2HBSB

The high resolution crystal structure of deoxyhemoglobin s
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
146
structure length
146
Chain Sequence
VHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high resolution crystal structure of deoxyhemoglobin S.
pubmed doi rcsb
molecule tags Oxygen transport
molecule keywords HEMOGLOBIN S (DEOXY), ALPHA CHAIN
total genus 56
structure length 146
sequence length 146
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 1997-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 2hbsB00
1MLMA 2MYAA 1IRDA 3UHYA 4H2LB 5CN9A 2BK9A 1LH2A 1NPGA 2MGFA 7HBIA 2QFKA 3D17A 1VXHA 1G0AA 3UHTA 3MJPB 4ZVBA 3HC9A 3PELA 2D5ZA 3AQ7A 2VYWA 110MA 3K8BB 2BLJM 1XZUB 1O1LB 2O5MX 2GNWA 2ZS1A 3ED9A 1HDAA 1YIEB 3ONZB 2GDMA 1XZ7B 3A59A 4NK1A 3GOUB 2WTHA 1YCAA 2ZLUB 5CN7A 1QXEB 2SPLA 4L7YA 2EVPA 1NWIA 3MJPA 1A0ZA 3VHBA 1UX8A 3WR1B 3WCVC 3HF4A 1Y0DB 5B85A 1DO7A 2O5SX 1HDSB 2XKGA 2ZSPA 1MBIA 1S5XA 4HSWA 2VYYA 1HDSA 2O5LX 1XQ5B 1DKEB 1HDBB 2MB5A 2QSPA 1B86A 2SPMA 3PI9A 2Z8AA 2W6VB 1Y31A 2HCOB 1DUKA 1Y4FA 1CG5A 2RAOA 2GKMA 1R1XA 1S6AA 1HHOA 1HHOB 1VXBA 1A00B 4KJTA 1LFYB 1TESA 1YGFA 2RAOB 3LB3A 1GZXA 1KR7A 1EBTA 1C7BB 4F6DA 1BZZB 5HLQA 4MQJB 1MLNA 1IOPA 1V4WB 1CLSB 3D1AA 1MYMA 1M6MA 3D4XB 1J52A 4O2GA 3WCPA 4N7OA 3ZJHA 3RJ6A 3W4UB 1MLJA 1XQ5A 1G0BA 1MLOA 3HF4B 4FH7A 2HBCB 1EW6A 2G10A 4YU3B 1OR6A 3HHBA 4H2LA 1NGKA 1Y7GB 3VRFA 3U3EA 1NAZA 1O1KB 3WHMB 2OHAA 2DN3B 2GTLB 1MBCA 1YG5A 1Y5JB 3OZUA 4U8UC 5MBNA 3UH5A 3OO5B 3GDJB 3BCQB 3GQGB 1Y0WB 1XZ7A 3K3UA 1YEQB 2G12A 1GBUA 1NWNA 1Y4BB 2FRFA 1MLFA 1XY0A 2V1JA 4GZGA 2QFNA 2EF2A 3D4XA 1J3YB 1YE0A 1NZ3A 3AQ6A 1O1MA 1RPSB 1URYA 1MLLA 2D6CA 2VLXA 1M9PB 5KKKA 3WR1A 1A6KA 1A0UA 1Y22A 3HENA 1CH7A 3NL7B 3EDAA 3H58A 1K1KA 1CO8A 1BIJA 1OUUB 1SI4A 2QSPB 1VWTB 4MQCB 5CN4A 1O1KA 1MCYA 1X3KA 2H35A 1JP9A 3WCWB 1MTJA 1LFQA 1XZ4A 1LA6B 4MQHB 1Y8KA 1Y4PB 2Z6NB 1MOAA 1A6NA 1HBHA 3TM9A 1HBSA 5EU2A 2GKNA 1LJWA 2XKIA 3UHZA 1GZXB 3QJCA 1THBA 2G0ZA 4VHBA 1A6GA 1Y35A 1FAWA 2R4WA 1YOGA 3IA3B 5HLXA 4FH6A 1DO4A 1URVA 1Y4QA 2ZT2A 3ZOLA 1DXUB 1S5YB 2Z6SA 1YENA 3UHIA 1VXCA 1LFTB 1Y22B 1J7WA 2MGCA 1DWTA 1OR4A 2D5ZB 2ZSOA 2PEGA 3MKBA 1IWHB 2AV0A 3VRGB 2EB9A 1BUWA 1Y5FA 1WMUA 3A5BA 4DC8A 3MN0A 1YE0B 4SDHA 2W6XA 1YH9A 3UHEA 105MA 1C7BA 3EU1A 1BVCA 5JDOE 4ZVAA 1V07A 3UH6A 2DXMA 3ZJLA 1YHUA 1COHB 3B75B 1Y4VB 104MA 5JDOF 3NMLA 1WLAA 1YMAA 1LH6A 2HBFB 4FC3A 3O7NA 1MWCA 3LQDB 2BW9M 4F6FA 1PMBA 2OHBA 2ZFBB 2DHBB 3NMMA 1X9FC 4UURA 1Y45A 3DHRA 5EE4C 2QU0B 4F6BA 3HEOA 2ZFOD 3PIAB 1ABWA 1XCHA 2DHBA 2O5TX 1UFJA 2ZLTB 1MWBA 5CNBA 3WFTA 3SDNA 1QXEA 1LHTA 1YE2B 2ZLVA 3BJ1B 1OFJA 1BVDA 1CMYA 3ARJA 3PT8A 3GKVB 4MQJA 3TLDA 5HU6B 1RVWA 3UHUA 5EETA 1COHA 3B75A 1T1NB 2DN1A 2MGAA 1NEJA 1HSYA 5F0BA 5E29A 1DWSA 1Y8WB 3ARKA 1NZ4A 3VREA 3BA2A 1HBAA 2MGGA 3QZZA 1QSHB 4ODCB 2HCOA 3MJUA 5E83B 3ZJPA 1MOCA 1MNOA 1CIOA 1S0HA 1V9QA 1NXFA 3R5IB 1MLRA 1B0BA 1VWTA 3PI8A 3UBCA 1MOHA 2R1HB 1G08B 1UVXA 3BJ1A 1YE2A 1Z8UB 2D60B 2MGJA 3DHTA 4N7NB 5EUIA 1YHEA 5AB8A 1V4UA 1G9VB 2ZSSA 2ZS0C 1XYEA 3QM7A 2W72B 3IC0A 1HBSB 1SDLB 1MKOA 1OFKA 4OODA 2GRHA 1SDKB 2GRFA 1C7CB 1Y8HB 1QPWB 3WFUA 5D1VA 5E83A 1HACB 1HV4A 1LFZA 2ZSXA 3IXFA 3V2VA 2D2NB 1QSHA 2ZT4A 1H1XA 4FWYA 4M4BB 4HRRA 2BWHA 2ZS1D 4ESAA 3CIUB 1YEVB 1CG8A 1Y7DA 1Y5KB 1Y0AA 3KMFC 3G4RA 1YG5B 4O4ZA 1J3FA 3BCQA 1HLBA 2D60A 3ZJIA 1NQPA 2GTLC 1LH3A 1IDRA 4MQKA 3OO5A 3LB1A 4HHBB 3CY5A 3S66A 1G08A 3P5QA 1SHRB 2HZ2A 1AJHA 5HY8B 2RI4B 3WCUA 1CH4A 2V1FA 1YDZB 1YVQA 3ZJSA 3ZOMA 1O1MB 3HYUA 2AURA 4ROMA 1SPGA 3UHNA 3VAUA 2PGHB 5EYJA 2HBEB 3MJUB 3AT5A 1OJ6A 5HBIA 1MWDA 1FHJB 1GLIB 1NS9B 3UHCA 4YU4B 1UT0A 4F6JA 2MYCA 2H8FA 1IBEA 5CMVA 1O16A 2MYDA 1C7CA 2QLSB 3ECZA 5E29B 3MYMA 1GCVA 1FN3A 3MBAA 3WCTA 2HBDB 5EV5A 1RQ3A 2V1KA 1GCVB 2EKUA 1YGFB 2Z6TA 2ZLWA 3LR7A 3NG6B 2ZFOA 2MYEA 5C6EA 1MYHA 1Y4PA 1MYFA 1HBGA 1DO3A 2MGKA 3PI9B 1XZ4B 1Y83B 1Y83A 3WCPB 1IWHA 3D7OB 2MGDA 3H57A 1JY7B 1MBDA 2ZT3A 1C7DB 1Y0DA 3WCTB 1HBAB 1V5HA 1UIWB 1O1JA 3OZWA 1FN3B 1U7SA 1AJGA 4F6IA 3OK5A 2QLSA 3E55A 4NI1B 1Y7DB 1O1JB 1NZ5A 1DUOA 4B4YA 5JGGA 1SWMA 1FDHG 4M4BA 1Y31B 2W6VA 5EYSA 1C40A 2HZ3A 3FH9A 1XZVA 2ZS1B 1BUWB 1Y5FB 1RSEA 1SPEA 111MA 4AVEA 3GKTA 3MKBB 3PI3A 4FWXA 3A2GA 1SI4B 1O1OB 1JZKA 4WCHD 1MKOB 1RTXA 1O1PA 4HHBA 2CMMA 1YHEB 3GK9A 3GLNA 1A6MA 3GOUA 1Y7ZB 2WY4A 5JOMA 1LTWA 2V1IA 4NS2A 3S65B 2XKHA 1YHRA 1MODA 1A01B 6HBIA 1Y4VA 1VXEA 4PQBA 4XDIA 3R5IA 2D2NA 3WCVB 5ILPA 3ORDA 4HRRB 3FH9B 1MTIA 4NI0A 5CNDA 1DLWA 2VHBA 1K0YB 2LH5A 2G0RA 1YCBA 1BZPA 2HHEA 1J7YA 1A9WE 2LH1A 3G4UA 4C0NA 2OH9A 3QM8A 3QJEB 2H35B 1Y4GA 2SPOA 2FRIX 3QQQA 1SDLA 1DXCA 1NIHA 2G0VA 1N9HA 2G3HA 1C7DA 1XYEB 4MQKB 2DN2A 5EUIB 4N7NA 1OUTB 2ZLVB 2MHBB 1S61A 2HBCA 1Y4RB 3BJ2A 3QJBA 1GDKA 2B7HA 4MU5A 1YFFA 2R4ZA 4G1BA 2NX0A 1MYZA 4PNJA 1HGBB 3WCUC 4ODCA 2HHDB 1J3YA 1GDIA 2ZFBA 2AA1B 1HACA 1HV4B 1LFZB 4NI0B 1GDJA 3AQ8A 1IT2A 1RQAA 2AA1A 1X46A 2D5XB 1RQ3B 5CNCA 3PT7B 4TWUA 1A00A 3AQ9A 1YMCA 4PQCA 4H07A 2O5OX 4DWTA 2D2MC 1YEOB 1YZIB 3WCWC 5HU6A 2AUQA 2BLHA 2MHBA 2MGMA 1FDHA 2O5QX 3ARLA 3MYNA 2ZWJA 1DM1A 1OBMA 2VRYA 1Y85A 1Y46A 4N7PB 3UHDA 2MGIA 3OO4A 1YHUD 1CBMA 1G0BB 1S5XB 4G51A 1LFVB 2NSSA 3UGYA 1MLGA 2G0SA 1DXVB 2VLZA 1XZVB 1RQ4B 1RQ4A 3FS4A 3ZJJA 1HCOA 1LFYA 3ASEA 2FRJX 4MQGB 2MGEA 2M6ZA 4IT8A 1FHJA 1YOIA 3K8BA 4MAXA 1DO1A 3AT5B 3UHHA 3V2ZA 2HBEA 2QSSB 1YH9B 1SDKA 1Y85B 2HBGA 4ROMB 2ZS0D 1YDZA 2W6WA 1JY7A 1J40B 5AZQA 4B3WA 1G0AB 2HZ1A 1UFPA 4TYXA 1A0ZB 3UH3A 1MBAA 2VLYA 1LH7A 2GTLD 1DTIA 3A5AA 1O1NA 1K1KB 1NPFA 1NQPB 3UGZA 1VXGA 5JGGB 3NFEB 1HABB 4G1VA 2HBSA 3PI8B 3PT7A 1L2KA 1KFRA 1QXDA 2O58X 2MGHA 1CH3A 1S69A 1BZ0A 1NIHB 3SZKB 1XXTB 3UI0A 1VREA 2Z6NA 1R1XB 4MQHA 1IT3A 1NZ2A 1Y2ZA 3HYUB 3BJ3A 5CNGA 1A9WA 3D7OA 1XZ2A 3GYSA 3D17B 3IC0B 1MOBA 2C0KA 3S48C 3GQRA 5IKSA 1OUTA 1HGAB 2ZLXA 4NZIA 1Y0TB 3NL7A 1JF3A 1GDLA 1VXFA 2ZT1A 5KDQB 4PQ6A 2IG3A 2ZS1C 1Y4QB 5ILMA 3UHKA 3MOUA 4XS0B 1A4FB 4MXLA 3UHBA 2IN4A 2R1HA 4JACA 2GLNA 3BOMA 1Y45B 1JP8A 1VXDA 1GJNA 1N9FA 3AT6A 1J7YB 2M6ZB 2QMBB 2R4YA 1G09B 3TM3A 