVB 3VAUA 2MYAA 3IXFA 2MYDA 3WFXA 3RJNB 2LHBA 1CBMA 1MLJA 1LA6A 3NFEA 1YCAA 2W6VA 3FEWX 4Z8KA 1LFLA 1G08A 1GLIB 1MLLA 1Y7ZA 3UHRA 1XY0A 3WCVA 1CLSA 1J3YA 2ZS1D 5EE4C 2FRFA 3G4WA 4LM6B 1A4FA 3ZJSA 1YH9B 1UC3A 1S5YA 1Y01B 2D2MA 3VREB 2HCOB 5AB8A 4F68A 3HF4A 1J7WB 4M4BB 2MGDA 5JDOF 1DWTA 1MLHA 2AUQA 2DN1B 1X3KA 1J41B 1DUOA 4ETTA 3GOUA 3GQGA 4XXKA 5JDOC 3G4VA 1Y8IB 2EKUA 5CN4A 1BABB 1QSIB 2ZLXB 2UUNB 1QSHB 1Y2ZA 1QXEB 1YGFB 1LFQA 1Y5JB 1QPWB 1IRCA 1G09A 3LQ9A 2O5TX 3AQ7A 1V9QA 1LFZB 2LH5A 4A8FA 1SPGB 1HCOB 1O1PB 1SPGA 3OZWA 4ERVA 2LH1A 1HBAB 2ZS1B 3DHRA 1Y8KA 1XZUB 2AA1A 1Y4VA 1Y8HB 2G3HA 1O1JB 3UHSA 1DXVB 1JWNA 1LJWB 1UVMA 1ASHA 1VXBA 2W6YA 3A59B 1SDKA 3K8BA 3E5IA 1CH3A 2DHBA 3D7OA 3B75B 4TWUA 3ZOLA 3HRWB 2RAOB 1A0UA 1TU9A 1UFPA 1VXHA 2BLJM 3LB2A 1Y4RB 3BJ3A 5C6YA 4N6SA 1YVQA 3UHEA 1Y7CB 3GYSA 1UX9A 1Z8UB 1J7YB 2FALA 1XCHA 1GH0B 2VJTB 1M9PA 1K1KB 1OR4A 2D2MB 1GH0A 1NQPA 2AV0A 2UUMA 3UHNA 3PT8B 3PT7A 4HHBA 3VRGB 4MQIA 3PT7B 4MQKA 4MQGA 3G4YA 5IKSA 4TWVA 3QJBA 1YZIB 1A6MA 2FRIX 1A6KA 4JYQA 1A6NA 3KVSA 2IG3A 1DTMA 2HBFA 4F6BA 1M6MA 3BOMB 1VRFA 3VHBA 3D17B 1CPCA 3R5IB 1NZ4A 1NEJB 103MA 2ZLUB 4N7NA 2O5LX 3R5IA 1UIWA 1A4FB 105MA 3GLNA 1S56A 3ZJNA 4AVEA 1MBDA 1A3OB 1Y8KB 1BBBB 3PIAB 2MHBB 1THBB 1WMUA 2UULH 1KR7A 2GLNA 2V1KA 1DLYA 3VNCA 4XDIA 4ZIZB 3NG6A 2D2ND 5CNCA 1JBOA 1YEUA 1C7CB 1ECAA 1MWCA 1QXEA 1YGFA 1A0UB 3G46A 3H57A 3D1KB 4UURA 1OUTB 4G1BA 2DKAA 1HABA 1RQAA 2V1HA 3KMFC 2H8DB 2D5XA 1VXAA 1XZ4A 2D60A 1CQ2A 2ZS0B 1VHBA 3O18A 3S65A 4N7OA 1HDSA 1YG5A 3OO4A 1UVYA 2MGEA 2HHEA 1N9FA 4FC3A 1MNIA 3OO4B 4U8UC 3CY5A 4Q70A 3V2VA 3BJ2A 1ITHA 3NL7B 2HBGA 3MBAA 1Y0DB 4HRRB 2HZ1A 4MQCB 1CQXA 1CBLA 1YHEB 4H0BA 1JPBA 1HBRB 1OFJA 1N9HA 4Z8KB 1V4WB 3DBJA 1ALLA 3HXNB 1CG8B 3HYUB 1Y7CA 3GYSB 1SI4A 1CG8A 3HYUA 4WCHD 3ONZA 1LFZA 4NZIA 3WCPA 1MYTA 2VRYA 2HZ3A 1YFFA 2ZS0D 3GQPB 1F99B 2Z85A 1YDZA 1JZMA 1OJ6A 4M4BA 1MBNA 4BJAA 2BKMA 3MJPB 2OH9A 1MYMA 3IC2B 4NI1A 4H0MB 3A0GB 4MQHB 1YHUD 4NK2A 1HBHA 1YE0B 1LH6A 2MB5A 4ROLB 1LFQB 1Y5JA 2E2YA 1JL6A 1FDHG 1Y46A 2R80A 2OHAA 2W72C 1DXUB 2VMLA 3M3AA 1J40B 1CG5B 5JOMA 1MWBA 3SZKA 2MGGA 1RPSA 1F5OA 1AJHA 3K9ZA 2HZ2A 1CH4A 1KD2A 3PI9A 5JGGB 1Y7GB 1V5HA 1JF4A 5FVBA 1Y8WA 4U8UD 1PHNA 1C7DB 1COHB 2D2NA 1GJNA 4XS0B 1RQ3B 3MJUA 2D2NB 1QGWC 3ZTAA 2UULC 3QM9A 1MTIA 1BIJA 4HBIA 1LHTA 1ABWB 1YHEA 1HGBB 1BINA 3DR9A 2GL3A 4HRTB 1O1KA 1T1NA 3ZJIA 1X9FC 1S0HA 1MWDA 1XY0B 5HY8A 3D4XA 2QLSA 3WCTB 1CH2A 3D4XB 3P5QB 2ZWJA 2HBDA 3MOUA 1CLSB 2ZS0A 1O1MB 2UULA 3GIOA 1HV4B 1IT2A 4WJGA 1BZ1A 2VM0A 3O7NA 1F99A 2J96A 1L2KA 3QJCB 2GNVA 1C7BB 4PO5A 2HCOA 1SDLB 2C7LA 1GCVB 1MBOA 2GKNA 1HLBA 3IC2A 1Y4PA 3D1AA 1RVWA 1Y0AB 2WCRA 2VLXA 1Y8IA 4ESUA 1RVWB 4BS9A 1HHTP 3KVSB 4YU3A 1GZXB 2XKIA 1LH7A 1HA7B 1VXEA 1ABYA 2QRWA 1HGAA 3GKVB 1JP6A 2D2MD 1OUTA 3AG0A 3ZJQA 1BZZB 2HHDB 3W4UA 1RQAB 1A3NB 1Y7GA 1EBCA 3SDHA 2EVKA 1G0BB 2KSCA 1F5PA 3TM9A 3GDJA 3UHZA 3LQDB 1YHUA 2BV8B 1Y5FA 3BJ1A 1H1XA 1LIAB 1YHUB 1HRMA 1MBCA 5B85A 2HBEA 2V1EA 4HSWA 1YEVB 2WTGA 1JF3A 1DO1A 1XDTT 1HI0P 1Y0DA 1YMAA 2ZSYA 5KERA 1J52A 1ABSA 2H8FB 2O5OX 3K8BB 1MLRA 2AUOA 2G0VA 2VJRA 2ZSQA 4KN3A 2GRHA 2PEGB 1YEQB 4O35A 1ALLB 1HACA 1R1YA 2QLSB 3WCWB 1HSYA 2WCQA 4O2GA 1MLMA 3WCWA 1XZ4B 1Y22B 2O5SX 1A9WA 2GKMA 2VYWA 3HF4B 1DKEB 1B33A 4M4AA 5E29B 1AZIA 3MWNA 5E29A 1MTJA 1RQ3A 3MYNA 1C40A 1DWRA 3PMDA 1MLNA 3E55A 3WHMA 4FH7A 1HBRA 3UHQA 2G0RA 3KMFA 4B4YA 2W72B 2RI4A 3WCUC 1G9VB 1Y0WA 1F65A 5EYSA 2SPOA 2GTLB 4UIQA 1NAZA 2UULD 3HXNA 2BK9A 1HBSB 5M3SA 1A6GA 1UT0A 1BZPA 3UGYA 1YMCA 5MBNA 1O1PA 5JDOD 1FLPA 5CNBA 1AJ9A 1IRDA 1J7WA 1FSXA 2C7KB 3WR1B 1Y4FB 1NS9A 1XZ2A 2BV8A 3GUQA 3ZJJA 3OZVA 2GDMA 1V4UA 1I7YB 1X9FA 2HBEB 1V4UB 2BWHA 6HBWA 4NXAA 1PBXB 5EV5A 2PGHA 3OO5A 3AQ8A 1MNKA 2UUNA 1ECNA 5ILPA 4TMAB 1YEUB 4WJG1 1HA7A 3D1KA 5D1VA 2UUMX 1MNOA 4N8TB 1GDIA 3EDAA 3O18B 111MA 5JGGA 1IT3A 4O1TA 1J3ZA 1Y4BB 4FWYA 1YIHB 1OFKA 1LFTA 1DWSA 3S1JA 3MJUB 5ILRA 1F0LA 1N9XA 5AZRA 2HHEB 1Y0TB 1DXVA 1LH1A 1BZRA 2ZSZA 3ZJPA 3O2CB 1ABWA 4PQCA 1C7CA 1RQ4B 4HRTA 1HGCB 2VJRB 1HBGA 2NRMA 2LH7A 1EBTA 3A5GA 1S61A 1KN1B 3WCWD 1JZLA 1MKOB 5F2AA 3H58A 3M38A 1NZ3A 2MGIA 1DM1A 4PNJA 4KJTA 5CMVA 1MBSA 1SI4B 3PELB 1GDLA 2VEEA 4F6DA 3EOKA 2ZLTA 3OZUA 3NMMA 3ZJHA 1G0BA 4FC3B 2R4XA 5AZQA 4HHBB 2GRFA 2VLZA 3VRFA 2O5MX 1Y09A 3MKBA 3KUOA 1I7YA 1X9FB 2QMBA 1B86B 3HHBA 1V4XB 2OHBA 4TYXA 2C0KA 3ARJA 3BA2A 3ZHWA 4MQCA 2QSPB 1Y0CA 2DC3A 4MQJB 4OF9A 1OUUB 2D5ZB 1JP8A 2GTLD 1HDBA 1Y0WB 2D6CA 6HBIA 3D17A 2ZFOC 1CH5A 3G52A 1YVTB 5CNFA 3UHCA 1XQ5B 3O89A 3PMCA 1Y4QB 2EVPA 1IBEA 2G0SA 3OK5A 1Y85A 1CO8A 1MOAA 1V07A 5CN7A 3W4UB 4L1EB 3PI8A 1O1NB 1J3ZB 1WLAA 1YHRB 4ODCA 5CNDA 1GVHA 4ILZA 3ECLA 3AQ6A 1HBBB 2LH2A 5CN5A 1C7DA 1X9FD 1Y8HA 1MCYA 2FRJX 1IDRA 1LFYB 3A59A 1C40B 1FDHA 3QQQA 5HLUA 2EB9A 2H35A 1QXDA 1XZVB 1V75A 1LH3A 1NS6A 1O1OA 3UI0A 3WCVC 5C6EB 1O1LA 2H8FA 1Y31A 1YENB 1MLKA 5EU2A 3ZOMA 1Y31B 1YENA 2EB8A 3PI4A 4OODA 3LHBA 1JY7B 5B84A 3WCVB 4U8UB 2MYCA 1JY7A 1RH1A 1LFLB 3V57B 1HBSA 3WCPB 3M39A 3WCTA 2VHBA 1B33B 3BCQA 2AUPA 1Y8WB 1DXTA 2MGBA 2DN1A 4M4AB 1URYA 4MQGB 2Z8AA 2NX0A 2EKTA 3VRGA 1GDJA 3QJBB 3MN0A 3BJ2B 2MGHA 2MGCA 2HBSB 2JL9A 3TM3A 4A8YA 4C44A 2MYEA 4MAXA 1U7RA 1BABA 3AQ5A 1LHSA 1GZXA 2ZSTA 3OO5B 4ROMA 2ZSOA 1EMYA 2ZT0A 1HLMA 1S0HB 2G11A 1G09B 3SDNA 1YVTA 1JDOA 3DHTA 4RMPA 3UHUA 3GKVA 1A3NA 4L7YB 4G51B 1MLOA 2ZLUA 4N7NB 2WTHA 3S66A 4H07A 2DXMB 1MDTA 1A00B 1Y35B 2MHBA 4F0UA 1MNHA 1XZ2B 3GQPA 1NIHA 2NSRA 5HLQA 1NIHB 1Y5KB 3K3UA 1HBAA 1DUKA 1V4XA 1Y0TA 1YIEB 2IN4A 1MYHA 3U3EA 3AQ9A 1QSIA 1NXFA 5HBIA 1CO9A 2C7JB 1A01A 3V2ZA 1HACB 3LB1A 1YVQB 4DC8A 2FAMA 1S5XA 3ZJRA 3EU1A 1DDTA 1R1YB 3FH9B 2NRLA 3PI9B 4A8OA 1FAWA 1Y4BA 1K1KA 4UZVA 1KTPA 1YH9A 2MYBA 1HHOB 1XZ7B 4NS2A 4N7OB 1XF6C 1YIHA 1Y83B 3WFUA 1YGDA 1VREA 4IROA 2ZS1C 4KMVA 4MXLA 2AV3A 1QXDB 3NL7A 4DWTA 4MPMA 2AURA 1Y4GA 2Z6NB 2RAOA 1GCWA 3ZJLA 1GLIA 5MBAA 1B8DB 4YJJA 1J3FA 2G0XA 4RMPB 1B8DA 4YJJB 5EUIA 3ONZB 1J3YB 2ZFBA 2X49A 1NPGA 3NMMB 3V58B 3QZXA 1LH2A 4F6JA 3UBVA 2W31A 3S66B 1FHJB 2C7KA 1FN3A 1HJTA 3HEPA 1MOCA 1XZ5A 3GDJB 1I3EA 4AVDA 3WTGB 4MQKB 1Y4VB 1BBBA 2B7HB 1YOIA 4HH0A 1LIAA 3BRPB 1NS9B 2NSSA 3QJDB 6HBWB 1B86A 1QI8A 3FS4A 1CH1A 3GQGB 1VWTA 4X0LA 1PBXA 3ODQB 2D5ZA 2MGAA 2R4WA 2H35B 5SW7A 3RGKA 1CP5A 2M6ZB 2QFKA 2HBFB 1NS6B 1ECOA 1UMOA 2DN3A 3MYMA 1UVNA 1HDBB 5CN6A 1Y4QA 1DXUA 5HU6A 1YEQA 2FRKX 4N8TA 1CPCB 3G53A 2O5QX 4B02A 3GQRA 4GXEB 2GNWA 3WFTA 1O1NA 3IC0B 2HBCB 1HCOA 1FAWB 2G0ZA 2G12A 4L1EA 5E6EB 2DKCA 3UHBA 1BZ0B 1HHOA 1NGKA 1NQPB 3A9MA 1XZUA 2AA1B 3QM8A 1LFTB 5FVBM 1HI8A 1VXDA 1EWAA 2V1JA 3E4NA 2DHBB 3S48C 2GRZA 4ZIZA 1AJGA 5KDQB 1MDNA 3ZJOA 1XZVA 5CN8A 2ZLWB 4DC7A 7HBIA 3ECXA 4A8MP 2WY4A 1Y4RA 4AE1A 1UVKA 1LUEA 2R4ZA 1J7YA 3G4UA 3QJEA 3UHWA 2VJTA 3QJEB 2H8DA 1G08B 1Y7ZB 4ETUA 4QAUA 1RSEA 1IWHB 4PQ6A 1COLA 1O1MA 1C7BA 2QU0A 3UH5A 2VEBA 1J7SA 3ECZA 1BJEA 1CP0A 1J7SB 2R1HB 1SDLA 2C7LB 3HHBB 3AT6A 3D1AB 5KKKA 2Z6SA 4LPIA 2I88A 1JW8A 4HRRA 1W92A 3ODQA 1DLWA 1RTXA 3HENA 3QQRA 3WCVD 2VMLB 2C7JA 4F0TB 1OUUA 1Y46B 2R80B 2UUND 3ASEA 101MA 1CG5A 1UX8A 1MYJA 4C0NA 1JP9A 1DO4A 3UBCA 4NXCA 1FSLA 3UHHA 3EOKB 3QMAA 1SHRB 3M3BA 2MBWA 2ZT2A 4ZVBA 1Y5FB 4MBNA 3WR1A 1Y09B 3MKBB 1THBA 3LQDA 4O4TA 1Y5KA 1UVXA 2YSKA 1CIOA 3LB3A 3BJ1B 1LJWA 3O2CA 4NK1A 3G4RA 3PI3A 1RQ4A 2CMMA 1OBMA 1LA6B 3UHVA 1FCSA 1A01B 1S69A 5CHRA 4GY3A 1LFVA 1XQ5A 3UHTA 2O58X 2ZSRA 1BZ6A 5EUIB 4GZGA 3ZH0A 3PI8B 3PELA 1YFFB 1SWMA 1ON7A 1Y45A 4F4OB 3S1IA 1FN3B 1GCVA 1MLQA 1CPWA 3IA3B 1Y83A 3UHXA 1LH5A 1NY9A 1DXCA 3TLDA 3UHKA 1UVIA 1G0AB 2HBSA 4MU5A 5F0BA 1YEOB 2ZFOD 1YEOA 4ERTA 2JHOA 2GTLC 2VYYA 2G10A 2Z6NA 1A0ZA 3WCUB 4ROMB 4ROLA 3LR7A 1QSHA 1EYXB 1JZKA 1QPWA 2MGFA 102MA 1T1NB 1SGKA 1MYZA 1OR6A 3DBJB 1KN1A 1MTKA 3SZKB 4VHBA 2ZFBB 2GTLA 1XXTA 1N9IA 1TOXA 1BVCA 1HDAB 2VJHA 4FWZA 5HLXA 1YHUC 1AJ9B 4MBAA 2HHDA 2MGMA 1NZ5A 3WCTC 2MGJA 1WMUB 1XZ5B 1URVA 1A3OA 1GBUB 1DO3A 4LMXB 1I3DA 3AT6B 3ZJMA 1CIKA 4A8KA 4B3WA 1YIEA 4A8SA 1COHA 1VWTB 3WCWC 1LFYA 