1F5OA

2.9 angstrom crystal structure of deoxygenated lamprey hemoglobin v in the space group p2(1)2(1)2(1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
149
structure length
149
Chain Sequence
PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystalline ligand transitions in lamprey hemoglobin. Structural evidence for the regulation of oxygen affinity.
pubmed doi rcsb
molecule tags Oxygen storage/transport
molecule keywords HEMOGLOBIN V
total genus 58
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1f5oA00
3PELA 1Y7DA 1A3OA 2DN3B 4G1VA 3UHQA 3LB4A 4C44A 1Y85A 1CG5B 1JY7B 3WCVA 1G0AA 1HGBB 112MA 3OO5B 1RQ4B 3OO4B 3NL7B 2V1HA 5KERA 1WMUB 3WCUC 3D1AB 3WHMA 1KR7A 5ILPA 4F4OA 3UH5A 2HHBB 4M4AA 3MN0A 3QJDB 3AQ8A 1J7YA 3IC0A 3GOUB 1YH9B 1CH7A 5CNCA 1MNKA 1Y01B 3ORDA 1T1NB 5EV5A 3NMMB 2H8DA 3A5AA 3UHKA 3QJCB 1DXVB 1NS6A 1MBSA 2ZLUA 1A01B 2R1HA 1IRDB 1MOAA 1MYJA 1MLKA 4U8UC 1YG5A 1MWCA 1LFZA 2H35A 1YZIA 1M6CA 2FRKX 3D4XB 2W6VB 1MLLA 2EKTA 3AT6A 1NZ3A 1Y2ZA 1YIEB 1FAWB 2E2YA 1JP9A 3QMAA 4FH7A 2G0VA 3O7NA 4N8TA 5D1VA 1HBSA 4YU4A 5EYSA 3WTGB 1V4XA 3UHYA 4G51A 2QMBA 1A4FB 3ODQB 3QM6A 1QSIB 1HBGA 1YIHB 3QM5A 4MQCA 1YE2B 3ASEA 1BABA 1S69A 3PT8A 3ZJOA 2DHBA 3AQ9A 3HF4B 1CG5A 4HRTB 3PI9A 2PEGA 3UH7A 2W6YA 1MYGA 2W6XA 4AVDA 1XYEA 1A0ZA 1A00A 4B4YA 1CMYA 3A59B 1ECDA 1XZVA 2CMMA 6HBWA 3S66A 3UI0A 2ZS1B 3BJ2B 4G1BA 4NI0B 4HHBA 2ZFOA 3ZJNA 1IDRA 1JP8A 3WCWB 1GLIA 1XZ7B 1G9VB 1Y4QA 3WR1A 1QPWA 1JDOA 1MLGA 3GQRA 1MYZA 3A0GA 5CN7A 4DWTA 2QRWA 1Y83A 2QLSB 3GQGB 1NPGA 2ZSPA 1G09B 101MA 4NXCA 3MKBB 2R50A 3K8BB 2MGDA 1GCWA 2XYKA 1LJWA 2ZSXA 1LHTA 1HLBA 2MYAA 1YMBA 1OJ6A 5MBAA 3G4UA 3LB1A 4L2MA 2G0SA 1NWNA 4TYXA 4MQCB 3P5QA 4O35A 1MLFA 1GDJA 1N9HA 1QI8A 1YMCA 3WCVB 3QQQA 2ZT2A 2ZLVA 1MLRA 3UHCA 3HYUA 3ECZA 1DTMA 3UBCA 1Y8KA 1DTIA 1YH9A 1SI4A 1EMYA 1J7YB 2EVKA 1Y8IA 1NZ4A 1K0YB 5ILRA 1MLJA 1YMAA 1UIWA 2QU0B 1A0ZB 1NIHB 1CQXA 3D1KA 2ZLXB 1XZ5B 2HBCA 1Y7CA 2BWHA 2VRYA 3QJBB 1NXFA 1GDKA 1SHRB 1A9WA 3QJEA 1QI8B 1Y0WB 3IC2A 4IROA 2FAMA 4LPIA 2GRZA 5B85A 1SDKB 1RQAB 4F4OB 3E5IA 3UHBA 3QJDA 3LQDB 1KD2A 2ZSZA 2GNVA 1C40B 2VYWA 1HV4A 2HHDB 4H2LB 1MLNA 1X9FC 3GQPB 1HLMA 2GLNA 3OO5A 4MXLA 1OUUB 1YVQB 1EBTA 4ESAA 3EOKA 5E29A 3IXFA 4OODA 1QXDB 2B7HA 3ARKA 1MTIA 1XZ2B 1RSEA 2HHBA 1FSXB 3G46A 4L7YA 1R1YA 1Y0WA 1K1KB 3IC2B 1HSYA 1VHBA 1LH2A 2YRSA 1SPEA 1Y2ZB 3VRFB 1DO3A 1YHUB 2QFNA 4TWVA 1X9FD 2AV0A 2ZLXA 2LH6A 3WCWC 2V1GA 4GZGA 2HBEB 1A3NB 1Y0CA 1Y5KA 1GBUB 5EOHA 3NFEB 102MA 1NZ5A 1THBA 1NWIA 3LB3A 4F6DA 1HBIA 4O4TA 1O1JB 1DO7A 1M9PA 1YVTB 1FSLA 2DN1B 1N9XA 1CP0A 1Y7ZA 5CHQA 4HRRB 3EU1A 2FRJX 5C6EA 107MA 1JY7A 3UHZA 4F6BA 2PGHA 2VEEA 1Y83B 3DHTB 4VHBA 1HBRA 2HBGA 1DXUA 1BZRA 3MYNA 3D7OB 5C6YA 2FRFA 1JEBA 1RQ4A 3CIUA 2OLPA 1LJWB 1V4WA 1NIHA 1CBMA 2MHBB 4FC3A 1EW6A 2EF2A 5KDQB 6HBIA 1BZZA 1MBOA 1LA6A 4ESAB 1MBCA 3HRWB 1QPWB 1MNIA 5HU6A 1MWBA 2HBEA 3G53A 1UMOA 1H1XA 2ZSSA 2QFKA 3G4VA 2ZFOB 5E83A 1JZLA 3A5BA 4ROMB 3OZWA 5F2AA 1YZIB 2GNWA 4QAUA 1RPSA 4N7NB 1Y5JA 1GBVA 3HHBB 1V4UB 1A0UB 2HBFB 1SHRA 1ABSA 2MGIA 2ZSNA 5F0BA 1BZ0A 3UHTA 2RI4B 2OIFA 5CNGA 1YOGA 1MBDA 1CQ2A 1FSXA 1CH1A 2AA1A 1G09A 1SDKA 5JOMA 1Y09A 1CBLA 2QMBB 1MYFA 3UHVA 2ZS0D 3DHTA 3LR9A 3DUTA 4M4AB 1O1PB 1O1IB 2R4WA 1Y0AB 1SDLA 1ECAA 1VXCA 2V1JA 1YDZA 4FWZA 1XZ4B 1W92A 3GYSB 2VHBA 1SWMA 2HBCB 3WCTA 3IA3B 1S56A 4ILZA 3A59A 1ABWB 1LFVA 1A01A 2R1HB 2R4YA 1A6NA 2ZT1A 1N9IA 1Y0TA 4NS2A 3SZKB 3KMFA 2QSPB 1G0BB 1IBEA 1X3KA 3WFWA 2V1FA 2BLIA 1ECNA 1COHA 1BIJB 3ZJRA 2LHBA 1UVYA 3GOUA 2LH3A 1YE0A 1OR4A 2DN2B 4IROB 1Y7ZB 2H8FB 3AQ7A 1BINA 1A4FA 1GJNA 1CH4A 4O1TA 3PI8B 3UHNA 1VXDA 4ODCB 1LH7A 3A2GA 1NEJA 3VRGB 3WFXA 1O1LB 1M6MA 1CG8A 1J7WA 1B0BA 3PI9B 1A9WE 1UT0A 1HBHA 3PI1A 1K1KA 1HDBB 1YEQA 1HGCB 1O1OB 4HSXA 3E4NA 6HBWB 1NGKA 1PMBA 1M9PB 3FS4B 1XZ2A 1MOHA 4ODCA 2LH1A 1LFYA 1UX8A 3BJ3A 4NK2A 2AV3A 1HBAA 1OUUA 2D2NA 1I3EA 1R1XB 1YFFA 3B75B 3WHMB 3QM9A 4JYQA 1MYIA 1O1NB 1B86A 1J40A 1PBXA 2ZSOA 2R80B 4ROLA 3UHIA 3RJ6A 1CH9A 3G4WA 2MGGA 1RVWB 3AQ5A 2M6ZB 2D2MB 2VLXA 3WCTD 3R0GA 2Z6SA 3M3BA 3PI4A 1J40B 1CIOA 109MA 3VAUA 1J7SB 4WJG1 4M4BB 1HDAB 2MGLA 3WCWA 2WTHA 1YHEA 2MYCA 1ABWA 1LH3A 2D2NB 1YVTA 3OGBA 5E6EA 3WFTA 5AZQA 1X46A 2BK9A 5EUIB 2MBWA 1ABYB 3SDNA 4XS0A 2MHBA 1HDAA 2GTLC 2G0RA 2ZSRA 3PI3A 3VRFA 4KJTA 2ZS1A 3MJPB 1JEBB 2GKNA 1BVDA 1MLUA 2HCOA 2SPMA 1UFPA 1YEVA 1EBCA 3QJEB 2PEGB 7HBIA 1Y4PA 1F5PA 1Y31A 4C0NA 2ZS0A 1Y4BB 2ZLVB 1DWSA 3D17A 2VEBA 3UHWA 1HHOA 4MQKA 1Y5JB 1A6KA 2Z6NB 106MA 2NSRA 2D2MD 4MQGB 1FDHG 3WTGA 3E55A 2ZSTA 2SPNA 3QM7A 4FWYA 2FRIX 1CLSB 1Q1FA 1YHUA 1LFLB 1NQPB 1GVHA 3BCQA 4DC7A 3A5GA 3PT7B 1HGBA 2D2ND 4U8UD 3GDJA 1MNJA 3OZUA 1YIEA 4JACA 1O1LA 1DWTA 1YCAA 1O1IA 1J3FA 3UBVA 3OVUC 1LUEA 2ZWJA 2ZFBB 3WCVC 1HHOB 3K9ZA 3PT7A 1Y4RA 3WCUA 2MGKA 3CY5A 4IT8A 1HBRB 4SDHA 1LTWA 1HDSB 1HBAB 5JDOD 1MBIA 1DXDA 3OK5A 3PI8A 4PQ6A 3SZKA 5AB8A 2QSPA 1LHSA 1MWDA 4HHBB 1FAWA 2ZFOD 1G0AB 1MOCA 1HGAB 1BVCA 103MA 3R5IB 4FH6A 4N7PB 1MLMA 1YE0B 1IOPA 1IWHB 1AJ9B 3D1KB 1A3NA 3MOUA 1XXTA 3EOKB 1KFRA 2OHBA 4N7OB 3UHSA 5ILEA 2O5OX 3BJ1A 1Y22B 1CP5A 3EDBA 1NPFA 1VXFA 1Z8UB 2G11A 4PQCA 2O5QX 3DR9A 3ED9A 1QXEB 1CIKA 1VWTA 2W72B 1XXTB 2G12A 1MYTA 5JGGB 2O5SX 1LFZB 2H35B 2G0XA 1GBUA 1YEUB 3TLDA 5HLQA 2HZ3A 3MYMA 1VXAA 3ZJSA 1MODA 1B86B 3UHDA 2D5XB 3K8BA 4XDIA 2O5LX 1C7CA 1A0UA 2D6CA 3MJUB 2GRHA 3DUTB 5JGGA 3WCWD 2SPOA 2ZLWA 3QM8A 3ZOMA 1HDSA 1IRDA 3HXNA 1AJGA 1HRMA 5CN5A 2O58X 2R80A 4ROLB 1LFTA 3G4QA 4YU4B 3QJBA 2ZFOC 1MLQA 1GLIB 2MGCA 3NL7A 3PIAA 5CNFA 1DUKA 1Y5FB 1O1PA 1CH3A 1FN3A 4ZVBA 2RAOB 3G4YA 2D2NC 104MA 3ONZA 1XYEB 2NRLA 1AJ9A 1IWHA 3MBAA 1VXEA 3S65B 1DXVA 1HBBA 1BBBA 1BZ0B 1BZPA 3UHHA 1Y5FA 1YE2A 1IRCA 1DXUB 1J7SA 1TESA 5ILMA 3AQ6A 2B7HB 2ZSYA 2BLHA 2D5ZA 3BOMA 4KN3A 1HACB 1OR6A 4UZVA 1IBEB 2VYZA 2IN4A 5EE4D 3WCUB 3CY5B 1HCOA 4N8TB 2KSCA 1Y4BA 3OZVA 1ASHA 3BJ2A 4M4BA 2MGMA 4PQBA 4BJAA 4WCHD 2HBSA 2ZT4A 1RQAA 4O2GA 4X0LA 1L2KA 3A0GB 1HABA 1DUOA 3H57A 2R4XA 2DHBB 3UHUA 3QZXA 3EU1B 1R1YB 1VREA 1U7SA 1Y0AA 2MGAA 4FWXA 4DWUA 1DXTA 5HY8A 1DXCA 1O1JA 2EVPA 5EYJA 1C7BB 4MXKA 2BMMA 3S1JA 1QXDA 3WCTB 2GTLD 2AURA 3ECXA 4MAXA 3MJUA 4U8UA 2ZS0C 1X9FA 2VLYA 1XZUA 3QQRA 2DN2A 3AT5B 2YRSB 2MGHA 1UVXA 2GRFA 2VLZA 5SW7A 4YU3B 1MNOA 1S5XA 1O1NA 3RJNB 1ITHA 1XQ5B 3U3EA 1IT3A 1A00B 3VRGA 3BOMB 3OO4A 2D5ZB 5CMVA 2D5XA 3V2ZA 1Y4FA 1JF4A 1NZ2A 1MBNA 1UC3A 3GQPA 1O1KA 4WJGA 3VHBA 2MYBA 5HU6B 1Y4RB 4U8UB 5CNBA 2V1EA 3TM3A 2SPLA 1Y0DB 1QSHA 4PNJA 1QXEA 4MQJB 1G08B 1LA6B 5HY8B 4MBAA 2GL3A 1RTXA 1OFKA 3R5IA 1FN3B 1Y46A 3GDJB 1C40A 3VREB 5HAVA 1KD2B 3ZHWA 1YHRA 2H8DB 4XS0B 2BNLA 3AT6B 1J3ZB 3DHRB 4HBIA 3ZJMA 1RVWA 4F68A 1S5YA 2WY4A 1NS9B 1JP6A 5EETA 1F63A 1Y45B 2LH7A 1J41A 2R4ZA 2OH9A 3LR7A 1LH1A 1SPGA 1Y4FB 2ZT3A 1GDIA 2W6VA 1Y0CB 1Y5KB 1DXTB 1WLAA 1MBAA 2MGBA 3ONZB 1MKOA 2IG3A 2VYYA 4NI0A 1HGAA 4F69A 1FHJA 5EU2A 2DC3A 3UH3A 1O1MA 1Y4GA 1Y22A 1CO9A 1BZ1B 1NAZA 1LFLA 1NQPA 3BA2A 2D60A 2Z8AA 1VXGA 4OF9A 3GLNA 1D8UA 3SDHA 1Y0DA 1DKEA 1V4WB 1Y7GA 1SI4B 1F5OA 2ZLUB 4NZIA 1YVQA 2GDMA 1SPGB 1GCWB 2AA1B 2Z6TA 2ZS0B 5B84A 4H2LA 1S61A 3D7OA 2ZSQA 1HGCA 1WVPA 3ZH0A 1MDNA 2O5TX 5JDOE 2LH2A 3K3UA 3ARJA 5JDOC 3NFEA 3S48C 3ECLA 5E29B 1MYHA 1CG8B 5D5RA 3WR1B 1V4UA 3HHBA 1BJEA 5HLUA 1Y4GB 1RQ3B 1MZ0A 5JDOF 5IKSA 5SW7B 3KUNA 1Y85B 4MPMA 4MQHA 1DO1A 1PBXB 3UHXA 5HBIA 2HBFA 1LFQA 1A6GA 2MGEA 111MA 1HJTA 1R1XA 2RAOA 4ROMA 1UIWB 5CHRA 5EE4C 1YGFB 4KMVA 1LFYB 3ARLA 2D60B 1LH6A 1G0BA 3KMFC 1XZ4A 1YEOB 3NMMA 1U7RA 1MKOB 1O1KB 2O5BX 1BBBB 2O5MX 1FHJB 1MNHA 3O89A 3HRWA 1RQ3A 1OUTB 1V75B 1WMUA 2HBSB 4MQHB 1Y4VB 2FALA 1C7CB 5AZRA 5CN4A 3HF4A 2W6WA 2XKGA 3UHRA 1EWAA 1MTKA 3NG6B 1S0HA 3WCUD 1A3OB 3GYSA 5CN9A 2HZ1A 2NSSA 2DXMA 4N7NA 1GBVB 1OUTA 4NI1A 2MB5A 2OH8A 2PGHB 5E6EB 3ZJQA 1IT2A 1BUWB 1Y8HA 1Y7CB 2HBDB 2GTLB 3H58A 1JPBA 2HHEB 1DM1A 1GDLA 1S0HB 3MJPA 1YOIA 1HV4B 1S6AA 1UX9A 2HHDA 2AUPA 3UGYA 1Y0TB 1C7DA 1VRFA 1YHUD 1NEJB 1RPSB 3OJ1A 3GKVB 3DHRA 2W72C 4MBNA 3ZJLA 4MQKB 4L7YB 1MOBA 1Y46B 3ZJIA 1V5HA 2XKIA 1MGNA 2H8FA 1Y4VA 2G3HA 2D2MA 1MLOA 2ZLTB 2GKMA 1YIHA 2MGFA 3PI2A 2EKUA 3HEOA 3HXNB 1URYA 1H97A 2ZS1D 5CNDA 4MU5A 1XY0A 3IC0B 1JL6A 1JF3A 4HRRA 1DO4A 1V4XB 5C6EB 1LFQB 3AT5A 3AG0A 1OFJA 3A9MA 1HBHB 1QSIA 4ZVAA 1Y31B 3RGKA 1HACA 1YGFA 1DWRA 1S5YB 2MGJA 1FLPA 1BIJA 3V2VA 3M39A 3PELB 2OHAA 1GZXA 3E5OA 3KUOA 2M6ZA 1FDHA 2BLJM 5CN6A 1BZ1A 2HZ2A 1Y35A 2MYDA 1QSHB 3BJ3B 1J3ZA 108MA 2ZS1C 1MLHA 1HBBB 1G9VA 1Y4QB 3BCQB 2HHEA 1Y8WA 1YENB 1MCYA 1HABB 1Y8HB 2HBDA 4F6GA 3WI8A 3GKVA 3PIAB 1YDZB 5CNEA 1GZXB 4NK1A 1DLWA 5M3SA 1COHB 1Y8IB 1J7WB 3WCTC 1Y35B 2ZT0A 4H07A 3FH9A 4F6FA 2WTGA 2W31A 1Y45A 3WCPA 3S65A 5KKKA 1XZUB 3D4XA 1A6MA 3UGZA 1Y7DB 3S1IA 1YFFB 3B75A 4UURA 2ZLTA 3HEPA 2BW9M 1S5XB 1CPWA 4O4ZA 1YCBA 2BKMA 3GKTA 3D17B 5E83B 1AJHA 2QU0A 3ZJHA 1YEOA 4MQJA 4N7OA 1G08A 2V1IA 5HLXA 2AUQA 1AZIA 4AVEA 1XZVB 4HSWA 3LB2A 1Y8KB 105MA 3GQRB 1YGDA 2Z6NA 2C0KA 1VXHA 1HBSB 4UIQA 5KDQA 1YHEB 2QSSB 5MBNA 4KMWA 1NS6B 1MLSA 1Y4PB 110MA 2EB9A 1YEUA 1XZ5A 1CH2A 1CMYB 1JL7A 1LFVB 1Y09B 1UFJA 1URVA 2XKHA 1ABYA 2LH5A 1XQ5A 1J3YA 1F65A 4TWUA 4MQGA 4HRTA 3EDAA 2NX0A 3W4UA 1V9QA 3WFUA 1BABB 3PT8B 3BJ1B 2DN1A 1X9FB 3UHGA 3FH9B 1J52A 3NG6A 1V75A 2QLSA 1YGDB 3QZZA 3ODQA 2DN3A 1DLYA 1XY0B 2NRMA 1YEVB 1VXBA 1RTEA 3UH6A 2ZLWB 3WCVD 1XCHA 1XZ7A 1OBMA 1YG5B 2G0ZA 1FCSA 2DXMB 1O1MB 1HDBA 1YEQB 3CIUB 2ZFBA 3GK9A 3VREA 3HC9A 3UHEA 3NMLA 2EB8A 2V1KA 3MKBA 1MYMA 1BUWA 3MVCA 2MYEA 2AUOA 4NXAA 4YU3A 5EUIA 4NI1B 1C7DB 1V07A 3FS4A 3HYUB 4DC8A 1J41B 1GCVA 3D1AA 1TU9A 4B3WA 2GTLA 1JZKA 4F6IA 1LFTB 2G14A 1BZ6A 5CN8A 4F6JA 1YOHA 3ZJPA 3M38A 1N9FA 5KERB 1J3YB 1O16A 4FC3B 1GCVB 1O1OA 2JHOA 3W4UB 3WCPB 1ECOA 2RI4A 1CO8A 1MTJA 2QSSA 1VWTB 2G10A 2W72A 3ZOLA 1DKEB 1Y7GB 3GQGA 4MQIA 3G4RA 1YHRB 3HENA 3QJCA 1C7BA 1BZZB 3G52A 2VM0A 1HCOB 1SDLB 4H0BA 4N7PA 3LHBA 2D2MC 1YHUC 1CLSA 2Z85A 1Y8WB 1YENA 1T1NA 3LQDA 1K0YA 1NS9A 3M3AA 1CH5A 3TM9A 1JZMA 3S66B 1JW8A 4G51B 1I3DA 5EQMA 2HCOB 1JWNA 1THBB 4MQIB 3ZJJA 4X0LB 3P5QB 1LH5A