1YIHA 4UIQA 1H97A 2LH2A 2PGHA 1CLSA 3GQGA 3M3BA 1O1IA 1YVQB 1Y8WA 112MA 2EB8A 1YHUB 1Y8HA 3WTGB 1DWRA 1YEQA 5HY8A 1Y7ZA 4KN3A 4NXAA 3VRFB 2ZS0A 1Y7GA 1O1NB 3UHVA 3UHRA 1BBBA 1GVHA 2LH6A 3HXNB 5KDQA 3DR9A 1CG8B 2QRWA 1LFLB 1J7WB 1AJ9A 2NRMA 3QMAA 2AV3A 4HSXA 3ECXA 1G09A 5CNEA 1QI8A 2MGBA 4U8UD 3WI8A 1MNKA 1C40B 1HGCB 1V4WA 1PBXA 109MA 4MQGA 2Z85A 1BZRA 1BZZA 1CH1A 3UHQA 1GBVB 1JZLA 1YGDA 3ZJOA 1MBOA 1CH5A 1V4XB 3IC2B 1LJWB 1GBVA 2HHBA 1EMYA 3LR9A 3WHMA 2D2MA 1CIKA 5KERB 3LHBA 4YU3A 3PELB 3WCTD 3NMMB 2KSCA 3LQDA 2H8DA 1HBBB 1LFTA 1FSXB 1OUUA 1AJ9B 4ROLB 1DXTA 1DLYA 3AQ5A 2ZFOB 5C6EB 1YENB 3SZKA 6HBWB 1LH5A 1NEJB 1Y09B 3ZH0A 1YIEA 1YGDB 3ONZA 4MPMA 1JL7A 2VEEA 4F6GA 1ABYB 1Y0TA 3EU1B 2R80A 1ITHA 1ECAA 1LH1A 3A59B 5CN8A 3PT8B 3QJCB 4HRTA 3ODQB 2H8FB 4MBNA 4ESAB 1Y8IB 3K9ZA 1ECDA 1VXAA 5SW7A 2MYBA 1J40A 1BABB 1Y01B 4U8UB 3DHRB 3M3AA 3WCWA 1FSXA 3S65A 2PEGB 2SPNA 1WVPA 1F65A 1BIJB 1R1YB 2BKMA 106MA 3CY5B 1HJTA 3LB2A 1V4UB 3S1IA 1KD2B 4F69A 3DHTB 1CH9A 3O89A 3WTGA 4MXKA 2DXMB 1HDAB 1X9FA 2D2MD 1UMOA 3D1KA 5CNFA 1Y35B 3GYSB 1XZ5B 1HGCA 1CP5A 3EOKB 1QSIB 3D1KB 4G51B 5CN6A 1BINA 3HRWA 2OLPA 2NRLA 1QSIA 1YHUC 2HHDA 1T1NA 2D2ND 2DN1B 5M3SA 1YFFB 2OH8A 5EE4D 1HCOB 1LFLA 2B7HB 2O5BX 5E6EB 5E6EA 3QJDB 3FS4B 3HXNA 4MQCA 3UBVA 1B86B 1S5YA 4FWZA 1R1YA 3G4QA 1MYJA 1CO9A 5ILEA 1UVYA 1I3DA 1HLMA 3EOKA 1O1OA 1HBIA 3QJEA 2D2NC 1J7SB 3HRWB 3BJ3B 2FAMA 3W4UA 2HHEB 4L7YB 1AZIA 5C6YA 2BLIA 1O1IB 3A0GB 3WCVD 4HRTB 1A01A 1RVWB 3DUTB 3R0GA 3UHWA 2R80B 4FC3B 1V75A 2HBFA 2EKTA 3WCVA 4NI1A 3PI2A 1YEUB 1MBNA 2LH3A 3HEPA 4F4OB 3WFXA 3WCUD 4MQIB 4TWVA 1KD2A 4NK2A 5D5RA 4C44A 4KMVA 3PIAA 2AUOA 2MGLA 1DXTB 1LFVA 1Y5JA 5CN5A 4U8UA 5ILRA 4ILZA 1JL6A 1Y0CA 1HBBA 1Y4GB 2DN3A 3G52A 1VRFA 1J7SA 1ASHA 3A5GA 1BJEA 4F68A 1O1PB 1D8UA 3S66B 1TU9A 1XY0B 1Y4RA 3QJBB 1Y8IA 1N9XA 1YEUA 107MA 3IC2A 4WJGA 3M39A 2BMMA 2OIFA 1ABYA 5B84A 4M4AB 1CH2A 1THBB 3KUOA 3QZXA 1JEBA 1HBRB 3OGBA 1QPWA 1IRCA 2GTLA 1MZ0A 1HABA 3QM6A 1MLKA 1GLIA 1NS9A 4YU4A 2VYZA 4L2MA 2FALA 1Q1FA 2G0XA 2H8DB 1DKEA 1QI8B 1HRMA 1X9FB 2ZSNA 3OVUC 4HBIA 2V1EA 3UHSA 5AZRA 3NG6A 2ZSQA 1Y0CB 4OF9A 2LHBA 3E5OA 3D1AB 2ZLUA 2QSSA 1FLPA 1MLQA 4O4TA 1MLHA 1FAWB 2HHBB 1PBXB 1HBRA 1V4XA 3E5IA 3UHXA 3ZJRA 1IBEB 2W31A 108MA 2G14A 1YEVA 1UIWA 3WCWD 1MGNA 1BABA 1XZ5A 1J3ZA 1DXVA 1Y7CB 1HDBA 1BZ1A 1ABSA 2ZSYA 4H0BA 5CHQA 3EDBA 1J3ZB 3ZJNA 1HGBA 1YMBA 1BBBB 1YIHB 3G53A 1DTMA 3QM9A 1SHRA 3P5QB 1Y4BA 1Y09A 2ZT0A 3KMFA 1NS6A 1Y0WA 1MYTA 4QAUA 2DN2B 3GDJA 4N8TA 1UC3A 1M9PA 1J41A 1CQXA 4LPIA 3UH7A 1GCWB 1YEOA 1F5PA 2MBWA 2NSRA 1S56A 2W6YA 1MLSA 1S0HB 1MNHA 1HGAA 2ZLXB 1A3OB 3GQRB 3HHBB 3DUTA 3UHGA 2LH7A 1A3OA 2JHOA 2ZLWB 3G4YA 3A9MA 1A4FA 1QXDB 2YRSB 1JDOA 1XXTA 3BOMB 5JDOC 1MBSA 2E2YA 1J41B 1MLUA 3RJNB 1Y4FB 1I3EA 101MA 4ROLA 1WMUB 2XYKA 1JZMA 6HBWA 1YVTA 1NS6B 4O1TA 1XZ2B 3E4NA 4O35A 2V1HA 4AVDA 2AUPA 1BZ6A 4N7OB 1JF4A 2WTGA 1FSLA 4IROB 1BZ1B 2BNLA 1MNJA 2V1GA 1CP0A 4UZVA 4M4AA 1K0YA 2HBSB 1UX9A 102MA 3PI4A 1JW8A 1CG5B 4F4OA 2ZFOC 1JPBA 1U7RA 1MYIA 3S1JA 1Y0AB 1LHSA 1W92A 3ZHWA 3RGKA 3NFEA 1HBHB 1XZUA 2DC3A 1ECNA 1M6CA 1EWAA 1MDNA 3SDHA 1F63A 1LUEA 3AG0A 1EBCA 3GQPA 4IROA 2ZLTA 3VRGA 2GNVA 3WCUB 3OO4B 1ECOA 2EVKA 5MBAA 3GQPB 4WJG1 2R50A 2G11A 5SW7B 5KERA 3ECLA 1A0UB 1Y46B 4N7PA 3QM5A 5EQMA 3MVCA 1JEBB 1IRDB 3ODQA 1MYGA 3QJDA 4X0LB 1V75B 2VEBA 3CIUA 1RPSA 1O1LA 5CHRA 3ZJMA 4X0LA 1MNIA 3G4VA 4DC7A 1Y7CA 1Y2ZB 1GBUB 1CPWA 3WFWA 4BJAA 1FCSA 1VHBA 3A0GA 4MBAA 3QQRA 3VREB 1G9VA 3WCTC 2RI4A 2ZSRA 1GCWA 3BJ2B 2FRKX 1YZIA 1A3NA 4NXCA 5JDOD 5HLUA 1JWNA 1YOHA 1DXDA 3GKVA 4KMWA 4DWUA 4XS0A 2ZSTA 4MQIA 2D2MB 2W72C 2R4XA 1DXUA 2ZSZA 1Y5KA 1RQAB 1ABWB 2HBDA 3KUNA 3OZVA 2QU0A 3OJ1A 2YRSA 1N9IA 2D5XA 1LA6A 5EOHA 2QMBA 2GRZA 3AT6B 3LB4A 1Y8KB 5F2AA 1X9FD 1MTKA 2W72A 1SPGB 1LFQB 5HAVA 2VM0A 3PI1A 1BZ0B 3ZJQA 3G4WA 3G46A 3M38A 4N8TB 1CQ2A 1F5OA 1JP6A 1RTEA 2GL3A 103MA 1CBLA 1A3NB 1YVTB 1YHRB 1CMYB 4JYQA 2ZS0B
chains in the Genus database with same CATH superfamily
1MLMA 2MYAA 1IRDA 3UHYA 4H2LB 5CN9A 2BK9A 1LH2A 1NPGA 2MGFA 5FVBA 7HBIA 4GY3A 2QFKA 3D17A 1KTPB 1VXHA 1G0AA 2DKAA 3UHTA 3MJPB 4ZVBA 3HC9A 3PELA 2D5ZA 3AQ7A 2VYWA 110MA 3K8BB 2BLJM 1EYXB 1XZUB 2VJTB 1O1LB 2O5MX 2GNWA 2ZS1A 3ED9A 1HDAA 1YIEB 3ONZB 2GDMA 1CIIA 1XZ7B 3A59A 4NK1A 3GOUB 2WTHA 1YCAA 3FEWX 2ZLUB 1PHNB 5CN7A 1UVJA 1QXEB 2SPLA 4L7YA 2EVPA 1NWIA 3MJPA 1A0ZA 3VHBA 1UX8A 3WR1B 3WCVC 3HF4A 1Y0DB 5B85A 1DO7A 2O5SX 4GY3B 1HDSB 2XKGA 2ZSPA 1MBIA 1S5XA 4HSWA 3BRPB 2VYYA 1HDSA 2O5LX 1XQ5B 1DKEB 1HDBB 2MB5A 2QSPA 1B86A 2SPMA 3O18B 3PI9A 2Z8AA 2W6VB 3PMCA 4PO5A 1Y31A 2HCOB 1DUKA 1Y4FA 1CG5A 2RAOA 2GKMA 1R1XA 1S6AA 1HHOA 1HHOB 1VXBA 1A00B 4KJTA 1LFYB 2JLFA 1TESA 1YGFA 2RAOB 2UUMX 3LB3A 1GZXA 1KR7A 1EBTA 1C7BB 4F6DA 1BZZB 5HLQA 4MQJB 1HI8A 1MLNA 1IOPA 1V4WB 1CLSB 3D1AA 1MYMA 1M6MA 3D4XB 1J52A 4O2GA 3WCPA 4N7OA 3ZJHA 3RJ6A 3W4UB 1MLJA 2VJHB 1XQ5A 1G0BA 1MLOA 3HF4B 4FH7A 2HBCB 1EW6A 2G10A 4YU3B 1OR6A 3HHBA 4H2LA 1NGKA 1Y7GB 3VRFA 3U3EA 1NAZA 4AE1A 1O1KB 3WHMB 2OHAA 2DN3B 2GTLB 1MBCA 1YG5A 1Y5JB 3OZUA 4U8UC 5MBNA 3UH5A 3OO5B 4LM6B 3GDJB 3BCQB 3GQGB 1Y0WB 1XZ7A 3K3UA 1YEQB 2G12A 1GBUA 1NWNA 1Y4BB 2FRFA 1MLFA 1XY0A 2V1JA 4GZGA 2QFNA 2EF2A 3D4XA 1J3YB 1DDTA 1YE0A 1NZ3A 3AQ6A 1HI1A 1O1MA 1RPSB 1URYA 1MLLA 2D6CA 2VLXA 1M9PB 5KKKA 3WR1A 2C7JB 1A6KA 1ON7A 1A0UA 1Y22A 3HENA 1CH7A 3NL7B 3EDAA 3H58A 1K1KA 1CO8A 1BIJA 1OUUB 1SI4A 2QSPB 1VWTB 4MQCB 5CN4A 1O1KA 1MCYA 1X3KA 2H35A 1JP9A 3WCWB 1MTJA 1LFQA 2VJTA 1XZ4A 1LA6B 4MQHB 1Y8KA 1Y4PB 2Z6NB 1MOAA 1A6NA 1HBHA 3TM9A 1HBSA 5EU2A 2GKNA 1LJWA 2XKIA 3UHZA 1GZXB 3QJCA 1THBA 2G0ZA 4VHBA 1A6GA 1Y35A 1B8DA 1FAWA 2R4WA 1YOGA 3IA3B 5HLXA 4FH6A 1CPCB 1DO4A 1URVA 1Y4QA 2ZT2A 3ZOLA 1DXUB 1S5YB 2Z6SA 1YENA 3UHIA 1VXCA 1LFTB 1Y22B 1J7WA 2MGCA 1DWTA 1OR4A 2D5ZB 2ZSOA 2PEGA 3MKBA 1IWHB 2AV0A 3VRGB 2EB9A 2C7LB 1BUWA 1Y5FA 1WMUA 3A5BA 4DC8A 3MN0A 4GXEA 4ZIZB 1YE0B 4SDHA 2W6XA 1YH9A 3UHEA 105MA 1C7BA 3EU1A 1BVCA 5JDOE 4ZVAA 1V07A 3UH6A 2DXMA 3PMDA 3ZJLA 1YHUA 1COHB 3B75B 1Y4VB 3V57B 104MA 5JDOF 3NMLA 1WLAA 1YMAA 