4NI1B 2XYKA 1B0BA 1JEBB 2V1IA 1MLGA 1O1IB 2SPMA 4ESAA 2ZSXA 1K0YA 3D7OB 2ZSSA 1HI1A 4ESAB 4O4ZA 5KERB 3HRWA 4BJUA 4N7PB 3RQRA 1CIIA 1O1KB 2X4AA 107MA 1H97A 5E83B 5HY8B 5D5RA 4GXEA 3P5QA 1BZ0A 2V1FA 1VXFA 1HV4A 1MBIA 3VREA 2OH8A 4DWUA 1XZ7A 3A5BA 1WACA 5ILEA 3CIUB 2ZFOA 3NMLA 3ED9A 1BIJB 4Q70B 1UVLA 1JL7A 4JACA 1CH9A 1YOGA 4AE0A 5ILMA 2W6VB 1EYXA 3B75A 2ZLWA 1Y7DA 3AT5A 5AQDM 1NPFA 2XKGA 2D2NC 2QSSB 1CH7A 2VJHB 1HDAA 1BZ1B 3V57A 2QU0B 4FWXA 1KTPB 2OLPA 1ON7B 3UHIA 2DXMA 2LH6A 2ZLTB 3G4QA 3GK9A 3WFWA 1FHJA 1Y4FA 3DHRB 4MQIB 2R1HA 1UFJA 3HEOA 3WTGA 5EETA 1DO7A 3FS4B 1MOBA 1KFRA 3PI1A 3BRPA 3MVCA 4F69A 5HAVA 3WCUD 3A0GA 2BNLA 2PGHB 4MQHA 1Y4GB 1Y2ZB 1K0YB 2O5BX 2RI4B 1J40A 3KUNA 2PEGA 4F6FA 1D8UA 1GBVB 4F6IA 1MZ0A 1MYGA 1XXTB 4A8WA 4N6SB 1XYEA 5CN9A 1YE2A 2W6WA 3FH9A 4FH6A 5CHQA 1M6CA 1KD2B 1DXDA 1M9PB 1HDSB 2VLYA 5B13G 1MNJA 3A2GA 3PT8A 2BLIA 4KMWA 3QJDA 4XS0A 3CIUA 5CNGA 4H2LB 1BUWA 1CMYB 2ZT3A 2D2MC 3OJ1A 1CMYA 5KDQA 1JEBA 2M6ZA 2ZT1A 4SDHA 4MXKA 3EDBA 1A9WE 2DN3B 2VYZA 3A5AA 1O1OB 3GKTA 2W72A 1R1XB 2DN2A 1S6AA 4GY3B 3UHDA 5B13A 4L2MA 1SPEA 2W6XA 4HH1A 1HABB 2XKHA 1HBIA 3L0FA 1S5XB 4A8QA 1MKOA 1MLUA 4U8UA 3ORDA 2HHBB 109MA 2G14A 3LR9A 3QZZA 3BCQB 1S5YB 1NWIA 1Y22A 1MBAA 2UULB 1IWHA 2ZSPA 4YU4A 3OGBA 5EQMA 1FSXB 1G0AA 3QJCA 1GDKA 2ZLVA 2MGKA 1A87A 1J41A 4G1VA 2QMBB 1A0ZB 1Y4PB 2BLHA 3WCUA 4X0LB 5AQDA 2ZLXA 1DTIA 2SPLA 1JBOB 3NFEB 2JLGA 3AT5B 1G9VA 2OIFA 1V4WA 1ABYB 2EF2A 3R0GA 3BOMA 3QM6A 4F0TA 4LMSB 2Z6TA 4NI0B 5E83A 1MGNA 1UIWB 4IT8A 3RJ6A 1YHRA 1O16A 2DKDA 3PIAA 3MJPA 1Q1FA 1XG0C 3ARKA 1GBUA 1UVJA 2B7HA 2LH3A 112MA 1O1JA 2R4YA 104MA 1RTEA 3GOUB 2V8AA 1O1IA 106MA 2R50A 1HBHB 1YE0A 5JDOE 1YEVA 1HGBA 3QM7A 1LFVB 108MA 110MA 1GBVA 3EU1B 1IBEB 1VXGA 4PQBA 2D60B 2MGLA 3BJ3B 3LB4A 2QSSA 3S65B 1IOPA 1VXCA 5E6EA 1MLFA 2BW9M 1DXTB 5EYJA 1DKEA 2ZS1A 3UH7A 1WVPA 3HC9A 1TESA 3CY5B 1Y45B 4F4OA 1PHNB 1YDZB 1YGDB 1HBBA
chains in the Genus database with same CATH topology
4H2LA 4ZVAA 2YRSA 5EE4D 3WHMB 2YRSB 1X46A 1NZ2A 1O1LB 1MYIA 4YU3B 1HGCA 1LTWA 1YCBA 1Y7DB 3WI8A 1R1XA 2DN2B 3UGZA 1MOHA 1GCWB 1YOHA 1NWNA 4NI0A 1BZZA 2HHBA 1XYEB 2SPNA 1MLSA 2HBDB 3WCTD 1NEJA 4G51A 1SHRA 5EOHA 1IRDB 1BVDA 3UH3A 2ZS0C 3UH6A 3VRFB 1QI8B 2ZSNA 2BMMA 1Y0AA 1YZIA 1F63A 1Y0CB 3NG6B 3DUTB 3UHGA 1SDKB 2QSPA 3DUTA 1V75B 2V1GA 3UHYA 5SW7B 4MQJA 1MYFA 4N7PA 5C6EA 4HSXA 1RPSB 3ARLA 1HGAB 3DHTB 3OVUC 1YE2B 3PI2A 5HU6B 1U7SA 1PMBA 4L7YA 1YMBA 3IC0A 3QM5A 2QFNA 2D5XB 1Y85B 1EW6A 3GQRB 2HBCA 4ODCB 1A00A 1Y35A 1MODA 1YG5B 5CNEA 2ZT4A 3E5OA 4YU4B 1BUWB 2ZFOB 1ECDA 4F6GA 4IROB 2ZLVB 3VAUA 2MYAA 3IXFA 2MYDA 3WFXA 3RJNB 2LHBA 1CBMA 1MLJA 1LA6A 3NFEA 1YCAA 2W6VA 1LFLA 1G08A 1GLIB 1MLLA 1Y7ZA 3UHRA 1XY0A 3WCVA 1CLSA 1J3YA 2ZS1D 5EE4C 2FRFA 3G4WA 1A4FA 3ZJSA 1YH9B 1UC3A 1S5YA 1Y01B 2D2MA 3VREB 2HCOB 5AB8A 4F68A 3HF4A 1J7WB 4M4BB 2MGDA 5JDOF 1DWTA 1MLHA 2AUQA 2DN1B 1X3KA 1J41B 1DUOA 3GOUA 3GQGA 5JDOC 3G4VA 1Y8IB 2EKUA 5CN4A 1BABB 1QSIB 2ZLXB 1QSHB 1Y2ZA 1QXEB 1YGFB 1LFQA 1Y5JB 1QPWB 1IRCA 1G09A 2O5TX 3AQ7A 1V9QA 1LFZB 2LH5A 1SPGB 1HCOB 1O1PB 1SPGA 3OZWA 2LH1A 1HBAB 2ZS1B 3DHRA 1Y8KA 1XZUB 2AA1A 1Y4VA 1Y8HB 2G3HA 1O1JB 3UHSA 1DXVB 1JWNA 1LJWB 1ASHA 1VXBA 2W6YA 3A59B 1SDKA 3K8BA 3E5IA 1CH3A 2DHBA 3D7OA 3B75B 4TWUA 3ZOLA 3HRWB 2RAOB 1A0UA 1TU9A 1UFPA 1VXHA 2BLJM 3LB2A 1Y4RB 3BJ3A 5C6YA 1YVQA 3UHEA 1Y7CB 3GYSA 1UX9A 1Z8UB 1J7YB 2FALA 1XCHA 1M9PA 1K1KB 1OR4A 2D2MB 1NQPA 2AV0A 3UHNA 3PT8B 3PT7A 4HHBA 3VRGB 4MQIA 3PT7B 4MQKA 4MQGA 3G4YA 5IKSA 4TWVA 3QJBA 1YZIB 1A6MA 2FRIX 1A6KA 4JYQA 1A6NA 2IG3A 1DTMA 2HBFA 4F6BA 1M6MA 3BOMB 1VRFA 3VHBA 3D17B 3R5IB 1NZ4A 1NEJB 103MA 2ZLUB 4N7NA 2O5LX 3R5IA 1UIWA 1A4FB 105MA 3GLNA 1S56A 3ZJNA 4AVEA 1MBDA 1A3OB 1Y8KB 1BBBB 3PIAB 2MHBB 1THBB 1WMUA 1KR7A 2GLNA 2V1KA 1DLYA 4XDIA 3NG6A 2D2ND 5CNCA 1YEUA 1C7CB 1ECAA 1MWCA 1QXEA 1YGFA 1A0UB 3G46A 3H57A 3D1KB 4UURA 1OUTB 4G1BA 1HABA 1RQAA 2V1HA 3KMFC 2H8DB 2D5XA 1VXAA 1XZ4A 2D60A 1CQ2A 2ZS0B 1VHBA 3S65A 4N7OA 1HDSA 1YG5A 3OO4A 1UVYA 2MGEA 2HHEA 1N9FA 4FC3A 1MNIA 3OO4B 4U8UC 3CY5A 3V2VA 3BJ2A 1ITHA 3NL7B 2HBGA 3MBAA 1Y0DB 4HRRB 2HZ1A 4MQCB 1CQXA 1CBLA 1YHEB 4H0BA 1JPBA 1HBRB 1OFJA 1N9HA 1V4WB 3HXNB 1CG8B 3HYUB 1Y7CA 3GYSB 1SI4A 1CG8A 3HYUA 4WCHD 3ONZA 1LFZA 4NZIA 3WCPA 1MYTA 2VRYA 2HZ3A 1YFFA 2ZS0D 3GQPB 2Z85A 1YDZA 1JZMA 1OJ6A 4M4BA 1MBNA 4BJAA 2BKMA 3MJPB 2OH9A 1MYMA 3IC2B 4NI1A 3A0GB 4MQHB 1YHUD 4NK2A 1HBHA 1YE0B 1LH6A 2MB5A 4ROLB 1LFQB 1Y5JA 2E2YA 1JL6A 1FDHG 1Y46A 2R80A 2OHAA 2W72C 1DXUB 3M3AA 1J40B 1CG5B 5JOMA 1MWBA 3SZKA 2MGGA 1RPSA 1F5OA 1AJHA 3K9ZA 2HZ2A 1CH4A 1KD2A 3PI9A 5JGGB 1Y7GB 1V5HA 1JF4A 1Y8WA 4U8UD 1C7DB 1COHB 2D2NA 1GJNA 4XS0B 1RQ3B 3MJUA 2D2NB 3QM9A 1MTIA 1BIJA 4HBIA 1LHTA 1ABWB 1YHEA 1HGBB 1BINA 3DR9A 2GL3A 4HRTB 1O1KA 1T1NA 3ZJIA 1X9FC 1S0HA 1MWDA 1XY0B 5HY8A 3D4XA 2QLSA 3WCTB 1CH2A 3D4XB 3P5QB 2ZWJA 2HBDA 3MOUA 1CLSB 2ZS0A 1O1MB 1HV4B 1IT2A 4WJGA 1BZ1A 2VM0A 3O7NA 1L2KA 3QJCB 2GNVA 1C7BB 2HCOA 1SDLB 1GCVB 1MBOA 2GKNA 1HLBA 3IC2A 1Y4PA 3D1AA 1RVWA 1Y0AB 2VLXA 1Y8IA 1RVWB 4YU3A 1GZXB 2XKIA 1LH7A 1VXEA 1ABYA 2QRWA 1HGAA 3GKVB 1JP6A 2D2MD 1OUTA 3AG0A 3ZJQA 1BZZB 2HHDB 3W4UA 1RQAB 1A3NB 1Y7GA 1EBCA 3SDHA 2EVKA 1G0BB 2KSCA 1F5PA 3TM9A 3GDJA 3UHZA 3LQDB 1YHUA 1Y5FA 3BJ1A 1H1XA 1YHUB 1HRMA 1MBCA 5B85A 2HBEA 2V1EA 4HSWA 1YEVB 2WTGA 1JF3A 1DO1A 1Y0DA 1YMAA 2ZSYA 5KERA 1J52A 1ABSA 2H8FB 2O5OX 3K8BB 1MLRA 2AUOA 2G0VA 2ZSQA 4KN3A 2GRHA 2PEGB 1YEQB 4O35A 1HACA 1R1YA 2QLSB 3WCWB 1HSYA 4O2GA 1MLMA 3WCWA 1XZ4B 1Y22B 2O5SX 1A9WA 2GKMA 2VYWA 3HF4B 1DKEB 4M4AA 5E29B 1AZIA 5E29A 1MTJA 1RQ3A 3MYNA 1C40A 1DWRA 1MLNA 3E55A 3WHMA 4FH7A 3UHQA 1HBRA 2G0RA 3KMFA 4B4YA 2W72B 2RI4A 3WCUC 1G9VB 1Y0WA 1F65A 5EYSA 2SPOA 4UIQA 2GTLB 1NAZA 3HXNA 2BK9A 1HBSB 5M3SA 1A6GA 1UT0A 1BZPA 3UGYA 1YMCA 5MBNA 1O1PA 5JDOD 1FLPA 5CNBA 1AJ9A 1IRDA 1J7WA 1FSXA 3WR1B 1Y4FB 1NS9A 1XZ2A 3ZJJA 3OZVA 2GDMA 1V4UA 1X9FA 2HBEB 1V4UB 2BWHA 6HBWA 4NXAA 1PBXB 5EV5A 2PGHA 3OO5A 3AQ8A 1MNKA 5ILPA 1ECNA 1YEUB 4WJG1 3D1KA 5D1VA 1MNOA 4N8TB 1GDIA 3EDAA 111MA 5JGGA 1IT3A 4O1TA 1J3ZA 1Y4BB 4FWYA 1YIHB 1OFKA 1LFTA 1DWSA 3S1JA 3MJUB 5ILRA 5AZRA 1N9XA 2HHEB 1Y0TB 1DXVA 1LH1A 1BZRA 2ZSZA 3ZJPA 1ABWA 4PQCA 1C7CA 1RQ4B 4HRTA 1HGCB 1HBGA 2NRMA 2LH7A 1EBTA 3A5GA 1S61A 3WCWD 1JZLA 1MKOB 5F2AA 3H58A 3M38A 1NZ3A 2MGIA 1DM1A 4PNJA 4KJTA 5CMVA 1MBSA 1SI4B 3PELB 1GDLA 2VEEA 4F6DA 3EOKA 2ZLTA 3OZUA 3NMMA 3ZJHA 1G0BA 4FC3B 2R4XA 5AZQA 4HHBB 2GRFA 2VLZA 3VRFA 2O5MX 1Y09A 3MKBA 3KUOA 1X9FB 2QMBA 1B86B 3HHBA 1V4XB 2OHBA 4TYXA 2C0KA 3ARJA 3BA2A 3ZHWA 4MQCA 2QSPB 1Y0CA 2DC3A 4MQJB 4OF9A 1OUUB 2D5ZB 1JP8A 2GTLD 1HDBA 1Y0WB 2D6CA 6HBIA 3D17A 2ZFOC 1CH5A 3G52A 1YVTB 5CNFA 3UHCA 1XQ5B 3O89A 1Y4QB 2EVPA 1IBEA 2G0SA 3OK5A 1Y85A 1CO8A 1MOAA 1V07A 5CN7A 3W4UB 3PI8A 1O1NB 1J3ZB 1WLAA 1YHRB 4ODCA 5CNDA 1GVHA 4ILZA 3ECLA 3AQ6A 1HBBB 2LH2A 5CN5A 1C7DA 1X9FD 1Y8HA 1MCYA 2FRJX 1IDRA 1LFYB 3A59A 1C40B 1FDHA 5HLUA 3QQQA 2EB9A 2H35A 1QXDA 1XZVB 1V75A 1LH3A 1NS6A 1O1OA 3UI0A 3WCVC 5C6EB 1O1LA 2H8FA 1Y31A 1YENB 1MLKA 5EU2A 3ZOMA 1Y31B 1YENA 2EB8A 3PI4A 4OODA 3LHBA 1JY7B 5B84A 3WCVB 4U8UB 2MYCA 1JY7A 1LFLB 1HBSA 3WCPB 3M39A 3WCTA 2VHBA 3BCQA 2AUPA 1Y8WB 1DXTA 2MGBA 2DN1A 4M4AB 1URYA 4MQGB 2Z8AA 2NX0A 2EKTA 3VRGA 1GDJA 3QJBB 3BJ2B 3MN0A 2MGHA 2MGCA 2HBSB 3TM3A 4C44A 2MYEA 4MAXA 1U7RA 1BABA 3AQ5A 1LHSA 1GZXA 2ZSTA 3OO5B 4ROMA 2ZSOA 1EMYA 2ZT0A 1HLMA 1S0HB 2G11A 1G09B 3SDNA 1YVTA 1JDOA 3DHTA 3UHUA 3GKVA 1A3NA 4L7YB 4G51B 1MLOA 2ZLUA 4N7NB 2WTHA 3S66A 4H07A 2DXMB 1A00B 1Y35B 2MHBA 1MNHA 1XZ2B 3GQPA 1NIHA 2NSRA 5HLQA 1NIHB 1Y5KB 3K3UA 1HBAA 1DUKA 1V4XA 1Y0TA 1YIEB 2IN4A 1MYHA 3U3EA 3AQ9A 1QSIA 1NXFA 5HBIA 1CO9A 1A01A 3V2ZA 1HACB 3LB1A 1YVQB 4DC8A 2FAMA 1S5XA 3ZJRA 3EU1A 1R1YB 3FH9B 2NRLA 3PI9B 1FAWA 1Y4BA 1K1KA 4UZVA 1YH9A 2MYBA 1HHOB 1XZ7B 4NS2A 4N7OB 1YIHA 1Y83B 3WFUA 1YGDA 1VREA 4IROA 2ZS1C 4KMVA 4MXLA 2AV3A 1QXDB 3NL7A 4DWTA 4MPMA 2AURA 1Y4GA 2Z6NB 2RAOA 1GCWA 3ZJLA 1GLIA 5MBAA 1J3FA 2G0XA 5EUIA 3ONZB 1J3YB 2ZFBA 1NPGA 