chains in the Genus database with same CATH superfamily
3PELA 1Y7DA 1A3OA 2DN3B 4G1VA 3UHQA 3LB4A 4C44A 1Y85A 1CG5B 1JY7B 3WCVA 1G0AA 1ON7B 1HGBB 112MA 3OO5B 1RQ4B 3OO4B 3NL7B 2V1HA 5KERA 1WMUB 3WCUC 3D1AB 3WHMA 1KR7A 5ILPA 4F4OA 3UH5A 2HHBB 1B8DB 4M4AA 3MN0A 3QJDB 3AQ8A 1J7YA 3IC0A 3GOUB 1YH9B 1CH7A 5CNCA 1MNKA 2X4AA 1Y01B 3ORDA 1T1NB 5EV5A 4LMXB 1UVLA 3NMMB 2H8DA 3A5AA 3UHKA 3QJCB 1DXVB 4F0UA 1NS6A 1MBSA 2ZLUA 1A01B 2R1HA 1IRDB 4N6SA 1MOAA 1MYJA 1MLKA 4U8UC 1YG5A 4GXEB 1MWCA 1LFZA 2H35A 1YZIA 1M6CA 2FRKX 3D4XB 4A8WA 2W6VB 1MLLA 2EKTA 3AT6A 1NZ3A 1Y2ZA 1YIEB 2VMLB 1FAWB 2E2YA 1JP9A 3QMAA 4FH7A 1ALLB 2G0VA 3O18A 4L1EA 2UUNB 3O7NA 4N8TA 5D1VA 1HBSA 4Z8KB 4YU4A 5EYSA 3WTGB 4ESUA 1V4XA 1F0LA 3UHYA 4G51A 2QMBA 1A4FB 3ODQB 3QM6A 1QSIB 1HBGA 1YIHB 3QM5A 4MQCA 1YE2B 3ASEA 1BABA 1S69A 3PT8A 3ZJOA 2DHBA 3AQ9A 3HF4B 1CG5A 4ERTA 4HRTB 3PI9A 2PEGA 3UH7A 2W6YA 1MYGA 2W6XA 4AVDA 1XYEA 1A0ZA 1A00A 4B4YA 1CMYA 3A59B 1ECDA 1XZVA 2CMMA 6HBWA 4L1EB 3S66A 3UI0A 2ZS1B 3BJ2B 4G1BA 4NI0B 4HHBA 2ZFOA 3ZJNA 1IDRA 1JP8A 3WCWB 1GLIA 1XZ7B 1G9VB 1Y4QA 3WR1A 1QPWA 1JDOA 1MLGA 2C7LA 3GQRA 1MYZA 3A0GA 5CN7A 4DWTA 2QRWA 1Y83A 2QLSB 3GQGB 1NPGA 2ZSPA 1G09B 101MA 1KTPA 4NXCA 3MKBB 2R50A 3K8BB 2MGDA 1GCWA 2XYKA 1LJWA 2ZSXA 1LHTA 1HLBA 2MYAA 1CPCA 1YMBA 1OJ6A 5MBAA 3G4UA 3LB1A 4L2MA 2G0SA 1NWNA 4TYXA 4MQCB 3P5QA 4O35A 5B13G 1MLFA 1GDJA 2DKDA 1N9HA 1QI8A 4Q70A 1YMCA 3WCVB 3QQQA 2ZT2A 2ZLVA 3BRPA 1MLRA 3UHCA 3HYUA 3ECZA 1DTMA 3UBCA 1Y8KA 1DTIA 1YH9A 1SI4A 1EMYA 1J7YB 2EVKA 1Y8IA 1NZ4A 1K0YB 5ILRA 1MLJA 1YMAA 1UIWA 2QU0B 1A0ZB 1NIHB 1CQXA 4Z8KA 3D1KA 2ZLXB 1XZ5B 2HBCA 1Y7CA 2BWHA 2VRYA 3QJBB 1NXFA 1GDKA 1NY9A 1SHRB 1A9WA 3QJEA 1QI8B 1Y0WB 3IC2A 4IROA 2FAMA 4LPIA 2GRZA 4BS9A 4TMAB 5B85A 1SDKB 1RQAB 4F4OB 3E5IA 3UHBA 3QJDA 3LQDB 1KD2A 2ZSZA 2GNVA 1C40B 4LMSB 2VYWA 1HV4A 2HHDB 4H2LB 1MLNA 1X9FC 3GQPB 1HLMA 2GLNA 3OO5A 4MXLA 1OUUB 1YVQB 1EBTA 4ESAA 3EOKA 5E29A 3IXFA 4OODA 1QXDB 2B7HA 3ARKA 1MTIA 1XZ2B 1RSEA 2HHBA 1FSXB 3G46A 4L7YA 1R1YA 1Y0WA 1K1KB 3IC2B 1HSYA 1VHBA 1LH2A 2VJHB 1HI1A 2YRSA 1SPEA 1Y2ZB 3VRFB 1DO3A 1YHUB 2QFNA 4TWVA 1X9FD 2AV0A 2ZLXA 3LQ9A 2LH6A 3WCWC 2V1GA 4GZGA 2HBEB 1A3NB 1Y0CA 1Y5KA 1GBUB 5EOHA 3NFEB 1UVJA 102MA 1NZ5A 1THBA 1NWIA 3LB3A 4F6DA 1HBIA 4O4TA 4H0MA 1O1JB 1DO7A 1M9PA 1YVTB 1FSLA 2DN1B 1N9XA 1CP0A 1Y7ZA 4A8KA 5CHQA 4HRRB 3EU1A 2FRJX 5C6EA 107MA 1JY7A 3UHZA 1HA7B 2PGHA 4F6BA 2VEEA 1Y83B 3DHTB 4VHBA 1HBRA 2HBGA 1DXUA 1BZRA 3MYNA 2UULB 3D7OB 5C6YA 2FRFA 3RQRA 1JEBA 1CPCB 1RQ4A 3CIUA 2OLPA 1LJWB 5FVBA 1V4WA 1NIHA 2JL9A 1CBMA 2MHBB 4FC3A 1EW6A 2EF2A 5KDQB 6HBIA 1BZZA 3NUHB 1MBOA 1LA6A 4ESAB 1XDTT 1MBCA 3HRWB 1QPWB 1MNIA 2C7LB 5HU6A 1MWBA 2HBEA 3G53A 3BRPB 1UMOA 1H1XA 2ZSSA 2QFKA 3G4VA 2ZFOB 5E83A 1F99A 1JZLA 3A5BA 4ROMB 3OZWA 4AE0A 5F2AA 1YZIB 2GNWA 4QAUA 1RPSA 4N7NB 1Y5JA 1GBVA 3HHBB 1V4UB 4ZIZB 1A0UB 4A8OA 2HBFB 1SHRA 1COLA 1ABSA 2MGIA 2ZSNA 5F0BA 1BZ0A 3UHTA 2RI4B 2OIFA 5CNGA 1YOGA 1MBDA 1CQ2A 1SGKA 1HHSA 1KTPB 1FSXA 1CH1A 2AA1A 1G09A 1SDKA 5JOMA 2JLFA 1Y09A 1CBLA 2QMBB 1MYFA 3UHVA 2ZS0D 3DHTA 3LR9A 3DUTA 4M4AB 1O1PB 1O1IB 2R4WA 1Y0AB 1SDLA 1ECAA 1VXCA 2V1JA 1YDZA 4FWZA 1XZ4B 1W92A 3GYSB 2VHBA 1SWMA 2HBCB 3MWNA 3WCTA 3IA3B 1S56A 4PO5A 4ILZA 3A59A 2BV8A 1ABWB 3V57B 1LFVA 4N6SB 1A01A 2R1HB 2R4YA 1A6NA 3FEWX 2ZT1A 1N9IA 1Y0TA 4NS2A 1RH1A 3SZKB 3KMFA 2QSPB 2UULA 1G0BB 1IBEA 1X3KA 3WFWA 2V1FA 2BLIA 1ECNA 1COHA 1BIJB 3ZJRA 2LHBA 1UVYA 3GOUA 1A87A 2LH3A 1YE0A 1OR4A 1MDTA 2DN2B 4IROB 4RMPA 1Y7ZB 2H8FB 3AQ7A 1BINA 1A4FA 1GJNA 1CH4A 4O1TA 3PI8B 5AQDA 3UHNA 1VXDA 4ODCB 1LH7A 3A2GA 1NEJA 3VRGB 3WFXA 1O1LB 1M6MA 1CG8A 1J7WA 1B0BA 3PI9B 1A9WE 1UT0A 1HBHA 3PI1A 1K1KA 1HDBB 1YEQA 1HGCB 1O1OB 2UUMA 3O2CA 4HSXA 3E4NA 6HBWB 1NGKA 1PMBA 1M9PB 3FS4B 1XZ2A 1MOHA 4ODCA 2LH1A 1LFYA 1KN1B 1UX8A 3BJ3A 4NK2A 2AV3A 1HBAA 1OUUA 2D2NA 1I3EA 1R1XB 1YFFA 3B75B 1WACA 3WHMB 3QM9A 4JYQA 1MYIA 1O1NB 1B8DA 1B86A 1J40A 4ETVA 1PBXA 2ZSOA 2R80B 4ROLA 3UHIA 3V58B 3RJ6A 1CH9A 3G4WA 2MGGA 1RVWB 3AQ5A 2M6ZB 2D2MB 2VLXA 3WCTD 3R0GA 2Z6SA 3M3BA 3PI4A 1J40B 1CIOA 109MA 3VAUA 1J7SB 4WJG1 4M4BB 1HDAB 2MGLA 1XF6C 3WCWA 2WTHA 1YHEA 2MYCA 1ABWA 1LH3A 2D2NB 1YVTA 3PMCA 3OGBA 5E6EA 3WFTA 5AZQA 1X46A 2BK9A 5EUIB 2MBWA 2DKAA 1ABYB 3SDNA 3ZTAA 4XS0A 2VJRB 2MHBA 1HDAA 2GTLC 2G0RA 2ZSRA 3PI3A 3VRFA 4KJTA 2ZS1A 3MJPB 1JEBB 2GKNA 1BVDA 1MLUA 2HCOA 2BV8B 3DBJA 2SPMA 3V58A 1UFPA 3GIOA 1YEVA 1EBCA 3QJEB 5FVBM 2PEGB 1XG0C 4B02A 7HBIA 1Y4PA 1F5PA 1Y31A 4C0NA 2ZS0A 1Y4BB 2ZLVB 1DWSA 3D17A 2VEBA 1ALLA 3UHWA 1HHOA 4MQKA 1Y5JB 1A6KA 2Z6NB 106MA 2NSRA 2D2MD 4MQGB 1FDHG 3WTGA 3E55A 2ZSTA 1PHNA 2SPNA 3QM7A 4FWYA 2FRIX 1CLSB 1Q1FA 1YHUA 1LFLB 1NQPB 1GVHA 3BCQA 4DC7A 3A5GA 3PT7B 1HGBA 2D2ND 4U8UD 3GDJA 1MNJA 3OZUA 1YIEA 4JACA 1O1LA 1DWTA 1YCAA 1UVMA 1O1IA 1J3FA 3UBVA 3OVUC 1LUEA 2UULD 2ZWJA 2ZFBB 3WCVC 1HHOB 3K9ZA 3PT7A 1Y4RA 3WCUA 2MGKA 3CY5A 4IT8A 1HBRB 4SDHA 1LTWA 4Q70B 1HDSB 1HBAB 5JDOD 1MBIA 1DXDA 3OK5A 2VJTB 3PI8A 4AE1A 4PQ6A 3SZKA 5AB8A 2QSPA 1LHSA 2C7KA 1MWDA 4HHBB 1FAWA 2ZFOD 1G0AB 1MOCA 1HGAB 1ON7A 3KVSA 1BVCA 103MA 3R5IB 4FH6A 4N7PB 1MLMA 1YE0B 1IOPA 1IWHB 1AJ9B 3D1KB 1LIAB 1A3NA 3MOUA 1XXTA 4A8MP 3EOKB 1KFRA 2OHBA 4N7OB 3UHSA 5ILEA 2O5OX 3BJ1A 1Y22B 1CP5A 3EDBA 1NPFA 1VXFA 1Z8UB 2G11A 4PQCA 2O5QX 3DR9A 3ED9A 1QXEB 1CIKA 1VWTA 2W72B 1XXTB 2G12A 2UULH 1MYTA 5JGGB 2O5SX 1LFZB 2H35B 2G0XA 1GBUA 1YEUB 3TLDA 5HLQA 2HZ3A 3MYMA 1VXAA 3ZJSA 1MODA 1B86B 3UHDA 2D5XB 2DKCA 3K8BA 4XDIA 2O5LX 1C7CA 1A0UA 2D6CA 3MJUB 2GRHA 3DUTB 5JGGA 3WCWD 2SPOA 2ZLWA 3QM8A 3ZOMA 1HDSA 1IRDA 3HXNA 1AJGA 1HRMA 5CN5A 2O58X 2R80A 4ROLB 1LFTA 3G4QA 4YU4B 3QJBA 2ZFOC 1UVIA 1MLQA 2V8AA 1GLIB 2MGCA 3NL7A 3PIAA 4A8QA 5CNFA 1DUKA 1Y5FB 1O1PA 1CH3A 1FN3A 4ZVBA 4A8YA 1B33A 2RAOB 3G4YA 2D2NC 1JBOA 104MA 3ONZA 1XYEB 2NRLA 1AJ9A 1IWHA 4ERVA 3MBAA 1VXEA 3S65B 1DXVA 1HBBA 1BBBA 1BZ0B 1BZPA 3UHHA 1Y5FA 1YE2A 1IRCA 1DXUB 1J7SA 1TESA 5ILMA 3AQ6A 2B7HB 2ZSYA 2BLHA 2D5ZA 3BOMA 4KN3A 1HACB 1OR6A 4UZVA 1IBEB 2VYZA 2IN4A 5EE4D 3PMDA 3WCUB 3CY5B 1HCOA 4N8TB 2KSCA 1Y4BA 3OZVA 1ASHA 3BJ2A 4M4BA 2MGMA 4PQBA 4BJAA 4WCHD 2HBSA 2ZT4A 4PO5B 1RQAA 4O2GA 4X0LA 1DDTA 1L2KA 3A0GB 1HABA 3O2CB 1DUOA 3H57A 2R4XA 2DHBB 3UHUA 4GY3B 2VMLA 3QZXA 3EU1B 1R1YB 1VREA 1U7SA 1Y0AA 2MGAA 4FWXA 4DWUA 1DXTA 5HY8A 1DXCA 1O1JA 2EVPA 5EYJA 1C7BB 4MXKA 4F0TA 2BMMA 3S1JA 1QXDA 3WCTB 2GTLD 4F0UB 2AURA 3ECXA 4MAXA 3MJUA 4U8UA 2ZS0C 1X9FA 2VLYA 4RMPB 1XZUA 3QQRA 2DN2A 3AT5B 2YRSB 2C7JB 2MGHA 1UVXA 2GRFA 2VLZA 5SW7A 4YU3B 1MNOA 1EYXA 1S5XA 1O1NA 3RJNB 1ITHA 1XQ5B 3U3EA 1IT3A 4ETUA 1A00B 3VRGA 3BOMB 3OO4A 2D5ZB 5CMVA 2D5XA 3V2ZA 1Y4FA 1JF4A 1NZ2A 1MBNA 1UC3A 3GQPA 1O1KA 2UUMX 4WJGA 3VHBA 2MYBA 5HU6B 1Y4RB 4U8UB 3GUQA 5CNBA 2V1EA 3TM3A 2SPLA 1Y0DB 1UVKA 1QSHA 4PNJA 1QXEA 4MQJB 1G08B 1LA6B 5HY8B 4MBAA 2GL3A 1RTXA 1OFKA 3R5IA 1FN3B 1Y46A 3GDJB 1C40A 3VREB 5HAVA 4HH1A 1KD2B 3ZHWA 1YHRA 2H8DB 4XS0B 2BNLA 3AT6B 1J3ZB 3DHRB 4HBIA 4LM6B 3ZJMA 1RVWA 4F68A 1S5YA 2WY4A 1NS9B 1JP6A 4HH0A 5EETA 1F63A 1Y45B 2LH7A 1J41A 4BJUA 2R4ZA 2OH9A 3LR7A 1LH1A 1SPGA 1Y4FB 2ZT3A 1GDIA 2W6VA 1Y0CB 1Y5KB 1DXTB 1WLAA 1MBAA 2MGBA 3ONZB 1MKOA 2IG3A 2VYYA 4NI0A 1HGAA 4F69A 1FHJA 4H0MB 5EU2A 2DC3A 3UH3A 3V57A 1O1MA 1Y4GA 1Y22A 1CO9A 1BZ1B 1NAZA 1LFLA 1NQPA 3BA2A 1UVNA 2V8AB 1HI0P 2D60A 2Z8AA 1VXGA 4OF9A 3GLNA 1D8UA 3SDHA 1Y0DA 1DKEA 1V4WB 1Y7GA 1SI4B 1F5OA 2ZLUB 3L0FA 4NZIA 2VJHA 1YVQA 2GDMA 1SPGB 1GCWB 2AA1B 2Z6TA 2ZS0B 5B84A 4H2LA 1S61A 3D7OA 1GH0A 2ZSQA 5AQDM 1HGCA 1WVPA 3ZH0A 1MDNA 2O5TX 5JDOE 2LH2A 3K3UA 3ARJA 5JDOC 3NFEA 3S48C 3ECLA 5E29B 1MYHA 1CG8B 5D5RA 3WR1B 1V4UA 3HHBA 1BJEA 5HLUA 1Y4GB 1RQ3B 1MZ0A 5JDOF 5IKSA 5SW7B 3KUNA 2C7JA 1Y85B 2J96A 4MPMA 4MQHA 1DO1A 1PBXB 3UHXA 5HBIA 2C7KB 2HBFA 1LFQA 1A6GA 2MGEA 111MA 1HJTA 1R1XA 1B33B 2RAOA 4ROMA 1UIWB 5CHRA 1I7YA 4F0TB 5EE4C 1YGFB 4KMVA 1LFYB 1LIAA 3ARLA 2D60B 1LH6A 1G0BA 3KMFC 1XZ4A 1YEOB 2UULC 3NMMA 1U7RA 1MKOB 1O1KB 2O5BX 1BBBB 2O5MX 1FHJB 1MNHA 3L0FB 3O89A 1HI8A 3HRWA 1RQ3A 1OUTB 1V75B 1WMUA 2HBSB 4MQHB 1Y4VB 2FALA 1C7CB 5AZRA 5CN4A 3HF4A 2W6WA 2XKGA 3UHRA 1EWAA 1MTKA 3NG6B 1S0HA 3WCUD 1A3OB 3GYSA 5CN9A 2HZ1A 2NSSA 2DXMA 4N7NA 1GBVB 4ZIZA 1OUTA 4NI1A 2MB5A 2OH8A 2PGHB 2WCQA 3DBJB 5E6EB 2I88A 3ZJQA 1IT2A 1BUWB 1Y8HA 1Y7CB 2HBDB 2GTLB 3H58A 1JPBA 2HHEB 1DM1A 1GDLA 1S0HB 3MJPA 1YOIA 1HV4B 1S6AA 1UX9A 1I7YB 2HHDA 3VNCA 2AUPA 3UGYA 1Y0TB 1C7DA 1VRFA 1YHUD 1NEJB 1RPSB 3OJ1A 3GKVB 3DHRA 2W72C 4MBNA 3ZJLA 4MQKB 4L7YB 1MOBA 1Y46B 3ZJIA 1V5HA 2XKIA 1MGNA 2H8FA 1Y4VA 2G3HA 2D2MA 1MLOA 2ZLTB 2GKMA 1YIHA 2MGFA 3PI2A 2JLGA 1PHNB 2EKUA 3HEOA 3HXNB 1URYA 1H97A 4XXKA 2ZS1D 5CNDA 4MU5A 1XY0A 3IC0B 1JL6A 1JF3A 4HRRA 1DO4A 1V4XB 