1LH6A 2HBFB 4FC3A 3O7NA 1MWCA 5B13G 3LQDB 2BW9M 4F6FA 1XF6C 1PMBA 2OHBA 4HH0A 2ZFBB 2DHBB 3NMMA 1X9FC 4UURA 1Y45A 3DHRA 5EE4C 2QU0B 4F6BA 3HEOA 2ZFOD 3PIAB 1ABWA 1XCHA 2DHBA 2O5TX 1UFJA 2ZLTB 1MWBA 5CNBA 3WFTA 3SDNA 1QXEA 1LHTA 1YE2B 2ZLVA 3BJ1B 1OFJA 1BVDA 1CMYA 3ARJA 3PT8A 3GKVB 4MQJA 3TLDA 5HU6B 1RVWA 3UHUA 3V57A 5EETA 1COHA 4L1EB 3B75A 1T1NB 2DN1A 2MGAA 1NEJA 1HSYA 5F0BA 5E29A 1DWSA 1Y8WB 3ARKA 1NZ4A 2DKCA 3VREA 3BA2A 1HBAA 2MGGA 3QZZA 1QSHB 4ODCB 2HCOA 3MJUA 5E83B 3ZJPA 1MOCA 1MNOA 1CIOA 1S0HA 2J96A 1V9QA 1NXFA 3R5IB 1MLRA 1B0BA 1VWTA 2V8AB 3PI8A 3UBCA 1MOHA 2R1HB 4BJUA 1G08B 1UVXA 1F99B 3BJ1A 1YE2A 1Z8UB 2D60B 2MGJA 3DHTA 1WACA 4ERTA 4N7NB 5EUIA 1YHEA 5AB8A 1V4UA 1G9VB 2ZSSA 2ZS0C 1XYEA 3QM7A 2W72B 3IC0A 1HBSB 1SDLB 1MKOA 1OFKA 4OODA 2GRHA 1SDKB 2GRFA 1C7CB 1Y8HB 1QPWB 3WFUA 5D1VA 5E83A 1HACB 1HV4A 1LFZA 2ZSXA 3IXFA 3V2VA 2D2NB 1QSHA 2ZT4A 1H1XA 4FWYA 4M4BB 4HRRA 2BWHA 2ZS1D 1JBOA 4ESAA 3CIUB 1YEVB 1CG8A 1Y7DA 1Y5KB 1Y0AA 3KMFC 2UULD 1NY9A 3G4RA 1YG5B 4O4ZA 1J3FA 3BCQA 1HLBA 2D60A 3ZJIA 1NQPA 2GTLC 1LH3A 1IDRA 4MQKA 3OO5A 3LB1A 4HHBB 3CY5A 3S66A 1G08A 3P5QA 1SHRB 2HZ2A 1AJHA 5HY8B 3RQRA 2RI4B 3WCUA 1CH4A 2V1FA 1YDZB 4XXKA 1YVQA 3ZJSA 3ZOMA 1O1MB 3HYUA 2AURA 4ROMA 1SPGA 3UHNA 3VAUA 2PGHB 1TOXA 5EYJA 2HBEB 3MJUB 3AT5A 1OJ6A 5HBIA 1MWDA 1FHJB 1GLIB 1NS9B 3UHCA 4YU4B 1UT0A 4F6JA 2MYCA 2H8FA 1IBEA 5CMVA 1O16A 2MYDA 1C7CA 2QLSB 3LQ9A 3ECZA 5E29B 3MYMA 4YJJB 1GCVA 1FN3A 3MBAA 3WCTA 2HBDB 5EV5A 1RQ3A 2V1KA 1GCVB 2EKUA 1YGFB 2Z6TA 2ZLWA 3LR7A 3NG6B 2ZFOA 2MYEA 5C6EA 1MYHA 1Y4PA 1MYFA 1HBGA 1DO3A 2MGKA 3O18A 1XZ4B 1Y83B 3PI9B 1Y83A 3WCPB 1IWHA 4RMPB 3D7OB 1XDTT 2MGDA 3H57A 1JY7B 1MBDA 2ZT3A 4H0MB 4ERVA 1ALLB 1C7DB 1HHSA 1Y0DA 3WCTB 1HBAB 1V5HA 1UIWB 1O1JA 3OZWA 1FN3B 1U7SA 1AJGA 2C7JA 4F6IA 3OK5A 2QLSA 3E55A 4NI1B 1Y7DB 1O1JB 1NZ5A 1DUOA 3V58A 4B4YA 5JGGA 1SWMA 1FDHG 4M4BA 1Y31B 2W6VA 5EYSA 1C40A 2HZ3A 3FH9A 1XZVA 2ZS1B 1BUWB 1Y5FB 1RSEA 1SPEA 111MA 4AVEA 3GKTA 3MKBB 3PI3A 4FWXA 3A2GA 1SI4B 1O1OB 1JZKA 4WCHD 1MKOB 1RTXA 1B33A 4AE0A 1O1PA 2X49A 4HHBA 2CMMA 1YHEB 3GK9A 3GLNA 1A6MA 3GOUA 1Y7ZB 2UUNA 2WY4A 5JOMA 1LTWA 1PHNA 2V1IA 4NS2A 3S65B 1QGWC 2XKHA 2BV8B 1YHRA 1HA7A 1MODA 1A01B 6HBIA 1Y4VA 1VXEA 4PQBA 4XDIA 3R5IA 2D2NA 3WCVB 3VNCA 5ILPA 3ORDA 4HRRB 3FH9B 1MTIA 4NI0A 5CNDA 1DLWA 2VHBA 1K0YB 2LH5A 2UULA 2G0RA 1YCBA 1BZPA 2HHEA 1J7YA 1HHTP 1A9WE 2LH1A 3G4UA 4C0NA 2OH9A 3QM8A 3QJEB 2H35B 5B13A 1Y4GA 2SPOA 2FRIX 3QQQA 1SDLA 1DXCA 1NIHA 2G0VA 1N9HA 2G3HA 1C7DA 3KVSA 1XYEB 4MQKB 2DN2A 4F0TA 5EUIB 4N7NA 1OUTB 2ZLVB 2MHBB 1S61A 2UUMA 2HBCA 1Y4RB 3BJ2A 3QJBA 4F0TB 1GDKA 2VJHA 2B7HA 2VJRA 2I88A 4MU5A 1YFFA 2R4ZA 4G1BA 2NX0A 1MYZA 4PNJA 1HGBB 3WCUC 4ODCA 2HHDB 1J3YA 1GDIA 2ZFBA 2AA1B 1HACA 1HV4B 1LFZB 4NI0B 1GDJA 3AQ8A 1IT2A 1RQAA 2AA1A 1X46A 5AQDA 2D5XB 1RQ3B 5CNCA 3PT7B 4TWUA 1A00A 3AQ9A 1YMCA 4PQCA 4H07A 2O5OX 4DWTA 2D2MC 1YEOB 1YZIB 3WCWC 5HU6A 2AUQA 2BLHA 2MHBA 2MGMA 1FDHA 2BV8A 2O5QX 3ARLA 3MWNA 3MYNA 2ZWJA 1DM1A 1OBMA 2VRYA 1Y85A 1Y46A 4N7PB 3UHDA 2MGIA 3OO4A 1YHUD 1CBMA 1G0BB 1S5XB 4G51A 5FVBM 1LFVB 3O2CA 2NSSA 1A87A 3UGYA 1MLGA 4HH1A 2G0SA 3V58B 1DXVB 2UULH 2VLZA 1UVMA 1XZVB 1RQ4B 1RQ4A 3FS4A 3ZJJA 1HCOA 1LFYA 3ASEA 4Z8KA 2FRJX 4MQGB 4ZIZA 2MGEA 2M6ZA 4IT8A 3DBJB 2C7LA 1FHJA 1YOIA 3K8BA 4MAXA 1DO1A 3AT5B 3UHHA 3V2ZA 2HBEA 2QSSB 1YH9B 1SDKA 1Y85B 2HBGA 4ROMB 2ZS0D 1YDZA 2W6WA 1JY7A 1J40B 5AZQA 2UUND 4B3WA 4A8QA 1G0AB 2HZ1A 4B02A 1UFPA 4LMXB 4TYXA 1A0ZB 3UH3A 1MBAA 2VLYA 1LH7A 4ETUA 2GTLD 1DTIA 3A5AA 1O1NA 1K1KB 1NPFA 1NQPB 3UGZA 1VXGA 5JGGB 3NFEB 1UVNA 1HABB 4G1VA 2HBSA 3PI8B 3PT7A 1RH1A 1L2KA 1KFRA 1QXDA 4A8MP 2O58X 2MGHA 1CH3A 1S69A 1BZ0A 1NIHB 3SZKB 1XXTB 3UI0A 1VREA 2Z6NA 1R1XB 4MQHA 1IT3A 2YSKA 1NZ2A 1Y2ZA 3HYUB 3BJ3A 5CNGA 1A9WA 3D7OA 4Q70B 1XZ2A 3GYSA 2UUMB 3D17B 3IC0B 1MOBA 2C0KA 3S48C 3GQRA 5IKSA 1OUTA 1HGAB 2ZLXA 4NZIA 1Y0TB 4XXIA 2VJRB 3NL7A 1JF3A 1GDLA 1VXFA 2ZT1A 5KDQB 4PQ6A 2IG3A 2ZS1C 1CPCA 1Y4QB 5ILMA 3UHKA 3MOUA 4XS0B 1A4FB 4MXLA 3ZTAA 3UHBA 2IN4A 2R1HA 4JACA 2GLNA 1JBOB 3BOMA 2V8AA 1Y45B 1JP8A 1VXDA 1GJNA 1GH0A 1N9FA 3AT6A 1J7YB 1B33B 1F0LA 1UVKA 2M6ZB 2QMBB 2R4YA 2UULB 1G09B 3TM3A 1YIHA 4UIQA 1H97A 4N6SB 2LH2A 2PGHA 1CLSA 3GQGA 3M3BA 1O1IA 1YVQB 1Y8WA 112MA 2EB8A 1YHUB 1Y8HA 3WTGB 1DWRA 4L1EA 1YEQA 5HY8A 1Y7ZA 4KN3A 4NXAA 2JL9A 3VRFB 2ZS0A 1Y7GA 4A8FA 1O1NB 3UHVA 3UHRA 2DKDA 1BBBA 1GVHA 2LH6A 3HXNB 5KDQA 3DR9A 1CG8B 2QRWA 1LFLB 1J7WB 1AJ9A 2NRMA 4A8KA 3QMAA 4N6SA 2AV3A 4HSXA 3ECXA 1G09A 5CNEA 1QI8A 2MGBA 3NUHB 3L0FB 4U8UD 3WI8A 1MNKA 1C40B 3DBJA 1HGCB 1V4WA 1PBXA 109MA 4MQGA 2Z85A 1BZRA 1BZZA 1CH1A 3UHQA 1GBVB 1JZLA 1YGDA 3ZJOA 1MBOA 1CH5A 1V4XB 3IC2B 1LJWB 1GBVA 2HHBA 4A8WA 1EMYA 3LR9A 3WHMA 2D2MA 1CIKA 5KERB 3LHBA 4YU3A 1UVLA 3PELB 3WCTD 3NMMB 2KSCA 3LQDA 2H8DA 1HBBB 1LFTA 1FSXB 1OUUA 1AJ9B 4ROLB 1DXTA 1UVIA 1DLYA 3AQ5A 2ZFOB 5C6EB 1YENB 3SZKA 6HBWB 1LH5A 1NEJB 1Y09B 3ZH0A 1YIEA 1YGDB 3ONZA 4MPMA 1JL7A 2VEEA 2C7KB 4F6GA 1ABYB 4ESUA 1Y0TA 3EU1B 2R80A 1ITHA 1ECAA 1LH1A 3A59B 5CN8A 3PT8B 3QJCB 4HRTA 4Q70A 3ODQB 4GXEB 2H8FB 4MBNA 4ESAB 1Y8IB 3K9ZA 1ECDA 1VXAA 5SW7A 2MYBA 1J40A 1BABB 1Y01B 4U8UB 3DHRB 3M3AA 3WCWA 1FSXA 3S65A 2UULC 2PEGB 1KTPA 2SPNA 1WVPA 1F65A 1BIJB 1R1YB 2BKMA 106MA 3CY5B 1HJTA 3LB2A 1V4UB 3S1IA 1KD2B 3KVSB 4F69A 1SGKA 3DHTB 1CH9A 3O89A 3WTGA 4MXKA 2DXMB 1HDAB 1X9FA 2D2MD 1UMOA 3D1KA 5CNFA 1Y35B 3GYSB 1XZ5B 1HGCA 1CP5A 3EOKB 1QSIB 3D1KB 4G51B 5CN6A 1BINA 2JLGA 3HRWA 2OLPA 2NRLA 1QSIA 1YHUC 2HHDA 1T1NA 2D2ND 2DN1B 5M3SA 1YFFB 2OH8A 5EE4D 1HCOB 1LFLA 2B7HB 2O5BX 5E6EB 5E6EA 3QJDB 3FS4B 3HXNA 4MQCA 3UBVA 1B86B 1S5YA 4FWZA 1R1YA 4A8SA 3G4QA 1MYJA 1CO9A 5ILEA 1UVYA 1I3DA 1HLMA 3EOKA 1O1OA 1HBIA 3QJEA 2D2NC 1J7SB 3HRWB 3BJ3B 2FAMA 3W4UA 2HHEB 4L7YB 1AZIA 5C6YA 2BLIA 1O1IB 3A0GB 3WCVD 4HRTB 1A01A 1RVWB 3DUTB 3R0GA 3UHWA 2R80B 1HA7B 4FC3B 1V75A 2HBFA 2EKTA 3WCVA 4NI1A 3PI2A 1YEUB 1MBNA 2LH3A 3HEPA 4F4OB 3WFXA 3WCUD 4MQIB 4TWVA 1KD2A 4NK2A 5D5RA 4C44A 4KMVA 3PIAA 2AUOA 2MGLA 1DXTB 3O2CB 1LFVA 1Y5JA 5CN5A 4U8UA 5ILRA 4ILZA 1KN1B 1JL6A 1Y0CA 