3NMMB 4F6JA 3QZXA 1LH2A 3UBVA 2W31A 3S66B 1FHJB 1FN3A 1HJTA 3HEPA 1MOCA 1XZ5A 3GDJB 1I3EA 4AVDA 3WTGB 4MQKB 1Y4VB 1BBBA 2B7HB 1YOIA 1NS9B 2NSSA 3QJDB 6HBWB 1B86A 1QI8A 3FS4A 1CH1A 3GQGB 1VWTA 4X0LA 1PBXA 3ODQB 2D5ZA 2MGAA 2R4WA 2H35B 5SW7A 3RGKA 1CP5A 2M6ZB 2QFKA 2HBFB 1NS6B 1ECOA 1UMOA 2DN3A 3MYMA 1HDBB 5CN6A 1Y4QA 1DXUA 5HU6A 1YEQA 2FRKX 4N8TA 3G53A 2O5QX 3GQRA 2GNWA 3WFTA 1O1NA 3IC0B 2HBCB 1HCOA 1FAWB 2G0ZA 2G12A 5E6EB 3UHBA 1BZ0B 1HHOA 1NGKA 1NQPB 3A9MA 1XZUA 2AA1B 3QM8A 1LFTB 1VXDA 1EWAA 2V1JA 3E4NA 2DHBB 3S48C 2GRZA 1AJGA 5KDQB 1MDNA 3ZJOA 1XZVA 5CN8A 2ZLWB 4DC7A 7HBIA 3ECXA 2WY4A 1Y4RA 2R4ZA 1LUEA 1J7YA 3G4UA 3QJEA 3UHWA 3QJEB 2H8DA 1G08B 1Y7ZB 4QAUA 1RSEA 1IWHB 4PQ6A 1O1MA 1C7BA 2QU0A 3UH5A 2VEBA 1J7SA 3ECZA 1BJEA 1CP0A 1J7SB 2R1HB 1SDLA 3HHBB 3AT6A 3D1AB 5KKKA 2Z6SA 4LPIA 1JW8A 4HRRA 1W92A 3ODQA 1DLWA 1RTXA 3HENA 3QQRA 3WCVD 1OUUA 1Y46B 2R80B 3ASEA 101MA 1CG5A 1UX8A 1MYJA 4C0NA 1JP9A 3UBCA 1DO4A 4NXCA 1FSLA 3UHHA 3EOKB 3QMAA 1SHRB 3M3BA 2MBWA 2ZT2A 4ZVBA 1Y5FB 4MBNA 3WR1A 1Y09B 3MKBB 1THBA 3LQDA 4O4TA 1Y5KA 1UVXA 1CIOA 3LB3A 3BJ1B 1LJWA 4NK1A 3G4RA 3PI3A 1RQ4A 2CMMA 1OBMA 1LA6B 3UHVA 1FCSA 1A01B 1S69A 5CHRA 1LFVA 1XQ5A 3UHTA 2O58X 2ZSRA 1BZ6A 5EUIB 4GZGA 3ZH0A 3PI8B 3PELA 1YFFB 1SWMA 1Y45A 4F4OB 3S1IA 1FN3B 1GCVA 1MLQA 1CPWA 3IA3B 1Y83A 3UHXA 1LH5A 1DXCA 3TLDA 3UHKA 1G0AB 2HBSA 4MU5A 5F0BA 1YEOB 2ZFOD 1YEOA 2JHOA 2GTLC 2VYYA 2G10A 2Z6NA 1A0ZA 3WCUB 4ROMB 4ROLA 3LR7A 1QSHA 1JZKA 1QPWA 2MGFA 102MA 1T1NB 1MYZA 1OR6A 1MTKA 3SZKB 4VHBA 2ZFBB 2GTLA 1XXTA 1N9IA 1BVCA 1HDAB 4FWZA 5HLXA 1YHUC 1AJ9B 4MBAA 2HHDA 2MGMA 1NZ5A 3WCTC 2MGJA 1WMUB 1XZ5B 1URVA 1A3OA 1GBUB 1DO3A 1I3DA 3AT6B 3ZJMA 1CIKA 4B3WA 1YIEA 1COHA 1VWTB 3WCWC 1LFYA 4NI1B 2XYKA 1B0BA 1JEBB 2V1IA 1MLGA 1O1IB 2SPMA 4ESAA 2ZSXA 1K0YA 3D7OB 2ZSSA 4ESAB 4O4ZA 5KERB 3HRWA 4N7PB 1O1KB 107MA 1H97A 5E83B 5HY8B 5D5RA 3P5QA 1BZ0A 2V1FA 1VXFA 1HV4A 1MBIA 3VREA 2OH8A 4DWUA 1XZ7A 3A5BA 5ILEA 3CIUB 2ZFOA 3NMLA 3ED9A 1BIJB 1JL7A 4JACA 1CH9A 1YOGA 5ILMA 2W6VB 3B75A 2ZLWA 1Y7DA 3AT5A 1NPFA 2XKGA 2D2NC 2QSSB 1CH7A 1HDAA 1BZ1B 2QU0B 4FWXA 2OLPA 3UHIA 2DXMA 2LH6A 2ZLTB 3G4QA 3GK9A 3WFWA 1FHJA 1Y4FA 3DHRB 4MQIB 2R1HA 1UFJA 3HEOA 3WTGA 5EETA 1DO7A 3FS4B 1MOBA 1KFRA 3PI1A 3MVCA 4F69A 5HAVA 3WCUD 3A0GA 2BNLA 2PGHB 4MQHA 1Y4GB 1Y2ZB 1K0YB 2O5BX 2RI4B 1J40A 3KUNA 2PEGA 4F6FA 1D8UA 1GBVB 4F6IA 1MZ0A 1MYGA 1XXTB 1XYEA 5CN9A 1YE2A 2W6WA 3FH9A 4FH6A 5CHQA 1M6CA 1KD2B 1DXDA 1M9PB 1HDSB 2VLYA 1MNJA 3A2GA 3PT8A 2BLIA 4XS0A 3QJDA 4KMWA 3CIUA 5CNGA 4H2LB 1BUWA 1CMYB 2ZT3A 2D2MC 3OJ1A 1CMYA 5KDQA 1JEBA 2M6ZA 2ZT1A 4SDHA 4MXKA 3EDBA 1A9WE 2DN3B 2VYZA 3A5AA 1O1OB 3GKTA 2W72A 1R1XB 2DN2A 1S6AA 3UHDA 4L2MA 1SPEA 2W6XA 1HABB 2XKHA 1HBIA 1S5XB 1MKOA 1MLUA 4U8UA 3ORDA 2HHBB 109MA 2G14A 3LR9A 3QZZA 3BCQB 1S5YB 1NWIA 1Y22A 1MBAA 1IWHA 2ZSPA 4YU4A 3OGBA 5EQMA 1FSXB 1G0AA 3QJCA 1GDKA 2ZLVA 2MGKA 1J41A 4G1VA 2QMBB 1A0ZB 1Y4PB 2BLHA 3WCUA 4X0LB 2ZLXA 1DTIA 2SPLA 3NFEB 3AT5B 1G9VA 2OIFA 1V4WA 1ABYB 2EF2A 3BOMA 3QM6A 3R0GA 2Z6TA 4NI0B 5E83A 1MGNA 1UIWB 4IT8A 3RJ6A 1YHRA 1O16A 3PIAA 1Q1FA 3ARKA 3MJPA 1GBUA 2B7HA 2LH3A 112MA 1O1JA 2R4YA 104MA 1RTEA 3GOUB 1O1IA 106MA 2R50A 1HBHB 1YE0A 5JDOE 1YEVA 1HGBA 3QM7A 1LFVB 108MA 110MA 1GBVA 3EU1B 1IBEB 1VXGA 4PQBA 2D60B 2MGLA 3BJ3B 3LB4A 2QSSA 3S65B 1IOPA 1VXCA 5E6EA 1MLFA 2BW9M 5EYJA 1DXTB 1DKEA 2ZS1A 3UH7A 1WVPA 3HC9A 1TESA 3CY5B 1Y45B 4F4OA 1YDZB 1YGDB 1HBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2L A;  4ZVA A;  2YRS A;  5EE4 D;  3WHM B;  2YRS B;  1X46 A;  1NZ2 A;  1O1L B;  1MYI A;  4YU3 B;  1HGC A;  1LTW A;  1YCB A;  1Y7D B;  3WI8 A;  1R1X A;  2DN2 B;  3UGZ A;  1MOH A;  1GCW B;  1YOH A;  1NWN A;  4NI0 A;  1BZZ A;  2HHB A;  1XYE B;  2SPN A;  1MLS A;  2HBD B;  3WCT D;  1NEJ A;  4G51 A;  1SHR A;  5EOH A;  1IRD B;  1BVD A;  3UH3 A;  2ZS0 C;  3UH6 A;  3VRF B;  1QI8 B;  2ZSN A;  2BMM A;  1Y0A A;  1YZI A;  1F63 A;  1Y0C B;  3NG6 B;  3DUT B;  3UHG A;  1SDK B;  2QSP A;  3DUT A;  1V75 B;  2V1G A;  3UHY A;  5SW7 B;  4MQJ A;  1MYF A;  4N7P A;  5C6E A;  4HSX A;  1RPS B;  3ARL A;  1HGA B;  3DHT B;  3OVU C;  1YE2 B;  3PI2 A;  5HU6 B;  1U7S A;  1PMB A;  4L7Y A;  1YMB A;  3IC0 A;  3QM5 A;  2QFN A;  2D5X B;  1Y85 B;  1EW6 A;  3GQR B;  2HBC A;  4ODC B;  1A00 A;  1Y35 A;  1MOD A;  1YG5 B;  5CNE A;  2ZT4 A;  3E5O A;  4YU4 B;  1BUW B;  2ZFO B;  1ECD A;  4F6G A;  4IRO B;  2ZLV B;  3VAU A;  2MYA A;  3IXF A;  2MYD A;  3WFX A;  3RJN B;  2LHB A;  1CBM A;  1MLJ A;  1LA6 A;  3NFE A;  1YCA A;  2W6V A;  1LFL A;  1G08 A;  1GLI B;  1MLL A;  1Y7Z A;  3UHR A;  1XY0 A;  3WCV A;  1CLS A;  1J3Y A;  2ZS1 D;  5EE4 C;  2FRF A;  3G4W A;  1A4F A;  3ZJS A;  1YH9 B;  1UC3 A;  1S5Y A;  1Y01 B;  2D2M A;  3VRE B;  2HCO B;  5AB8 A;  4F68 A;  3HF4 A;  1J7W B;  4M4B B;  2MGD A;  5JDO F;  1DWT A;  1MLH A;  2AUQ A;  2DN1 B;  1X3K A;  1J41 B;  1DUO A;  3GOU A;  3GQG A;  5JDO C;  3G4V A;  1Y8I B;  2EKU A;  5CN4 A;  1BAB B;  1QSI B;  2ZLX B;  1QSH B;  1Y2Z A;  1QXE B;  1YGF B;  1LFQ A;  1Y5J B;  1QPW B;  1IRC A;  1G09 A;  2O5T X;  3AQ7 A;  1V9Q A;  1LFZ B;  2LH5 A;  1SPG B;  1HCO B;  1O1P B;  1SPG A;  3OZW A;  2LH1 A;  1HBA B;  2ZS1 B;  3DHR A;  1Y8K A;  1XZU B;  2AA1 A;  1Y4V A;  1Y8H B;  2G3H A;  1O1J B;  3UHS A;  1DXV B;  1JWN A;  1LJW B;  1ASH A;  1VXB A;  2W6Y A;  3A59 B;  1SDK A;  3K8B A;  3E5I A;  1CH3 A;  2DHB A;  3D7O A;  3B75 B;  4TWU A;  3ZOL A;  3HRW B;  2RAO B;  1A0U A;  1TU9 A;  1UFP A;  1VXH A;  2BLJ M;  3LB2 A;  1Y4R B;  3BJ3 A;  5C6Y A;  1YVQ A;  3UHE A;  1Y7C B;  3GYS A;  1UX9 A;  1Z8U B;  1J7Y B;  2FAL A;  1XCH A;  1M9P A;  1K1K B;  1OR4 A;  2D2M B;  1NQP A;  2AV0 A;  3UHN A;  3PT8 B;  3PT7 A;  4HHB A;  3VRG B;  4MQI A;  3PT7 B;  4MQK A;  4MQG A;  3G4Y A;  5IKS A;  4TWV A;  3QJB A;  1YZI B;  1A6M A;  2FRI X;  1A6K A;  4JYQ A;  1A6N A;  2IG3 A;  1DTM A;  2HBF A;  4F6B A;  1M6M A;  3BOM B;  1VRF A;  3VHB A;  3D17 B;  3R5I B;  1NZ4 A;  1NEJ B;  103M A;  2ZLU B;  4N7N A;  2O5L X;  3R5I A;  1UIW A;  1A4F B;  105M A;  3GLN A;  1S56 A;  3ZJN A;  4AVE A;  1MBD A;  1A3O B;  1Y8K B;  1BBB B;  3PIA B;  2MHB B;  1THB B;  1WMU A;  1KR7 A;  2GLN A;  2V1K A;  1DLY A;  4XDI A;  3NG6 A;  2D2N D;  5CNC A;  1YEU A;  1C7C B;  1ECA A;  1MWC A;  1QXE A;  1YGF A;  1A0U B;  3G46 A;  3H57 A;  3D1K B;  4UUR A;  1OUT B;  4G1B A;  1HAB A;  1RQA A;  2V1H A;  3KMF C;  2H8D B;  2D5X A;  1VXA A;  1XZ4 A;  2D60 A;  1CQ2 A;  2ZS0 B;  1VHB A;  3S65 A;  4N7O A;  1HDS A;  1YG5 A;  3OO4 A;  1UVY A;  2MGE A;  2HHE A;  1N9F A;  4FC3 A;  1MNI A;  3OO4 B;  4U8U C;  3CY5 A;  3V2V A;  3BJ2 A;  1ITH A;  3NL7 B;  2HBG A;  3MBA A;  1Y0D B;  4HRR B;  2HZ1 A;  4MQC B;  1CQX A;  1CBL A;  1YHE B;  4H0B A;  1JPB A;  1HBR B;  1OFJ A;  1N9H A;  1V4W B;  3HXN B;  1CG8 B;  3HYU B;  1Y7C A;  3GYS B;  1SI4 A;  1CG8 A;  3HYU A;  4WCH D;  3ONZ A;  1LFZ A;  4NZI A;  3WCP A;  1MYT A;  2VRY A;  2HZ3 A;  1YFF A;  2ZS0 D;  3GQP B;  2Z85 A;  1YDZ A;  1JZM A;  1OJ6 A;  4M4B A;  1MBN A;  4BJA A;  2BKM A;  3MJP B;  2OH9 A;  1MYM A;  3IC2 B;  4NI1 A;  3A0G B;  4MQH B;  1YHU D;  4NK2 A;  1HBH A;  1YE0 B;  1LH6 A;  2MB5 A;  4ROL B;  1LFQ B;  1Y5J A;  2E2Y A;  1JL6 A;  1FDH G;  1Y46 A;  2R80 A;  2OHA A;  2W72 C;  1DXU B;  3M3A A;  1J40 B;  1CG5 B;  5JOM A;  1MWB A;  3SZK A;  2MGG A;  1RPS A;  1F5O A;  1AJH A;  3K9Z A;  2HZ2 A;  1CH4 A;  1KD2 A;  3PI9 A;  5JGG B;  1Y7G B;  1V5H A;  1JF4 A;  1Y8W A;  4U8U D;  1C7D B;  1COH B;  2D2N A;  1GJN A;  4XS0 B;  1RQ3 B;  3MJU A;  2D2N B;  3QM9 A;  1MTI A;  1BIJ A;  4HBI A;  1LHT A;  1ABW B;  1YHE A;  1HGB B;  1BIN A;  3DR9 A;  2GL3 A;  4HRT B;  1O1K A;  1T1N A;  3ZJI A;  1X9F C;  1S0H A;  1MWD A;  1XY0 B;  5HY8 A;  3D4X A;  2QLS A;  3WCT B;  1CH2 A;  3D4X B;  3P5Q B;  2ZWJ A;  2HBD A;  3MOU A;  1CLS B;  2ZS0 A;  1O1M B;  1HV4 B;  1IT2 A;  4WJG A;  1BZ1 A;  2VM0 A;  3O7N A;  1L2K A;  3QJC B;  2GNV A;  1C7B B;  2HCO A;  1SDL B;  1GCV B;  1MBO