5C6EB 1LFQB 3AT5A 4YJJB 2X49A 3AG0A 1OFJA 3A9MA 1HBHB 1QSIA 4ZVAA 1Y31B 3RGKA 1HACA 1YGFA 1DWRA 1S5YB 2MGJA 1FLPA 1TOXA 1BIJA 2UUND 3V2VA 3M39A 3PELB 2OHAA 1GZXA 3E5OA 3KUOA 2M6ZA 1FDHA 2BLJM 5CN6A 1BZ1A 2HZ2A 1QGWC 1Y35A 2MYDA 1QSHB 3BJ3B 1J3ZA 108MA 2ZS1C 1MLHA 1HBBB 1G9VA 1Y4QB 3BCQB 2HHEA 1Y8WA 1YENB 1MCYA 1HABB 1Y8HB 2HBDA 4F6GA 3WI8A 3GKVA 3PIAB 1YDZB 5CNEA 4GXEA 1GZXB 4NK1A 1DLWA 5M3SA 1COHB 1Y8IB 1J7WB 3WCTC 1Y35B 2ZT0A 4H07A 3FH9A 4F6FA 2WTGA 2W31A 1Y45A 3WCPA 3S65A 5KKKA 1XZUB 3D4XA 4YJJA 1A6MA 3UGZA 1Y7DB 3S1IA 1YFFB 3B75A 4UURA 2ZLTA 3HEPA 2BW9M 1EYXB 1S5XB 3O18B 1CPWA 4O4ZA 1YCBA 2BKMA 2VJRA 3GKTA 3D17B 5E83B 1AJHA 2QU0A 3ZJHA 1YEOA 4MQJA 4N7OA 1G08A 2V1IA 5HLXA 2AUQA 1AZIA 4AVEA 1XZVB 3LB2A 4HSWA 1Y8KB 105MA 3GQRB 4ETTA 1YGDA 2Z6NA 2C0KA 1VXHA 1HBSB 4UIQA 5KDQA 1YHEB 2QSSB 5MBNA 4KMWA 1NS6B 1MLSA 1Y4PB 110MA 2EB9A 4GY3A 1YEUA 2YSKA 1XZ5A 1CH2A 1CIIA 1CMYB 1JL7A 1LFVB 1Y09B 1UFJA 1URVA 2WCRA 2XKHA 1ABYA 2LH5A 1XQ5A 1J3YA 1F65A 4TWUA 4MQGA 4HRTA 3EDAA 3KVSB 2NX0A 3W4UA 1V9QA 3WFUA 1BABB 3PT8B 3BJ1B 2DN1A 1X9FB 3UHGA 3FH9B 1J52A 3NG6A 1V75A 2QLSA 1YGDB 3QZZA 3ODQA 2DN3A 1DLYA 1XY0B 2NRMA 1KN1A 1YEVB 1VXBA 1RTEA 3UH6A 2ZLWB 3WCVD 1XCHA 1XZ7A 1OBMA 1YG5B 2G0ZA 1FCSA 1JBOB 2DXMB 1O1MB 1HDBA 1YEQB 3CIUB 2ZFBA 3GK9A 4A8FA 3VREA 3HC9A 3UHEA 3NMLA 2EB8A 2V1KA 3MKBA 1MYMA 4XXIA 1BUWA 3MVCA 2MYEA 2AUOA 4NXAA 4YU3A 5EUIA 4NI1B 1C7DB 1V07A 3FS4A 3HYUB 4DC8A 1J41B 1GCVA 3D1AA 5B13A 1TU9A 4B3WA 2GTLA 1JZKA 4F6IA 1LFTB 2G14A 1BZ6A 5CN8A 4F6JA 1YOHA 1HA7A 3ZJPA 3M38A 1N9FA 2UUNA 5KERB 1J3YB 1O16A 4FC3B 1GCVB 1O1OA 2UUMB 2JHOA 3W4UB 3WCPB 1ECOA 2RI4A 1CO8A 1MTJA 2QSSA 1HHTP 2VJTA 1VWTB 2G10A 2W72A 4A8SA 3ZOLA 1DKEB 1Y7GB 3GQGA 4MQIA 3G4RA 1F99B 1YHRB 3HENA 3QJCA 1C7BA 1BZZB 3G52A 2VM0A 1HCOB 1SDLB 4H0BA 4N7PA 3LHBA 2D2MC 1GH0B 1YHUC 1CLSA 2Z85A 1Y8WB 1YENA 1T1NA 3LQDA 1K0YA 1NS9A 3M3AA 1CH5A 3TM9A 1JZMA 3S66B 1JW8A 4G51B 1I3DA 5EQMA 2HCOB 1JWNA 1THBB 4MQIB 3ZJJA 4X0LB 3P5QB 1LH5A
chains in the Genus database with same CATH topology
3PELA 1Y7DA 1A3OA 2DN3B 4G1VA 3UHQA 3LB4A 4C44A 1Y85A 1CG5B 1JY7B 3WCVA 1G0AA 1HGBB 112MA 3OO5B 1RQ4B 3OO4B 3NL7B 2V1HA 5KERA 1WMUB 3WCUC 3D1AB 3WHMA 1KR7A 5ILPA 4F4OA 3UH5A 2HHBB 4M4AA 3MN0A 3QJDB 3AQ8A 1J7YA 3IC0A 3GOUB 1YH9B 1CH7A 5CNCA 1MNKA 1Y01B 3ORDA 1T1NB 5EV5A 3NMMB 2H8DA 3A5AA 3UHKA 3QJCB 1DXVB 1NS6A 1MBSA 2ZLUA 1A01B 2R1HA 1IRDB 1MOAA 1MYJA 1MLKA 4U8UC 1YG5A 1MWCA 1LFZA 2H35A 1YZIA 1M6CA 2FRKX 3D4XB 2W6VB 1MLLA 2EKTA 3AT6A 1NZ3A 1Y2ZA 1YIEB 1FAWB 2E2YA 1JP9A 3QMAA 4FH7A 2G0VA 3O7NA 4N8TA 5D1VA 1HBSA 4YU4A 5EYSA 3WTGB 1V4XA 3UHYA 4G51A 2QMBA 1A4FB 3ODQB 3QM6A 1QSIB 1HBGA 1YIHB 3QM5A 4MQCA 1YE2B 3ASEA 1BABA 1S69A 3PT8A 3ZJOA 2DHBA 3AQ9A 3HF4B 1CG5A 4HRTB 3PI9A 2PEGA 3UH7A 2W6YA 1MYGA 2W6XA 4AVDA 1XYEA 1A0ZA 1A00A 4B4YA 1CMYA 3A59B 1ECDA 1XZVA 2CMMA 6HBWA 3S66A 3UI0A 2ZS1B 3BJ2B 4G1BA 4NI0B 4HHBA 2ZFOA 3ZJNA 1IDRA 1JP8A 3WCWB 1GLIA 1XZ7B 1G9VB 1Y4QA 3WR1A 1QPWA 1JDOA 1MLGA 3GQRA 1MYZA 3A0GA 5CN7A 4DWTA 2QRWA 1Y83A 2QLSB 3GQGB 1NPGA 2ZSPA 1G09B 101MA 4NXCA 3MKBB 2R50A 3K8BB 2MGDA 1GCWA 2XYKA 1LJWA 2ZSXA 1LHTA 1HLBA 2MYAA 1YMBA 1OJ6A 5MBAA 3G4UA 3LB1A 4L2MA 2G0SA 1NWNA 4TYXA 4MQCB 3P5QA 4O35A 1MLFA 1GDJA 1N9HA 1QI8A 1YMCA 3WCVB 3QQQA 2ZT2A 2ZLVA 1MLRA 3UHCA 3HYUA 3ECZA 1DTMA 3UBCA 1Y8KA 1DTIA 1YH9A 1SI4A 1EMYA 1J7YB 2EVKA 1Y8IA 1NZ4A 1K0YB 5ILRA 1MLJA 1YMAA 1UIWA 2QU0B 1A0ZB 1NIHB 1CQXA 3D1KA 2ZLXB 1XZ5B 2HBCA 1Y7CA 2BWHA 2VRYA 3QJBB 1NXFA 1GDKA 1SHRB 1A9WA 3QJEA 1QI8B 1Y0WB 3IC2A 4IROA 2FAMA 4LPIA 2GRZA 5B85A 1SDKB 1RQAB 4F4OB 3E5IA 3UHBA 3QJDA 3LQDB 1KD2A 2ZSZA 2GNVA 1C40B 2VYWA 1HV4A 2HHDB 4H2LB 1MLNA 1X9FC 3GQPB 1HLMA 2GLNA 3OO5A 4MXLA 1OUUB 1YVQB 1EBTA 4ESAA 3EOKA 5E29A 3IXFA 4OODA 1QXDB 2B7HA 3ARKA 1MTIA 1XZ2B 1RSEA 2HHBA 1FSXB 3G46A 4L7YA 1R1YA 1Y0WA 1K1KB 3IC2B 1HSYA 1VHBA 1LH2A 2YRSA 1SPEA 1Y2ZB 3VRFB 1DO3A 1YHUB 2QFNA 4TWVA 1X9FD 2AV0A 2ZLXA 2LH6A 3WCWC 2V1GA 4GZGA 2HBEB 1A3NB 1Y0CA 1Y5KA 1GBUB 5EOHA 3NFEB 102MA 1NZ5A 1THBA 1NWIA 3LB3A 4F6DA 1HBIA 4O4TA 1O1JB 1DO7A 1M9PA 1YVTB 1FSLA 2DN1B 1N9XA 1CP0A 1Y7ZA 5CHQA 4HRRB 3EU1A 2FRJX 5C6EA 107MA 1JY7A 3UHZA 4F6BA 2PGHA 2VEEA 1Y83B 3DHTB 4VHBA 1HBRA 2HBGA 1DXUA 1BZRA 3MYNA 3D7OB 5C6YA 2FRFA 1JEBA 1RQ4A 3CIUA 2OLPA 1LJWB 1V4WA 1NIHA 1CBMA 2MHBB 4FC3A 1EW6A 2EF2A 5KDQB 6HBIA 1BZZA 1MBOA 1LA6A 4ESAB 1MBCA 3HRWB 1QPWB 1MNIA 5HU6A 1MWBA 2HBEA 3G53A 1UMOA 1H1XA 2ZSSA 2QFKA 3G4VA 2ZFOB 5E83A 1JZLA 3A5BA 4ROMB 3OZWA 5F2AA 1YZIB 2GNWA 4QAUA 1RPSA 4N7NB 1Y5JA 1GBVA 3HHBB 1V4UB 1A0UB 2HBFB 1SHRA 1ABSA 2MGIA 2ZSNA 5F0BA 1BZ0A 3UHTA 2RI4B 2OIFA 5CNGA 1YOGA 1MBDA 1CQ2A 1FSXA 1CH1A 2AA1A 1G09A 1SDKA 5JOMA 1Y09A 1CBLA 2QMBB 1MYFA 3UHVA 2ZS0D 3DHTA 3LR9A 3DUTA 4M4AB 1O1PB 1O1IB 2R4WA 1Y0AB 1SDLA 1ECAA 1VXCA 2V1JA 1YDZA 4FWZA 1XZ4B 1W92A 3GYSB 2VHBA 1SWMA 2HBCB 3WCTA 3IA3B 1S56A 4ILZA 3A59A 1ABWB 1LFVA 1A01A 2R1HB 2R4YA 1A6NA 2ZT1A 1N9IA 1Y0TA 4NS2A 3SZKB 3KMFA 2QSPB 1G0BB 1IBEA 1X3KA 3WFWA 2V1FA 2BLIA 1ECNA 1COHA 1BIJB 3ZJRA 2LHBA 1UVYA 3GOUA 2LH3A 1YE0A 1OR4A 2DN2B 4IROB 1Y7ZB 2H8FB 3AQ7A 1BINA 1A4FA 1GJNA 1CH4A 4O1TA 3PI8B 3UHNA 1VXDA 4ODCB 1LH7A 3A2GA 1NEJA 3VRGB 3WFXA 1O1LB 1M6MA 1CG8A 1J7WA 1B0BA 3PI9B 1A9WE 1UT0A 1HBHA 3PI1A 1K1KA 1HDBB 1YEQA 1HGCB 1O1OB 4HSXA 3E4NA 6HBWB 1NGKA 1PMBA 1M9PB 3FS4B 1XZ2A 1MOHA 4ODCA 2LH1A 1LFYA 1UX8A 3BJ3A 4NK2A 2AV3A 1HBAA 1OUUA 2D2NA 1I3EA 1R1XB 1YFFA 3B75B 3WHMB 3QM9A 4JYQA 1MYIA 1O1NB 1B86A 1J40A 1PBXA 2ZSOA 2R80B 4ROLA 3UHIA 3RJ6A 1CH9A 3G4WA 2MGGA 1RVWB 3AQ5A 2M6ZB 2D2MB 2VLXA 3WCTD 3R0GA 2Z6SA 3M3BA 3PI4A 1J40B 1CIOA 109MA 3VAUA 1J7SB 4WJG1 4M4BB 1HDAB 2MGLA 3WCWA 2WTHA 1YHEA 2MYCA 1ABWA 1LH3A 2D2NB 1YVTA 3OGBA 5E6EA 3WFTA 5AZQA 1X46A 2BK9A 5EUIB 2MBWA 1ABYB 3SDNA 4XS0A 2MHBA 1HDAA 2GTLC 2G0RA 2ZSRA 3PI3A 3VRFA 4KJTA 2ZS1A 3MJPB 1JEBB 2GKNA 1BVDA 1MLUA 2HCOA 2SPMA 1UFPA 1YEVA 1EBCA 3QJEB 2PEGB 7HBIA 1Y4PA 1F5PA 1Y31A 4C0NA 2ZS0A 1Y4BB 2ZLVB 1DWSA 3D17A 2VEBA 3UHWA 1HHOA 4MQKA 1Y5JB 1A6KA 2Z6NB 106MA 2NSRA 2D2MD 4MQGB 1FDHG 3WTGA 3E55A 2ZSTA 2SPNA 3QM7A 4FWYA 2FRIX 1CLSB 1Q1FA 1YHUA 1LFLB 1NQPB 1GVHA 3BCQA 4DC7A 3A5GA 3PT7B 1HGBA 2D2ND 4U8UD 3GDJA 1MNJA 3OZUA 1YIEA 4JACA 1O1LA 1DWTA 1YCAA 1O1IA 1J3FA 3UBVA 3OVUC 1LUEA 2ZWJA 2ZFBB 3WCVC 1HHOB 3K9ZA 3PT7A 1Y4RA 3WCUA 2MGKA 3CY5A 4IT8A 1HBRB 4SDHA 1LTWA 1HDSB 1HBAB 5JDOD 1MBIA 1DXDA 3OK5A 3PI8A 4PQ6A 3SZKA 5AB8A 2QSPA 1LHSA 1MWDA 4HHBB 1FAWA 2ZFOD 1G0AB 1MOCA 1HGAB 1BVCA 103MA 3R5IB 4FH6A 4N7PB 1MLMA 1YE0B 1IOPA 1IWHB 1AJ9B 3D1KB 1A3NA 3MOUA 1XXTA 3EOKB 1KFRA 2OHBA 4N7OB 3UHSA 5ILEA 2O5OX 3BJ1A 1Y22B 1CP5A 3EDBA 1NPFA 1VXFA 1Z8UB 2G11A 4PQCA 2O5QX 3DR9A 3ED9A 1QXEB 1CIKA 1VWTA 2W72B 1XXTB 2G12A 1MYTA 5JGGB 2O5SX 1LFZB 2H35B 2G0XA 1GBUA 1YEUB 3TLDA 5HLQA 2HZ3A 3MYMA 1VXAA 3ZJSA 1MODA 1B86B 3UHDA 2D5XB 3K8BA 4XDIA 2O5LX 1C7CA 1A0UA 2D6CA 3MJUB 2GRHA 3DUTB 5JGGA 3WCWD 2SPOA 2ZLWA 3QM8A 3ZOMA 1HDSA 1IRDA 3HXNA 1AJGA 1HRMA 5CN5A 2O58X 2R80A 4ROLB 1LFTA 3G4QA 4YU4B 3QJBA 2ZFOC 1MLQA 1GLIB 2MGCA 3NL7A 3PIAA 5CNFA 1DUKA 1Y5FB 1O1PA 1CH3A 1FN3A 4ZVBA 2RAOB 3G4YA 2D2NC 104MA 3ONZA 1XYEB 2NRLA 1AJ9A 1IWHA 3MBAA 1VXEA 3S65B 1DXVA 1HBBA 1BBBA 1BZ0B 1BZPA 3UHHA 1Y5FA 1YE2A 1IRCA 1DXUB 1J7SA 1TESA 5ILMA 3AQ6A 2B7HB 2ZSYA 2BLHA 2D5ZA 3BOMA 4KN3A 1HACB 1OR6A 4UZVA 1IBEB 2VYZA 2IN4A 5EE4D 3WCUB 3CY5B 1HCOA 4N8TB 2KSCA 1Y4BA 3OZVA 1ASHA 3BJ2A 4M4BA 2MGMA 4PQBA 4BJAA 4WCHD 2HBSA 2ZT4A 1RQAA 4O2GA 4X0LA 1L2KA 3A0GB 1HABA 1DUOA 3H57A 2R4XA 2DHBB 3UHUA 3QZXA 3EU1B 1R1YB 1VREA 1U7SA 1Y0AA 2MGAA 4FWXA 4DWUA 1DXTA 5HY8A 1DXCA 1O1JA 2EVPA 5EYJA 1C7BB 4MXKA 2BMMA 3S1JA 1QXDA 3WCTB 2GTLD 2AURA 3ECXA 4MAXA 3MJUA 4U8UA 2ZS0C 1X9FA 2VLYA 1XZUA 3QQRA 2DN2A 3AT5B 2YRSB 2MGHA 1UVXA 2GRFA 2VLZA 5SW7A 4YU3B 1MNOA 1S5XA 1O1NA 3RJNB 1ITHA 1XQ5B 3U3EA 1IT3A 1A00B 3VRGA 3BOMB 3OO4A 2D5ZB 5CMVA 2D5XA 3V2ZA 1Y4FA 1JF4A 1NZ2A 1MBNA 1UC3A 3GQPA 1O1KA 4WJGA 3VHBA 2MYBA 5HU6B 1Y4RB 4U8UB 5CNBA 2V1EA 3TM3A 2SPLA 1Y0DB 1QSHA 4PNJA 1QXEA 4MQJB 1G08B 1LA6B 5HY8B 4MBAA 2GL3A 1RTXA 1OFKA 3R5IA 1FN3B 1Y46A 3GDJB 1C40A 3VREB 5HAVA 1KD2B 3ZHWA 1YHRA 2H8DB 4XS0B 2BNLA 3AT6B 1J3ZB 3DHRB 4HBIA 3ZJMA 1RVWA 4F68A 1S5YA 2WY4A 1NS9B 1JP6A 5EETA 1F63A 1Y45B 2LH7A 1J41A 2R4ZA 2OH9A 3LR7A 1LH1A 1SPGA 1Y4FB 2ZT3A 1GDIA 2W6VA 1Y0CB 1Y5KB 1DXTB 1WLAA 1MBAA 2MGBA 3ONZB 1MKOA 2IG3A 2VYYA 4NI0A 1HGAA 4F69A 1FHJA 5EU2A 2DC3A 3UH3A 1O1MA 1Y4GA 1Y22A 1CO9A 1BZ1B 1NAZA 1LFLA 1NQPA 3BA2A 2D60A 2Z8AA 1VXGA 4OF9A 3GLNA 1D8UA 3SDHA 1Y0DA 1DKEA 1V4WB 1Y7GA 1SI4B 1F5OA 2ZLUB 4NZIA 1YVQA 2GDMA 1SPGB 1GCWB 2AA1B 2Z6TA 2ZS0B 5B84A 4H2LA 1S61A 3D7OA 2ZSQA 1HGCA 1WVPA 3ZH0A 1MDNA 2O5TX 5JDOE 2LH2A 3K3UA 3ARJA 5JDOC 3NFEA 3S48C 3ECLA 5E29B 1MYHA 1CG8B 5D5RA 3WR1B 1V4UA 3HHBA 1BJEA 5HLUA 1Y4GB 1RQ3B 1MZ0A 5JDOF 5IKSA 5SW7B 3KUNA 1Y85B 4MPMA 4MQHA 1DO1A 1PBXB 3UHXA 5HBIA 2HBFA 1LFQA 1A6GA 2MGEA 111MA 1HJTA 1R1XA 2RAOA 4ROMA 1UIWB 5CHRA 5EE4C 1YGFB 4KMVA 1LFYB 3ARLA 2D60B 1LH6A 1G0BA 3KMFC 1XZ4A 1YEOB 3NMMA 1U7RA 1MKOB 1O1KB 2O5BX 1BBBB 2O5MX 1FHJB 1MNHA 3O89A 3HRWA 1RQ3A 1OUTB 1V75B 1WMUA 2HBSB 4MQHB 1Y4VB 2FALA 1C7CB 5AZRA 5CN4A 3HF4A 2W6WA 2XKGA 3UHRA 1EWAA 1MTKA 3NG6B 1S0HA 3WCUD 1A3OB 3GYSA 5CN9A 2HZ1A 2NSSA 2DXMA 4N7NA 1GBVB 1OUTA 4NI1A 2MB5A 2OH8A 2PGHB 5E6EB 3ZJQA 1IT2A 1BUWB 1Y8HA 1Y7CB 2HBDB 2GTLB 3H58A 1JPBA 2HHEB 