1HBBA 1Y4GB 2DN3A 3G52A 1VRFA 1J7SA 1ASHA 3A5GA 1BJEA 4F68A 1KN1A 1O1PB 1D8UA 3S66B 1TU9A 1XY0B 4F0UB 1Y4RA 3QJBB 1Y8IA 1N9XA 1YEUA 107MA 3IC2A 4WJGA 3M39A 2BMMA 2OIFA 1ABYA 5B84A 4M4AB 1CH2A 4YJJA 1THBB 3KUOA 3QZXA 1JEBA 4PO5B 1HBRB 3OGBA 4LMSB 1QPWA 1IRCA 2GTLA 1MZ0A 1HABA 3QM6A 1MLKA 1GLIA 1NS9A 4YU4A 2VYZA 4L2MA 3BRPA 2FALA 1Q1FA 2G0XA 2H8DB 1DKEA 1QI8B 1HRMA 1X9FB 2ZSNA 3OVUC 4HBIA 2V1EA 3UHSA 5AZRA 3NG6A 2ZSQA 1Y0CB 1HI0P 4OF9A 2LHBA 3E5OA 3D1AB 2ZLUA 2QSSA 1FLPA 1MLQA 4O4TA 1MLHA 1FAWB 2HHBB 1PBXB 1HBRA 1V4XA 3E5IA 3UHXA 3ZJRA 1IBEB 2W31A 108MA 2G14A 2X4AA 1YEVA 1UIWA 3WCWD 1ON7B 1MGNA 1ALLA 1BABA 1XZ5A 4ETTA 1J3ZA 1DXVA 1Y7CB 1HDBA 1BZ1A 1ABSA 1LIAA 2ZSYA 4H0BA 5CHQA 3EDBA 1J3ZB 3ZJNA 1HGBA 1YMBA 1BBBB 1COLA 1YIHB 3G53A 1DTMA 3QM9A 1SHRA 1XG0C 3P5QB 1Y4BA 1Y09A 1GH0B 2ZT0A 3KMFA 1NS6A 1Y0WA 1MYTA 4QAUA 2DN2B 3GDJA 4N8TA 1UC3A 1M9PA 1J41A 4H0MA 1CQXA 4LPIA 3UH7A 1GCWB 1YEOA 1F5PA 2MBWA 2NSRA 1S56A 2VMLB 2WCRA 2W6YA 1MLSA 1S0HB 1MNHA 1HGAA 2ZLXB 1A3OB 3GQRB 3HHBB 3DUTA 3UHGA 2LH7A 5AQDM 1A3OA 2JHOA 2ZLWB 3G4YA 3A9MA 1A4FA 4TMAB 1QXDB 2YRSB 1JDOA 1XXTA 3BOMB 5JDOC 1MBSA 2E2YA 1J41B 1MLUA 3RJNB 1Y4FB 1I3EA 101MA 4ROLA 1WMUB 2XYKA 1JZMA 6HBWA 1YVTA 1NS6B 3L0FA 4O1TA 1XZ2B 3E4NA 4O35A 2V1HA 4AVDA 2AUPA 1BZ6A 4N7OB 1JF4A 2WTGA 1FSLA 4IROB 1BZ1B 1LIAB 2BNLA 1MNJA 2V1GA 1CP0A 4UZVA 4M4AA 1K0YA 2HBSB 1UX9A 102MA 3PI4A 1JW8A 1CG5B 4F4OA 2ZFOC 1JPBA 1U7RA 1MYIA 3S1JA 1Y0AB 1LHSA 1W92A 3ZHWA 3RGKA 4Z8KB 3NFEA 1HBHB 1F99A 1EYXA 1XZUA 2DC3A 4A8YA 1ECNA 1M6CA 1EWAA 1MDNA 3SDHA 1F63A 1LUEA 3AG0A 1EBCA 3GQPA 4IROA 2ZLTA 2VMLA 3VRGA 2GNVA 3WCUB 3OO4B 1ECOA 2EVKA 5MBAA 3GQPB 4WJG1 2R50A 2G11A 5SW7B 5KERA 3ECLA 1A0UB 1Y46B 4N7PA 3QM5A 5EQMA 3MVCA 1JEBB 1IRDB 3ODQA 1MYGA 3QJDA 4X0LB 1V75B 2VEBA 4ETVA 3CIUA 1RPSA 1O1LA 5CHRA 3ZJMA 4X0LA 1MNIA 3G4VA 4DC7A 1Y7CA 4F0UA 1Y2ZB 1GBUB 1CPWA 3WFWA 4BJAA 3GIOA 1FCSA 1VHBA 3A0GA 4MBAA 3QQRA 4A8OA 3VREB 1G9VA 3WCTC 2RI4A 2ZSRA 1GCWA 4RMPA 3BJ2B 2FRKX 1YZIA 1A3NA 4NXCA 5JDOD 5HLUA 1I7YB 1JWNA 1YOHA 1DXDA 3GKVA 4KMWA 4DWUA 4XS0A 2ZSTA 4MQIA 2D2MB 2W72C 1I7YA 2R4XA 1B8DB 1DXUA 2ZSZA 1Y5KA 1RQAB 1ABWB 2HBDA 3KUNA 3OZVA 2QU0A 3OJ1A 2YRSA 1N9IA 1MDTA 2D5XA 1LA6A 5EOHA 2QMBA 2WCQA 2GRZA 3AT6B 3LB4A 1Y8KB 5F2AA 1X9FD 1MTKA 2W72A 1SPGB 1LFQB 5HAVA 2VM0A 3PI1A 1BZ0B 2C7KA 3ZJQA 3G4WA 3G46A 3M38A 3GUQA 4N8TB 1CQ2A 1F5OA 1JP6A 1RTEA 2GL3A 2UUNB 103MA 1CBLA 4BS9A 1A3NB 1YVTB 1YHRB 1CMYB 4JYQA 2ZS0B
chains in the Genus database with same CATH topology
1MLMA 2MYAA 1IRDA 3UHYA 4H2LB 5CN9A 2BK9A 1LH2A 1NPGA 2MGFA 7HBIA 2QFKA 3D17A 1VXHA 1G0AA 3UHTA 3MJPB 4ZVBA 3HC9A 3PELA 2D5ZA 3AQ7A 2VYWA 110MA 3K8BB 2BLJM 1XZUB 1O1LB 2O5MX 2GNWA 2ZS1A 3ED9A 1HDAA 1YIEB 3ONZB 2GDMA 1XZ7B 3A59A 4NK1A 3GOUB 2WTHA 1YCAA 2ZLUB 5CN7A 1QXEB 2SPLA 4L7YA 2EVPA 1NWIA 3MJPA 1A0ZA 3VHBA 1UX8A 3WR1B 3WCVC 3HF4A 1Y0DB 5B85A 1DO7A 2O5SX 1HDSB 2XKGA 2ZSPA 1MBIA 1S5XA 4HSWA 2VYYA 1HDSA 2O5LX 1XQ5B 1DKEB 1HDBB 2MB5A 2QSPA 1B86A 2SPMA 3PI9A 2Z8AA 2W6VB 1Y31A 2HCOB 1DUKA 1Y4FA 1CG5A 2RAOA 2GKMA 1R1XA 1S6AA 1HHOA 1HHOB 1VXBA 1A00B 4KJTA 1LFYB 1TESA 1YGFA 2RAOB 3LB3A 1GZXA 1KR7A 1EBTA 1C7BB 4F6DA 1BZZB 5HLQA 4MQJB 1MLNA 1IOPA 1V4WB 1CLSB 3D1AA 1MYMA 1M6MA 3D4XB 1J52A 4O2GA 3WCPA 4N7OA 3ZJHA 3RJ6A 3W4UB 1MLJA 1XQ5A 1G0BA 1MLOA 3HF4B 4FH7A 2HBCB 1EW6A 2G10A 4YU3B 1OR6A 3HHBA 4H2LA 1NGKA 1Y7GB 3VRFA 3U3EA 1NAZA 1O1KB 3WHMB 2OHAA 2DN3B 2GTLB 1MBCA 1YG5A 1Y5JB 3OZUA 4U8UC 5MBNA 3UH5A 3OO5B 3GDJB 3BCQB 3GQGB 1Y0WB 1XZ7A 3K3UA 1YEQB 2G12A 1GBUA 1NWNA 1Y4BB 2FRFA 1MLFA 1XY0A 2V1JA 4GZGA 2QFNA 2EF2A 3D4XA 1J3YB 1YE0A 1NZ3A 3AQ6A 1O1MA 1RPSB 1URYA 1MLLA 2D6CA 2VLXA 1M9PB 5KKKA 3WR1A 1A6KA 1A0UA 1Y22A 3HENA 1CH7A 3NL7B 3EDAA 3H58A 1K1KA 1CO8A 1BIJA 1OUUB 1SI4A 2QSPB 1VWTB 4MQCB 5CN4A 1O1KA 1MCYA 1X3KA 2H35A 1JP9A 3WCWB 1MTJA 1LFQA 1XZ4A 1LA6B 4MQHB 1Y8KA 1Y4PB 2Z6NB 1MOAA 1A6NA 1HBHA 3TM9A 1HBSA 5EU2A 2GKNA 1LJWA 2XKIA 3UHZA 1GZXB 3QJCA 1THBA 2G0ZA 4VHBA 1A6GA 1Y35A 1FAWA 2R4WA 1YOGA 3IA3B 5HLXA 4FH6A 1DO4A 1URVA 1Y4QA 2ZT2A 3ZOLA 1DXUB 1S5YB 2Z6SA 1YENA 3UHIA 1VXCA 1LFTB 1Y22B 1J7WA 2MGCA 1DWTA 1OR4A 2D5ZB 2ZSOA 2PEGA 3MKBA 1IWHB 2AV0A 3VRGB 2EB9A 1BUWA 1Y5FA 1WMUA 3A5BA 4DC8A 3MN0A 1YE0B 4SDHA 2W6XA 1YH9A 3UHEA 105MA 1C7BA 3EU1A 1BVCA 5JDOE 4ZVAA 1V07A 3UH6A 2DXMA 3ZJLA 1YHUA 1COHB 3B75B 1Y4VB 104MA 5JDOF 3NMLA 1WLAA 1YMAA 1LH6A 2HBFB 4FC3A 3O7NA 1MWCA 3LQDB 2BW9M 4F6FA 1PMBA 2OHBA 2ZFBB 2DHBB 3NMMA 1X9FC 4UURA 1Y45A 3DHRA 5EE4C 2QU0B 4F6BA 3HEOA 2ZFOD 3PIAB 1ABWA 1XCHA 2DHBA 2O5TX 1UFJA 2ZLTB 1MWBA 5CNBA 3WFTA 3SDNA 1QXEA 1LHTA 1YE2B 2ZLVA 3BJ1B 1OFJA 1BVDA 1CMYA 3ARJA 3PT8A 3GKVB 4MQJA 3TLDA 5HU6B 1RVWA 3UHUA 5EETA 1COHA 3B75A 1T1NB 2DN1A 2MGAA 1NEJA 1HSYA 5F0BA 5E29A 1DWSA 1Y8WB 3ARKA 1NZ4A 3VREA 3BA2A 1HBAA 2MGGA 3QZZA 1QSHB 4ODCB 2HCOA 3MJUA 5E83B 3ZJPA 1MOCA 1MNOA 1CIOA 1S0HA 1V9QA 1NXFA 3R5IB 1MLRA 1B0BA 1VWTA 3PI8A 3UBCA 1MOHA 2R1HB 1G08B 1UVXA 3BJ1A 1YE2A 1Z8UB 2D60B 2MGJA 3DHTA 4N7NB 5EUIA 1YHEA 5AB8A 1V4UA 1G9VB 2ZSSA 2ZS0C 1XYEA 3QM7A 2W72B 3IC0A 1HBSB 1SDLB 1MKOA 1OFKA 4OODA 2GRHA 1SDKB 2GRFA 1C7CB 1Y8HB 1QPWB 3WFUA 5D1VA 5E83A 1HACB 1HV4A 1LFZA 2ZSXA 3IXFA 3V2VA 2D2NB 1QSHA 2ZT4A 1H1XA 4FWYA 4M4BB 4HRRA 2BWHA 2ZS1D 4ESAA 3CIUB 1YEVB 1CG8A 1Y7DA 1Y5KB 1Y0AA 3KMFC 3G4RA 1YG5B 4O4ZA 1J3FA 3BCQA 1HLBA 2D60A 3ZJIA 1NQPA 2GTLC 1LH3A 1IDRA 4MQKA 3OO5A 3LB1A 4HHBB 3CY5A 3S66A 1G08A 3P5QA 1SHRB 2HZ2A 1AJHA 5HY8B 2RI4B 3WCUA 1CH4A 2V1FA 1YDZB 1YVQA 3ZJSA 3ZOMA 1O1MB 3HYUA 2AURA 4ROMA 1SPGA 3UHNA 3VAUA 2PGHB 5EYJA 2HBEB 3MJUB 3AT5A 1OJ6A 5HBIA 1MWDA 1FHJB 1GLIB 1NS9B 3UHCA 4YU4B 1UT0A 4F6JA 2MYCA 2H8FA 1IBEA 5CMVA 1O16A 2MYDA 1C7CA 2QLSB 3ECZA 5E29B 3MYMA 1GCVA 1FN3A 3MBAA 3WCTA 2HBDB 5EV5A 1RQ3A 2V1KA 1GCVB 2EKUA 1YGFB 2Z6TA 2ZLWA 3LR7A 3NG6B 2ZFOA 2MYEA 5C6EA 1MYHA 1Y4PA 1MYFA 1HBGA 1DO3A 2MGKA 3PI9B 1XZ4B 1Y83B 1Y83A 3WCPB 1IWHA 3D7OB 2MGDA 3H57A 1JY7B 1MBDA 2ZT3A 1C7DB 1Y0DA 3WCTB 1HBAB 1V5HA 1UIWB 1O1JA 3OZWA 1FN3B 1U7SA 1AJGA 4F6IA 3OK5A 2QLSA 3E55A 4NI1B 1Y7DB 1O1JB 1NZ5A 1DUOA 4B4YA 