A;  2GKN A;  1HLB A;  3IC2 A;  1Y4P A;  3D1A A;  1RVW A;  1Y0A B;  2VLX A;  1Y8I A;  1RVW B;  4YU3 A;  1GZX B;  2XKI A;  1LH7 A;  1VXE A;  1ABY A;  2QRW A;  1HGA A;  3GKV B;  1JP6 A;  2D2M D;  1OUT A;  3AG0 A;  3ZJQ A;  1BZZ B;  2HHD B;  3W4U A;  1RQA B;  1A3N B;  1Y7G A;  1EBC A;  3SDH A;  2EVK A;  1G0B B;  2KSC A;  1F5P A;  3TM9 A;  3GDJ A;  3UHZ A;  3LQD B;  1YHU A;  1Y5F A;  3BJ1 A;  1H1X A;  1YHU B;  1HRM A;  1MBC A;  5B85 A;  2HBE A;  2V1E A;  4HSW A;  1YEV B;  2WTG A;  1JF3 A;  1DO1 A;  1Y0D A;  1YMA A;  2ZSY A;  5KER A;  1J52 A;  1ABS A;  2H8F B;  2O5O X;  3K8B B;  1MLR A;  2AUO A;  2G0V A;  2ZSQ A;  4KN3 A;  2GRH A;  2PEG B;  1YEQ B;  4O35 A;  1HAC A;  1R1Y A;  2QLS B;  3WCW B;  1HSY A;  4O2G A;  1MLM A;  3WCW A;  1XZ4 B;  1Y22 B;  2O5S X;  1A9W A;  2GKM A;  2VYW A;  3HF4 B;  1DKE B;  4M4A A;  5E29 B;  1AZI A;  5E29 A;  1MTJ A;  1RQ3 A;  3MYN A;  1C40 A;  1DWR A;  1MLN A;  3E55 A;  3WHM A;  4FH7 A;  3UHQ A;  1HBR A;  2G0R A;  3KMF A;  4B4Y A;  2W72 B;  2RI4 A;  3WCU C;  1G9V B;  1Y0W A;  1F65 A;  5EYS A;  2SPO A;  4UIQ A;  2GTL B;  1NAZ A;  3HXN A;  2BK9 A;  1HBS B;  5M3S A;  1A6G A;  1UT0 A;  1BZP A;  3UGY A;  1YMC A;  5MBN A;  1O1P A;  5JDO D;  1FLP A;  5CNB A;  1AJ9 A;  1IRD A;  1J7W A;  1FSX A;  3WR1 B;  1Y4F B;  1NS9 A;  1XZ2 A;  3ZJJ A;  3OZV A;  2GDM A;  1V4U A;  1X9F A;  2HBE B;  1V4U B;  2BWH A;  6HBW A;  4NXA A;  1PBX B;  5EV5 A;  2PGH A;  3OO5 A;  3AQ8 A;  1MNK A;  5ILP A;  1ECN A;  1YEU B;  4WJG 1;  3D1K A;  5D1V A;  1MNO A;  4N8T B;  1GDI A;  3EDA A;  111M A;  5JGG A;  1IT3 A;  4O1T A;  1J3Z A;  1Y4B B;  4FWY A;  1YIH B;  1OFK A;  1LFT A;  1DWS A;  3S1J A;  3MJU B;  5ILR A;  5AZR A;  1N9X A;  2HHE B;  1Y0T B;  1DXV A;  1LH1 A;  1BZR A;  2ZSZ A;  3ZJP A;  1ABW A;  4PQC A;  1C7C A;  1RQ4 B;  4HRT A;  1HGC B;  1HBG A;  2NRM A;  2LH7 A;  1EBT A;  3A5G A;  1S61 A;  3WCW D;  1JZL A;  1MKO B;  5F2A A;  3H58 A;  3M38 A;  1NZ3 A;  2MGI A;  1DM1 A;  4PNJ A;  4KJT A;  5CMV A;  1MBS A;  1SI4 B;  3PEL B;  1GDL A;  2VEE A;  4F6D A;  3EOK A;  2ZLT A;  3OZU A;  3NMM A;  3ZJH A;  1G0B A;  4FC3 B;  2R4X A;  5AZQ A;  4HHB B;  2GRF A;  2VLZ A;  3VRF A;  2O5M X;  1Y09 A;  3MKB A;  3KUO A;  1X9F B;  2QMB A;  1B86 B;  3HHB A;  1V4X B;  2OHB A;  4TYX A;  2C0K A;  3ARJ A;  3BA2 A;  3ZHW A;  4MQC A;  2QSP B;  1Y0C A;  2DC3 A;  4MQJ B;  4OF9 A;  1OUU B;  2D5Z B;  1JP8 A;  2GTL D;  1HDB A;  1Y0W B;  2D6C A;  6HBI A;  3D17 A;  2ZFO C;  1CH5 A;  3G52 A;  1YVT B;  5CNF A;  3UHC A;  1XQ5 B;  3O89 A;  1Y4Q B;  2EVP A;  1IBE A;  2G0S A;  3OK5 A;  1Y85 A;  1CO8 A;  1MOA A;  1V07 A;  5CN7 A;  3W4U B;  3PI8 A;  1O1N B;  1J3Z B;  1WLA A;  1YHR B;  4ODC A;  5CND A;  1GVH A;  4ILZ A;  3ECL A;  3AQ6 A;  1HBB B;  2LH2 A;  5CN5 A;  1C7D A;  1X9F D;  1Y8H A;  1MCY A;  2FRJ X;  1IDR A;  1LFY B;  3A59 A;  1C40 B;  1FDH A;  5HLU A;  3QQQ A;  2EB9 A;  2H35 A;  1QXD A;  1XZV B;  1V75 A;  1LH3 A;  1NS6 A;  1O1O A;  3UI0 A;  3WCV C;  5C6E B;  1O1L A;  2H8F A;  1Y31 A;  1YEN B;  1MLK A;  5EU2 A;  3ZOM A;  1Y31 B;  1YEN A;  2EB8 A;  3PI4 A;  4OOD A;  3LHB A;  1JY7 B;  5B84 A;  3WCV B;  4U8U B;  2MYC A;  1JY7 A;  1LFL B;  1HBS A;  3WCP B;  3M39 A;  3WCT A;  2VHB A;  3BCQ A;  2AUP A;  1Y8W B;  1DXT A;  2MGB A;  2DN1 A;  4M4A B;  1URY A;  4MQG B;  2Z8A A;  2NX0 A;  2EKT A;  3VRG A;  1GDJ A;  3QJB B;  3BJ2 B;  3MN0 A;  2MGH A;  2MGC A;  2HBS B;  3TM3 A;  4C44 A;  2MYE A;  4MAX A;  1U7R A;  1BAB A;  3AQ5 A;  1LHS A;  1GZX A;  2ZST A;  3OO5 B;  4ROM A;  2ZSO A;  1EMY A;  2ZT0 A;  1HLM A;  1S0H B;  2G11 A;  1G09 B;  3SDN A;  1YVT A;  1JDO A;  3DHT A;  3UHU A;  3GKV A;  1A3N A;  4L7Y B;  4G51 B;  1MLO A;  2ZLU A;  4N7N B;  2WTH A;  3S66 A;  4H07 A;  2DXM B;  1A00 B;  1Y35 B;  2MHB A;  1MNH A;  1XZ2 B;  3GQP A;  1NIH A;  2NSR A;  5HLQ A;  1NIH B;  1Y5K B;  3K3U A;  1HBA A;  1DUK A;  1V4X A;  1Y0T A;  1YIE B;  2IN4 A;  1MYH A;  3U3E A;  3AQ9 A;  1QSI A;  1NXF A;  5HBI A;  1CO9 A;  1A01 A;  3V2Z A;  1HAC B;  3LB1 A;  1YVQ B;  4DC8 A;  2FAM A;  1S5X A;  3ZJR A;  3EU1 A;  1R1Y B;  3FH9 B;  2NRL A;  3PI9 B;  1FAW A;  1Y4B A;  1K1K A;  4UZV A;  1YH9 A;  2MYB A;  1HHO B;  1XZ7 B;  4NS2 A;  4N7O B;  1YIH A;  1Y83 B;  3WFU A;  1YGD A;  1VRE A;  4IRO A;  2ZS1 C;  4KMV A;  4MXL A;  2AV3 A;  1QXD B;  3NL7 A;  4DWT A;  4MPM A;  2AUR A;  1Y4G A;  2Z6N B;  2RAO A;  1GCW A;  3ZJL A;  1GLI A;  5MBA A;  1J3F A;  2G0X A;  5EUI A;  3ONZ B;  1J3Y B;  2ZFB A;  1NPG A;  3NMM B;  4F6J A;  3QZX A;  1LH2 A;  3UBV A;  2W31 A;  3S66 B;  1FHJ B;  1FN3 A;  1HJT A;  3HEP A;  1MOC A;  1XZ5 A;  3GDJ B;  1I3E A;  4AVD A;  3WTG B;  4MQK B;  1Y4V B;  1BBB A;  2B7H B;  1YOI A;  1NS9 B;  2NSS A;  3QJD B;  6HBW B;  1B86 A;  1QI8 A;  3FS4 A;  1CH1 A;  3GQG B;  1VWT A;  4X0L A;  1PBX A;  3ODQ B;  2D5Z A;  2MGA A;  2R4W A;  2H35 B;  5SW7 A;  3RGK A;  1CP5 A;  2M6Z B;  2QFK A;  2HBF B;  1NS6 B;  1ECO A;  1UMO A;  2DN3 A;  3MYM A;  1HDB B;  5CN6 A;  1Y4Q A;  1DXU A;  5HU6 A;  1YEQ A;  2FRK X;  4N8T A;  3G53 A;  2O5Q X;  3GQR A;  2GNW A;  3WFT A;  1O1N A;  3IC0 B;  2HBC B;  1HCO A;  1FAW B;  2G0Z A;  2G12 A;  5E6E B;  3UHB A;  1BZ0 B;  1HHO A;  1NGK A;  1NQP B;  3A9M A;  1XZU A;  2AA1 B;  3QM8 A;  1LFT B;  1VXD A;  1EWA A;  2V1J A;  3E4N A;  2DHB B;  3S48 C;  2GRZ A;  1AJG A;  5KDQ B;  1MDN A;  3ZJO A;  1XZV A;  5CN8 A;  2ZLW B;  4DC7 A;  7HBI A;  3ECX A;  2WY4 A;  1Y4R A;  2R4Z A;  1LUE A;  1J7Y A;  3G4U A;  3QJE A;  3UHW A;  3QJE B;  2H8D A;  1G08 B;  1Y7Z B;  4QAU A;  1RSE A;  1IWH B;  4PQ6 A;  1O1M A;  1C7B A;  2QU0 A;  3UH5 A;  2VEB A;  1J7S A;  3ECZ A;  1BJE A;  1CP0 A;  1J7S B;  2R1H B;  1SDL A;  3HHB B;  3AT6 A;  3D1A B;  5KKK A;  2Z6S A;  4LPI A;  1JW8 A;  4HRR A;  1W92 A;  3ODQ A;  1DLW A;  1RTX A;  3HEN A;  3QQR A;  3WCV D;  1OUU A;  1Y46 B;  2R80 B;  3ASE A;  101M A;  1CG5 A;  1UX8 A;  1MYJ A;  4C0N A;  1JP9 A;  3UBC A;  1DO4 A;  4NXC A;  1FSL A;  3UHH A;  3EOK B;  3QMA A;  1SHR B;  3M3B A;  2MBW A;  2ZT2 A;  4ZVB A;  1Y5F B;  4MBN A;  3WR1 A;  1Y09 B;  3MKB B;  1THB A;  3LQD A;  4O4T A;  1Y5K A;  1UVX A;  1CIO A;  3LB3 A;  3BJ1 B;  1LJW A;  4NK1 A;  3G4R A;  3PI3 A;  1RQ4 A;  2CMM A;  1OBM A;  1LA6 B;  3UHV A;  1FCS A;  1A01 B;  1S69 A;  5CHR A;  1LFV A;  1XQ5 A;  3UHT A;  2O58 X;  2ZSR A;  1BZ6 A;  5EUI B;  4GZG A;  3ZH0 A;  3PI8 B;  3PEL A;  1YFF B;  1SWM A;  1Y45 A;  4F4O B;  3S1I A;  1FN3 B;  1GCV A;  1MLQ A;  1CPW A;  3IA3 B;  1Y83 A;  3UHX A;  1LH5 A;  1DXC A;  3TLD A;  3UHK A;  1G0A B;  2HBS A;  4MU5 A;  5F0B A;  1YEO B;  2ZFO D;  1YEO A;  2JHO A;  2GTL C;  2VYY A;  2G10 A;  2Z6N A;  1A0Z A;  3WCU B;  4ROM B;  4ROL A;  3LR7 A;  1QSH A;  1JZK A;  1QPW A;  2MGF A;  102M A;  1T1N B;  1MYZ A;  1OR6 A;  1MTK A;  3SZK B;  4VHB A;  2ZFB B;  2GTL A;  1XXT A;  1N9I A;  1BVC A;  1HDA B;  4FWZ A;  5HLX A;  1YHU C;  1AJ9 B;  4MBA A;  2HHD A;  2MGM A;  1NZ5 A;  3WCT C;  2MGJ A;  1WMU B;  1XZ5 B;  1URV A;  1A3O A;  1GBU B;  1DO3 A;  1I3D A;  3AT6 B;  3ZJM A;  1CIK A;  4B3W A;  1YIE A;  1COH A;  1VWT B;  3WCW C;  1LFY A;  4NI1 B;  2XYK A;  1B0B A;  1JEB B;  2V1I A;  1MLG A;  1O1I B;  2SPM A;  4ESA A;  2ZSX A;  1K0Y A;  3D7O B;  2ZSS A;  4ESA B;  4O4Z A;  5KER B;  3HRW A;  4N7P B;  1O1K B;  107M A;  1H97 A;  5E83 B;  5HY8 B;  5D5R A;  3P5Q A;  1BZ0 A;  2V1F A;  1VXF A;  1HV4 A;  1MBI A;  3VRE A;  2OH8 A;  4DWU A;  1XZ7 A;  3A5B A;  5ILE A;  3CIU B;  2ZFO A;  3NML A;  3ED9 A;  1BIJ B;  1JL7 A;  4JAC A;  1CH9 A;  1YOG A;  5ILM A;  2W6V B;  3B75 A;  2ZLW A;  1Y7D A;  3AT5 A;  1NPF A;  2XKG A;  2D2N C;  2QSS B;  1CH7 A;  1HDA A;  1BZ1 B;  2QU0 B;  4FWX A;  2OLP A;  3UHI A;  2DXM A;  2LH6 A;  2ZLT B;  3G4Q A;  3GK9 A;  3WFW A;  1FHJ A;  1Y4F A;  3DHR B;  4MQI B;  2R1H A;  1UFJ A;  3HEO A;  3WTG A;  5EET A;  1DO7 A;  3FS4 B;  1MOB A;  1KFR A;  3PI1 A;  3MVC A;  4F69 A;  5HAV A;  3WCU D;  3A0G A;  2BNL A;  2PGH B;  4MQH A;  