1DM1A 1GDLA 1S0HB 3MJPA 1YOIA 1HV4B 1S6AA 1UX9A 2HHDA 2AUPA 3UGYA 1Y0TB 1C7DA 1VRFA 1YHUD 1NEJB 1RPSB 3OJ1A 3GKVB 3DHRA 2W72C 4MBNA 3ZJLA 4MQKB 4L7YB 1MOBA 1Y46B 3ZJIA 1V5HA 2XKIA 1MGNA 2H8FA 1Y4VA 2G3HA 2D2MA 1MLOA 2ZLTB 2GKMA 1YIHA 2MGFA 3PI2A 2EKUA 3HEOA 3HXNB 1URYA 1H97A 2ZS1D 5CNDA 4MU5A 1XY0A 3IC0B 1JL6A 1JF3A 4HRRA 1DO4A 1V4XB 5C6EB 1LFQB 3AT5A 3AG0A 1OFJA 3A9MA 1HBHB 1QSIA 4ZVAA 1Y31B 3RGKA 1HACA 1YGFA 1DWRA 1S5YB 2MGJA 1FLPA 1BIJA 3V2VA 3M39A 3PELB 2OHAA 1GZXA 3E5OA 3KUOA 2M6ZA 1FDHA 2BLJM 5CN6A 1BZ1A 2HZ2A 1Y35A 2MYDA 1QSHB 3BJ3B 1J3ZA 108MA 2ZS1C 1MLHA 1HBBB 1G9VA 1Y4QB 3BCQB 2HHEA 1Y8WA 1YENB 1MCYA 1HABB 1Y8HB 2HBDA 4F6GA 3WI8A 3GKVA 3PIAB 1YDZB 5CNEA 1GZXB 4NK1A 1DLWA 5M3SA 1COHB 1Y8IB 1J7WB 3WCTC 1Y35B 2ZT0A 4H07A 3FH9A 4F6FA 2WTGA 2W31A 1Y45A 3WCPA 3S65A 5KKKA 1XZUB 3D4XA 1A6MA 3UGZA 1Y7DB 3S1IA 1YFFB 3B75A 4UURA 2ZLTA 3HEPA 2BW9M 1S5XB 1CPWA 4O4ZA 1YCBA 2BKMA 3GKTA 3D17B 5E83B 1AJHA 2QU0A 3ZJHA 1YEOA 4MQJA 4N7OA 1G08A 2V1IA 5HLXA 2AUQA 1AZIA 4AVEA 1XZVB 4HSWA 3LB2A 1Y8KB 105MA 3GQRB 1YGDA 2Z6NA 2C0KA 1VXHA 1HBSB 4UIQA 5KDQA 1YHEB 2QSSB 5MBNA 4KMWA 1NS6B 1MLSA 1Y4PB 110MA 2EB9A 1YEUA 1XZ5A 1CH2A 1CMYB 1JL7A 1LFVB 1Y09B 1UFJA 1URVA 2XKHA 1ABYA 2LH5A 1XQ5A 1J3YA 1F65A 4TWUA 4MQGA 4HRTA 3EDAA 2NX0A 3W4UA 1V9QA 3WFUA 1BABB 3PT8B 3BJ1B 2DN1A 1X9FB 3UHGA 3FH9B 1J52A 3NG6A 1V75A 2QLSA 1YGDB 3QZZA 3ODQA 2DN3A 1DLYA 1XY0B 2NRMA 1YEVB 1VXBA 1RTEA 3UH6A 2ZLWB 3WCVD 1XCHA 1XZ7A 1OBMA 1YG5B 2G0ZA 1FCSA 2DXMB 1O1MB 1HDBA 1YEQB 3CIUB 2ZFBA 3GK9A 3VREA 3HC9A 3UHEA 3NMLA 2EB8A 2V1KA 3MKBA 1MYMA 1BUWA 3MVCA 2MYEA 2AUOA 4NXAA 4YU3A 5EUIA 4NI1B 1C7DB 1V07A 3FS4A 3HYUB 4DC8A 1J41B 1GCVA 3D1AA 1TU9A 4B3WA 2GTLA 1JZKA 4F6IA 1LFTB 2G14A 1BZ6A 5CN8A 4F6JA 1YOHA 3ZJPA 3M38A 1N9FA 5KERB 1J3YB 1O16A 4FC3B 1GCVB 1O1OA 2JHOA 3W4UB 3WCPB 1ECOA 2RI4A 1CO8A 1MTJA 2QSSA 1VWTB 2G10A 2W72A 3ZOLA 1DKEB 1Y7GB 3GQGA 4MQIA 3G4RA 1YHRB 3HENA 3QJCA 1C7BA 1BZZB 3G52A 2VM0A 1HCOB 1SDLB 4H0BA 4N7PA 3LHBA 2D2MC 1YHUC 1CLSA 2Z85A 1Y8WB 1YENA 1T1NA 3LQDA 1K0YA 1NS9A 3M3AA 1CH5A 3TM9A 1JZMA 3S66B 1JW8A 4G51B 1I3DA 5EQMA 2HCOB 1JWNA 1THBB 4MQIB 3ZJJA 4X0LB 3P5QB 1LH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEL A;  1Y7D A;  1A3O A;  2DN3 B;  4G1V A;  3UHQ A;  3LB4 A;  4C44 A;  1Y85 A;  1CG5 B;  1JY7 B;  3WCV A;  1G0A A;  1HGB B;  112M A;  3OO5 B;  1RQ4 B;  3OO4 B;  3NL7 B;  2V1H A;  5KER A;  1WMU B;  3WCU C;  3D1A B;  3WHM A;  1KR7 A;  5ILP A;  4F4O A;  3UH5 A;  2HHB B;  4M4A A;  3MN0 A;  3QJD B;  3AQ8 A;  1J7Y A;  3IC0 A;  3GOU B;  1YH9 B;  1CH7 A;  5CNC A;  1MNK A;  1Y01 B;  3ORD A;  1T1N B;  5EV5 A;  3NMM B;  2H8D A;  3A5A A;  3UHK A;  3QJC B;  1DXV B;  1NS6 A;  1MBS A;  2ZLU A;  1A01 B;  2R1H A;  1IRD B;  1MOA A;  1MYJ A;  1MLK A;  4U8U C;  1YG5 A;  1MWC A;  1LFZ A;  2H35 A;  1YZI A;  1M6C A;  2FRK X;  3D4X B;  2W6V B;  1MLL A;  2EKT A;  3AT6 A;  1NZ3 A;  1Y2Z A;  1YIE B;  1FAW B;  2E2Y A;  1JP9 A;  3QMA A;  4FH7 A;  2G0V A;  3O7N A;  4N8T A;  5D1V A;  1HBS A;  4YU4 A;  5EYS A;  3WTG B;  1V4X A;  3UHY A;  4G51 A;  2QMB A;  1A4F B;  3ODQ B;  3QM6 A;  1QSI B;  1HBG A;  1YIH B;  3QM5 A;  4MQC A;  1YE2 B;  3ASE A;  1BAB A;  1S69 A;  3PT8 A;  3ZJO A;  2DHB A;  3AQ9 A;  3HF4 B;  1CG5 A;  4HRT B;  3PI9 A;  2PEG A;  3UH7 A;  2W6Y A;  1MYG A;  2W6X A;  4AVD A;  1XYE A;  1A0Z A;  1A00 A;  4B4Y A;  1CMY A;  3A59 B;  1ECD A;  1XZV A;  2CMM A;  6HBW A;  3S66 A;  3UI0 A;  2ZS1 B;  3BJ2 B;  4G1B A;  4NI0 B;  4HHB A;  2ZFO A;  3ZJN A;  1IDR A;  1JP8 A;  3WCW B;  1GLI A;  1XZ7 B;  1G9V B;  1Y4Q A;  3WR1 A;  1QPW A;  1JDO A;  1MLG A;  3GQR A;  1MYZ A;  3A0G A;  5CN7 A;  4DWT A;  2QRW A;  1Y83 A;  2QLS B;  3GQG B;  1NPG A;  2ZSP A;  1G09 B;  101M A;  4NXC A;  3MKB B;  2R50 A;  3K8B B;  2MGD A;  1GCW A;  2XYK A;  1LJW A;  2ZSX A;  1LHT A;  1HLB A;  2MYA A;  1YMB A;  1OJ6 A;  5MBA A;  3G4U A;  3LB1 A;  4L2M A;  2G0S A;  1NWN A;  4TYX A;  4MQC B;  3P5Q A;  4O35 A;  1MLF A;  1GDJ A;  1N9H A;  1QI8 A;  1YMC A;  3WCV B;  3QQQ A;  2ZT2 A;  2ZLV A;  1MLR A;  3UHC A;  3HYU A;  3ECZ A;  1DTM A;  3UBC A;  1Y8K A;  1DTI A;  1YH9 A;  1SI4 A;  1EMY A;  1J7Y B;  2EVK A;  1Y8I A;  1NZ4 A;  1K0Y B;  5ILR A;  1MLJ A;  1YMA A;  1UIW A;  2QU0 B;  1A0Z B;  1NIH B;  1CQX A;  3D1K A;  2ZLX B;  1XZ5 B;  2HBC A;  1Y7C A;  2BWH A;  2VRY A;  3QJB B;  1NXF A;  1GDK A;  1SHR B;  1A9W A;  3QJE A;  1QI8 B;  1Y0W B;  3IC2 A;  4IRO A;  2FAM A;  4LPI A;  2GRZ A;  5B85 A;  1SDK B;  1RQA B;  4F4O B;  3E5I A;  3UHB A;  3QJD A;  3LQD B;  1KD2 A;  2ZSZ A;  2GNV A;  1C40 B;  2VYW A;  1HV4 A;  2HHD B;  4H2L B;  1MLN A;  1X9F C;  3GQP B;  1HLM A;  2GLN A;  3OO5 A;  4MXL A;  1OUU B;  1YVQ B;  1EBT A;  4ESA A;  3EOK A;  5E29 A;  3IXF A;  4OOD A;  1QXD B;  2B7H A;  3ARK A;  1MTI A;  1XZ2 B;  1RSE A;  2HHB A;  1FSX B;  3G46 A;  4L7Y A;  1R1Y A;  1Y0W A;  1K1K B;  3IC2 B;  1HSY A;  1VHB A;  1LH2 A;  2YRS A;  1SPE A;  1Y2Z B;  3VRF B;  1DO3 A;  1YHU B;  2QFN A;  4TWV A;  1X9F D;  2AV0 A;  2ZLX A;  2LH6 A;  3WCW C;  2V1G A;  4GZG A;  2HBE B;  1A3N B;  1Y0C A;  1Y5K A;  1GBU B;  5EOH A;  3NFE B;  102M A;  1NZ5 A;  1THB A;  1NWI A;  3LB3 A;  4F6D A;  1HBI A;  4O4T A;  1O1J B;  1DO7 A;  1M9P A;  1YVT B;  1FSL A;  2DN1 B;  1N9X A;  1CP0 A;  1Y7Z A;  5CHQ A;  4HRR B;  3EU1 A;  2FRJ X;  5C6E A;  107M A;  1JY7 A;  3UHZ A;  4F6B A;  2PGH A;  2VEE A;  1Y83 B;  3DHT B;  4VHB A;  1HBR A;  2HBG A;  1DXU A;  1BZR A;  3MYN A;  3D7O B;  5C6Y A;  2FRF A;  1JEB A;  1RQ4 A;  3CIU A;  2OLP A;  1LJW B;  1V4W A;  1NIH A;  1CBM A;  2MHB B;  4FC3 A;  1EW6 A;  2EF2 A;  5KDQ B;  6HBI A;  1BZZ A;  1MBO A;  1LA6 A;  4ESA B;  1MBC A;  3HRW B;  1QPW B;  1MNI A;  5HU6 A;  1MWB A;  2HBE A;  3G53 A;  1UMO A;  1H1X A;  2ZSS A;  2QFK A;  3G4V A;  2ZFO B;  5E83 A;  1JZL A;  3A5B A;  4ROM B;  3OZW A;  5F2A A;  1YZI B;  2GNW A;  4QAU A;  1RPS A;  4N7N B;  1Y5J A;  1GBV A;  3HHB B;  1V4U B;  1A0U B;  2HBF B;  1SHR A;  1ABS A;  2MGI A;  2ZSN A;  5F0B A;  1BZ0 A;  3UHT A;  2RI4 B;  2OIF A;  5CNG A;  1YOG A;  1MBD A;  1CQ2 A;  1FSX A;  1CH1 A;  2AA1 A;  1G09 A;  1SDK A;  5JOM A;  1Y09 A;  1CBL A;  2QMB B;  1MYF A;  3UHV A;  2ZS0 D;  3DHT A;  3LR9 A;  3DUT A;  4M4A B;  1O1P B;  1O1I B;  2R4W A;  1Y0A B;  1SDL A;  1ECA A;  1VXC A;  2V1J A;  1YDZ A;  4FWZ A;  1XZ4 B;  1W92 A;  3GYS B;  2VHB A;  1SWM A;  2HBC B;  3WCT A;  3IA3 B;  1S56 A;  4ILZ A;  3A59 A;  1ABW B;  1LFV A;  1A01 A;  2R1H B;  2R4Y A;  1A6N A;  2ZT1 A;  1N9I A;  1Y0T A;  4NS2 A;  3SZK B;  3KMF A;  2QSP B;  1G0B B;  1IBE A;  1X3K A;  3WFW A;  2V1F A;  2BLI A;  1ECN A;  1COH A;  1BIJ B;  3ZJR A;  2LHB A;  1UVY A;  3GOU A;  2LH3 A;  1YE0 A;  1OR4 A;  2DN2 B;  4IRO B;  1Y7Z B;  2H8F B;  3AQ7 A;  1BIN A;  1A4F A;  1GJN A;  1CH4 A;  4O1T A;  3PI8 B;  3UHN A;  1VXD A;  4ODC B;  1LH7 A;  3A2G A;  1NEJ A;  3VRG B;  3WFX A;  1O1L B;  1M6M A;  1CG8 A;  1J7W A;  1B0B A;  3PI9 B;  1A9W E;  1UT0 A;  1HBH A;  3PI1 A;  1K1K A;  1HDB B;  1YEQ A;  1HGC B;  1O1O B;  4HSX A;  3E4N A;  6HBW B;  1NGK A;  1PMB A;  1M9P B;  3FS4 B;  1XZ2 A;  1MOH A;  4ODC A;  2LH1 A;  1LFY A;  1UX8 A;  3BJ3 A;  4NK2 A;  2AV3 A;  1HBA A;  1OUU A;  2D2N A;  1I3E A;  1R1X B;  1YFF A;  3B75 B;  3WHM B;  3QM9 A;  4JYQ A;  1MYI A;  1O1N B;  1B86 A;  1J40 A;  1PBX A;  2ZSO A;  2R80 B;  4ROL A;  3UHI A;  3RJ6 A;  1CH9 A;  3G4W A;  2MGG A;  1RVW B;  3AQ5 A;  2M6Z B;  2D2M B;  2VLX A;  3WCT D;  3R0G A;  2Z6S A;  3M3B A;  3PI4 A;  1J40 B;  1CIO A;  109M A;  3VAU A;  1J7S B;  4WJG 1;  4M4B B;  1HDA B;  2MGL A;  3WCW A;  2WTH A;  1YHE A;  2MYC A;  1ABW A;  1LH3 A;  2D2N B;  1YVT A;  3OGB A;  5E6E A;  3WFT A;  5AZQ A;  1X46 A;  2BK9 A;  5EUI B;  2MBW A;  1ABY B;  3SDN A;  4XS0 A;  2MHB A;  1HDA A;  2GTL C;  2G0R A;  2ZSR A;  3PI3 A;  3VRF A;  4KJT A;  2ZS1 A;  3MJP B;  1JEB B;  2GKN A;  1BVD A;  1MLU A;  2HCO A;  2SPM A;  1UFP A;  1YEV A;  1EBC A;  3QJE B;  2PEG B;  7HBI A;  1Y4P A;  1F5P A;  1Y31 A;  4C0N A;  2ZS0 A;  1Y4B B;  2ZLV B;  1DWS A;  3D17 A;  2VEB A;  3UHW A;  1HHO A;  4MQK A;  1Y5J B;  1A6K A;  2Z6N B;  106M A;  2NSR A;  2D2M D;  4MQG B;  1FDH G;  3WTG A;  3E55 A;  2ZST A;  2SPN A;  3QM7 A;  4FWY A;  2FRI X;  1CLS B;  1Q1F A;  1YHU A;  1LFL B;  1NQP B;  1GVH A;  3BCQ A;  4DC7 A;  3A5G A;  3PT7 B;  1HGB A;  2D2N D;  4U8U D;  3GDJ A;  1MNJ A;  3OZU A;  1YIE A;  4JAC A;  1O1L A;  1DWT A;  1YCA A;  1O1I A;  1J3F A;  3UBV A;  3OVU C;  1LUE A;  2ZWJ A;  2ZFB B;  3WCV C;  1HHO B;  3K9Z A;  3PT7 A;  1Y4R A;  3WCU A;  2MGK A;  3CY5 A;  4IT8 A;  1HBR B;  4SDH A;  1LTW A;  1HDS B;  1HBA B;  5JDO D;  1MBI A;  1DXD A;  3OK5 A;  3PI8 A;  4PQ6 A;  3SZK A;  5AB8 A;  2QSP A;  1LHS A;  1MWD A;  4HHB B;  1FAW A;  2ZFO D;  1G0A B;  1MOC A;  1HGA B;  1BVC A;  103M A;  3R5I B;  4FH6 A;  4N7P B;  1MLM A;  1YE0 B;  1IOP A;  1IWH B;  1AJ9 B;  3D1K B;  1A3N A;  3MOU A;  1XXT A;  3EOK B;  1KFR A;  2OHB A;  4N7O B;  3UHS A;  5ILE A;  2O5O X;  3BJ1 A;  1Y22 B;  1CP5 A;  3EDB A;  1NPF A;  1VXF A;  1Z8U B;  2G11 A;  4PQC A;  2O5Q X;  3DR9 A;  3ED9 A;  1QXE B;  1CIK A;  1VWT A;  2W72 B;  1XXT B;  2G12 A;  1MYT A;  5JGG B;  2O5S X;  1LFZ B;  2H35 B;  2G0X A;  1GBU A;  1YEU B;  3TLD A;  5HLQ A;  2HZ3 A;  3MYM A;  1VXA A;  3ZJS A;  