5JGGA 1SWMA 1FDHG 4M4BA 1Y31B 2W6VA 5EYSA 1C40A 2HZ3A 3FH9A 1XZVA 2ZS1B 1BUWB 1Y5FB 1RSEA 1SPEA 111MA 4AVEA 3GKTA 3MKBB 3PI3A 4FWXA 3A2GA 1SI4B 1O1OB 1JZKA 4WCHD 1MKOB 1RTXA 1O1PA 4HHBA 2CMMA 1YHEB 3GK9A 3GLNA 1A6MA 3GOUA 1Y7ZB 2WY4A 5JOMA 1LTWA 2V1IA 4NS2A 3S65B 2XKHA 1YHRA 1MODA 1A01B 6HBIA 1Y4VA 1VXEA 4PQBA 4XDIA 3R5IA 2D2NA 3WCVB 5ILPA 3ORDA 4HRRB 3FH9B 1MTIA 4NI0A 5CNDA 1DLWA 2VHBA 1K0YB 2LH5A 2G0RA 1YCBA 1BZPA 2HHEA 1J7YA 1A9WE 2LH1A 3G4UA 4C0NA 2OH9A 3QM8A 3QJEB 2H35B 1Y4GA 2SPOA 2FRIX 3QQQA 1SDLA 1DXCA 1NIHA 2G0VA 1N9HA 2G3HA 1C7DA 1XYEB 4MQKB 2DN2A 5EUIB 4N7NA 1OUTB 2ZLVB 2MHBB 1S61A 2HBCA 1Y4RB 3BJ2A 3QJBA 1GDKA 2B7HA 4MU5A 1YFFA 2R4ZA 4G1BA 2NX0A 1MYZA 4PNJA 1HGBB 3WCUC 4ODCA 2HHDB 1J3YA 1GDIA 2ZFBA 2AA1B 1HACA 1HV4B 1LFZB 4NI0B 1GDJA 3AQ8A 1IT2A 1RQAA 2AA1A 1X46A 2D5XB 1RQ3B 5CNCA 3PT7B 4TWUA 1A00A 3AQ9A 1YMCA 4PQCA 4H07A 2O5OX 4DWTA 2D2MC 1YEOB 1YZIB 3WCWC 5HU6A 2AUQA 2BLHA 2MHBA 2MGMA 1FDHA 2O5QX 3ARLA 3MYNA 2ZWJA 1DM1A 1OBMA 2VRYA 1Y85A 1Y46A 4N7PB 3UHDA 2MGIA 3OO4A 1YHUD 1CBMA 1G0BB 1S5XB 4G51A 1LFVB 2NSSA 3UGYA 1MLGA 2G0SA 1DXVB 2VLZA 1XZVB 1RQ4B 1RQ4A 3FS4A 3ZJJA 1HCOA 1LFYA 3ASEA 2FRJX 4MQGB 2MGEA 2M6ZA 4IT8A 1FHJA 1YOIA 3K8BA 4MAXA 1DO1A 3AT5B 3UHHA 3V2ZA 2HBEA 2QSSB 1YH9B 1SDKA 1Y85B 2HBGA 4ROMB 2ZS0D 1YDZA 2W6WA 1JY7A 1J40B 5AZQA 4B3WA 1G0AB 2HZ1A 1UFPA 4TYXA 1A0ZB 3UH3A 1MBAA 2VLYA 1LH7A 2GTLD 1DTIA 3A5AA 1O1NA 1K1KB 1NPFA 1NQPB 3UGZA 1VXGA 5JGGB 3NFEB 1HABB 4G1VA 2HBSA 3PI8B 3PT7A 1L2KA 1KFRA 1QXDA 2O58X 2MGHA 1CH3A 1S69A 1BZ0A 1NIHB 3SZKB 1XXTB 3UI0A 1VREA 2Z6NA 1R1XB 4MQHA 1IT3A 1NZ2A 1Y2ZA 3HYUB 3BJ3A 5CNGA 1A9WA 3D7OA 1XZ2A 3GYSA 3D17B 3IC0B 1MOBA 2C0KA 3S48C 3GQRA 5IKSA 1OUTA 1HGAB 2ZLXA 4NZIA 1Y0TB 3NL7A 1JF3A 1GDLA 1VXFA 2ZT1A 5KDQB 4PQ6A 2IG3A 2ZS1C 1Y4QB 5ILMA 3UHKA 3MOUA 4XS0B 1A4FB 4MXLA 3UHBA 2IN4A 2R1HA 4JACA 2GLNA 3BOMA 1Y45B 1JP8A 1VXDA 1GJNA 1N9FA 3AT6A 1J7YB 2M6ZB 2QMBB 2R4YA 1G09B 3TM3A 1YIHA 4UIQA 1H97A 2LH2A 2PGHA 1CLSA 3GQGA 3M3BA 1O1IA 1YVQB 1Y8WA 112MA 2EB8A 1YHUB 1Y8HA 3WTGB 1DWRA 1YEQA 5HY8A 1Y7ZA 4KN3A 4NXAA 3VRFB 2ZS0A 1Y7GA 1O1NB 3UHVA 3UHRA 1BBBA 1GVHA 2LH6A 3HXNB 5KDQA 3DR9A 1CG8B 2QRWA 1LFLB 1J7WB 1AJ9A 2NRMA 3QMAA 2AV3A 4HSXA 3ECXA 1G09A 5CNEA 1QI8A 2MGBA 4U8UD 3WI8A 1MNKA 1C40B 1HGCB 1V4WA 1PBXA 109MA 4MQGA 2Z85A 1BZRA 1BZZA 1CH1A 3UHQA 1GBVB 1JZLA 1YGDA 3ZJOA 1MBOA 1CH5A 1V4XB 3IC2B 1LJWB 1GBVA 2HHBA 1EMYA 3LR9A 3WHMA 2D2MA 1CIKA 5KERB 3LHBA 4YU3A 3PELB 3WCTD 3NMMB 2KSCA 3LQDA 2H8DA 1HBBB 1LFTA 1FSXB 1OUUA 1AJ9B 4ROLB 1DXTA 1DLYA 3AQ5A 2ZFOB 5C6EB 1YENB 3SZKA 6HBWB 1LH5A 1NEJB 1Y09B 3ZH0A 1YIEA 1YGDB 3ONZA 4MPMA 1JL7A 2VEEA 4F6GA 1ABYB 1Y0TA 3EU1B 2R80A 1ITHA 1ECAA 1LH1A 3A59B 5CN8A 3PT8B 3QJCB 4HRTA 3ODQB 2H8FB 4MBNA 4ESAB 1Y8IB 3K9ZA 1ECDA 1VXAA 5SW7A 2MYBA 1J40A 1BABB 1Y01B 4U8UB 3DHRB 3M3AA 3WCWA 1FSXA 3S65A 2PEGB 2SPNA 1WVPA 1F65A 1BIJB 1R1YB 2BKMA 106MA 3CY5B 1HJTA 3LB2A 1V4UB 3S1IA 1KD2B 4F69A 3DHTB 1CH9A 3O89A 3WTGA 4MXKA 2DXMB 1HDAB 1X9FA 2D2MD 1UMOA 3D1KA 5CNFA 1Y35B 3GYSB 1XZ5B 1HGCA 1CP5A 3EOKB 1QSIB 3D1KB 4G51B 5CN6A 1BINA 3HRWA 2OLPA 2NRLA 1QSIA 1YHUC 2HHDA 1T1NA 2D2ND 2DN1B 5M3SA 1YFFB 2OH8A 5EE4D 1HCOB 1LFLA 2B7HB 2O5BX 5E6EB 5E6EA 3QJDB 3FS4B 3HXNA 4MQCA 3UBVA 1B86B 1S5YA 4FWZA 1R1YA 3G4QA 1MYJA 1CO9A 5ILEA 1UVYA 1I3DA 1HLMA 3EOKA 1O1OA 1HBIA 3QJEA 2D2NC 1J7SB 3HRWB 3BJ3B 2FAMA 3W4UA 2HHEB 4L7YB 1AZIA 5C6YA 2BLIA 1O1IB 3A0GB 3WCVD 4HRTB 1A01A 1RVWB 3DUTB 3R0GA 3UHWA 2R80B 4FC3B 1V75A 2HBFA 2EKTA 3WCVA 4NI1A 3PI2A 1YEUB 1MBNA 2LH3A 3HEPA 4F4OB 3WFXA 3WCUD 4MQIB 4TWVA 1KD2A 4NK2A 5D5RA 4C44A 4KMVA 3PIAA 2AUOA 2MGLA 1DXTB 1LFVA 1Y5JA 5CN5A 4U8UA 5ILRA 4ILZA 1JL6A 1Y0CA 1HBBA 1Y4GB 2DN3A 3G52A 1VRFA 1J7SA 1ASHA 3A5GA 1BJEA 4F68A 1O1PB 1D8UA 3S66B 1TU9A 1XY0B 1Y4RA 3QJBB 1Y8IA 1N9XA 1YEUA 107MA 3IC2A 4WJGA 3M39A 2BMMA 2OIFA 1ABYA 5B84A 4M4AB 1CH2A 1THBB 3KUOA 3QZXA 1JEBA 1HBRB 3OGBA 1QPWA 1IRCA 2GTLA 1MZ0A 1HABA 3QM6A 1MLKA 1GLIA 1NS9A 4YU4A 2VYZA 4L2MA 2FALA 1Q1FA 2G0XA 2H8DB 1DKEA 1QI8B 1HRMA 1X9FB 2ZSNA 3OVUC 4HBIA 2V1EA 3UHSA 5AZRA 3NG6A 2ZSQA 1Y0CB 4OF9A 2LHBA 3E5OA 3D1AB 2ZLUA 2QSSA 1FLPA 1MLQA 4O4TA 1MLHA 1FAWB 2HHBB 1PBXB 1HBRA 1V4XA 3E5IA 3UHXA 3ZJRA 1IBEB 2W31A 108MA 2G14A 1YEVA 1UIWA 3WCWD 1MGNA 1BABA 1XZ5A 1J3ZA 1DXVA 1Y7CB 1HDBA 1BZ1A 1ABSA 2ZSYA 4H0BA 5CHQA 3EDBA 1J3ZB 3ZJNA 1HGBA 1YMBA 1BBBB 1YIHB 3G53A 1DTMA 3QM9A 1SHRA 3P5QB 1Y4BA 1Y09A 2ZT0A 3KMFA 1NS6A 1Y0WA 1MYTA 4QAUA 2DN2B 3GDJA 4N8TA 1UC3A 1M9PA 1J41A 1CQXA 4LPIA 3UH7A 1GCWB 1YEOA 1F5PA 2MBWA 2NSRA 1S56A 2W6YA 1MLSA 1S0HB 1MNHA 1HGAA 2ZLXB 1A3OB 3GQRB 3HHBB 3DUTA 3UHGA 2LH7A 1A3OA 2JHOA 2ZLWB 3G4YA 3A9MA 1A4FA 1QXDB 2YRSB 1JDOA 1XXTA 3BOMB 5JDOC 1MBSA 2E2YA 1J41B 1MLUA 3RJNB 1Y4FB 1I3EA 101MA 4ROLA 1WMUB 2XYKA 1JZMA 6HBWA 1YVTA 1NS6B 4O1TA 1XZ2B 3E4NA 4O35A 2V1HA 4AVDA 2AUPA 1BZ6A 4N7OB 1JF4A 2WTGA 1FSLA 4IROB 1BZ1B 2BNLA 1MNJA 2V1GA 1CP0A 4UZVA 4M4AA 1K0YA 2HBSB 1UX9A 102MA 3PI4A 1JW8A 1CG5B 4F4OA 2ZFOC 1JPBA 1U7RA 1MYIA 3S1JA 1Y0AB 1LHSA 1W92A 3ZHWA 3RGKA 3NFEA 1HBHB 1XZUA 2DC3A 1ECNA 1M6CA 1EWAA 1MDNA 3SDHA 1F63A 1LUEA 3AG0A 1EBCA 3GQPA 4IROA 2ZLTA 3VRGA 2GNVA 3WCUB 3OO4B 1ECOA 2EVKA 5MBAA 3GQPB 4WJG1 2R50A 2G11A 5SW7B 5KERA 3ECLA 1A0UB 1Y46B 4N7PA 3QM5A 5EQMA 3MVCA 1JEBB 1IRDB 3ODQA 1MYGA 3QJDA 4X0LB 1V75B 2VEBA 3CIUA 1RPSA 1O1LA 5CHRA 3ZJMA 4X0LA 1MNIA 3G4VA 4DC7A 1Y7CA 1Y2ZB 1GBUB 1CPWA 3WFWA 4BJAA 1FCSA 1VHBA 3A0GA 4MBAA 3QQRA 3VREB 1G9VA 3WCTC 2RI4A 2ZSRA 1GCWA 3BJ2B 2FRKX 1YZIA 1A3NA 4NXCA 5JDOD 5HLUA 1JWNA 1YOHA 1DXDA 3GKVA 4KMWA 4DWUA 4XS0A 2ZSTA 4MQIA 2D2MB 2W72C 2R4XA 1DXUA 2ZSZA 1Y5KA 1RQAB 1ABWB 2HBDA 3KUNA 3OZVA 2QU0A 3OJ1A 2YRSA 1N9IA 2D5XA 1LA6A 5EOHA 2QMBA 2GRZA 3AT6B 3LB4A 1Y8KB 5F2AA 1X9FD 1MTKA 2W72A 1SPGB 1LFQB 5HAVA 2VM0A 3PI1A 1BZ0B 3ZJQA 3G4WA 3G46A 3M38A 4N8TB 1CQ2A 1F5OA 1JP6A 1RTEA 2GL3A 103MA 1CBLA 1A3NB 1YVTB 1YHRB 1CMYB 4JYQA 2ZS0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MLM A;  2MYA A;  1IRD A;  3UHY A;  4H2L B;  5CN9 A;  2BK9 A;  1LH2 A;  1NPG A;  2MGF A;  7HBI A;  2QFK A;  