1Y4G B;  1Y2Z B;  1K0Y B;  2O5B X;  2RI4 B;  1J40 A;  3KUN A;  2PEG A;  4F6F A;  1D8U A;  1GBV B;  4F6I A;  1MZ0 A;  1MYG A;  1XXT B;  1XYE A;  5CN9 A;  1YE2 A;  2W6W A;  3FH9 A;  4FH6 A;  5CHQ A;  1M6C A;  1KD2 B;  1DXD A;  1M9P B;  1HDS B;  2VLY A;  1MNJ A;  3A2G A;  3PT8 A;  2BLI A;  4XS0 A;  3QJD A;  4KMW A;  3CIU A;  5CNG A;  4H2L B;  1BUW A;  1CMY B;  2ZT3 A;  2D2M C;  3OJ1 A;  1CMY A;  5KDQ A;  1JEB A;  2M6Z A;  2ZT1 A;  4SDH A;  4MXK A;  3EDB A;  1A9W E;  2DN3 B;  2VYZ A;  3A5A A;  1O1O B;  3GKT A;  2W72 A;  1R1X B;  2DN2 A;  1S6A A;  3UHD A;  4L2M A;  1SPE A;  2W6X A;  1HAB B;  2XKH A;  1HBI A;  1S5X B;  1MKO A;  1MLU A;  4U8U A;  3ORD A;  2HHB B;  109M A;  2G14 A;  3LR9 A;  3QZZ A;  3BCQ B;  1S5Y B;  1NWI A;  1Y22 A;  1MBA A;  1IWH A;  2ZSP A;  4YU4 A;  3OGB A;  5EQM A;  1FSX B;  1G0A A;  3QJC A;  1GDK A;  2ZLV A;  2MGK A;  1J41 A;  4G1V A;  2QMB B;  1A0Z B;  1Y4P B;  2BLH A;  3WCU A;  4X0L B;  2ZLX A;  1DTI A;  2SPL A;  3NFE B;  3AT5 B;  1G9V A;  2OIF A;  1V4W A;  1ABY B;  2EF2 A;  3BOM A;  3QM6 A;  3R0G A;  2Z6T A;  4NI0 B;  5E83 A;  1MGN A;  1UIW B;  4IT8 A;  3RJ6 A;  1YHR A;  1O16 A;  3PIA A;  1Q1F A;  3ARK A;  3MJP A;  1GBU A;  2B7H A;  2LH3 A;  112M A;  1O1J A;  2R4Y A;  104M A;  1RTE A;  3GOU B;  1O1I A;  106M A;  2R50 A;  1HBH B;  1YE0 A;  5JDO E;  1YEV A;  1HGB A;  3QM7 A;  1LFV B;  108M A;  110M A;  1GBV A;  3EU1 B;  1IBE B;  1VXG A;  4PQB A;  2D60 B;  2MGL A;  3BJ3 B;  3LB4 A;  2QSS A;  3S65 B;  1IOP A;  1VXC A;  5E6E A;  1MLF A;  2BW9 M;  5EYJ A;  1DXT B;  1DKE A;  2ZS1 A;  3UH7 A;  1WVP A;  3HC9 A;  1TES A;  3CY5 B;  1Y45 B;  4F4O A;  1YDZ B;  1YGD B;  1HBB A; 
#chains in the Genus database with same CATH topology
 4H2L A;  4ZVA A;  2YRS A;  5EE4 D;  3WHM B;  4H0M A;  2YRS B;  1X46 A;  2JLF A;  1NZ2 A;  1O1L B;  1MYI A;  4YU3 B;  1HHS A;  1HGC A;  1LTW A;  1YCB A;  1Y7D B;  3WI8 A;  1R1X A;  2DN2 B;  3UGZ A;  1MOH A;  1GCW B;  1YOH A;  3NUH B;  3L0F B;  1NWN A;  4NI0 A;  1BZZ A;  2HHB A;  1XYE B;  2SPN A;  1MLS A;  2HBD B;  3WCT D;  1NEJ A;  4G51 A;  1SHR A;  5EOH A;  3V58 A;  1IRD B;  1BVD A;  2UUM B;  3UH3 A;  2ZS0 C;  3UH6 A;  4PO5 B;  3VRF B;  1QI8 B;  2ZSN A;  2BMM A;  1Y0A A;  1YZI A;  1F63 A;  1Y0C B;  3NG6 B;  3DUT B;  3UHG A;  1SDK B;  2QSP A;  3DUT A;  1V75 B;  2V1G A;  3UHY A;  5SW7 B;  4MQJ A;  1MYF A;  4N7P A;  5C6E A;  4ETV A;  4HSX A;  1RPS B;  3ARL A;  1HGA B;  3DHT B;  3OVU C;  1YE2 B;  3PI2 A;  5HU6 B;  1U7S A;  1PMB A;  4XXI A;  4L7Y A;  1YMB A;  3IC0 A;  3QM5 A;  2QFN A;  2D5X B;  1Y85 B;  1EW6 A;  3GQR B;  2HBC A;  4ODC B;  1A00 A;  1Y35 A;  4F0U B;  1MOD A;  1YG5 B;  5CNE A;  2ZT4 A;  3E5O A;  4YU4 B;  1BUW B;  2ZFO B;  1ECD A;  4F6G A;  4IRO B;  2V8A B;  2ZLV B;  3VAU A;  2MYA A;  3IXF A;  2MYD A;  3WFX A;  3RJN B;  2LHB A;  1CBM A;  1MLJ A;  1LA6 A;  3NFE A;  1YCA A;  2W6V A;  3FEW X;  4Z8K A;  1LFL A;  1G08 A;  1GLI B;  1MLL A;  1Y7Z A;  3UHR A;  1XY0 A;  3WCV A;  1CLS A;  1J3Y A;  2ZS1 D;  5EE4 C;  2FRF A;  3G4W A;  4LM6 B;  1A4F A;  3ZJS A;  1YH9 B;  1UC3 A;  1S5Y A;  1Y01 B;  2D2M A;  3VRE B;  2HCO B;  5AB8 A;  4F68 A;  3HF4 A;  1J7W B;  4M4B B;  2MGD A;  5JDO F;  1DWT A;  1MLH A;  2AUQ A;  2DN1 B;  1X3K A;  1J41 B;  1DUO A;  4ETT A;  3GOU A;  3GQG A;  4XXK A;  5JDO C;  3G4V A;  1Y8I B;  2EKU A;  5CN4 A;  1BAB B;  1QSI B;  2ZLX B;  2UUN B;  1QSH B;  1Y2Z A;  1QXE B;  1YGF B;  1LFQ A;  1Y5J B;  1QPW B;  1IRC A;  1G09 A;  3LQ9 A;  2O5T X;  3AQ7 A;  1V9Q A;  1LFZ B;  2LH5 A;  4A8F A;  1SPG B;  1HCO B;  1O1P B;  1SPG A;  3OZW A;  4ERV A;  2LH1 A;  1HBA B;  2ZS1 B;  3DHR A;  1Y8K A;  1XZU B;  2AA1 A;  1Y4V A;  1Y8H B;  2G3H A;  1O1J B;  3UHS A;  1DXV B;  1JWN A;  1LJW B;  1UVM A;  1ASH A;  1VXB A;  2W6Y A;  3A59 B;  1SDK A;  3K8B A;  3E5I A;  1CH3 A;  2DHB A;  3D7O A;  3B75 B;  4TWU A;  3ZOL A;  3HRW B;  2RAO B;  1A0U A;  1TU9 A;  1UFP A;  1VXH A;  2BLJ M;  3LB2 A;  1Y4R B;  3BJ3 A;  5C6Y A;  4N6S A;  1YVQ A;  3UHE A;  1Y7C B;  3GYS A;  1UX9 A;  1Z8U B;  1J7Y B;  2FAL A;  1XCH A;  1GH0 B;  2VJT B;  1M9P A;  1K1K B;  1OR4 A;  2D2M B;  1GH0 A;  1NQP A;  2AV0 A;  2UUM A;  3UHN A;  3PT8 B;  3PT7 A;  4HHB A;  3VRG B;  4MQI A;  3PT7 B;  4MQK A;  4MQG A;  3G4Y A;  5IKS A;  4TWV A;  3QJB A;  1YZI B;  1A6M A;  2FRI X;  1A6K A;  4JYQ A;  1A6N A;  3KVS A;  2IG3 A;  1DTM A;  2HBF A;  4F6B A;  1M6M A;  3BOM B;  1VRF A;  3VHB A;  3D17 B;  1CPC A;  3R5I B;  1NZ4 A;  1NEJ B;  103M A;  2ZLU B;  4N7N A;  2O5L X;  3R5I A;  1UIW A;  1A4F B;  105M A;  3GLN A;  1S56 A;  3ZJN A;  4AVE A;  1MBD A;  1A3O B;  1Y8K B;  1BBB B;  3PIA B;  2MHB B;  1THB B;  1WMU A;  2UUL H;  1KR7 A;  2GLN A;  2V1K A;  1DLY A;  3VNC A;  4XDI A;  4ZIZ B;  3NG6 A;  2D2N D;  5CNC A;  1JBO A;  1YEU A;  1C7C B;  1ECA A;  1MWC A;  1QXE A;  1YGF A;  1A0U B;  3G46 A;  3H57 A;  3D1K B;  4UUR A;  1OUT B;  4G1B A;  2DKA A;  1HAB A;  1RQA A;  2V1H A;  3KMF C;  2H8D B;  2D5X A;  1VXA A;  1XZ4 A;  2D60 A;  1CQ2 A;  2ZS0 B;  1VHB A;  3O18 A;  3S65 A;  4N7O A;  1HDS A;  1YG5 A;  3OO4 A;  1UVY A;  2MGE A;  2HHE A;  1N9F A;  4FC3 A;  1MNI A;  3OO4 B;  4U8U C;  3CY5 A;  4Q70 A;  3V2V A;  3BJ2 A;  1ITH A;  3NL7 B;  2HBG A;  3MBA A;  1Y0D B;  4HRR B;  2HZ1 A;  4MQC B;  1CQX A;  1CBL A;  1YHE B;  4H0B A;  1JPB A;  1HBR B;  1OFJ A;  1N9H A;  4Z8K B;  1V4W B;  3DBJ A;  1ALL A;  3HXN B;  1CG8 B;  3HYU B;  1Y7C A;  3GYS B;  1SI4 A;  1CG8 A;  3HYU A;  4WCH D;  3ONZ A;  1LFZ A;  4NZI A;  3WCP A;  1MYT A;  2VRY A;  2HZ3 A;  1YFF A;  2ZS0 D;  3GQP B;  1F99 B;  2Z85 A;  1YDZ A;  1JZM A;  1OJ6 A;  4M4B A;  1MBN A;  4BJA A;  2BKM A;  3MJP B;  2OH9 A;  1MYM A;  3IC2 B;  4NI1 A;  4H0M B;  3A0G B;  4MQH B;  1YHU D;  4NK2 A;  1HBH A;  1YE0 B;  1LH6 A;  2MB5 A;  4ROL B;  1LFQ B;  1Y5J A;  2E2Y A;  1JL6 A;  1FDH G;  1Y46 A;  2R80 A;  2OHA A;  2W72 C;  1DXU B;  2VML A;  3M3A A;  1J40 B;  1CG5 B;  5JOM A;  1MWB A;  3SZK A;  2MGG A;  1RPS A;  1F5O A;  1AJH A;  3K9Z A;  2HZ2 A;  1CH4 A;  1KD2 A;  3PI9 A;  5JGG B;  1Y7G B;  1V5H A;  1JF4 A;  5FVB A;  1Y8W A;  4U8U D;  1PHN A;  1C7D B;  1COH B;  2D2N A;  1GJN A;  4XS0 B;  1RQ3 B;  3MJU A;  2D2N B;  1QGW C;  3ZTA A;  2UUL C;  3QM9 A;  1MTI A;  1BIJ A;  4HBI A;  1LHT A;  1ABW B;  1YHE A;  1HGB B;  1BIN A;  3DR9 A;  2GL3 A;  4HRT B;  1O1K A;  1T1N A;  3ZJI A;  1X9F C;  1S0H A;  1MWD A;  1XY0 B;  5HY8 A;  3D4X A;  2QLS A;  3WCT B;  1CH2 A;  3D4X B;  3P5Q B;  2ZWJ A;  2HBD A;  3MOU A;  1CLS B;  2ZS0 A;  1O1M B;  2UUL A;  3GIO A;  1HV4 B;  1IT2 A;  4WJG A;  1BZ1 A;  2VM0 A;  3O7N A;  1F99 A;  2J96 A;  1L2K A;  3QJC B;  2GNV A;  1C7B B;  4PO5 A;  2HCO A;  1SDL B;  2C7L A;  1GCV B;  1MBO A;  2GKN A;  1HLB A;  3IC2 A;  1Y4P A;  3D1A A;  1RVW A;  1Y0A B;  2WCR A;  2VLX A;  1Y8I A;  4ESU A;  1RVW B;  4BS9 A;  1HHT P;  3KVS B;  4YU3 A;  1GZX B;  2XKI A;  1LH7 A;  1HA7 B;  1VXE A;  1ABY A;  2QRW A;  1HGA A;  3GKV B;  1JP6 A;  2D2M D;  1OUT A;  3AG0 A;  3ZJQ A;  1BZZ B;  2HHD B;  3W4U A;  1RQA B;  1A3N B;  1Y7G A;  1EBC A;  3SDH A;  2EVK A;  1G0B B;  2KSC A;  1F5P A;  3TM9 A;  3GDJ A;  3UHZ A;  3LQD B;  1YHU A;  2BV8 B;  1Y5F A;  3BJ1 A;  1H1X A;  1LIA B;  1YHU B;  1HRM A;  1MBC A;  5B85 A;  2HBE A;  2V1E A;  4HSW A;  1YEV B;  2WTG A;  1JF3 A;  1DO1 A;  1XDT T;  1HI0 P;  1Y0D A;  1YMA A;  2ZSY A;  5KER A;  1J52 A;  1ABS A;  2H8F B;  2O5O X;  3K8B B;  1MLR A;  2AUO A;  2G0V A;  2VJR A;  2ZSQ A;  4KN3 A;  2GRH A;  2PEG B;  1YEQ B;  4O35 A;  1ALL B;  1HAC A;  1R1Y A;  2QLS B;  3WCW B;  1HSY A;  2WCQ A;  4O2G A;  1MLM A;  3WCW A;  1XZ4 B;  1Y22 B;  2O5S X;  1A9W A;  2GKM A;  2VYW A;  3HF4 B;  1DKE B;  1B33 A;  4M4A A;  5E29 B;  1AZI A;  3MWN A;  5E29 A;  1MTJ A;  1RQ3 A;  3MYN A;  1C40 A;  1DWR A;  3PMD A;  1MLN A;  3E55 A;  3WHM A;  4FH7 A;  1HBR A;  3UHQ A;  2G0R A;  3KMF A;  4B4Y A;  2W72 B;  2RI4 A;  3WCU C;  1G9V B;  1Y0W A;  1F65 A;  5EYS A;  2SPO A;  