1MOD A;  1B86 B;  3UHD A;  2D5X B;  3K8B A;  4XDI A;  2O5L X;  1C7C A;  1A0U A;  2D6C A;  3MJU B;  2GRH A;  3DUT B;  5JGG A;  3WCW D;  2SPO A;  2ZLW A;  3QM8 A;  3ZOM A;  1HDS A;  1IRD A;  3HXN A;  1AJG A;  1HRM A;  5CN5 A;  2O58 X;  2R80 A;  4ROL B;  1LFT A;  3G4Q A;  4YU4 B;  3QJB A;  2ZFO C;  1MLQ A;  1GLI B;  2MGC A;  3NL7 A;  3PIA A;  5CNF A;  1DUK A;  1Y5F B;  1O1P A;  1CH3 A;  1FN3 A;  4ZVB A;  2RAO B;  3G4Y A;  2D2N C;  104M A;  3ONZ A;  1XYE B;  2NRL A;  1AJ9 A;  1IWH A;  3MBA A;  1VXE A;  3S65 B;  1DXV A;  1HBB A;  1BBB A;  1BZ0 B;  1BZP A;  3UHH A;  1Y5F A;  1YE2 A;  1IRC A;  1DXU B;  1J7S A;  1TES A;  5ILM A;  3AQ6 A;  2B7H B;  2ZSY A;  2BLH A;  2D5Z A;  3BOM A;  4KN3 A;  1HAC B;  1OR6 A;  4UZV A;  1IBE B;  2VYZ A;  2IN4 A;  5EE4 D;  3WCU B;  3CY5 B;  1HCO A;  4N8T B;  2KSC A;  1Y4B A;  3OZV A;  1ASH A;  3BJ2 A;  4M4B A;  2MGM A;  4PQB A;  4BJA A;  4WCH D;  2HBS A;  2ZT4 A;  1RQA A;  4O2G A;  4X0L A;  1L2K A;  3A0G B;  1HAB A;  1DUO A;  3H57 A;  2R4X A;  2DHB B;  3UHU A;  3QZX A;  3EU1 B;  1R1Y B;  1VRE A;  1U7S A;  1Y0A A;  2MGA A;  4FWX A;  4DWU A;  1DXT A;  5HY8 A;  1DXC A;  1O1J A;  2EVP A;  5EYJ A;  1C7B B;  4MXK A;  2BMM A;  3S1J A;  1QXD A;  3WCT B;  2GTL D;  2AUR A;  3ECX A;  4MAX A;  3MJU A;  4U8U A;  2ZS0 C;  1X9F A;  2VLY A;  1XZU A;  3QQR A;  2DN2 A;  3AT5 B;  2YRS B;  2MGH A;  1UVX A;  2GRF A;  2VLZ A;  5SW7 A;  4YU3 B;  1MNO A;  1S5X A;  1O1N A;  3RJN B;  1ITH A;  1XQ5 B;  3U3E A;  1IT3 A;  1A00 B;  3VRG A;  3BOM B;  3OO4 A;  2D5Z B;  5CMV A;  2D5X A;  3V2Z A;  1Y4F A;  1JF4 A;  1NZ2 A;  1MBN A;  1UC3 A;  3GQP A;  1O1K A;  4WJG A;  3VHB A;  2MYB A;  5HU6 B;  1Y4R B;  4U8U B;  5CNB A;  2V1E A;  3TM3 A;  2SPL A;  1Y0D B;  1QSH A;  4PNJ A;  1QXE A;  4MQJ B;  1G08 B;  1LA6 B;  5HY8 B;  4MBA A;  2GL3 A;  1RTX A;  1OFK A;  3R5I A;  1FN3 B;  1Y46 A;  3GDJ B;  1C40 A;  3VRE B;  5HAV A;  1KD2 B;  3ZHW A;  1YHR A;  2H8D B;  4XS0 B;  2BNL A;  3AT6 B;  1J3Z B;  3DHR B;  4HBI A;  3ZJM A;  1RVW A;  4F68 A;  1S5Y A;  2WY4 A;  1NS9 B;  1JP6 A;  5EET A;  1F63 A;  1Y45 B;  2LH7 A;  1J41 A;  2R4Z A;  2OH9 A;  3LR7 A;  1LH1 A;  1SPG A;  1Y4F B;  2ZT3 A;  1GDI A;  2W6V A;  1Y0C B;  1Y5K B;  1DXT B;  1WLA A;  1MBA A;  2MGB A;  3ONZ B;  1MKO A;  2IG3 A;  2VYY A;  4NI0 A;  1HGA A;  4F69 A;  1FHJ A;  5EU2 A;  2DC3 A;  3UH3 A;  1O1M A;  1Y4G A;  1Y22 A;  1CO9 A;  1BZ1 B;  1NAZ A;  1LFL A;  1NQP A;  3BA2 A;  2D60 A;  2Z8A A;  1VXG A;  4OF9 A;  3GLN A;  1D8U A;  3SDH A;  1Y0D A;  1DKE A;  1V4W B;  1Y7G A;  1SI4 B;  1F5O A;  2ZLU B;  4NZI A;  1YVQ A;  2GDM A;  1SPG B;  1GCW B;  2AA1 B;  2Z6T A;  2ZS0 B;  5B84 A;  4H2L A;  1S61 A;  3D7O A;  2ZSQ A;  1HGC A;  1WVP A;  3ZH0 A;  1MDN A;  2O5T X;  5JDO E;  2LH2 A;  3K3U A;  3ARJ A;  5JDO C;  3NFE A;  3S48 C;  3ECL A;  5E29 B;  1MYH A;  1CG8 B;  5D5R A;  3WR1 B;  1V4U A;  3HHB A;  1BJE A;  5HLU A;  1Y4G B;  1RQ3 B;  1MZ0 A;  5JDO F;  5IKS A;  5SW7 B;  3KUN A;  1Y85 B;  4MPM A;  4MQH A;  1DO1 A;  1PBX B;  3UHX A;  5HBI A;  2HBF A;  1LFQ A;  1A6G A;  2MGE A;  111M A;  1HJT A;  1R1X A;  2RAO A;  4ROM A;  1UIW B;  5CHR A;  5EE4 C;  1YGF B;  4KMV A;  1LFY B;  3ARL A;  2D60 B;  1LH6 A;  1G0B A;  3KMF C;  1XZ4 A;  1YEO B;  3NMM A;  1U7R A;  1MKO B;  1O1K B;  2O5B X;  1BBB B;  2O5M X;  1FHJ B;  1MNH A;  3O89 A;  3HRW A;  1RQ3 A;  1OUT B;  1V75 B;  1WMU A;  2HBS B;  4MQH B;  1Y4V B;  2FAL A;  1C7C B;  5AZR A;  5CN4 A;  3HF4 A;  2W6W A;  2XKG A;  3UHR A;  1EWA A;  1MTK A;  3NG6 B;  1S0H A;  3WCU D;  1A3O B;  3GYS A;  5CN9 A;  2HZ1 A;  2NSS A;  2DXM A;  4N7N A;  1GBV B;  1OUT A;  4NI1 A;  2MB5 A;  2OH8 A;  2PGH B;  5E6E B;  3ZJQ A;  1IT2 A;  1BUW B;  1Y8H A;  1Y7C B;  2HBD B;  2GTL B;  3H58 A;  1JPB A;  2HHE B;  1DM1 A;  1GDL A;  1S0H B;  3MJP A;  1YOI A;  1HV4 B;  1S6A A;  1UX9 A;  2HHD A;  2AUP A;  3UGY A;  1Y0T B;  1C7D A;  1VRF A;  1YHU D;  1NEJ B;  1RPS B;  3OJ1 A;  3GKV B;  3DHR A;  2W72 C;  4MBN A;  3ZJL A;  4MQK B;  4L7Y B;  1MOB A;  1Y46 B;  3ZJI A;  1V5H A;  2XKI A;  1MGN A;  2H8F A;  1Y4V A;  2G3H A;  2D2M A;  1MLO A;  2ZLT B;  2GKM A;  1YIH A;  2MGF A;  3PI2 A;  2EKU A;  3HEO A;  3HXN B;  1URY A;  1H97 A;  2ZS1 D;  5CND A;  4MU5 A;  1XY0 A;  3IC0 B;  1JL6 A;  1JF3 A;  4HRR A;  1DO4 A;  1V4X B;  5C6E B;  1LFQ B;  3AT5 A;  3AG0 A;  1OFJ A;  3A9M A;  1HBH B;  1QSI A;  4ZVA A;  1Y31 B;  3RGK A;  1HAC A;  1YGF A;  1DWR A;  1S5Y B;  2MGJ A;  1FLP A;  1BIJ A;  3V2V A;  3M39 A;  3PEL B;  2OHA A;  1GZX A;  3E5O A;  3KUO A;  2M6Z A;  1FDH A;  2BLJ M;  5CN6 A;  1BZ1 A;  2HZ2 A;  1Y35 A;  2MYD A;  1QSH B;  3BJ3 B;  1J3Z A;  108M A;  2ZS1 C;  1MLH A;  1HBB B;  1G9V A;  1Y4Q B;  3BCQ B;  2HHE A;  1Y8W A;  1YEN B;  1MCY A;  1HAB B;  1Y8H B;  2HBD A;  4F6G A;  3WI8 A;  3GKV A;  3PIA B;  1YDZ B;  5CNE A;  1GZX B;  4NK1 A;  1DLW A;  5M3S A;  1COH B;  1Y8I B;  1J7W B;  3WCT C;  1Y35 B;  2ZT0 A;  4H07 A;  3FH9 A;  4F6F A;  2WTG A;  2W31 A;  1Y45 A;  3WCP A;  3S65 A;  5KKK A;  1XZU B;  3D4X A;  1A6M A;  3UGZ A;  1Y7D B;  3S1I A;  1YFF B;  3B75 A;  4UUR A;  2ZLT A;  3HEP A;  2BW9 M;  1S5X B;  1CPW A;  4O4Z A;  1YCB A;  2BKM A;  3GKT A;  3D17 B;  5E83 B;  1AJH A;  2QU0 A;  3ZJH A;  1YEO A;  4MQJ A;  4N7O A;  1G08 A;  2V1I A;  5HLX A;  2AUQ A;  1AZI A;  4AVE A;  1XZV B;  4HSW A;  3LB2 A;  1Y8K B;  105M A;  3GQR B;  1YGD A;  2Z6N A;  2C0K A;  1VXH A;  1HBS B;  4UIQ A;  5KDQ A;  1YHE B;  2QSS B;  5MBN A;  4KMW A;  1NS6 B;  1MLS A;  1Y4P B;  110M A;  2EB9 A;  1YEU A;  1XZ5 A;  1CH2 A;  1CMY B;  1JL7 A;  1LFV B;  1Y09 B;  1UFJ A;  1URV A;  2XKH A;  1ABY A;  2LH5 A;  1XQ5 A;  1J3Y A;  1F65 A;  4TWU A;  4MQG A;  4HRT A;  3EDA A;  2NX0 A;  3W4U A;  1V9Q A;  3WFU A;  1BAB B;  3PT8 B;  3BJ1 B;  2DN1 A;  1X9F B;  3UHG A;  3FH9 B;  1J52 A;  3NG6 A;  1V75 A;  2QLS A;  1YGD B;  3QZZ A;  3ODQ A;  2DN3 A;  1DLY A;  1XY0 B;  2NRM A;  1YEV B;  1VXB A;  1RTE A;  3UH6 A;  2ZLW B;  3WCV D;  1XCH A;  1XZ7 A;  1OBM A;  1YG5 B;  2G0Z A;  1FCS A;  2DXM B;  1O1M B;  1HDB A;  1YEQ B;  3CIU B;  2ZFB A;  3GK9 A;  3VRE A;  3HC9 A;  3UHE A;  3NML A;  2EB8 A;  2V1K A;  3MKB A;  1MYM A;  1BUW A;  3MVC A;  2MYE A;  2AUO A;  4NXA A;  4YU3 A;  5EUI A;  4NI1 B;  1C7D B;  1V07 A;  3FS4 A;  3HYU B;  4DC8 A;  1J41 B;  1GCV A;  3D1A A;  1TU9 A;  4B3W A;  2GTL A;  1JZK A;  4F6I A;  1LFT B;  2G14 A;  1BZ6 A;  5CN8 A;  4F6J A;  1YOH A;  3ZJP A;  3M38 A;  1N9F A;  5KER B;  1J3Y B;  1O16 A;  4FC3 B;  1GCV B;  1O1O A;  2JHO A;  3W4U B;  3WCP B;  1ECO A;  2RI4 A;  1CO8 A;  1MTJ A;  2QSS A;  1VWT B;  2G10 A;  2W72 A;  3ZOL A;  1DKE B;  1Y7G B;  3GQG A;  4MQI A;  3G4R A;  1YHR B;  3HEN A;  3QJC A;  1C7B A;  1BZZ B;  3G52 A;  2VM0 A;  1HCO B;  1SDL B;  4H0B A;  4N7P A;  3LHB A;  2D2M C;  1YHU C;  1CLS A;  2Z85 A;  1Y8W B;  1YEN A;  1T1N A;  3LQD A;  1K0Y A;  1NS9 A;  3M3A A;  1CH5 A;  3TM9 A;  1JZM A;  3S66 B;  1JW8 A;  4G51 B;  1I3D A;  5EQM A;  2HCO B;  1JWN A;  1THB B;  4MQI B;  3ZJJ A;  4X0L B;  3P5Q B;  1LH5 A; 
#chains in the Genus database with same CATH topology
 3PEL A;  1Y7D A;  1A3O A;  2DN3 B;  4G1V A;  3UHQ A;  3LB4 A;  4C44 A;  1Y85 A;  1CG5 B;  1JY7 B;  3WCV A;  1G0A A;  1ON7 B;  1HGB B;  112M A;  3OO5 B;  1RQ4 B;  3OO4 B;  3NL7 B;  2V1H A;  5KER A;  1WMU B;  3WCU C;  3D1A B;  3WHM A;  1KR7 A;  5ILP A;  4F4O A;  3UH5 A;  2HHB B;  1B8D B;  4M4A A;  3MN0 A;  3QJD B;  3AQ8 A;  1J7Y A;  3IC0 A;  3GOU B;  1YH9 B;  1CH7 A;  5CNC A;  1MNK A;  2X4A A;  1Y01 B;  3ORD A;  1T1N B;  5EV5 A;  4LMX B;  1UVL A;  3NMM B;  2H8D A;  3A5A A;  3UHK A;  3QJC B;  1DXV B;  4F0U A;  1NS6 A;  1MBS A;  2ZLU A;  1A01 B;  2R1H A;  1IRD B;  4N6S A;  1MOA A;  1MYJ A;  1MLK A;  4U8U C;  1YG5 A;  4GXE B;  1MWC A;  1LFZ A;  2H35 A;  1YZI A;  1M6C A;  2FRK X;  3D4X B;  4A8W A;  2W6V B;  1MLL A;  2EKT A;  3AT6 A;  1NZ3 A;  1Y2Z A;  1YIE B;  2VML B;  1FAW B;  2E2Y A;  1JP9 A;  3QMA A;  4FH7 A;  1ALL B;  2G0V A;  3O18 A;  4L1E A;  2UUN B;  3O7N A;  4N8T A;  5D1V A;  1HBS A;  4Z8K B;  4YU4 A;  5EYS A;  3WTG B;  4ESU A;  1V4X A;  1F0L A;  3UHY A;  4G51 A;  2QMB A;  1A4F B;  3ODQ B;  3QM6 A;  1QSI B;  1HBG A;  1YIH B;  3QM5 A;  4MQC A;  1YE2 B;  3ASE A;  1BAB A;  1S69 A;  3PT8 A;  3ZJO A;  2DHB A;  3AQ9 A;  3HF4 B;  1CG5 A;  4ERT A;  4HRT B;  3PI9 A;  2PEG A;  3UH7 A;  2W6Y A;  1MYG A;  2W6X A;  4AVD A;  1XYE A;  1A0Z A;  1A00 A;  4B4Y A;  1CMY A;  3A59 B;  1ECD A;  1XZV A;  2CMM A;  6HBW A;  4L1E B;  3S66 A;  3UI0 A;  2ZS1 B;  3BJ2 B;  4G1B A;  4NI0 B;  4HHB A;  2ZFO A;  3ZJN A;  1IDR A;  1JP8 A;  3WCW B;  1GLI A;  1XZ7 B;  1G9V B;  1Y4Q A;  3WR1 A;  1QPW A;  1JDO A;  1MLG A;  2C7L A;  3GQR A;  1MYZ A;  3A0G A;  5CN7 A;  4DWT A;  2QRW A;  1Y83 A;  2QLS B;  3GQG B;  1NPG A;  2ZSP A;  1G09 B;  101M A;  1KTP A;  4NXC A;  3MKB B;  2R50 A;  3K8B B;  2MGD A;  1GCW A;  2XYK A;  1LJW A;  2ZSX A;  1LHT A;  1HLB A;  2MYA A;  1CPC A;  1YMB A;  1OJ6 A;  5MBA A;  3G4U A;  3LB1 A;  4L2M A;  2G0S A;  1NWN A;  4TYX A;  4MQC B;  3P5Q A;  4O35 A;  5B13 G;  1MLF A;  1GDJ A;  2DKD A;  1N9H A;  1QI8 A;  4Q70 A;  1YMC A;  3WCV B;  3QQQ A;  2ZT2 A;  2ZLV A;  3BRP A;  1MLR A;  3UHC A;  3HYU A;  3ECZ A;  1DTM A;  3UBC A;  1Y8K A;  1DTI A;  1YH9 A;  1SI4 A;  1EMY A;  1J7Y