3D17 A;  1VXH A;  1G0A A;  3UHT A;  3MJP B;  4ZVB A;  3HC9 A;  3PEL A;  2D5Z A;  3AQ7 A;  2VYW A;  110M A;  3K8B B;  2BLJ M;  1XZU B;  1O1L B;  2O5M X;  2GNW A;  2ZS1 A;  3ED9 A;  1HDA A;  1YIE B;  3ONZ B;  2GDM A;  1XZ7 B;  3A59 A;  4NK1 A;  3GOU B;  2WTH A;  1YCA A;  2ZLU B;  5CN7 A;  1QXE B;  2SPL A;  4L7Y A;  2EVP A;  1NWI A;  3MJP A;  1A0Z A;  3VHB A;  1UX8 A;  3WR1 B;  3WCV C;  3HF4 A;  1Y0D B;  5B85 A;  1DO7 A;  2O5S X;  1HDS B;  2XKG A;  2ZSP A;  1MBI A;  1S5X A;  4HSW A;  2VYY A;  1HDS A;  2O5L X;  1XQ5 B;  1DKE B;  1HDB B;  2MB5 A;  2QSP A;  1B86 A;  2SPM A;  3PI9 A;  2Z8A A;  2W6V B;  1Y31 A;  2HCO B;  1DUK A;  1Y4F A;  1CG5 A;  2RAO A;  2GKM A;  1R1X A;  1S6A A;  1HHO A;  1HHO B;  1VXB A;  1A00 B;  4KJT A;  1LFY B;  1TES A;  1YGF A;  2RAO B;  3LB3 A;  1GZX A;  1KR7 A;  1EBT A;  1C7B B;  4F6D A;  1BZZ B;  5HLQ A;  4MQJ B;  1MLN A;  1IOP A;  1V4W B;  1CLS B;  3D1A A;  1MYM A;  1M6M A;  3D4X B;  1J52 A;  4O2G A;  3WCP A;  4N7O A;  3ZJH A;  3RJ6 A;  3W4U B;  1MLJ A;  1XQ5 A;  1G0B A;  1MLO A;  3HF4 B;  4FH7 A;  2HBC B;  1EW6 A;  2G10 A;  4YU3 B;  1OR6 A;  3HHB A;  4H2L A;  1NGK A;  1Y7G B;  3VRF A;  3U3E A;  1NAZ A;  1O1K B;  3WHM B;  2OHA A;  2DN3 B;  2GTL B;  1MBC A;  1YG5 A;  1Y5J B;  3OZU A;  4U8U C;  5MBN A;  3UH5 A;  3OO5 B;  3GDJ B;  3BCQ B;  3GQG B;  1Y0W B;  1XZ7 A;  3K3U A;  1YEQ B;  2G12 A;  1GBU A;  1NWN A;  1Y4B B;  2FRF A;  1MLF A;  1XY0 A;  2V1J A;  4GZG A;  2QFN A;  2EF2 A;  3D4X A;  1J3Y B;  1YE0 A;  1NZ3 A;  3AQ6 A;  1O1M A;  1RPS B;  1URY A;  1MLL A;  2D6C A;  2VLX A;  1M9P B;  5KKK A;  3WR1 A;  1A6K A;  1A0U A;  1Y22 A;  3HEN A;  1CH7 A;  3NL7 B;  3EDA A;  3H58 A;  1K1K A;  1CO8 A;  1BIJ A;  1OUU B;  1SI4 A;  2QSP B;  1VWT B;  4MQC B;  5CN4 A;  1O1K A;  1MCY A;  1X3K A;  2H35 A;  1JP9 A;  3WCW B;  1MTJ A;  1LFQ A;  1XZ4 A;  1LA6 B;  4MQH B;  1Y8K A;  1Y4P B;  2Z6N B;  1MOA A;  1A6N A;  1HBH A;  3TM9 A;  1HBS A;  5EU2 A;  2GKN A;  1LJW A;  2XKI A;  3UHZ A;  1GZX B;  3QJC A;  1THB A;  2G0Z A;  4VHB A;  1A6G A;  1Y35 A;  1FAW A;  2R4W A;  1YOG A;  3IA3 B;  5HLX A;  4FH6 A;  1DO4 A;  1URV A;  1Y4Q A;  2ZT2 A;  3ZOL A;  1DXU B;  1S5Y B;  2Z6S A;  1YEN A;  3UHI A;  1VXC A;  1LFT B;  1Y22 B;  1J7W A;  2MGC A;  1DWT A;  1OR4 A;  2D5Z B;  2ZSO A;  2PEG A;  3MKB A;  1IWH B;  2AV0 A;  3VRG B;  2EB9 A;  1BUW A;  1Y5F A;  1WMU A;  3A5B A;  4DC8 A;  3MN0 A;  1YE0 B;  4SDH A;  2W6X A;  1YH9 A;  3UHE A;  105M A;  1C7B A;  3EU1 A;  1BVC A;  5JDO E;  4ZVA A;  1V07 A;  3UH6 A;  2DXM A;  3ZJL A;  1YHU A;  1COH B;  3B75 B;  1Y4V B;  104M A;  5JDO F;  3NML A;  1WLA A;  1YMA A;  1LH6 A;  2HBF B;  4FC3 A;  3O7N A;  1MWC A;  3LQD B;  2BW9 M;  4F6F A;  1PMB A;  2OHB A;  2ZFB B;  2DHB B;  3NMM A;  1X9F C;  4UUR A;  1Y45 A;  3DHR A;  5EE4 C;  2QU0 B;  4F6B A;  3HEO A;  2ZFO D;  3PIA B;  1ABW A;  1XCH A;  2DHB A;  2O5T X;  1UFJ A;  2ZLT B;  1MWB A;  5CNB A;  3WFT A;  3SDN A;  1QXE A;  1LHT A;  1YE2 B;  2ZLV A;  3BJ1 B;  1OFJ A;  1BVD A;  1CMY A;  3ARJ A;  3PT8 A;  3GKV B;  4MQJ A;  3TLD A;  5HU6 B;  1RVW A;  3UHU A;  5EET A;  1COH A;  3B75 A;  1T1N B;  2DN1 A;  2MGA A;  1NEJ A;  1HSY A;  5F0B A;  5E29 A;  1DWS A;  1Y8W B;  3ARK A;  1NZ4 A;  3VRE A;  3BA2 A;  1HBA A;  2MGG A;  3QZZ A;  1QSH B;  4ODC B;  2HCO A;  3MJU A;  5E83 B;  3ZJP A;  1MOC A;  1MNO A;  1CIO A;  1S0H A;  1V9Q A;  1NXF A;  3R5I B;  1MLR A;  1B0B A;  1VWT A;  3PI8 A;  3UBC A;  1MOH A;  2R1H B;  1G08 B;  1UVX A;  3BJ1 A;  1YE2 A;  1Z8U B;  2D60 B;  2MGJ A;  3DHT A;  4N7N B;  5EUI A;  1YHE A;  5AB8 A;  1V4U A;  1G9V B;  2ZSS A;  2ZS0 C;  1XYE A;  3QM7 A;  2W72 B;  3IC0 A;  1HBS B;  1SDL B;  1MKO A;  1OFK A;  4OOD A;  2GRH A;  1SDK B;  2GRF A;  1C7C B;  1Y8H B;  1QPW B;  3WFU A;  5D1V A;  5E83 A;  1HAC B;  1HV4 A;  1LFZ A;  2ZSX A;  3IXF A;  3V2V A;  2D2N B;  1QSH A;  2ZT4 A;  1H1X A;  4FWY A;  4M4B B;  4HRR A;  2BWH A;  2ZS1 D;  4ESA A;  3CIU B;  1YEV B;  1CG8 A;  1Y7D A;  1Y5K B;  1Y0A A;  3KMF C;  3G4R A;  1YG5 B;  4O4Z A;  1J3F A;  3BCQ A;  1HLB A;  2D60 A;  3ZJI A;  1NQP A;  2GTL C;  1LH3 A;  1IDR A;  4MQK A;  3OO5 A;  3LB1 A;  4HHB B;  3CY5 A;  3S66 A;  1G08 A;  3P5Q A;  1SHR B;  2HZ2 A;  1AJH A;  5HY8 B;  2RI4 B;  3WCU A;  1CH4 A;  2V1F A;  1YDZ B;  1YVQ A;  3ZJS A;  3ZOM A;  1O1M B;  3HYU A;  2AUR A;  4ROM A;  1SPG A;  3UHN A;  3VAU A;  2PGH B;  5EYJ A;  2HBE B;  3MJU B;  3AT5 A;  1OJ6 A;  5HBI A;  1MWD A;  1FHJ B;  1GLI B;  1NS9 B;  3UHC A;  4YU4 B;  1UT0 A;  4F6J A;  2MYC A;  2H8F A;  1IBE A;  5CMV A;  1O16 A;  2MYD A;  1C7C A;  2QLS B;  3ECZ A;  5E29 B;  3MYM A;  1GCV A;  1FN3 A;  3MBA A;  3WCT A;  2HBD B;  5EV5 A;  1RQ3 A;  2V1K A;  1GCV B;  2EKU A;  1YGF B;  2Z6T A;  2ZLW A;  3LR7 A;  3NG6 B;  2ZFO A;  2MYE A;  5C6E A;  1MYH A;  1Y4P A;  1MYF A;  1HBG A;  1DO3 A;  2MGK A;  3PI9 B;  1XZ4 B;  1Y83 B;  1Y83 A;  3WCP B;  1IWH A;  3D7O B;  2MGD A;  3H57 A;  1JY7 B;  1MBD A;  2ZT3 A;  1C7D B;  1Y0D A;  3WCT B;  1HBA B;  1V5H A;  1UIW B;  1O1J A;  3OZW A;  1FN3 B;  1U7S A;  1AJG A;  4F6I A;  3OK5 A;  2QLS A;  3E55 A;  4NI1 B;  1Y7D B;  1O1J B;  1NZ5 A;  1DUO A;  4B4Y A;  5JGG A;  1SWM A;  1FDH G;  4M4B A;  1Y31 B;  2W6V A;  5EYS A;  1C40 A;  2HZ3 A;  3FH9 A;  1XZV A;  2ZS1 B;  1BUW B;  1Y5F B;  1RSE A;  1SPE A;  111M A;  4AVE A;  3GKT A;  3MKB B;  3PI3 A;  4FWX A;  3A2G A;  1SI4 B;  1O1O B;  1JZK A;  4WCH D;  1MKO B;  1RTX A;  1O1P A;  4HHB A;  2CMM A;  1YHE B;  3GK9 A;  3GLN A;  1A6M A;  3GOU A;  1Y7Z B;  2WY4 A;  5JOM A;  1LTW A;  2V1I A;  4NS2 A;  3S65 B;  2XKH A;  1YHR A;  1MOD A;  1A01 B;  6HBI A;  1Y4V A;  1VXE A;  4PQB A;  4XDI A;  3R5I A;  2D2N A;  3WCV B;  5ILP A;  3ORD A;  4HRR B;  3FH9 B;  1MTI A;  4NI0 A;  5CND A;  1DLW A;  2VHB A;  1K0Y B;  2LH5 A;  2G0R A;  1YCB A;  1BZP A;  2HHE A;  1J7Y A;  1A9W E;  2LH1 A;  3G4U A;  4C0N A;  2OH9 A;  3QM8 A;  3QJE B;  2H35 B;  1Y4G A;  2SPO A;  2FRI X;  3QQQ A;  1SDL A;  1DXC A;  1NIH A;  2G0V A;  1N9H A;  2G3H A;  1C7D A;  1XYE B;  4MQK