2GTL B;  4UIQ A;  1NAZ A;  2UUL D;  3HXN A;  2BK9 A;  1HBS B;  5M3S A;  1A6G A;  1UT0 A;  1BZP A;  3UGY A;  1YMC A;  5MBN A;  1O1P A;  5JDO D;  1FLP A;  5CNB A;  1AJ9 A;  1IRD A;  1J7W A;  1FSX A;  2C7K B;  3WR1 B;  1Y4F B;  1NS9 A;  1XZ2 A;  2BV8 A;  3GUQ A;  3ZJJ A;  3OZV A;  2GDM A;  1V4U A;  1I7Y B;  1X9F A;  2HBE B;  1V4U B;  2BWH A;  6HBW A;  4NXA A;  1PBX B;  5EV5 A;  2PGH A;  3OO5 A;  3AQ8 A;  1MNK A;  2UUN A;  1ECN A;  5ILP A;  4TMA B;  1YEU B;  4WJG 1;  1HA7 A;  3D1K A;  5D1V A;  2UUM X;  1MNO A;  4N8T B;  1GDI A;  3EDA A;  3O18 B;  111M A;  5JGG A;  1IT3 A;  4O1T A;  1J3Z A;  1Y4B B;  4FWY A;  1YIH B;  1OFK A;  1LFT A;  1DWS A;  3S1J A;  3MJU B;  5ILR A;  1F0L A;  1N9X A;  5AZR A;  2HHE B;  1Y0T B;  1DXV A;  1LH1 A;  1BZR A;  2ZSZ A;  3ZJP A;  3O2C B;  1ABW A;  4PQC A;  1C7C A;  1RQ4 B;  4HRT A;  1HGC B;  2VJR B;  1HBG A;  2NRM A;  2LH7 A;  1EBT A;  3A5G A;  1S61 A;  1KN1 B;  3WCW D;  1JZL A;  1MKO B;  5F2A A;  3H58 A;  3M38 A;  1NZ3 A;  2MGI A;  1DM1 A;  4PNJ A;  4KJT A;  5CMV A;  1MBS A;  1SI4 B;  3PEL B;  1GDL A;  2VEE A;  4F6D A;  3EOK A;  2ZLT A;  3OZU A;  3NMM A;  3ZJH A;  1G0B A;  4FC3 B;  2R4X A;  5AZQ A;  4HHB B;  2GRF A;  2VLZ A;  3VRF A;  2O5M X;  1Y09 A;  3MKB A;  3KUO A;  1I7Y A;  1X9F B;  2QMB A;  1B86 B;  3HHB A;  1V4X B;  2OHB A;  4TYX A;  2C0K A;  3ARJ A;  3BA2 A;  3ZHW A;  4MQC A;  2QSP B;  1Y0C A;  2DC3 A;  4MQJ B;  4OF9 A;  1OUU B;  2D5Z B;  1JP8 A;  2GTL D;  1HDB A;  1Y0W B;  2D6C A;  6HBI A;  3D17 A;  2ZFO C;  1CH5 A;  3G52 A;  1YVT B;  5CNF A;  3UHC A;  1XQ5 B;  3O89 A;  3PMC A;  1Y4Q B;  2EVP A;  1IBE A;  2G0S A;  3OK5 A;  1Y85 A;  1CO8 A;  1MOA A;  1V07 A;  5CN7 A;  3W4U B;  4L1E B;  3PI8 A;  1O1N B;  1J3Z B;  1WLA A;  1YHR B;  4ODC A;  5CND A;  1GVH A;  4ILZ A;  3ECL A;  3AQ6 A;  1HBB B;  2LH2 A;  5CN5 A;  1C7D A;  1X9F D;  1Y8H A;  1MCY A;  2FRJ X;  1IDR A;  1LFY B;  3A59 A;  1C40 B;  1FDH A;  3QQQ A;  5HLU A;  2EB9 A;  2H35 A;  1QXD A;  1XZV B;  1V75 A;  1LH3 A;  1NS6 A;  1O1O A;  3UI0 A;  3WCV C;  5C6E B;  1O1L A;  2H8F A;  1Y31 A;  1YEN B;  1MLK A;  5EU2 A;  3ZOM A;  1Y31 B;  1YEN A;  2EB8 A;  3PI4 A;  4OOD A;  3LHB A;  1JY7 B;  5B84 A;  3WCV B;  4U8U B;  2MYC A;  1JY7 A;  1RH1 A;  1LFL B;  3V57 B;  1HBS A;  3WCP B;  3M39 A;  3WCT A;  2VHB A;  1B33 B;  3BCQ A;  2AUP A;  1Y8W B;  1DXT A;  2MGB A;  2DN1 A;  4M4A B;  1URY A;  4MQG B;  2Z8A A;  2NX0 A;  2EKT A;  3VRG A;  1GDJ A;  3QJB B;  3MN0 A;  3BJ2 B;  2MGH A;  2MGC A;  2HBS B;  2JL9 A;  3TM3 A;  4A8Y A;  4C44 A;  2MYE A;  4MAX A;  1U7R A;  1BAB A;  3AQ5 A;  1LHS A;  1GZX A;  2ZST A;  3OO5 B;  4ROM A;  2ZSO A;  1EMY A;  2ZT0 A;  1HLM A;  1S0H B;  2G11 A;  1G09 B;  3SDN A;  1YVT A;  1JDO A;  3DHT A;  4RMP A;  3UHU A;  3GKV A;  1A3N A;  4L7Y B;  4G51 B;  1MLO A;  2ZLU A;  4N7N B;  2WTH A;  3S66 A;  4H07 A;  2DXM B;  1MDT A;  1A00 B;  1Y35 B;  2MHB A;  4F0U A;  1MNH A;  1XZ2 B;  3GQP A;  1NIH A;  2NSR A;  5HLQ A;  1NIH B;  1Y5K B;  3K3U A;  1HBA A;  1DUK A;  1V4X A;  1Y0T A;  1YIE B;  2IN4 A;  1MYH A;  3U3E A;  3AQ9 A;  1QSI A;  1NXF A;  5HBI A;  1CO9 A;  2C7J B;  1A01 A;  3V2Z A;  1HAC B;  3LB1 A;  1YVQ B;  4DC8 A;  2FAM A;  1S5X A;  3ZJR A;  3EU1 A;  1DDT A;  1R1Y B;  3FH9 B;  2NRL A;  3PI9 B;  4A8O A;  1FAW A;  1Y4B A;  1K1K A;  4UZV A;  1KTP A;  1YH9 A;  2MYB A;  1HHO B;  1XZ7 B;  4NS2 A;  4N7O B;  1XF6 C;  1YIH A;  1Y83 B;  3WFU A;  1YGD A;  1VRE A;  4IRO A;  2ZS1 C;  4KMV A;  4MXL A;  2AV3 A;  1QXD B;  3NL7 A;  4DWT A;  4MPM A;  2AUR A;  1Y4G A;  2Z6N B;  2RAO A;  1GCW A;  3ZJL A;  1GLI A;  5MBA A;  1B8D B;  4YJJ A;  1J3F A;  2G0X A;  4RMP B;  1B8D A;  4YJJ B;  5EUI A;  3ONZ B;  1J3Y B;  2ZFB A;  2X49 A;  1NPG A;  3NMM B;  3V58 B;  3QZX A;  1LH2 A;  4F6J A;  3UBV A;  2W31 A;  3S66 B;  1FHJ B;  2C7K A;  1FN3 A;  1HJT A;  3HEP A;  1MOC A;  1XZ5 A;  3GDJ B;  1I3E A;  4AVD A;  3WTG B;  4MQK B;  1Y4V B;  1BBB A;  2B7H B;  1YOI A;  4HH0 A;  1LIA A;  3BRP B;  1NS9 B;  2NSS A;  3QJD B;  6HBW B;  1B86 A;  1QI8 A;  3FS4 A;  1CH1 A;  3GQG B;  1VWT A;  4X0L A;  1PBX A;  3ODQ B;  2D5Z A;  2MGA A;  2R4W A;  2H35 B;  5SW7 A;  3RGK A;  1CP5 A;  2M6Z B;  2QFK A;  2HBF B;  1NS6 B;  1ECO A;  1UMO A;  2DN3 A;  3MYM A;  1UVN A;  1HDB B;  5CN6 A;  1Y4Q A;  1DXU A;  5HU6 A;  1YEQ A;  2FRK X;  4N8T A;  1CPC B;  3G53 A;  2O5Q X;  4B02 A;  3GQR A;  4GXE B;  2GNW A;  3WFT A;  1O1N A;  3IC0 B;  2HBC B;  1HCO A;  1FAW B;  2G0Z A;  2G12 A;  4L1E A;  5E6E B;  2DKC A;  3UHB A;  1BZ0 B;  1HHO A;  1NGK A;  1NQP B;  3A9M A;  1XZU A;  2AA1 B;  3QM8 A;  1LFT B;  5FVB M;  1HI8 A;  1VXD A;  1EWA A;  2V1J A;  3E4N A;  2DHB B;  3S48 C;  2GRZ A;  4ZIZ A;  1AJG A;  5KDQ B;  1MDN A;  3ZJO A;  1XZV A;  5CN8 A;  2ZLW B;  4DC7 A;  7HBI A;  3ECX A;  4A8M P;  2WY4 A;  1Y4R A;  4AE1 A;  1UVK A;  1LUE A;  2R4Z A;  1J7Y A;  3G4U A;  3QJE A;  3UHW A;  2VJT A;  3QJE B;  2H8D A;  1G08 B;  1Y7Z B;  4ETU A;  4QAU A;  1RSE A;  1IWH B;  4PQ6 A;  1COL A;  1O1M A;  1C7B A;  2QU0 A;  3UH5 A;  2VEB A;  1J7S A;  3ECZ A;  1BJE A;  1CP0 A;  1J7S B;  2R1H B;  1SDL A;  2C7L B;  3HHB B;  3AT6 A;  3D1A B;  5KKK A;  2Z6S A;  4LPI A;  2I88 A;  1JW8 A;  4HRR A;  1W92 A;  3ODQ A;  1DLW A;  1RTX A;  3HEN A;  3QQR A;  3WCV D;  2VML B;  2C7J A;  4F0T B;  1OUU A;  1Y46 B;  2R80 B;  2UUN D;  3ASE A;  101M A;  1CG5 A;  1UX8 A;  1MYJ A;  4C0N A;  1JP9 A;  1DO4 A;  3UBC A;  4NXC A;  1FSL A;  3UHH A;  3EOK B;  3QMA A;  1SHR B;  3M3B A;  2MBW A;  2ZT2 A;  4ZVB A;  1Y5F B;  4MBN A;  3WR1 A;  1Y09 B;  3MKB B;  1THB A;  3LQD A;  4O4T A;  1Y5K A;  1UVX A;  2YSK A;  1CIO A;  3LB3 A;  3BJ1 B;  1LJW A;  3O2C A;  4NK1 A;  3G4R A;  3PI3 A;  1RQ4 A;  2CMM A;  1OBM A;  1LA6 B;  3UHV A;  1FCS A;  1A01 B;  1S69 A;  5CHR A;  4GY3 A;  1LFV A;  1XQ5 A;  3UHT A;  2O58 X;  2ZSR A;  1BZ6 A;  5EUI B;  4GZG A;  3ZH0 A;  3PI8 B;  3PEL A;  1YFF B;  1SWM A;  1ON7 A;  1Y45 A;  4F4O B;  3S1I A;  1FN3 B;  1GCV A;  1MLQ A;  1CPW A;  3IA3 B;  1Y83 A;  3UHX A;  1LH5 A;  1NY9 A;  1DXC A;  3TLD A;  3UHK A;  1UVI A;  1G0A B;  2HBS A;  4MU5 A;  5F0B A;  1YEO B;  2ZFO D;  1YEO A;  4ERT A;  2JHO A;  2GTL C;  2VYY A;  2G10 A;  2Z6N A;  1A0Z A;  3WCU B;  4ROM B;  4ROL A;  3LR7 A;  1QSH A;  1EYX B;  1JZK A;  1QPW A;  2MGF A;  102M A;  1T1N B;  1SGK A;  1MYZ A;  1OR6 A;  3DBJ B;  1KN1 A;  1MTK A;  3SZK B;  4VHB A;  2ZFB B;  2GTL A;  1XXT A;  1N9I A;  1TOX A;  1BVC A;  1HDA B;  2VJH A;  4FWZ A;  5HLX A;  1YHU C;  1AJ9 B;  4MBA A;  2HHD A;  2MGM A;  1NZ5 A;  3WCT C;  2MGJ A;  1WMU B;  1XZ5 B;  1URV A;  1A3O A;  1GBU B;  1DO3 A;  4LMX B;  1I3D A;  3AT6 B;  3ZJM A;  1CIK A;  4A8K A;  4B3W A;  1YIE A;  4A8S A;  1COH A;  1VWT B;  3WCW C;  1LFY A;  4NI1 B;  2XYK A;  1B0B A;  1JEB B;  2V1I A;  1MLG A;  1O1I B;  2SPM A;  4ESA A;  2ZSX A;  1K0Y A;  3D7O B;  2ZSS A;  1HI1 A;  4ESA B;  4O4Z A;  5KER B;  3HRW A;  4BJU A;  4N7P B;  3RQR A;  1CII A;  1O1K B;  2X4A A;  107M A;  1H97 A;  5E83 B;  5HY8 B;  5D5R A;  4GXE A;  3P5Q A;  1BZ0 A;  2V1F A;  1VXF A;  1HV4 A;  1MBI A;  3VRE A;  2OH8 A;  4DWU A;  1XZ7 A;  3A5B A;  1WAC A;  5ILE A;  3CIU B;  2ZFO A;  3NML A;  3ED9 A;  1BIJ B;  4Q70 B;  1UVL A;  1JL7 A;  4JAC A;  1CH9 A;  1YOG A;  4AE0 A;  5ILM A;  2W6V B;  1EYX A;  3B75 A;  2ZLW A;  1Y7D A;  3AT5 A;  5AQD M;  1NPF A;  2XKG A;  2D2N C;  2QSS B;  1CH7 A;  2VJH B;  1HDA A;  1BZ1 B;  3V57 A;  2QU0 B;  4FWX A;  1KTP B;  2OLP A;  1ON7 B;  3UHI A;  2DXM A;  2LH6 A;  2ZLT B;  3G4Q A;  3GK9 A;  3WFW A;  1FHJ A;  1Y4F A;  3DHR B;  4MQI B;  2R1H A;  1UFJ A;  3HEO A;  3WTG A;  5EET A;  1DO7 A;  3FS4 B;  1MOB A;  1KFR A;  3PI1 A;  3BRP A;  3MVC A;  4F69 A;  5HAV A;  3WCU D;  3A0G A;  2BNL A;  2PGH B;  4MQH A;  1Y4G B;  1Y2Z B;  1K0Y B;  2O5B X;  2RI4 B;  1J40 A;  3KUN A;  2PEG A;  4F6F A;  1D8U A;  1GBV B;  4F6I A;  1MZ0 A;  1MYG A;  1XXT B;  4A8W A;  4N6S B;  1XYE A;  5CN9 A;  1YE2 A;  2W6W