B;  2EVK A;  1Y8I A;  1NZ4 A;  1K0Y B;  5ILR A;  1MLJ A;  1YMA A;  1UIW A;  2QU0 B;  1A0Z B;  1NIH B;  1CQX A;  4Z8K A;  3D1K A;  2ZLX B;  1XZ5 B;  2HBC A;  1Y7C A;  2BWH A;  2VRY A;  3QJB B;  1NXF A;  1GDK A;  1NY9 A;  1SHR B;  1A9W A;  3QJE A;  1QI8 B;  1Y0W B;  3IC2 A;  4IRO A;  2FAM A;  4LPI A;  2GRZ A;  4BS9 A;  4TMA B;  5B85 A;  1SDK B;  1RQA B;  4F4O B;  3E5I A;  3UHB A;  3QJD A;  3LQD B;  1KD2 A;  2ZSZ A;  2GNV A;  1C40 B;  4LMS B;  2VYW A;  1HV4 A;  2HHD B;  4H2L B;  1MLN A;  1X9F C;  3GQP B;  1HLM A;  2GLN A;  3OO5 A;  4MXL A;  1OUU B;  1YVQ B;  1EBT A;  4ESA A;  3EOK A;  5E29 A;  3IXF A;  4OOD A;  1QXD B;  2B7H A;  3ARK A;  1MTI A;  1XZ2 B;  1RSE A;  2HHB A;  1FSX B;  3G46 A;  4L7Y A;  1R1Y A;  1Y0W A;  1K1K B;  3IC2 B;  1HSY A;  1VHB A;  1LH2 A;  2VJH B;  1HI1 A;  2YRS A;  1SPE A;  1Y2Z B;  3VRF B;  1DO3 A;  1YHU B;  2QFN A;  4TWV A;  1X9F D;  2AV0 A;  2ZLX A;  3LQ9 A;  2LH6 A;  3WCW C;  2V1G A;  4GZG A;  2HBE B;  1A3N B;  1Y0C A;  1Y5K A;  1GBU B;  5EOH A;  3NFE B;  1UVJ A;  102M A;  1NZ5 A;  1THB A;  1NWI A;  3LB3 A;  4F6D A;  1HBI A;  4O4T A;  4H0M A;  1O1J B;  1DO7 A;  1M9P A;  1YVT B;  1FSL A;  2DN1 B;  1N9X A;  1CP0 A;  1Y7Z A;  4A8K A;  5CHQ A;  4HRR B;  3EU1 A;  2FRJ X;  5C6E A;  107M A;  1JY7 A;  3UHZ A;  1HA7 B;  2PGH A;  4F6B A;  2VEE A;  1Y83 B;  3DHT B;  4VHB A;  1HBR A;  2HBG A;  1DXU A;  1BZR A;  3MYN A;  2UUL B;  3D7O B;  5C6Y A;  2FRF A;  3RQR A;  1JEB A;  1CPC B;  1RQ4 A;  3CIU A;  2OLP A;  1LJW B;  5FVB A;  1V4W A;  1NIH A;  2JL9 A;  1CBM A;  2MHB B;  4FC3 A;  1EW6 A;  2EF2 A;  5KDQ B;  6HBI A;  1BZZ A;  3NUH B;  1MBO A;  1LA6 A;  4ESA B;  1XDT T;  1MBC A;  3HRW B;  1QPW B;  1MNI A;  2C7L B;  5HU6 A;  1MWB A;  2HBE A;  3G53 A;  3BRP B;  1UMO A;  1H1X A;  2ZSS A;  2QFK A;  3G4V A;  2ZFO B;  5E83 A;  1F99 A;  1JZL A;  3A5B A;  4ROM B;  3OZW A;  4AE0 A;  5F2A A;  1YZI B;  2GNW A;  4QAU A;  1RPS A;  4N7N B;  1Y5J A;  1GBV A;  3HHB B;  1V4U B;  4ZIZ B;  1A0U B;  4A8O A;  2HBF B;  1SHR A;  1COL A;  1ABS A;  2MGI A;  2ZSN A;  5F0B A;  1BZ0 A;  3UHT A;  2RI4 B;  2OIF A;  5CNG A;  1YOG A;  1MBD A;  1CQ2 A;  1SGK A;  1HHS A;  1KTP B;  1FSX A;  1CH1 A;  2AA1 A;  1G09 A;  1SDK A;  5JOM A;  2JLF A;  1Y09 A;  1CBL A;  2QMB B;  1MYF A;  3UHV A;  2ZS0 D;  3DHT A;  3LR9 A;  3DUT A;  4M4A B;  1O1P B;  1O1I B;  2R4W A;  1Y0A B;  1SDL A;  1ECA A;  1VXC A;  2V1J A;  1YDZ A;  4FWZ A;  1XZ4 B;  1W92 A;  3GYS B;  2VHB A;  1SWM A;  2HBC B;  3MWN A;  3WCT A;  3IA3 B;  1S56 A;  4PO5 A;  4ILZ A;  3A59 A;  2BV8 A;  1ABW B;  3V57 B;  1LFV A;  4N6S B;  1A01 A;  2R1H B;  2R4Y A;  1A6N A;  3FEW X;  2ZT1 A;  1N9I A;  1Y0T A;  4NS2 A;  1RH1 A;  3SZK B;  3KMF A;  2QSP B;  2UUL A;  1G0B B;  1IBE A;  1X3K A;  3WFW A;  2V1F A;  2BLI A;  1ECN A;  1COH A;  1BIJ B;  3ZJR A;  2LHB A;  1UVY A;  3GOU A;  1A87 A;  2LH3 A;  1YE0 A;  1OR4 A;  1MDT A;  2DN2 B;  4IRO B;  4RMP A;  1Y7Z B;  2H8F B;  3AQ7 A;  1BIN A;  1A4F A;  1GJN A;  1CH4 A;  4O1T A;  3PI8 B;  5AQD A;  3UHN A;  1VXD A;  4ODC B;  1LH7 A;  3A2G A;  1NEJ A;  3VRG B;  3WFX A;  1O1L B;  1M6M A;  1CG8 A;  1J7W A;  1B0B A;  3PI9 B;  1A9W E;  1UT0 A;  1HBH A;  3PI1 A;  1K1K A;  1HDB B;  1YEQ A;  1HGC B;  1O1O B;  2UUM A;  3O2C A;  4HSX A;  3E4N A;  6HBW B;  1NGK A;  1PMB A;  1M9P B;  3FS4 B;  1XZ2 A;  1MOH A;  4ODC A;  2LH1 A;  1LFY A;  1KN1 B;  1UX8 A;  3BJ3 A;  4NK2 A;  2AV3 A;  1HBA A;  1OUU A;  2D2N A;  1I3E A;  1R1X B;  1YFF A;  3B75 B;  1WAC A;  3WHM B;  3QM9 A;  4JYQ A;  1MYI A;  1O1N B;  1B8D A;  1B86 A;  1J40 A;  4ETV A;  1PBX A;  2ZSO A;  2R80 B;  4ROL A;  3UHI A;  3V58 B;  3RJ6 A;  1CH9 A;  3G4W A;  2MGG A;  1RVW B;  3AQ5 A;  2M6Z B;  2D2M B;  2VLX A;  3WCT D;  3R0G A;  2Z6S A;  3M3B A;  3PI4 A;  1J40 B;  1CIO A;  109M A;  3VAU A;  1J7S B;  4WJG 1;  4M4B B;  1HDA B;  2MGL A;  1XF6 C;  3WCW A;  2WTH A;  1YHE A;  2MYC A;  1ABW A;  1LH3 A;  2D2N B;  1YVT A;  3PMC A;  3OGB A;  5E6E A;  3WFT A;  5AZQ A;  1X46 A;  2BK9 A;  5EUI B;  2MBW A;  2DKA A;  1ABY B;  3SDN A;  3ZTA A;  4XS0 A;  2VJR B;  2MHB A;  1HDA A;  2GTL C;  2G0R A;  2ZSR A;  3PI3 A;  3VRF A;  4KJT A;  2ZS1 A;  3MJP B;  1JEB B;  2GKN A;  1BVD A;  1MLU A;  2HCO A;  2BV8 B;  3DBJ A;  2SPM A;  3V58 A;  1UFP A;  3GIO A;  1YEV A;  1EBC A;  3QJE B;  5FVB M;  2PEG B;  1XG0 C;  4B02 A;  7HBI A;  1Y4P A;  1F5P A;  1Y31 A;  4C0N A;  2ZS0 A;  1Y4B B;  2ZLV B;  1DWS A;  3D17 A;  2VEB A;  1ALL A;  3UHW A;  1HHO A;  4MQK A;  1Y5J B;  1A6K A;  2Z6N B;  106M A;  2NSR A;  2D2M D;  4MQG B;  1FDH G;  3WTG A;  3E55 A;  2ZST A;  1PHN A;  2SPN A;  3QM7 A;  4FWY A;  2FRI X;  1CLS B;  1Q1F A;  1YHU A;  1LFL B;  1NQP B;  1GVH A;  3BCQ A;  4DC7 A;  3A5G A;  3PT7 B;  1HGB A;  2D2N D;  4U8U D;  3GDJ A;  1MNJ A;  3OZU A;  1YIE A;  4JAC A;  1O1L A;  1DWT A;  1YCA A;  1UVM A;  1O1I A;  1J3F A;  3UBV A;  3OVU C;  1LUE A;  2UUL D;  2ZWJ A;  2ZFB B;  3WCV C;  1HHO B;  3K9Z A;  3PT7 A;  1Y4R A;  3WCU A;  2MGK A;  3CY5 A;  4IT8 A;  1HBR B;  4SDH A;  1LTW A;  4Q70 B;  1HDS B;  1HBA B;  5JDO D;  1MBI A;  1DXD A;  3OK5 A;  2VJT B;  3PI8 A;  4AE1 A;  4PQ6 A;  3SZK A;  5AB8 A;  2QSP A;  1LHS A;  2C7K A;  1MWD A;  4HHB B;  1FAW A;  2ZFO D;  1G0A B;  1MOC A;  1HGA B;  1ON7 A;  3KVS A;  1BVC A;  103M A;  3R5I B;  4FH6 A;  4N7P B;  1MLM A;  1YE0 B;  1IOP A;  1IWH B;  1AJ9 B;  3D1K B;  1LIA B;  1A3N A;  3MOU A;  1XXT A;  4A8M P;  3EOK B;  1KFR A;  2OHB A;  4N7O B;  3UHS A;  5ILE A;  2O5O X;  3BJ1 A;  1Y22 B;  1CP5 A;  3EDB A;  1NPF A;  1VXF A;  1Z8U B;  2G11 A;  4PQC A;  2O5Q X;  3DR9 A;  3ED9 A;  1QXE B;  1CIK A;  1VWT A;  2W72 B;  1XXT B;  2G12 A;  2UUL H;  1MYT A;  5JGG B;  2O5S X;  1LFZ B;  2H35 B;  2G0X A;  1GBU A;  1YEU B;  3TLD A;  5HLQ A;  2HZ3 A;  3MYM A;  1VXA A;  3ZJS A;  1MOD A;  1B86 B;  3UHD A;  2D5X B;  2DKC A;  3K8B A;  4XDI A;  2O5L X;  1C7C A;  1A0U A;  2D6C A;  3MJU B;  2GRH A;  3DUT B;  5JGG A;  3WCW D;  2SPO A;  2ZLW A;  3QM8 A;  3ZOM A;  1HDS A;  1IRD A;  3HXN A;  1AJG A;  1HRM A;  5CN5 A;  2O58 X;  2R80 A;  4ROL B;  1LFT A;  3G4Q A;  4YU4 B;  3QJB A;  2ZFO C;  1UVI A;  1MLQ A;  2V8A A;  1GLI B;  2MGC A;  3NL7 A;  3PIA A;  4A8Q A;  5CNF A;  1DUK A;  1Y5F B;  1O1P A;  1CH3 A;  1FN3 A;  4ZVB A;  4A8Y A;  1B33 A;  2RAO B;  3G4Y A;  2D2N C;  1JBO A;  104M A;  3ONZ A;  1XYE B;  2NRL A;  1AJ9 A;  1IWH A;  4ERV A;  3MBA A;  1VXE A;  3S65 B;  1DXV A;  1HBB A;  1BBB A;  1BZ0 B;  1BZP A;  3UHH A;  1Y5F A;  1YE2 A;  1IRC A;  1DXU B;  1J7S A;  1TES A;  5ILM A;  3AQ6 A;  2B7H B;  2ZSY A;  2BLH A;  2D5Z A;  3BOM A;  4KN3 A;  1HAC B;  1OR6 A;  4UZV A;  1IBE B;  2VYZ A;  2IN4 A;  5EE4 D;  3PMD A;  3WCU B;  3CY5 B;  1HCO A;  4N8T B;  2KSC A;  1Y4B A;  3OZV A;  1ASH A;  3BJ2 A;  4M4B A;  2MGM A;  4PQB A;  4BJA A;  4WCH D;  2HBS A;  2ZT4 A;  4PO5 B;  1RQA A;  4O2G A;  4X0L A;  1DDT A;  1L2K A;  3A0G B;  1HAB A;  3O2C B;  1DUO A;  3H57 A;  2R4X A;  2DHB B;  3UHU A;  4GY3 B;  2VML A;  3QZX A;  3EU1 B;  1R1Y B;  1VRE A;  1U7S A;  1Y0A A;  2MGA A;  4FWX A;  4DWU A;  1DXT A;  5HY8 A;  1DXC A;  1O1J A;  2EVP A;  5EYJ A;  1C7B B;  4MXK A;  4F0T A;  2BMM A;  3S1J A;  1QXD A;  3WCT B;  2GTL D;  4F0U B;  2AUR A;  3ECX A;  4MAX A;  3MJU A;  4U8U A;  2ZS0 C;  1X9F A;  2VLY A;  4RMP B;  1XZU A;  3QQR A;  2DN2 A;  3AT5 B;  2YRS B;  2C7J B;  2MGH A;  1UVX A;  2GRF A;  2VLZ A;  5SW7 A;  4YU3 B;  1MNO A;  1EYX A;  1S5X A;  1O1N A;  3RJN B;  1ITH A;  1XQ5 B;  3U3E A;  1IT3 A;  4ETU A;  1A00 B;  3VRG A;  3BOM B;  3OO4 A;  2D5Z B;  5CMV A;  2D5X A;  3V2Z A;  1Y4F A;  1JF4 A;  1NZ2 A;  1MBN A;  1UC3 A;  3GQP A;  1O1K A;  2UUM X;  4WJG A;  3VHB A;  2MYB A;  5HU6 B;  1Y4R B;  4U8U B;  3GUQ A;  5CNB A;  2V1E A;  3TM3 A;  2SPL A;  1Y0D B;  1UVK A;  1QSH A;  4PNJ A;  1QXE A;  4MQJ B;  1G08 B;  1LA6 B;  5HY8 B;  4MBA A;  2GL3 A;  1RTX A;  1OFK A;  3R5I A;  1FN3 B;  1Y46 A;  3GDJ B;  1C40 A;  3VRE B;  5HAV A;  4HH1 A;  1KD2 B;  3ZHW A;  1YHR A;  2H8D B;  4XS0 B;  2BNL A;  3AT6 B;  1J3Z B;  3DHR B;  4HBI A;  4LM6 B;  3ZJM A;  1RVW A;  4F68 A;  1S5Y A;  2WY4 A;  1NS9 B;  1JP6 A;  4HH0 A;  5EET A;  1F63 A;  1Y45 B;  2LH7 A;  1J41 A;  4BJU A;  2R4Z A;  2OH9 A;  3LR7 A;  1LH1 A;  1SPG A;  1Y4F B;  2ZT3 A;  1GDI A;  2W6V A;  1Y0C B;  1Y5K B;  1DXT B;  1WLA A;  1MBA A;  2MGB A;  3ONZ B;  1MKO A;  2IG3 A;  2VYY A;  4NI0 A;  1HGA A;  4F69 A;  1FHJ A;  4H0M B;  5EU2 A;  2DC3 A;  3UH3 A;  3V57 A;  1O1M A;  1Y4G A;  1Y22 A;  1CO9 A;  1BZ1 B;  1NAZ A;  1LFL A;  1NQP A;  3BA2 A;  1UVN A;  2V8A B;  1HI0 P;  2D60 A;  2Z8A A;  1VXG A;  4OF9 A;  3GLN A;  1D8U A;  3SDH A;  1Y0D A;  1DKE A;  1V4W B;  1Y7G A;  1SI4 B;  1F5O A;  2ZLU B;  3L0F A;  4NZI A;  2VJH A;  1YVQ A;  2GDM A;  1SPG B;  1GCW B;  2AA1 B;  2Z6T A;  2ZS0 B;  5B84 A;  4H2L A;  1S61 A;  3D7O A;  1GH0 A;  2ZSQ A;  5AQD M;  1HGC A;  1WVP A;  3ZH0 A;  1MDN A;  2O5T X;  5JDO E;  2LH2 A;  3K3U A;  3ARJ A;  5JDO C;  3NFE A;  3S48 C;  3ECL A;  5E29 B;  1MYH A;  1CG8 B;  5D5R A;  3WR1 B;  1V4U A;  3HHB A;  1BJE A;  5HLU A;  1Y4G B;  1RQ3 B;  1MZ0 A;  5JDO F;  5IKS A;  5SW7 B;  3KUN A;  2C7J A;  1Y85 B;  2J96 A;  4MPM A;  4MQH A;  1DO1 A;  1PBX B;  3UHX A;  5HBI A;  2C7K B;  2HBF A;  1LFQ A;  1A6G A;  2MGE A;  111M A;  