B;  2DN2 A;  5EUI B;  4N7N A;  1OUT B;  2ZLV B;  2MHB B;  1S61 A;  2HBC A;  1Y4R B;  3BJ2 A;  3QJB A;  1GDK A;  2B7H A;  4MU5 A;  1YFF A;  2R4Z A;  4G1B A;  2NX0 A;  1MYZ A;  4PNJ A;  1HGB B;  3WCU C;  4ODC A;  2HHD B;  1J3Y A;  1GDI A;  2ZFB A;  2AA1 B;  1HAC A;  1HV4 B;  1LFZ B;  4NI0 B;  1GDJ A;  3AQ8 A;  1IT2 A;  1RQA A;  2AA1 A;  1X46 A;  2D5X B;  1RQ3 B;  5CNC A;  3PT7 B;  4TWU A;  1A00 A;  3AQ9 A;  1YMC A;  4PQC A;  4H07 A;  2O5O X;  4DWT A;  2D2M C;  1YEO B;  1YZI B;  3WCW C;  5HU6 A;  2AUQ A;  2BLH A;  2MHB A;  2MGM A;  1FDH A;  2O5Q X;  3ARL A;  3MYN A;  2ZWJ A;  1DM1 A;  1OBM A;  2VRY A;  1Y85 A;  1Y46 A;  4N7P B;  3UHD A;  2MGI A;  3OO4 A;  1YHU D;  1CBM A;  1G0B B;  1S5X B;  4G51 A;  1LFV B;  2NSS A;  3UGY A;  1MLG A;  2G0S A;  1DXV B;  2VLZ A;  1XZV B;  1RQ4 B;  1RQ4 A;  3FS4 A;  3ZJJ A;  1HCO A;  1LFY A;  3ASE A;  2FRJ X;  4MQG B;  2MGE A;  2M6Z A;  4IT8 A;  1FHJ A;  1YOI A;  3K8B A;  4MAX A;  1DO1 A;  3AT5 B;  3UHH A;  3V2Z A;  2HBE A;  2QSS B;  1YH9 B;  1SDK A;  1Y85 B;  2HBG A;  4ROM B;  2ZS0 D;  1YDZ A;  2W6W A;  1JY7 A;  1J40 B;  5AZQ A;  4B3W A;  1G0A B;  2HZ1 A;  1UFP A;  4TYX A;  1A0Z B;  3UH3 A;  1MBA A;  2VLY A;  1LH7 A;  2GTL D;  1DTI A;  3A5A A;  1O1N A;  1K1K B;  1NPF A;  1NQP B;  3UGZ A;  1VXG A;  5JGG B;  3NFE B;  1HAB B;  4G1V A;  2HBS A;  3PI8 B;  3PT7 A;  1L2K A;  1KFR A;  1QXD A;  2O58 X;  2MGH A;  1CH3 A;  1S69 A;  1BZ0 A;  1NIH B;  3SZK B;  1XXT B;  3UI0 A;  1VRE A;  2Z6N A;  1R1X B;  4MQH A;  1IT3 A;  1NZ2 A;  1Y2Z A;  3HYU B;  3BJ3 A;  5CNG A;  1A9W A;  3D7O A;  1XZ2 A;  3GYS A;  3D17 B;  3IC0 B;  1MOB A;  2C0K A;  3S48 C;  3GQR A;  5IKS A;  1OUT A;  1HGA B;  2ZLX A;  4NZI A;  1Y0T B;  3NL7 A;  1JF3 A;  1GDL A;  1VXF A;  2ZT1 A;  5KDQ B;  4PQ6 A;  2IG3 A;  2ZS1 C;  1Y4Q B;  5ILM A;  3UHK A;  3MOU A;  4XS0 B;  1A4F B;  4MXL A;  3UHB A;  2IN4 A;  2R1H A;  4JAC A;  2GLN A;  3BOM A;  1Y45 B;  1JP8 A;  1VXD A;  1GJN A;  1N9F A;  3AT6 A;  1J7Y B;  2M6Z B;  2QMB B;  2R4Y A;  1G09 B;  3TM3 A;  1YIH A;  4UIQ A;  1H97 A;  2LH2 A;  2PGH A;  1CLS A;  3GQG A;  3M3B A;  1O1I A;  1YVQ B;  1Y8W A;  112M A;  2EB8 A;  1YHU B;  1Y8H A;  3WTG B;  1DWR A;  1YEQ A;  5HY8 A;  1Y7Z A;  4KN3 A;  4NXA A;  3VRF B;  2ZS0 A;  1Y7G A;  1O1N B;  3UHV A;  3UHR A;  1BBB A;  1GVH A;  2LH6 A;  3HXN B;  5KDQ A;  3DR9 A;  1CG8 B;  2QRW A;  1LFL B;  1J7W B;  1AJ9 A;  2NRM A;  3QMA A;  2AV3 A;  4HSX A;  3ECX A;  1G09 A;  5CNE A;  1QI8 A;  2MGB A;  4U8U D;  3WI8 A;  1MNK A;  1C40 B;  1HGC B;  1V4W A;  1PBX A;  109M A;  4MQG A;  2Z85 A;  1BZR A;  1BZZ A;  1CH1 A;  3UHQ A;  1GBV B;  1JZL A;  1YGD A;  3ZJO A;  1MBO A;  1CH5 A;  1V4X B;  3IC2 B;  1LJW B;  1GBV A;  2HHB A;  1EMY A;  3LR9 A;  3WHM A;  2D2M A;  1CIK A;  5KER B;  3LHB A;  4YU3 A;  3PEL B;  3WCT D;  3NMM B;  2KSC A;  3LQD A;  2H8D A;  1HBB B;  1LFT A;  1FSX B;  1OUU A;  1AJ9 B;  4ROL B;  1DXT A;  1DLY A;  3AQ5 A;  2ZFO B;  5C6E B;  1YEN B;  3SZK A;  6HBW B;  1LH5 A;  1NEJ B;  1Y09 B;  3ZH0 A;  1YIE A;  1YGD B;  3ONZ A;  4MPM A;  1JL7 A;  2VEE A;  4F6G A;  1ABY B;  1Y0T A;  3EU1 B;  2R80 A;  1ITH A;  1ECA A;  1LH1 A;  3A59 B;  5CN8 A;  3PT8 B;  3QJC B;  4HRT A;  3ODQ B;  2H8F B;  4MBN A;  4ESA B;  1Y8I B;  3K9Z A;  1ECD A;  1VXA A;  5SW7 A;  2MYB A;  1J40 A;  1BAB B;  1Y01 B;  4U8U B;  3DHR B;  3M3A A;  3WCW A;  1FSX A;  3S65 A;  2PEG B;  2SPN A;  1WVP A;  1F65 A;  1BIJ B;  1R1Y B;  2BKM A;  106M A;  3CY5 B;  1HJT A;  3LB2 A;  1V4U B;  3S1I A;  1KD2 B;  4F69 A;  3DHT B;  1CH9 A;  3O89 A;  3WTG A;  4MXK A;  2DXM B;  1HDA B;  1X9F A;  2D2M D;  1UMO A;  3D1K A;  5CNF A;  1Y35 B;  3GYS B;  1XZ5 B;  1HGC A;  1CP5 A;  3EOK B;  1QSI B;  3D1K B;  4G51 B;  5CN6 A;  1BIN A;  3HRW A;  2OLP A;  2NRL A;  1QSI A;  1YHU C;  2HHD A;  1T1N A;  2D2N D;  2DN1 B;  5M3S A;  1YFF B;  2OH8 A;  5EE4 D;  1HCO B;  1LFL A;  2B7H B;  2O5B X;  5E6E B;  5E6E A;  3QJD B;  3FS4 B;  3HXN A;  4MQC A;  3UBV A;  1B86 B;  1S5Y A;  4FWZ A;  1R1Y A;  3G4Q A;  1MYJ A;  1CO9 A;  5ILE A;  1UVY A;  1I3D A;  1HLM A;  3EOK A;  1O1O A;  1HBI A;  3QJE A;  2D2N C;  1J7S B;  3HRW B;  3BJ3 B;  2FAM A;  3W4U A;  2HHE B;  4L7Y B;  1AZI A;  5C6Y A;  2BLI A;  1O1I B;  3A0G B;  3WCV D;  4HRT B;  1A01 A;  1RVW B;  3DUT B;  3R0G A;  3UHW A;  2R80 B;  4FC3 B;  1V75 A;  2HBF A;  2EKT A;  3WCV A;  4NI1 A;  3PI2 A;  1YEU B;  1MBN A;  2LH3 A;  3HEP A;  4F4O B;  3WFX A;  3WCU D;  4MQI B;  4TWV A;  1KD2 A;  4NK2 A;  5D5R A;  4C44 A;  4KMV A;  3PIA A;  2AUO A;  2MGL A;  1DXT B;  1LFV A;  1Y5J A;  5CN5 A;  4U8U A;  5ILR A;  4ILZ A;  1JL6 A;  1Y0C A;  1HBB A;  1Y4G B;  2DN3 A;  3G52 A;  1VRF A;  1J7S A;  1ASH A;  3A5G A;  1BJE A;  4F68 A;  1O1P B;  1D8U A;  3S66 B;  1TU9 A;  1XY0 B;  1Y4R A;  3QJB B;  1Y8I A;  1N9X A;  1YEU A;  107M A;  3IC2 A;  4WJG A;  3M39 A;  2BMM A;  2OIF A;  1ABY A;  5B84 A;  4M4A B;  1CH2 A;  1THB B;  3KUO A;  3QZX A;  1JEB A;  1HBR B;  3OGB A;  1QPW A;  1IRC A;  2GTL A;  1MZ0 A;  1HAB A;  3QM6 A;  1MLK A;  1GLI A;  1NS9 A;  4YU4 A;  2VYZ A;  4L2M A;  2FAL A;  1Q1F A;  2G0X A;  2H8D B;  1DKE A;  1QI8 B;  1HRM A;  1X9F B;  2ZSN A;  3OVU C;  4HBI A;  2V1E A;  3UHS A;  5AZR A;  3NG6 A;  2ZSQ A;  1Y0C B;  4OF9 A;  2LHB A;  3E5O A;  3D1A B;  2ZLU A;  2QSS A;  1FLP A;  1MLQ A;  4O4T A;  1MLH A;  1FAW B;  2HHB B;  1PBX B;  1HBR A;  1V4X A;  3E5I A;  3UHX A;  3ZJR A;  1IBE B;  2W31 A;  108M A;  2G14 A;  1YEV A;  1UIW A;  3WCW D;  1MGN A;  1BAB A;  1XZ5 A;  1J3Z A;  1DXV A;  1Y7C B;  1HDB A;  1BZ1 A;  1ABS A;  2ZSY A;  4H0B A;  5CHQ A;  3EDB A;  1J3Z B;  3ZJN A;  1HGB A;  1YMB A;  1BBB B;  1YIH B;  3G53 A;  1DTM A;  3QM9 A;  1SHR A;  3P5Q B;  1Y4B A;  1Y09 A;  2ZT0 A;  3KMF A;  1NS6 A;  1Y0W A;  1MYT A;  4QAU A;  2DN2 B;  3GDJ A;  4N8T A;  1UC3 A;  1M9P A;  1J41 A;  1CQX A;  4LPI A;  3UH7 A;  1GCW B;  1YEO A;  1F5P A;  2MBW A;  2NSR A;  1S56 A;  2W6Y A;  1MLS A;  1S0H B;  1MNH A;  1HGA A;  2ZLX B;  1A3O B;  3GQR B;  3HHB B;  3DUT A;  3UHG A;  2LH7 A;  