A;  3FH9 A;  4FH6 A;  5CHQ A;  1M6C A;  1KD2 B;  1DXD A;  1M9P B;  1HDS B;  2VLY A;  5B13 G;  1MNJ A;  3A2G A;  3PT8 A;  2BLI A;  4KMW A;  3QJD A;  4XS0 A;  3CIU A;  5CNG A;  4H2L B;  1BUW A;  1CMY B;  2ZT3 A;  2D2M C;  3OJ1 A;  1CMY A;  5KDQ A;  1JEB A;  2M6Z A;  2ZT1 A;  4SDH A;  4MXK A;  3EDB A;  1A9W E;  2DN3 B;  2VYZ A;  3A5A A;  1O1O B;  3GKT A;  2W72 A;  1R1X B;  2DN2 A;  1S6A A;  4GY3 B;  3UHD A;  5B13 A;  4L2M A;  1SPE A;  2W6X A;  4HH1 A;  1HAB B;  2XKH A;  1HBI A;  3L0F A;  1S5X B;  4A8Q A;  1MKO A;  1MLU A;  4U8U A;  3ORD A;  2HHB B;  109M A;  2G14 A;  3LR9 A;  3QZZ A;  3BCQ B;  1S5Y B;  1NWI A;  1Y22 A;  1MBA A;  2UUL B;  1IWH A;  2ZSP A;  4YU4 A;  3OGB A;  5EQM A;  1FSX B;  1G0A A;  3QJC A;  1GDK A;  2ZLV A;  2MGK A;  1A87 A;  1J41 A;  4G1V A;  2QMB B;  1A0Z B;  1Y4P B;  2BLH A;  3WCU A;  4X0L B;  5AQD A;  2ZLX A;  1DTI A;  2SPL A;  1JBO B;  3NFE B;  2JLG A;  3AT5 B;  1G9V A;  2OIF A;  1V4W A;  1ABY B;  2EF2 A;  3R0G A;  3BOM A;  3QM6 A;  4F0T A;  4LMS B;  2Z6T A;  4NI0 B;  5E83 A;  1MGN A;  1UIW B;  4IT8 A;  3RJ6 A;  1YHR A;  1O16 A;  2DKD A;  3PIA A;  3MJP A;  1Q1F A;  1XG0 C;  3ARK A;  1GBU A;  1UVJ A;  2B7H A;  2LH3 A;  112M A;  1O1J A;  2R4Y A;  104M A;  1RTE A;  3GOU B;  2V8A A;  1O1I A;  106M A;  2R50 A;  1HBH B;  1YE0 A;  5JDO E;  1YEV A;  1HGB A;  3QM7 A;  1LFV B;  108M A;  110M A;  1GBV A;  3EU1 B;  1IBE B;  1VXG A;  4PQB A;  2D60 B;  2MGL A;  3BJ3 B;  3LB4 A;  2QSS A;  3S65 B;  1IOP A;  1VXC A;  5E6E A;  1MLF A;  2BW9 M;  1DXT B;  5EYJ A;  1DKE A;  2ZS1 A;  3UH7 A;  1WVP A;  3HC9 A;  1TES A;  3CY5 B;  1Y45 B;  4F4O A;  1PHN B;  1YDZ B;  1YGD B;  1HBB A; 
#chains in the Genus database with same CATH homology
 4H2L A;  4ZVA A;  2YRS A;  5EE4 D;  3WHM B;  2YRS B;  1X46 A;  1NZ2 A;  1O1L B;  1MYI A;  4YU3 B;  1HGC A;  1LTW A;  1YCB A;  1Y7D B;  3WI8 A;  1R1X A;  2DN2 B;  3UGZ A;  1MOH A;  1GCW B;  1YOH A;  1NWN A;  4NI0 A;  1BZZ A;  2HHB A;  1XYE B;  2SPN A;  1MLS A;  2HBD B;  3WCT D;  1NEJ A;  4G51 A;  1SHR A;  5EOH A;  1IRD B;  1BVD A;  3UH3 A;  2ZS0 C;  3UH6 A;  3VRF B;  1QI8 B;  2ZSN A;  2BMM A;  1Y0A A;  1YZI A;  1F63 A;  1Y0C B;  3NG6 B;  3DUT B;  3UHG A;  1SDK B;  2QSP A;  3DUT A;  1V75 B;  2V1G A;  3UHY A;  5SW7 B;  4MQJ A;  1MYF A;  4N7P A;  5C6E A;  4HSX A;  1RPS B;  3ARL A;  1HGA B;  3DHT B;  3OVU C;  1YE2 B;  3PI2 A;  5HU6 B;  1U7S A;  1PMB A;  4L7Y A;  1YMB A;  3IC0 A;  3QM5 A;  2QFN A;  2D5X B;  1Y85 B;  1EW6 A;  3GQR B;  2HBC A;  4ODC B;  1A00 A;  1Y35 A;  1MOD A;  1YG5 B;  5CNE A;  2ZT4 A;  3E5O A;  4YU4 B;  1BUW B;  2ZFO B;  1ECD A;  4F6G A;  4IRO B;  2ZLV B;  3VAU A;  2MYA A;  3IXF A;  2MYD A;  3WFX A;  3RJN B;  2LHB A;  1CBM A;  1MLJ A;  1LA6 A;  3NFE A;  1YCA A;  2W6V A;  1LFL A;  1G08 A;  1GLI B;  1MLL A;  1Y7Z A;  3UHR A;  1XY0 A;  3WCV A;  1CLS A;  1J3Y A;  2ZS1 D;  5EE4 C;  2FRF A;  3G4W A;  1A4F A;  3ZJS A;  1YH9 B;  1UC3 A;  1S5Y A;  1Y01 B;  2D2M A;  3VRE B;  2HCO B;  5AB8 A;  4F68 A;  3HF4 A;  1J7W B;  4M4B B;  2MGD A;  5JDO F;  1DWT A;  1MLH A;  2AUQ A;  2DN1 B;  1X3K A;  1J41 B;  1DUO A;  3GOU A;  3GQG A;  5JDO C;  3G4V A;  1Y8I B;  2EKU A;  5CN4 A;  1BAB B;  1QSI B;  2ZLX B;  1QSH B;  1Y2Z A;  1QXE B;  1YGF B;  1LFQ A;  1Y5J B;  1QPW B;  1IRC A;  1G09 A;  2O5T X;  3AQ7 A;  1V9Q A;  1LFZ B;  2LH5 A;  1SPG B;  1HCO B;  1O1P B;  1SPG A;  3OZW A;  2LH1 A;  1HBA B;  2ZS1 B;  3DHR A;  1Y8K A;  1XZU B;  2AA1 A;  1Y4V A;  1Y8H B;  2G3H A;  1O1J B;  3UHS A;  1DXV B;  1JWN A;  1LJW B;  1ASH A;  1VXB A;  2W6Y A;  3A59 B;  1SDK A;  3K8B A;  3E5I A;  1CH3 A;  2DHB A;  3D7O A;  3B75 B;  4TWU A;  3ZOL A;  3HRW B;  2RAO B;  1A0U A;  1TU9 A;  1UFP A;  1VXH A;  2BLJ M;  3LB2 A;  1Y4R B;  3BJ3 A;  5C6Y A;  1YVQ A;  3UHE A;  1Y7C B;  3GYS A;  1UX9 A;  1Z8U B;  1J7Y B;  2FAL A;  1XCH A;  1M9P A;  1K1K B;  1OR4 A;  2D2M B;  1NQP A;  2AV0 A;  3UHN A;  3PT8 B;  3PT7 A;  4HHB A;  3VRG B;  4MQI A;  3PT7 B;  4MQK A;  4MQG A;  3G4Y A;  5IKS A;  4TWV A;  3QJB A;  1YZI B;  1A6M A;  2FRI X;  1A6K A;  4JYQ A;  1A6N A;  2IG3 A;  1DTM A;  2HBF A;  4F6B A;  1M6M A;  3BOM B;  1VRF A;  3VHB A;  3D17 B;  3R5I B;  1NZ4 A;  1NEJ B;  103M A;  2ZLU B;  4N7N A;  2O5L X;  3R5I A;  1UIW A;  1A4F B;  105M A;  3GLN A;  1S56 A;  3ZJN A;  4AVE A;  1MBD A;  1A3O B;  1Y8K B;  1BBB B;  3PIA B;  2MHB B;  1THB B;  1WMU A;  1KR7 A;  2GLN A;  2V1K A;  1DLY A;  4XDI A;  3NG6 A;  2D2N D;  5CNC A;  1YEU A;  1C7C B;  1ECA A;  1MWC A;  1QXE A;  1YGF A;  1A0U B;  3G46 A;  3H57 A;  3D1K B;  4UUR A;  1OUT B;  4G1B A;  1HAB A;  1RQA A;  2V1H A;  3KMF C;  2H8D B;  2D5X A;  1VXA A;  1XZ4 A;  2D60 A;  1CQ2 A;  2ZS0 B;  1VHB A;  3S65 A;  4N7O A;  1HDS A;  1YG5 A;  3OO4 A;  1UVY A;  2MGE A;  2HHE A;  1N9F A;  4FC3 A;  1MNI A;  3OO4 B;  4U8U C;  3CY5 A;  3V2V A;  3BJ2 A;  1ITH A;  3NL7 B;  2HBG A;  3MBA A;  1Y0D B;  4HRR B;  2HZ1 A;  4MQC B;  1CQX A;  1CBL A;  1YHE B;  4H0B A;  1JPB A;  1HBR B;  1OFJ A;  1N9H A;  1V4W B;  3HXN B;  1CG8 B;  3HYU B;  1Y7C A;  3GYS B;  1SI4 A;  1CG8 A;  3HYU A;  4WCH D;  3ONZ A;  1LFZ A;  4NZI A;  3WCP A;  1MYT A;  2VRY A;  2HZ3 A;  1YFF A;  2ZS0 D;  3GQP B;  2Z85 A;  1YDZ A;  1JZM A;  1OJ6 A;  4M4B A;  1MBN A;  4BJA A;  2BKM A;  3MJP B;  2OH9 A;  1MYM A;  3IC2 B;  4NI1 A;  3A0G B;  4MQH B;  1YHU D;  4NK2 A;  1HBH A;  1YE0 B;  1LH6 A;  2MB5 A;  4ROL B;  1LFQ B;  1Y5J A;  2E2Y A;  1JL6 A;  1FDH G;  1Y46 A;  2R80 A;  2OHA A;  2W72 C;  1DXU B;  3M3A A;  1J40 B;  1CG5 B;  5JOM A;  1MWB A;  3SZK A;  2MGG A;  1RPS A;  1F5O A;  1AJH A;  3K9Z A;  2HZ2 A;  1CH4 A;  1KD2 A;  3PI9 A;  5JGG B;  1Y7G B;  1V5H A;  1JF4 A;  1Y8W A;  4U8U D;  1C7D B;  1COH B;  2D2N A;  1GJN A;  4XS0 B;  1RQ3 B;  3MJU A;  2D2N B;  3QM9 A;  1MTI A;  1BIJ A;  4HBI A;  1LHT A;  1ABW B;  1YHE A;  1HGB B;  1BIN A;  3DR9 A;  2GL3 A;  4HRT B;  1O1K A;  1T1N A;  3ZJI A;  1X9F C;  1S0H A;  1MWD A;  1XY0 B;  5HY8 A;  3D4X A;  2QLS A;  3WCT B;  1CH2 A;  3D4X B;  3P5Q B;  2ZWJ A;  2HBD A;  3MOU A;  1CLS B;  2ZS0 A;  1O1M B;  1HV4 B;  1IT2 A;  4WJG A;  1BZ1 A;  2VM0 A;  3O7N A;  1L2K A;  3QJC B;  2GNV A;  1C7B B;  2HCO A;  1SDL B;  1GCV B;  1MBO A;  2GKN A;  1HLB A;  3IC2 A;  1Y4P A;  3D1A A;  1RVW A;  1Y0A B;  2VLX A;  1Y8I A;  1RVW B;  4YU3 A;  1GZX B;  2XKI A;  1LH7 A;  1VXE A;  1ABY A;  2QRW A;  1HGA A;  3GKV B;  1JP6 A;  2D2M D;  1OUT A;  3AG0 A;  3ZJQ A;  1BZZ B;  2HHD B;  3W4U A;  1RQA B;  1A3N B;  1Y7G A;  1EBC A;  3SDH A;  2EVK A;  1G0B B;  2KSC A;  1F5P A;  3TM9 A;  3GDJ A;  3UHZ A;  3LQD B;  1YHU A;  1Y5F A;  3BJ1 A;  1H1X A;  1YHU B;  1HRM A;  1MBC A;  5B85 A;  2HBE A;  2V1E A;  4HSW A;  1YEV B;  2WTG A;  1JF3 A;  1DO1 A;  1Y0D A;  1YMA A;  2ZSY A;  5KER A;  1J52 A;  1ABS A;  2H8F B;  2O5O X;  3K8B B;  1MLR A;  2AUO A;  2G0V A;  2ZSQ A;  4KN3 A;  2GRH A;  2PEG B;  1YEQ B;  4O35 A;  1HAC A;  1R1Y A;  2QLS B;  3WCW B;  1HSY A;  4O2G A;  1MLM A;  3WCW A;  1XZ4 B;  1Y22 B;  2O5S X;  1A9W A;  2GKM A;  2VYW A;  3HF4 B;  1DKE B;  4M4A A;  5E29 B;  1AZI A;  5E29 A;  1MTJ A;  1RQ3 A;  3MYN A;  1C40 A;  1DWR A;  1MLN A;  3E55 A;  3WHM A;  4FH7 A;  3UHQ A;  1HBR A;  2G0R A;  3KMF A;  4B4Y A;  2W72 B;  2RI4 A;  3WCU C;  1G9V B;  1Y0W A;  1F65 A;  5EYS A;  2SPO A;  4UIQ A;  2GTL B;  1NAZ A;  3HXN A;  2BK9 A;  1HBS B;  5M3S A;  1A6G A;  1UT0 A;  1BZP A;  3UGY A;  1YMC A;  5MBN A;  1O1P A;  5JDO D;  1FLP A;  5CNB A;  1AJ9 A;  1IRD A;  1J7W A;  1FSX A;  3WR1 B;  1Y4F B;  1NS9 A;  1XZ2 A;  3ZJJ A;  3OZV A;  2GDM A;  1V4U A;  1X9F A;  2HBE B;  1V4U B;  2BWH A;  6HBW A;  4NXA A;  1PBX B;  5EV5 A;  2PGH A;  3OO5 A;  3AQ8 A;  1MNK A;  5ILP A;  1ECN A;  1YEU B;  4WJG 1;  3D1K A;  5D1V A;  1MNO A;  4N8T B;  1GDI A;  3EDA A;  111M A;  5JGG A;  1IT3 A;  4O1T A;  1J3Z A;  1Y4B B;  4FWY A;  1YIH B;  1OFK A;  1LFT A;  1DWS A;  3S1J A;  3MJU B;  5ILR A;  5AZR A;  1N9X A;  2HHE B;  1Y0T B;  