1HJT A;  1R1X A;  1B33 B;  2RAO A;  4ROM A;  1UIW B;  5CHR A;  1I7Y A;  4F0T B;  5EE4 C;  1YGF B;  4KMV A;  1LFY B;  1LIA A;  3ARL A;  2D60 B;  1LH6 A;  1G0B A;  3KMF C;  1XZ4 A;  1YEO B;  2UUL C;  3NMM A;  1U7R A;  1MKO B;  1O1K B;  2O5B X;  1BBB B;  2O5M X;  1FHJ B;  1MNH A;  3L0F B;  3O89 A;  1HI8 A;  3HRW A;  1RQ3 A;  1OUT B;  1V75 B;  1WMU A;  2HBS B;  4MQH B;  1Y4V B;  2FAL A;  1C7C B;  5AZR A;  5CN4 A;  3HF4 A;  2W6W A;  2XKG A;  3UHR A;  1EWA A;  1MTK A;  3NG6 B;  1S0H A;  3WCU D;  1A3O B;  3GYS A;  5CN9 A;  2HZ1 A;  2NSS A;  2DXM A;  4N7N A;  1GBV B;  4ZIZ A;  1OUT A;  4NI1 A;  2MB5 A;  2OH8 A;  2PGH B;  2WCQ A;  3DBJ B;  5E6E B;  2I88 A;  3ZJQ A;  1IT2 A;  1BUW B;  1Y8H A;  1Y7C B;  2HBD B;  2GTL B;  3H58 A;  1JPB A;  2HHE B;  1DM1 A;  1GDL A;  1S0H B;  3MJP A;  1YOI A;  1HV4 B;  1S6A A;  1UX9 A;  1I7Y B;  2HHD A;  3VNC A;  2AUP A;  3UGY A;  1Y0T B;  1C7D A;  1VRF A;  1YHU D;  1NEJ B;  1RPS B;  3OJ1 A;  3GKV B;  3DHR A;  2W72 C;  4MBN A;  3ZJL A;  4MQK B;  4L7Y B;  1MOB A;  1Y46 B;  3ZJI A;  1V5H A;  2XKI A;  1MGN A;  2H8F A;  1Y4V A;  2G3H A;  2D2M A;  1MLO A;  2ZLT B;  2GKM A;  1YIH A;  2MGF A;  3PI2 A;  2JLG A;  1PHN B;  2EKU A;  3HEO A;  3HXN B;  1URY A;  1H97 A;  4XXK A;  2ZS1 D;  5CND A;  4MU5 A;  1XY0 A;  3IC0 B;  1JL6 A;  1JF3 A;  4HRR A;  1DO4 A;  1V4X B;  5C6E B;  1LFQ B;  3AT5 A;  4YJJ B;  2X49 A;  3AG0 A;  1OFJ A;  3A9M A;  1HBH B;  1QSI A;  4ZVA A;  1Y31 B;  3RGK A;  1HAC A;  1YGF A;  1DWR A;  1S5Y B;  2MGJ A;  1FLP A;  1TOX A;  1BIJ A;  2UUN D;  3V2V A;  3M39 A;  3PEL B;  2OHA A;  1GZX A;  3E5O A;  3KUO A;  2M6Z A;  1FDH A;  2BLJ M;  5CN6 A;  1BZ1 A;  2HZ2 A;  1QGW C;  1Y35 A;  2MYD A;  1QSH B;  3BJ3 B;  1J3Z A;  108M A;  2ZS1 C;  1MLH A;  1HBB B;  1G9V A;  1Y4Q B;  3BCQ B;  2HHE A;  1Y8W A;  1YEN B;  1MCY A;  1HAB B;  1Y8H B;  2HBD A;  4F6G A;  3WI8 A;  3GKV A;  3PIA B;  1YDZ B;  5CNE A;  4GXE A;  1GZX B;  4NK1 A;  1DLW A;  5M3S A;  1COH B;  1Y8I B;  1J7W B;  3WCT C;  1Y35 B;  2ZT0 A;  4H07 A;  3FH9 A;  4F6F A;  2WTG A;  2W31 A;  1Y45 A;  3WCP A;  3S65 A;  5KKK A;  1XZU B;  3D4X A;  4YJJ A;  1A6M A;  3UGZ A;  1Y7D B;  3S1I A;  1YFF B;  3B75 A;  4UUR A;  2ZLT A;  3HEP A;  2BW9 M;  1EYX B;  1S5X B;  3O18 B;  1CPW A;  4O4Z A;  1YCB A;  2BKM A;  2VJR A;  3GKT A;  3D17 B;  5E83 B;  1AJH A;  2QU0 A;  3ZJH A;  1YEO A;  4MQJ A;  4N7O A;  1G08 A;  2V1I A;  5HLX A;  2AUQ A;  1AZI A;  4AVE A;  1XZV B;  3LB2 A;  4HSW A;  1Y8K B;  105M A;  3GQR B;  4ETT A;  1YGD A;  2Z6N A;  2C0K A;  1VXH A;  1HBS B;  4UIQ A;  5KDQ A;  1YHE B;  2QSS B;  5MBN A;  4KMW A;  1NS6 B;  1MLS A;  1Y4P B;  110M A;  2EB9 A;  4GY3 A;  1YEU A;  2YSK A;  1XZ5 A;  1CH2 A;  1CII A;  1CMY B;  1JL7 A;  1LFV B;  1Y09 B;  1UFJ A;  1URV A;  2WCR A;  2XKH A;  1ABY A;  2LH5 A;  1XQ5 A;  1J3Y A;  1F65 A;  4TWU A;  4MQG A;  4HRT A;  3EDA A;  3KVS B;  2NX0 A;  3W4U A;  1V9Q A;  3WFU A;  1BAB B;  3PT8 B;  3BJ1 B;  2DN1 A;  1X9F B;  3UHG A;  3FH9 B;  1J52 A;  3NG6 A;  1V75 A;  2QLS A;  1YGD B;  3QZZ A;  3ODQ A;  2DN3 A;  1DLY A;  1XY0 B;  2NRM A;  1KN1 A;  1YEV B;  1VXB A;  1RTE A;  3UH6 A;  2ZLW B;  3WCV D;  1XCH A;  1XZ7 A;  1OBM A;  1YG5 B;  2G0Z A;  1FCS A;  1JBO B;  2DXM B;  1O1M B;  1HDB A;  1YEQ B;  3CIU B;  2ZFB A;  3GK9 A;  4A8F A;  3VRE A;  3HC9 A;  3UHE A;  3NML A;  2EB8 A;  2V1K A;  3MKB A;  1MYM A;  4XXI A;  1BUW A;  3MVC A;  2MYE A;  2AUO A;  4NXA A;  4YU3 A;  5EUI A;  4NI1 B;  1C7D B;  1V07 A;  3FS4 A;  3HYU B;  4DC8 A;  1J41 B;  1GCV A;  3D1A A;  5B13 A;  1TU9 A;  4B3W A;  2GTL A;  1JZK A;  4F6I A;  1LFT B;  2G14 A;  1BZ6 A;  5CN8 A;  4F6J A;  1YOH A;  1HA7 A;  3ZJP A;  3M38 A;  1N9F A;  2UUN A;  5KER B;  1J3Y B;  1O16 A;  4FC3 B;  1GCV B;  1O1O A;  2UUM B;  2JHO A;  3W4U B;  3WCP B;  1ECO A;  2RI4 A;  1CO8 A;  1MTJ A;  2QSS A;  1HHT P;  2VJT A;  1VWT B;  2G10 A;  2W72 A;  4A8S A;  3ZOL A;  1DKE B;  1Y7G B;  3GQG A;  4MQI A;  3G4R A;  1F99 B;  1YHR B;  3HEN A;  3QJC A;  1C7B A;  1BZZ B;  3G52 A;  2VM0 A;  1HCO B;  1SDL B;  4H0B A;  4N7P A;  3LHB A;  2D2M C;  1GH0 B;  1YHU C;  1CLS A;  2Z85 A;  1Y8W B;  1YEN A;  1T1N A;  3LQD A;  1K0Y A;  1NS9 A;  3M3A A;  1CH5 A;  3TM9 A;  1JZM A;  3S66 B;  1JW8 A;  4G51 B;  1I3D A;  5EQM A;  2HCO B;  1JWN A;  1THB B;  4MQI B;  3ZJJ A;  4X0L B;  3P5Q B;  1LH5 A; 
#chains in the Genus database with same CATH homology
 3PEL A;  1Y7D A;  1A3O A;  2DN3 B;  4G1V A;  3UHQ A;  3LB4 A;  4C44 A;  1Y85 A;  1CG5 B;  1JY7 B;  3WCV A;  1G0A A;  1HGB B;  112M A;  3OO5 B;  1RQ4 B;  3OO4 B;  3NL7 B;  2V1H A;  5KER A;  1WMU B;  3WCU C;  3D1A B;  3WHM A;  1KR7 A;  5ILP A;  4F4O A;  3UH5 A;  2HHB B;  4M4A A;  3MN0 A;  3QJD B;  3AQ8 A;  1J7Y A;  3IC0 A;  3GOU B;  1YH9 B;  1CH7 A;  5CNC A;  1MNK A;  1Y01 B;  3ORD A;  1T1N B;  5EV5 A;  3NMM B;  2H8D A;  3A5A A;  3UHK A;  3QJC B;  1DXV B;  1NS6 A;  1MBS A;  2ZLU A;  1A01 B;  2R1H A;  1IRD B;  1MOA A;  1MYJ A;  1MLK A;  4U8U C;  1YG5 A;  1MWC A;  1LFZ A;  2H35 A;  1YZI A;  1M6C A;  2FRK X;  3D4X B;  2W6V B;  1MLL A;  2EKT A;  3AT6 A;  1NZ3 A;  1Y2Z A;  1YIE B;  1FAW B;  2E2Y A;  1JP9 A;  3QMA A;  4FH7 A;  2G0V A;  3O7N A;  4N8T A;  5D1V A;  1HBS A;  4YU4 A;  5EYS A;  3WTG B;  1V4X A;  3UHY A;  4G51 A;  2QMB A;  1A4F B;  3ODQ B;  3QM6 A;  1QSI B;  1HBG A;  1YIH B;  3QM5 A;  4MQC A;  1YE2 B;  3ASE A;  1BAB A;  1S69 A;  3PT8 A;  3ZJO A;  2DHB A;  3AQ9 A;  3HF4 B;  1CG5 A;  4HRT B;  3PI9 A;  2PEG A;  3UH7 A;  2W6Y A;  1MYG A;  2W6X A;  4AVD A;  1XYE A;  1A0Z A;  1A00 A;  4B4Y A;  1CMY A;  3A59 B;  1ECD A;  1XZV A;  2CMM A;  6HBW A;  3S66 A;  3UI0 A;  2ZS1 B;  3BJ2 B;  4G1B A;  4NI0 B;  4HHB A;  2ZFO A;  3ZJN A;  1IDR A;  1JP8 A;  3WCW B;  1GLI A;  1XZ7 B;  1G9V B;  1Y4Q A;  3WR1 A;  1QPW A;  1JDO A;  1MLG A;  3GQR A;  1MYZ A;  3A0G A;  5CN7 A;  4DWT A;  2QRW A;  1Y83 A;  2QLS B;  3GQG B;  1NPG A;  2ZSP A;  1G09 B;  101M A;  4NXC A;  3MKB B;  2R50 A;  3K8B B;  2MGD A;  1GCW A;  2XYK A;  1LJW A;  2ZSX A;  1LHT A;  1HLB A;  2MYA A;  1YMB A;  1OJ6 A;  5MBA A;  3G4U A;  3LB1 A;  4L2M A;  2G0S A;  1NWN A;  4TYX A;  4MQC B;  3P5Q A;  4O35 A;  1MLF A;  1GDJ A;  1N9H A;  1QI8 A;  1YMC A;  3WCV B;  3QQQ A;  2ZT2 A;  2ZLV A;  1MLR A;  3UHC A;  3HYU A;  3ECZ A;  1DTM A;  3UBC A;  1Y8K A;  1DTI A;  1YH9 A;  1SI4 A;  1EMY A;  1J7Y B;  2EVK A;  1Y8I A;  1NZ4 A;  1K0Y B;  5ILR A;  1MLJ A;  1YMA A;  1UIW A;  2QU0 B;  1A0Z B;  1NIH B;  1CQX A;  3D1K A;  2ZLX B;  1XZ5 B;  2HBC A;  1Y7C A;  2BWH A;  2VRY A;  3QJB B;  1NXF A;  1GDK A;  1SHR B;  1A9W A;  3QJE A;  1QI8 B;  1Y0W B;  3IC2 A;  4IRO A;  2FAM A;  4LPI A;  2GRZ A;  5B85 A;  1SDK B;  1RQA B;  4F4O B;  3E5I A;  3UHB A;  3QJD A;  3LQD B;  1KD2 A;  2ZSZ A;  2GNV A;  1C40 B;  2VYW A;  1HV4 A;  2HHD B;  4H2L B;  1MLN A;  1X9F C;  3GQP B;  1HLM A;  2GLN A;  3OO5 A;  4MXL A;  1OUU B;  1YVQ B;  1EBT A;  4ESA A;  3EOK A;  5E29 A;  3IXF A;  4OOD A;  1QXD B;  2B7H A;  3ARK A;  1MTI A;  1XZ2 B;  1RSE A;  2HHB A;  1FSX B;  3G46 A;  4L7Y A;  1R1Y A;  1Y0W A;  1K1K B;  3IC2 B;  1HSY A;  1VHB A;  1LH2 A;  2YRS A;  1SPE A;  1Y2Z B;  3VRF B;  1DO3 A;  1YHU B;  2QFN A;  4TWV A;  1X9F D;  2AV0 A;  2ZLX A;  2LH6 A;  3WCW C;  2V1G A;  4GZG A;  2HBE B;  1A3N B;  1Y0C A;  1Y5K A;  1GBU B;  5EOH A;  3NFE B;  102M A;  1NZ5 A;  1THB A;  1NWI A;  3LB3 A;  4F6D A;  1HBI A;  4O4T A;  1O1J B;  1DO7 A;  1M9P A;  1YVT B;  1FSL A;  2DN1 B;  1N9X A;  1CP0 A;  1Y7Z A;  5CHQ A;  4HRR B;  3EU1 A;  2FRJ X;  5C6E A;  107M A;  1JY7 A;  3UHZ A;  4F6B A;  2PGH A;  2VEE A;  1Y83 B;  3DHT B;  4VHB A;  1HBR A;  2HBG A;  1DXU A;  1BZR A;  3MYN A;  3D7O B;  5C6Y A;  2FRF A;  1JEB A;  1RQ4 A;  3CIU A;  2OLP A;  1LJW B;  1V4W A;  1NIH A;  1CBM A;  2MHB B;  4FC3 A;  1EW6 A;  2EF2 A;  5KDQ B;  6HBI A;  1BZZ A;  1MBO A;  1LA6 A;  4ESA B;  1MBC A;  3HRW B;  1QPW B;  1MNI A;  5HU6 A;  1MWB A;  2HBE A;  3G53 A;  1UMO A;  1H1X A;  2ZSS A;  2QFK A;  3G4V A;  2ZFO B;  5E83 A;  1JZL A;  3A5B A;  4ROM B;  3OZW A;  5F2A A;  1YZI B;  2GNW A;  4QAU A;  1RPS A;  4N7N B;  1Y5J A;  1GBV A;  3HHB B;  1V4U B;  1A0U B;  2HBF B;  1SHR A;  1ABS A;  2MGI A;  2ZSN A;  5F0B A;  1BZ0 A;  3UHT A;  2RI4 B;  2OIF A;  5CNG A;  1YOG A;  1MBD A;  1CQ2 A;  1FSX A;  1CH1 A;  2AA1 A;  1G09 A;  1SDK A;  5JOM A;  1Y09 A;  1CBL A;  2QMB B;  1MYF A;  3UHV A;  2ZS0 D;  3DHT A;  3LR9 A;  3DUT A;  4M4A B;  1O1P B;  1O1I B;  2R4W A;  1Y0A B;  1SDL A;  1ECA A;  1VXC A;  2V1J A;  1YDZ A;  4FWZ A;  1XZ4 B;  1W92 A;  3GYS B;  2VHB A;  1SWM A;  2HBC B;  3WCT A;  3IA3 B;  1S56 A;  4ILZ A;  3A59 A;  1ABW B;  1LFV A;  1A01 A;  2R1H B;  2R4Y A;  1A6N A;  2ZT1 A;  1N9I A;  1Y0T A;  4NS2 A;  3SZK B;  3KMF A;  2QSP B;  1G0B B;  1IBE A;  1X3K A;  3WFW A;  2V1F A;  2BLI A;  1ECN A;  1COH A;  1BIJ B;  3ZJR A;  2LHB A;  1UVY A;  3GOU A;  2LH3 A;  1YE0 A;  1OR4 A;  2DN2 B;  4IRO B;  1Y7Z B;  2H8F B;  3AQ7 A;  1BIN A;  1A4F A;  1GJN A;  1CH4 A;  4O1T A;  3PI8 B;  3UHN A;  1VXD A;  4ODC B;  1LH7 A;  3A2G A;  1NEJ A;  3VRG B;  3WFX A;  1O1L B;  1M6M A;  1CG8 A;  1J7W A;  1B0B A;  3PI9 B;  1A9W E;  1UT0 A;  1HBH A;  3PI1 A;  1K1K A;  1HDB B;  1YEQ A;  1HGC B;  1O1O B;  4HSX A;  3E4N A;  6HBW B;  1NGK A;  1PMB A;  1M9P B;  