1DXV A;  1LH1 A;  1BZR A;  2ZSZ A;  3ZJP A;  1ABW A;  4PQC A;  1C7C A;  1RQ4 B;  4HRT A;  1HGC B;  1HBG A;  2NRM A;  2LH7 A;  1EBT A;  3A5G A;  1S61 A;  3WCW D;  1JZL A;  1MKO B;  5F2A A;  3H58 A;  3M38 A;  1NZ3 A;  2MGI A;  1DM1 A;  4PNJ A;  4KJT A;  5CMV A;  1MBS A;  1SI4 B;  3PEL B;  1GDL A;  2VEE A;  4F6D A;  3EOK A;  2ZLT A;  3OZU A;  3NMM A;  3ZJH A;  1G0B A;  4FC3 B;  2R4X A;  5AZQ A;  4HHB B;  2GRF A;  2VLZ A;  3VRF A;  2O5M X;  1Y09 A;  3MKB A;  3KUO A;  1X9F B;  2QMB A;  1B86 B;  3HHB A;  1V4X B;  2OHB A;  4TYX A;  2C0K A;  3ARJ A;  3BA2 A;  3ZHW A;  4MQC A;  2QSP B;  1Y0C A;  2DC3 A;  4MQJ B;  4OF9 A;  1OUU B;  2D5Z B;  1JP8 A;  2GTL D;  1HDB A;  1Y0W B;  2D6C A;  6HBI A;  3D17 A;  2ZFO C;  1CH5 A;  3G52 A;  1YVT B;  5CNF A;  3UHC A;  1XQ5 B;  3O89 A;  1Y4Q B;  2EVP A;  1IBE A;  2G0S A;  3OK5 A;  1Y85 A;  1CO8 A;  1MOA A;  1V07 A;  5CN7 A;  3W4U B;  3PI8 A;  1O1N B;  1J3Z B;  1WLA A;  1YHR B;  4ODC A;  5CND A;  1GVH A;  4ILZ A;  3ECL A;  3AQ6 A;  1HBB B;  2LH2 A;  5CN5 A;  1C7D A;  1X9F D;  1Y8H A;  1MCY A;  2FRJ X;  1IDR A;  1LFY B;  3A59 A;  1C40 B;  1FDH A;  5HLU A;  3QQQ A;  2EB9 A;  2H35 A;  1QXD A;  1XZV B;  1V75 A;  1LH3 A;  1NS6 A;  1O1O A;  3UI0 A;  3WCV C;  5C6E B;  1O1L A;  2H8F A;  1Y31 A;  1YEN B;  1MLK A;  5EU2 A;  3ZOM A;  1Y31 B;  1YEN A;  2EB8 A;  3PI4 A;  4OOD A;  3LHB A;  1JY7 B;  5B84 A;  3WCV B;  4U8U B;  2MYC A;  1JY7 A;  1LFL B;  1HBS A;  3WCP B;  3M39 A;  3WCT A;  2VHB A;  3BCQ A;  2AUP A;  1Y8W B;  1DXT A;  2MGB A;  2DN1 A;  4M4A B;  1URY A;  4MQG B;  2Z8A A;  2NX0 A;  2EKT A;  3VRG A;  1GDJ A;  3QJB B;  3BJ2 B;  3MN0 A;  2MGH A;  2MGC A;  2HBS B;  3TM3 A;  4C44 A;  2MYE A;  4MAX A;  1U7R A;  1BAB A;  3AQ5 A;  1LHS A;  1GZX A;  2ZST A;  3OO5 B;  4ROM A;  2ZSO A;  1EMY A;  2ZT0 A;  1HLM A;  1S0H B;  2G11 A;  1G09 B;  3SDN A;  1YVT A;  1JDO A;  3DHT A;  3UHU A;  3GKV A;  1A3N A;  4L7Y B;  4G51 B;  1MLO A;  2ZLU A;  4N7N B;  2WTH A;  3S66 A;  4H07 A;  2DXM B;  1A00 B;  1Y35 B;  2MHB A;  1MNH A;  1XZ2 B;  3GQP A;  1NIH A;  2NSR A;  5HLQ A;  1NIH B;  1Y5K B;  3K3U A;  1HBA A;  1DUK A;  1V4X A;  1Y0T A;  1YIE B;  2IN4 A;  1MYH A;  3U3E A;  3AQ9 A;  1QSI A;  1NXF A;  5HBI A;  1CO9 A;  1A01 A;  3V2Z A;  1HAC B;  3LB1 A;  1YVQ B;  4DC8 A;  2FAM A;  1S5X A;  3ZJR A;  3EU1 A;  1R1Y B;  3FH9 B;  2NRL A;  3PI9 B;  1FAW A;  1Y4B A;  1K1K A;  4UZV A;  1YH9 A;  2MYB A;  1HHO B;  1XZ7 B;  4NS2 A;  4N7O B;  1YIH A;  1Y83 B;  3WFU A;  1YGD A;  1VRE A;  4IRO A;  2ZS1 C;  4KMV A;  4MXL A;  2AV3 A;  1QXD B;  3NL7 A;  4DWT A;  4MPM A;  2AUR A;  1Y4G A;  2Z6N B;  2RAO A;  1GCW A;  3ZJL A;  1GLI A;  5MBA A;  1J3F A;  2G0X A;  5EUI A;  3ONZ B;  1J3Y B;  2ZFB A;  1NPG A;  3NMM B;  4F6J A;  3QZX A;  1LH2 A;  3UBV A;  2W31 A;  3S66 B;  1FHJ B;  1FN3 A;  1HJT A;  3HEP A;  1MOC A;  1XZ5 A;  3GDJ B;  1I3E A;  4AVD A;  3WTG B;  4MQK B;  1Y4V B;  1BBB A;  2B7H B;  1YOI A;  1NS9 B;  2NSS A;  3QJD B;  6HBW B;  1B86 A;  1QI8 A;  3FS4 A;  1CH1 A;  3GQG B;  1VWT A;  4X0L A;  1PBX A;  3ODQ B;  2D5Z A;  2MGA A;  2R4W A;  2H35 B;  5SW7 A;  3RGK A;  1CP5 A;  2M6Z B;  2QFK A;  2HBF B;  1NS6 B;  1ECO A;  1UMO A;  2DN3 A;  3MYM A;  1HDB B;  5CN6 A;  1Y4Q A;  1DXU A;  5HU6 A;  1YEQ A;  2FRK X;  4N8T A;  3G53 A;  2O5Q X;  3GQR A;  2GNW A;  3WFT A;  1O1N A;  3IC0 B;  2HBC B;  1HCO A;  1FAW B;  2G0Z A;  2G12 A;  5E6E B;  3UHB A;  1BZ0 B;  1HHO A;  1NGK A;  1NQP B;  3A9M A;  1XZU A;  2AA1 B;  3QM8 A;  1LFT B;  1VXD A;  1EWA A;  2V1J A;  3E4N A;  2DHB B;  3S48 C;  2GRZ A;  1AJG A;  5KDQ B;  1MDN A;  3ZJO A;  1XZV A;  5CN8 A;  2ZLW B;  4DC7 A;  7HBI A;  3ECX A;  2WY4 A;  1Y4R A;  2R4Z A;  1LUE A;  1J7Y A;  3G4U A;  3QJE A;  3UHW A;  3QJE B;  2H8D A;  1G08 B;  1Y7Z B;  4QAU A;  1RSE A;  1IWH B;  4PQ6 A;  1O1M A;  1C7B A;  2QU0 A;  3UH5 A;  2VEB A;  1J7S A;  3ECZ A;  1BJE A;  1CP0 A;  1J7S B;  2R1H B;  1SDL A;  3HHB B;  3AT6 A;  3D1A B;  5KKK A;  2Z6S A;  4LPI A;  1JW8 A;  4HRR A;  1W92 A;  3ODQ A;  1DLW A;  1RTX A;  3HEN A;  3QQR A;  3WCV D;  1OUU A;  1Y46 B;  2R80 B;  3ASE A;  101M A;  1CG5 A;  1UX8 A;  1MYJ A;  4C0N A;  1JP9 A;  3UBC A;  1DO4 A;  4NXC A;  1FSL A;  3UHH A;  3EOK B;  3QMA A;  1SHR B;  3M3B A;  2MBW A;  2ZT2 A;  4ZVB A;  1Y5F B;  4MBN A;  3WR1 A;  1Y09 B;  3MKB B;  1THB A;  3LQD A;  4O4T A;  1Y5K A;  1UVX A;  1CIO A;  3LB3 A;  3BJ1 B;  1LJW A;  4NK1 A;  3G4R A;  3PI3 A;  1RQ4 A;  2CMM A;  1OBM A;  1LA6 B;  3UHV A;  1FCS A;  1A01 B;  1S69 A;  5CHR A;  1LFV A;  1XQ5 A;  3UHT A;  2O58 X;  2ZSR A;  1BZ6 A;  5EUI B;  4GZG A;  3ZH0 A;  3PI8 B;  3PEL A;  1YFF B;  1SWM A;  1Y45 A;  4F4O B;  3S1I A;  1FN3 B;  1GCV A;  1MLQ A;  1CPW A;  3IA3 B;  1Y83 A;  3UHX A;  1LH5 A;  1DXC A;  3TLD A;  3UHK A;  1G0A B;  2HBS A;  4MU5 A;  5F0B A;  1YEO B;  2ZFO D;  1YEO A;  2JHO A;  2GTL C;  2VYY A;  2G10 A;  2Z6N A;  1A0Z A;  3WCU B;  4ROM B;  4ROL A;  3LR7 A;  1QSH A;  1JZK A;  1QPW A;  2MGF A;  102M A;  1T1N B;  1MYZ A;  1OR6 A;  1MTK A;  3SZK B;  4VHB A;  2ZFB B;  2GTL A;  1XXT A;  1N9I A;  1BVC A;  1HDA B;  4FWZ A;  5HLX A;  1YHU C;  1AJ9 B;  4MBA A;  2HHD A;  2MGM A;  1NZ5 A;  3WCT C;  2MGJ A;  1WMU B;  1XZ5 B;  1URV A;  1A3O A;  1GBU B;  1DO3 A;  1I3D A;  3AT6 B;  3ZJM A;  1CIK A;  4B3W A;  1YIE A;  1COH A;  1VWT B;  3WCW C;  1LFY A;  4NI1 B;  2XYK A;  1B0B A;  1JEB B;  2V1I A;  1MLG A;  1O1I B;  2SPM A;  4ESA A;  2ZSX A;  1K0Y A;  3D7O B;  2ZSS A;  4ESA B;  4O4Z A;  5KER B;  3HRW A;  4N7P B;  1O1K B;  107M A;  1H97 A;  5E83 B;  5HY8 B;  5D5R A;  3P5Q A;  1BZ0 A;  2V1F A;  1VXF A;  1HV4 A;  1MBI A;  3VRE A;  2OH8 A;  4DWU A;  1XZ7 A;  3A5B A;  5ILE A;  3CIU B;  2ZFO A;  3NML A;  3ED9 A;  1BIJ B;  1JL7 A;  4JAC A;  1CH9 A;  1YOG A;  5ILM A;  2W6V B;  3B75 A;  2ZLW A;  1Y7D A;  3AT5 A;  1NPF A;  2XKG A;  2D2N C;  2QSS B;  1CH7 A;  1HDA A;  1BZ1 B;  2QU0 B;  4FWX A;  2OLP A;  3UHI A;  2DXM A;  2LH6 A;  2ZLT B;  3G4Q A;  3GK9 A;  3WFW A;  1FHJ A;  1Y4F A;  3DHR B;  4MQI B;  2R1H A;  1UFJ A;  3HEO A;  3WTG A;  5EET A;  1DO7 A;  3FS4 B;  1MOB A;  1KFR A;  3PI1 A;  3MVC A;  4F69 A;  5HAV A;  3WCU D;  3A0G A;  2BNL A;  2PGH B;  4MQH A;  1Y4G B;  1Y2Z B;  1K0Y B;  2O5B X;  2RI4 B;  1J40 A;  3KUN A;  2PEG A;  4F6F A;  1D8U A;  1GBV B;  4F6I A;  1MZ0 A;  1MYG A;  1XXT B;  1XYE A;  5CN9 A;  1YE2 A;  2W6W A;  3FH9 A;  4FH6 A;  5CHQ A;  1M6C A;  1KD2 B;  1DXD A;  1M9P B;  1HDS B;  2VLY A;  1MNJ A;  3A2G A;  3PT8 A;  2BLI A;  4XS0 A;  3QJD A;  4KMW A;  3CIU A;  5CNG A;  4H2L B;  1BUW A;  1CMY B;  2ZT3 A;  2D2M C;  3OJ1 A;  1CMY A;  5KDQ A;  1JEB A;  2M6Z A;  2ZT1 A;  4SDH A;  4MXK A;  3EDB A;  1A9W E;  2DN3 B;  2VYZ A;  3A5A A;  1O1O B;  3GKT A;  2W72 A;  1R1X B;  2DN2 A;  1S6A A;  3UHD A;  4L2M A;  1SPE A;  2W6X A;  1HAB B;  2XKH A;  1HBI A;  1S5X B;  1MKO A;  1MLU A;  4U8U A;  3ORD A;  2HHB B;  109M A;  2G14 A;  3LR9 A;  3QZZ A;  3BCQ B;  1S5Y B;  1NWI A;  1Y22 A;  1MBA A;  1IWH A;  2ZSP A;  4YU4 A;  3OGB A;  5EQM A;  1FSX B;  1G0A A;  3QJC A;  1GDK A;  2ZLV A;  2MGK A;  1J41 A;  4G1V A;  2QMB B;  1A0Z B;  1Y4P B;  2BLH A;  3WCU A;  4X0L B;  2ZLX A;  1DTI A;  2SPL A;  3NFE B;  3AT5 B;  1G9V A;  2OIF A;  1V4W A;  1ABY B;  2EF2 A;  3BOM A;  3QM6 A;  3R0G A;  2Z6T A;  4NI0 B;  5E83 A;  1MGN A;  1UIW B;  4IT8 A;  3RJ6 A;  1YHR A;  1O16 A;  3PIA A;  1Q1F A;  3ARK A;  3MJP A;  1GBU A;  2B7H A;  2LH3 A;  112M A;  1O1J A;  2R4Y A;  104M A;  1RTE A;  3GOU B;  1O1I A;  106M A;  2R50 A;  1HBH B;  1YE0 A;  5JDO E;  1YEV A;  1HGB A;  3QM7 A;  1LFV B;  108M A;  110M A;  1GBV A;  3EU1 B;  1IBE B;  1VXG A;  4PQB A;  2D60 B;  2MGL A;  3BJ3 B;  3LB4 A;  2QSS A;  3S65 B;  1IOP A;  1VXC A;  5E6E A;  1MLF A;  2BW9 M;  5EYJ A;  1DXT B;  1DKE A;  2ZS1 A;  3UH7 A;  1WVP A;  3HC9 A;  1TES A;  3CY5 B;  1Y45 B;  4F4O A;  1YDZ B;  1YGD B;  1HBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...