3FS4 B;  1XZ2 A;  1MOH A;  4ODC A;  2LH1 A;  1LFY A;  1UX8 A;  3BJ3 A;  4NK2 A;  2AV3 A;  1HBA A;  1OUU A;  2D2N A;  1I3E A;  1R1X B;  1YFF A;  3B75 B;  3WHM B;  3QM9 A;  4JYQ A;  1MYI A;  1O1N B;  1B86 A;  1J40 A;  1PBX A;  2ZSO A;  2R80 B;  4ROL A;  3UHI A;  3RJ6 A;  1CH9 A;  3G4W A;  2MGG A;  1RVW B;  3AQ5 A;  2M6Z B;  2D2M B;  2VLX A;  3WCT D;  3R0G A;  2Z6S A;  3M3B A;  3PI4 A;  1J40 B;  1CIO A;  109M A;  3VAU A;  1J7S B;  4WJG 1;  4M4B B;  1HDA B;  2MGL A;  3WCW A;  2WTH A;  1YHE A;  2MYC A;  1ABW A;  1LH3 A;  2D2N B;  1YVT A;  3OGB A;  5E6E A;  3WFT A;  5AZQ A;  1X46 A;  2BK9 A;  5EUI B;  2MBW A;  1ABY B;  3SDN A;  4XS0 A;  2MHB A;  1HDA A;  2GTL C;  2G0R A;  2ZSR A;  3PI3 A;  3VRF A;  4KJT A;  2ZS1 A;  3MJP B;  1JEB B;  2GKN A;  1BVD A;  1MLU A;  2HCO A;  2SPM A;  1UFP A;  1YEV A;  1EBC A;  3QJE B;  2PEG B;  7HBI A;  1Y4P A;  1F5P A;  1Y31 A;  4C0N A;  2ZS0 A;  1Y4B B;  2ZLV B;  1DWS A;  3D17 A;  2VEB A;  3UHW A;  1HHO A;  4MQK A;  1Y5J B;  1A6K A;  2Z6N B;  106M A;  2NSR A;  2D2M D;  4MQG B;  1FDH G;  3WTG A;  3E55 A;  2ZST A;  2SPN A;  3QM7 A;  4FWY A;  2FRI X;  1CLS B;  1Q1F A;  1YHU A;  1LFL B;  1NQP B;  1GVH A;  3BCQ A;  4DC7 A;  3A5G A;  3PT7 B;  1HGB A;  2D2N D;  4U8U D;  3GDJ A;  1MNJ A;  3OZU A;  1YIE A;  4JAC A;  1O1L A;  1DWT A;  1YCA A;  1O1I A;  1J3F A;  3UBV A;  3OVU C;  1LUE A;  2ZWJ A;  2ZFB B;  3WCV C;  1HHO B;  3K9Z A;  3PT7 A;  1Y4R A;  3WCU A;  2MGK A;  3CY5 A;  4IT8 A;  1HBR B;  4SDH A;  1LTW A;  1HDS B;  1HBA B;  5JDO D;  1MBI A;  1DXD A;  3OK5 A;  3PI8 A;  4PQ6 A;  3SZK A;  5AB8 A;  2QSP A;  1LHS A;  1MWD A;  4HHB B;  1FAW A;  2ZFO D;  1G0A B;  1MOC A;  1HGA B;  1BVC A;  103M A;  3R5I B;  4FH6 A;  4N7P B;  1MLM A;  1YE0 B;  1IOP A;  1IWH B;  1AJ9 B;  3D1K B;  1A3N A;  3MOU A;  1XXT A;  3EOK B;  1KFR A;  2OHB A;  4N7O B;  3UHS A;  5ILE A;  2O5O X;  3BJ1 A;  1Y22 B;  1CP5 A;  3EDB A;  1NPF A;  1VXF A;  1Z8U B;  2G11 A;  4PQC A;  2O5Q X;  3DR9 A;  3ED9 A;  1QXE B;  1CIK A;  1VWT A;  2W72 B;  1XXT B;  2G12 A;  1MYT A;  5JGG B;  2O5S X;  1LFZ B;  2H35 B;  2G0X A;  1GBU A;  1YEU B;  3TLD A;  5HLQ A;  2HZ3 A;  3MYM A;  1VXA A;  3ZJS A;  1MOD A;  1B86 B;  3UHD A;  2D5X B;  3K8B A;  4XDI A;  2O5L X;  1C7C A;  1A0U A;  2D6C A;  3MJU B;  2GRH A;  3DUT B;  5JGG A;  3WCW D;  2SPO A;  2ZLW A;  3QM8 A;  3ZOM A;  1HDS A;  1IRD A;  3HXN A;  1AJG A;  1HRM A;  5CN5 A;  2O58 X;  2R80 A;  4ROL B;  1LFT A;  3G4Q A;  4YU4 B;  3QJB A;  2ZFO C;  1MLQ A;  1GLI B;  2MGC A;  3NL7 A;  3PIA A;  5CNF A;  1DUK A;  1Y5F B;  1O1P A;  1CH3 A;  1FN3 A;  4ZVB A;  2RAO B;  3G4Y A;  2D2N C;  104M A;  3ONZ A;  1XYE B;  2NRL A;  1AJ9 A;  1IWH A;  3MBA A;  1VXE A;  3S65 B;  1DXV A;  1HBB A;  1BBB A;  1BZ0 B;  1BZP A;  3UHH A;  1Y5F A;  1YE2 A;  1IRC A;  1DXU B;  1J7S A;  1TES A;  5ILM A;  3AQ6 A;  2B7H B;  2ZSY A;  2BLH A;  2D5Z A;  3BOM A;  4KN3 A;  1HAC B;  1OR6 A;  4UZV A;  1IBE B;  2VYZ A;  2IN4 A;  5EE4 D;  3WCU B;  3CY5 B;  1HCO A;  4N8T B;  2KSC A;  1Y4B A;  3OZV A;  1ASH A;  3BJ2 A;  4M4B A;  2MGM A;  4PQB A;  4BJA A;  4WCH D;  2HBS A;  2ZT4 A;  1RQA A;  4O2G A;  4X0L A;  1L2K A;  3A0G B;  1HAB A;  1DUO A;  3H57 A;  2R4X A;  2DHB B;  3UHU A;  3QZX A;  3EU1 B;  1R1Y B;  1VRE A;  1U7S A;  1Y0A A;  2MGA A;  4FWX A;  4DWU A;  1DXT A;  5HY8 A;  1DXC A;  1O1J A;  2EVP A;  5EYJ A;  1C7B B;  4MXK A;  2BMM A;  3S1J A;  1QXD A;  3WCT B;  2GTL D;  2AUR A;  3ECX A;  4MAX A;  3MJU A;  4U8U A;  2ZS0 C;  1X9F A;  2VLY A;  1XZU A;  3QQR A;  2DN2 A;  3AT5 B;  2YRS B;  2MGH A;  1UVX A;  2GRF A;  2VLZ A;  5SW7 A;  4YU3 B;  1MNO A;  1S5X A;  1O1N A;  3RJN B;  1ITH A;  1XQ5 B;  3U3E A;  1IT3 A;  1A00 B;  3VRG A;  3BOM B;  3OO4 A;  2D5Z B;  5CMV A;  2D5X A;  3V2Z A;  1Y4F A;  1JF4 A;  1NZ2 A;  1MBN A;  1UC3 A;  3GQP A;  1O1K A;  4WJG A;  3VHB A;  2MYB A;  5HU6 B;  1Y4R B;  4U8U B;  5CNB A;  2V1E A;  3TM3 A;  2SPL A;  1Y0D B;  1QSH A;  4PNJ A;  1QXE A;  4MQJ B;  1G08 B;  1LA6 B;  5HY8 B;  4MBA A;  2GL3 A;  1RTX A;  1OFK A;  3R5I A;  1FN3 B;  1Y46 A;  3GDJ B;  1C40 A;  3VRE B;  5HAV A;  1KD2 B;  3ZHW A;  1YHR A;  2H8D B;  4XS0 B;  2BNL A;  3AT6 B;  1J3Z B;  3DHR B;  4HBI A;  3ZJM A;  1RVW A;  4F68 A;  1S5Y A;  2WY4 A;  1NS9 B;  1JP6 A;  5EET A;  1F63 A;  1Y45 B;  2LH7 A;  1J41 A;  2R4Z A;  2OH9 A;  3LR7 A;  1LH1 A;  1SPG A;  1Y4F B;  2ZT3 A;  1GDI A;  2W6V A;  1Y0C B;  1Y5K B;  1DXT B;  1WLA A;  1MBA A;  2MGB A;  3ONZ B;  1MKO A;  2IG3 A;  2VYY A;  4NI0 A;  1HGA A;  4F69 A;  1FHJ A;  5EU2 A;  2DC3 A;  3UH3 A;  1O1M A;  1Y4G A;  1Y22 A;  1CO9 A;  1BZ1 B;  1NAZ A;  1LFL A;  1NQP A;  3BA2 A;  2D60 A;  2Z8A A;  1VXG A;  4OF9 A;  3GLN A;  1D8U A;  3SDH A;  1Y0D A;  1DKE A;  1V4W B;  1Y7G A;  1SI4 B;  1F5O A;  2ZLU B;  4NZI A;  1YVQ A;  2GDM A;  1SPG B;  1GCW B;  2AA1 B;  2Z6T A;  2ZS0 B;  5B84 A;  4H2L A;  1S61 A;  3D7O A;  2ZSQ A;  1HGC A;  1WVP A;  3ZH0 A;  1MDN A;  2O5T X;  5JDO E;  2LH2 A;  3K3U A;  3ARJ A;  5JDO C;  3NFE A;  3S48 C;  3ECL A;  5E29 B;  1MYH A;  1CG8 B;  5D5R A;  3WR1 B;  1V4U A;  3HHB A;  1BJE A;  5HLU A;  1Y4G B;  1RQ3 B;  1MZ0 A;  5JDO F;  5IKS A;  5SW7 B;  3KUN A;  1Y85 B;  4MPM A;  4MQH A;  1DO1 A;  1PBX B;  3UHX A;  5HBI A;  2HBF A;  1LFQ A;  1A6G A;  2MGE A;  111M A;  1HJT A;  1R1X A;  2RAO A;  4ROM A;  1UIW B;  5CHR A;  5EE4 C;  1YGF B;  4KMV A;  1LFY B;  3ARL A;  2D60 B;  1LH6 A;  1G0B A;  3KMF C;  1XZ4 A;  1YEO B;  3NMM A;  1U7R A;  1MKO B;  1O1K B;  2O5B X;  1BBB B;  2O5M X;  1FHJ B;  1MNH A;  3O89 A;  3HRW A;  1RQ3 A;  1OUT B;  1V75 B;  1WMU A;  2HBS B;  4MQH B;  1Y4V B;  2FAL A;  1C7C B;  5AZR A;  5CN4 A;  3HF4 A;  2W6W A;  2XKG A;  3UHR A;  1EWA A;  1MTK A;  3NG6 B;  1S0H A;  3WCU D;  1A3O B;  3GYS A;  5CN9 A;  2HZ1 A;  2NSS A;  2DXM A;  4N7N A;  1GBV B;  1OUT A;  4NI1 A;  2MB5 A;  2OH8 A;  2PGH B;  5E6E B;  3ZJQ A;  1IT2 A;  1BUW B;  1Y8H A;  1Y7C B;  2HBD B;  2GTL B;  3H58 A;  1JPB A;  2HHE B;  1DM1 A;  1GDL A;  1S0H B;  3MJP A;  1YOI A;  1HV4 B;  1S6A A;  1UX9 A;  2HHD A;  2AUP A;  3UGY A;  1Y0T B;  1C7D A;  1VRF A;  1YHU D;  1NEJ B;  1RPS B;  3OJ1 A;  3GKV B;  3DHR A;  2W72 C;  4MBN A;  3ZJL A;  4MQK B;  4L7Y B;  1MOB A;  1Y46 B;  3ZJI A;  1V5H A;  2XKI A;  1MGN A;  2H8F A;  1Y4V A;  2G3H A;  2D2M A;  1MLO A;  2ZLT B;  2GKM A;  1YIH A;  2MGF A;  3PI2 A;  2EKU A;  3HEO A;  3HXN B;  1URY A;  1H97 A;  2ZS1 D;  5CND A;  4MU5 A;  1XY0 A;  3IC0 B;  1JL6 A;  1JF3 A;  4HRR A;  1DO4 A;  1V4X B;  5C6E B;  1LFQ B;  3AT5 A;  3AG0 A;  1OFJ A;  3A9M A;  1HBH B;  1QSI A;  4ZVA A;  1Y31 B;  3RGK A;  1HAC A;  1YGF A;  1DWR A;  1S5Y B;  2MGJ A;  1FLP A;  1BIJ A;  3V2V A;  3M39 A;  3PEL B;  2OHA A;  1GZX A;  3E5O A;  3KUO A;  2M6Z A;  1FDH A;  2BLJ M;  5CN6 A;  1BZ1 A;  2HZ2 A;  1Y35 A;  2MYD A;  1QSH B;  3BJ3 B;  1J3Z A;  108M A;  2ZS1 C;  1MLH A;  1HBB B;  1G9V A;  1Y4Q B;  3BCQ B;  2HHE A;  1Y8W A;  1YEN B;  1MCY A;  1HAB B;  1Y8H B;  2HBD A;  4F6G A;  3WI8 A;  3GKV A;  3PIA B;  1YDZ B;  5CNE A;  1GZX B;  4NK1 A;  1DLW A;  5M3S A;  1COH B;  1Y8I B;  1J7W B;  3WCT C;  1Y35 B;  2ZT0 A;  4H07 A;  3FH9 A;  4F6F A;  2WTG A;  2W31 A;  1Y45 A;  3WCP A;  3S65 A;  5KKK A;  1XZU B;  3D4X A;  1A6M A;  3UGZ A;  1Y7D B;  3S1I A;  1YFF B;  3B75 A;  4UUR A;  2ZLT A;  3HEP A;  2BW9 M;  1S5X B;  1CPW A;  4O4Z A;  1YCB A;  2BKM A;  3GKT A;  3D17 B;  5E83 B;  1AJH A;  2QU0 A;  3ZJH A;  1YEO A;  4MQJ A;  4N7O A;  1G08 A;  2V1I A;  5HLX A;  2AUQ A;  1AZI A;  4AVE A;  1XZV B;  4HSW A;  3LB2 A;  1Y8K B;  105M A;  3GQR B;  1YGD A;  2Z6N A;  2C0K A;  1VXH A;  1HBS B;  4UIQ A;  5KDQ A;  1YHE B;  2QSS B;  5MBN A;  4KMW A;  1NS6 B;  1MLS A;  1Y4P B;  110M A;  2EB9 A;  1YEU A;  1XZ5 A;  1CH2 A;  1CMY B;  1JL7 A;  1LFV B;  1Y09 B;  1UFJ A;  1URV A;  2XKH A;  1ABY A;  2LH5 A;  1XQ5 A;  1J3Y A;  1F65 A;  4TWU A;  4MQG A;  4HRT A;  3EDA A;  2NX0 A;  3W4U A;  1V9Q A;  3WFU A;  1BAB B;  3PT8 B;  3BJ1 B;  2DN1 A;  1X9F B;  3UHG A;  3FH9 B;  1J52 A;  3NG6 A;  1V75 A;  2QLS A;  1YGD B;  3QZZ A;  3ODQ A;  2DN3 A;  1DLY A;  1XY0 B;  2NRM A;  1YEV B;  1VXB A;  1RTE A;  3UH6 A;  2ZLW B;  3WCV D;  1XCH A;  1XZ7 A;  1OBM A;  1YG5 B;  2G0Z A;  1FCS A;  2DXM B;  1O1M B;  1HDB A;  1YEQ B;  3CIU B;  2ZFB A;  3GK9 A;  3VRE A;  3HC9 A;  3UHE A;  3NML A;  2EB8 A;  2V1K A;  3MKB A;  1MYM A;  1BUW A;  3MVC A;  2MYE A;  2AUO A;  4NXA A;  4YU3 A;  5EUI A;  4NI1 B;  1C7D B;  1V07 A;  3FS4 A;  3HYU B;  4DC8 A;  1J41 B;  1GCV A;  3D1A A;  1TU9 A;  4B3W A;  2GTL A;  1JZK A;  4F6I A;  1LFT B;  2G14 A;  1BZ6 A;  5CN8 A;  4F6J A;  1YOH A;  3ZJP A;  3M38 A;  1N9F A;  5KER B;  1J3Y B;  1O16 A;  4FC3 B;  1GCV B;  1O1O A;  2JHO A;  3W4U B;  3WCP B;  1ECO A;  2RI4 A;  1CO8 A;  1MTJ A;  2QSS A;  1VWT B;  2G10 A;  2W72 A;  3ZOL A;  1DKE B;  1Y7G B;  3GQG A;  4MQI A;  3G4R A;  1YHR B;  3HEN A;  3QJC A;  1C7B A;  1BZZ B;  3G52 A;  2VM0 A;  1HCO B;  1SDL B;  4H0B A;  4N7P A;  3LHB A;  2D2M C;  1YHU C;  1CLS A;  2Z85 A;  1Y8W B;  1YEN A;  1T1N A;  3LQD A;  1K0Y A;  1NS9 A;  3M3A A;  1CH5 A;  3TM9 A;  1JZM A;  3S66 B;  1JW8 A;  4G51 B;  1I3D A;  5EQM A;  2HCO B;  1JWN A;  1THB B;  4MQI B;  3ZJJ A;  4X0L B;  3P5Q B;  1LH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...