1A3O A;  2JHO A;  2ZLW B;  3G4Y A;  3A9M A;  1A4F A;  1QXD B;  2YRS B;  1JDO A;  1XXT A;  3BOM B;  5JDO C;  1MBS A;  2E2Y A;  1J41 B;  1MLU A;  3RJN B;  1Y4F B;  1I3E A;  101M A;  4ROL A;  1WMU B;  2XYK A;  1JZM A;  6HBW A;  1YVT A;  1NS6 B;  4O1T A;  1XZ2 B;  3E4N A;  4O35 A;  2V1H A;  4AVD A;  2AUP A;  1BZ6 A;  4N7O B;  1JF4 A;  2WTG A;  1FSL A;  4IRO B;  1BZ1 B;  2BNL A;  1MNJ A;  2V1G A;  1CP0 A;  4UZV A;  4M4A A;  1K0Y A;  2HBS B;  1UX9 A;  102M A;  3PI4 A;  1JW8 A;  1CG5 B;  4F4O A;  2ZFO C;  1JPB A;  1U7R A;  1MYI A;  3S1J A;  1Y0A B;  1LHS A;  1W92 A;  3ZHW A;  3RGK A;  3NFE A;  1HBH B;  1XZU A;  2DC3 A;  1ECN A;  1M6C A;  1EWA A;  1MDN A;  3SDH A;  1F63 A;  1LUE A;  3AG0 A;  1EBC A;  3GQP A;  4IRO A;  2ZLT A;  3VRG A;  2GNV A;  3WCU B;  3OO4 B;  1ECO A;  2EVK A;  5MBA A;  3GQP B;  4WJG 1;  2R50 A;  2G11 A;  5SW7 B;  5KER A;  3ECL A;  1A0U B;  1Y46 B;  4N7P A;  3QM5 A;  5EQM A;  3MVC A;  1JEB B;  1IRD B;  3ODQ A;  1MYG A;  3QJD A;  4X0L B;  1V75 B;  2VEB A;  3CIU A;  1RPS A;  1O1L A;  5CHR A;  3ZJM A;  4X0L A;  1MNI A;  3G4V A;  4DC7 A;  1Y7C A;  1Y2Z B;  1GBU B;  1CPW A;  3WFW A;  4BJA A;  1FCS A;  1VHB A;  3A0G A;  4MBA A;  3QQR A;  3VRE B;  1G9V A;  3WCT C;  2RI4 A;  2ZSR A;  1GCW A;  3BJ2 B;  2FRK X;  1YZI A;  1A3N A;  4NXC A;  5JDO D;  5HLU A;  1JWN A;  1YOH A;  1DXD A;  3GKV A;  4KMW A;  4DWU A;  4XS0 A;  2ZST A;  4MQI A;  2D2M B;  2W72 C;  2R4X A;  1DXU A;  2ZSZ A;  1Y5K A;  1RQA B;  1ABW B;  2HBD A;  3KUN A;  3OZV A;  2QU0 A;  3OJ1 A;  2YRS A;  1N9I A;  2D5X A;  1LA6 A;  5EOH A;  2QMB A;  2GRZ A;  3AT6 B;  3LB4 A;  1Y8K B;  5F2A A;  1X9F D;  1MTK A;  2W72 A;  1SPG B;  1LFQ B;  5HAV A;  2VM0 A;  3PI1 A;  1BZ0 B;  3ZJQ A;  3G4W A;  3G46 A;  3M38 A;  4N8T B;  1CQ2 A;  1F5O A;  1JP6 A;  1RTE A;  2GL3 A;  103M A;  1CBL A;  1A3N B;  1YVT B;  1YHR B;  1CMY B;  4JYQ A;  2ZS0 B; 
#chains in the Genus database with same CATH topology
 1MLM A;  2MYA A;  1IRD A;  3UHY A;  4H2L B;  5CN9 A;  2BK9 A;  1LH2 A;  1NPG A;  2MGF A;  5FVB A;  7HBI A;  4GY3 A;  2QFK A;  3D17 A;  1KTP B;  1VXH A;  1G0A A;  2DKA A;  3UHT A;  3MJP B;  4ZVB A;  3HC9 A;  3PEL A;  2D5Z A;  3AQ7 A;  2VYW A;  110M A;  3K8B B;  2BLJ M;  1EYX B;  1XZU B;  2VJT B;  1O1L B;  2O5M X;  2GNW A;  2ZS1 A;  3ED9 A;  1HDA A;  1YIE B;  3ONZ B;  2GDM A;  1CII A;  1XZ7 B;  3A59 A;  4NK1 A;  3GOU B;  2WTH A;  1YCA A;  3FEW X;  2ZLU B;  1PHN B;  5CN7 A;  1UVJ A;  1QXE B;  2SPL A;  4L7Y A;  2EVP A;  1NWI A;  3MJP A;  1A0Z A;  3VHB A;  1UX8 A;  3WR1 B;  3WCV C;  3HF4 A;  1Y0D B;  5B85 A;  1DO7 A;  2O5S X;  4GY3 B;  1HDS B;  2XKG A;  2ZSP A;  1MBI A;  1S5X A;  4HSW A;  3BRP B;  2VYY A;  1HDS A;  2O5L X;  1XQ5 B;  1DKE B;  1HDB B;  2MB5 A;  2QSP A;  1B86 A;  2SPM A;  3O18 B;  3PI9 A;  2Z8A A;  2W6V B;  3PMC A;  4PO5 A;  1Y31 A;  2HCO B;  1DUK A;  1Y4F A;  1CG5 A;  2RAO A;  2GKM A;  1R1X A;  1S6A A;  1HHO A;  1HHO B;  1VXB A;  1A00 B;  4KJT A;  1LFY B;  2JLF A;  1TES A;  1YGF A;  2RAO B;  2UUM X;  3LB3 A;  1GZX A;  1KR7 A;  1EBT A;  1C7B B;  4F6D A;  1BZZ B;  5HLQ A;  4MQJ B;  1HI8 A;  1MLN A;  1IOP A;  1V4W B;  1CLS B;  3D1A A;  1MYM A;  1M6M A;  3D4X B;  1J52 A;  4O2G A;  3WCP A;  4N7O A;  3ZJH A;  3RJ6 A;  3W4U B;  1MLJ A;  2VJH B;  1XQ5 A;  1G0B A;  1MLO A;  3HF4 B;  4FH7 A;  2HBC B;  1EW6 A;  2G10 A;  4YU3 B;  1OR6 A;  3HHB A;  4H2L A;  1NGK A;  1Y7G B;  3VRF A;  3U3E A;  1NAZ A;  4AE1 A;  1O1K B;  3WHM B;  2OHA A;  2DN3 B;  2GTL B;  1MBC A;  1YG5 A;  1Y5J B;  3OZU A;  4U8U C;  5MBN A;  3UH5 A;  3OO5 B;  4LM6 B;  3GDJ B;  3BCQ B;  3GQG B;  1Y0W B;  1XZ7 A;  3K3U A;  1YEQ B;  2G12 A;  1GBU A;  1NWN A;  1Y4B B;  2FRF A;  1MLF A;  1XY0 A;  2V1J A;  4GZG A;  2QFN A;  2EF2 A;  3D4X A;  1J3Y B;  1DDT A;  1YE0 A;  1NZ3 A;  3AQ6 A;  1HI1 A;  1O1M A;  1RPS B;  1URY A;  1MLL A;  2D6C A;  2VLX A;  1M9P B;  5KKK A;  3WR1 A;  2C7J B;  1A6K A;  1ON7 A;  1A0U A;  1Y22 A;  3HEN A;  1CH7 A;  3NL7 B;  3EDA A;  3H58 A;  1K1K A;  1CO8 A;  1BIJ A;  1OUU B;  1SI4 A;  2QSP B;  1VWT B;  4MQC B;  5CN4 A;  1O1K A;  1MCY A;  1X3K A;  2H35 A;  1JP9 A;  3WCW B;  1MTJ A;  1LFQ A;  2VJT A;  1XZ4 A;  1LA6 B;  4MQH B;  1Y8K A;  1Y4P B;  2Z6N B;  1MOA A;  1A6N A;  1HBH A;  3TM9 A;  1HBS A;  5EU2 A;  2GKN A;  1LJW A;  2XKI A;  3UHZ A;  1GZX B;  3QJC A;  1THB A;  2G0Z A;  4VHB A;  1A6G A;  1Y35 A;  1B8D A;  1FAW A;  2R4W A;  1YOG A;  3IA3 B;  5HLX A;  4FH6 A;  1CPC B;  1DO4 A;  1URV A;  1Y4Q A;  2ZT2 A;  3ZOL A;  1DXU B;  1S5Y B;  2Z6S A;  1YEN A;  3UHI A;  1VXC A;  1LFT B;  1Y22 B;  1J7W A;  2MGC A;  1DWT A;  1OR4 A;  2D5Z B;  2ZSO A;  2PEG A;  3MKB A;  1IWH B;  2AV0 A;  3VRG B;  2EB9 A;  2C7L B;  1BUW A;  1Y5F A;  1WMU A;  3A5B A;  4DC8 A;  3MN0 A;  4GXE A;  4ZIZ B;  1YE0 B;  4SDH A;  2W6X A;  1YH9 A;  3UHE A;  105M A;  1C7B A;  3EU1 A;  1BVC A;  5JDO E;  4ZVA A;  1V07 A;  3UH6 A;  2DXM A;  3PMD A;  3ZJL A;  1YHU A;  1COH B;  3B75 B;  1Y4V B;  3V57 B;  104M A;  5JDO F;  3NML A;  1WLA A;  1YMA A;  1LH6 A;  2HBF B;  4FC3 A;  3O7N A;  1MWC A;  5B13 G;  3LQD B;  2BW9 M;  4F6F A;  1XF6 C;  1PMB A;  2OHB A;  4HH0 A;  2ZFB B;  2DHB B;  3NMM A;  1X9F C;  4UUR A;  1Y45 A;  3DHR A;  5EE4 C;  2QU0 B;  4F6B A;  3HEO A;  2ZFO D;  3PIA B;  1ABW A;  1XCH A;  2DHB A;  2O5T X;  1UFJ A;  2ZLT B;  1MWB A;  5CNB A;  3WFT A;  3SDN A;  1QXE A;  1LHT A;  1YE2 B;  2ZLV A;  3BJ1 B;  1OFJ A;  1BVD A;  1CMY A;  3ARJ A;  3PT8 A;  3GKV B;  4MQJ A;  3TLD A;  5HU6 B;  1RVW A;  3UHU A;  3V57 A;  5EET A;  1COH A;  4L1E B;  3B75 A;  1T1N B;  2DN1 A;  2MGA A;  1NEJ A;  1HSY A;  5F0B A;  5E29 A;  1DWS A;  1Y8W B;  3ARK A;  1NZ4 A;  2DKC A;  3VRE A;  3BA2 A;  1HBA A;  2MGG A;  3QZZ A;  1QSH B;  4ODC B;  2HCO A;  3MJU A;  5E83 B;  3ZJP A;  1MOC A;  1MNO A;  1CIO A;  1S0H A;  2J96 A;  1V9Q A;  1NXF A;  3R5I B;  1MLR A;  1B0B A;  1VWT A;  2V8A B;  3PI8 A;  3UBC A;  1MOH A;  2R1H B;  4BJU A;  1G08 B;  1UVX A;  1F99 B;  3BJ1 A;  1YE2 A;  1Z8U B;  2D60 B;  2MGJ A;  3DHT A;  1WAC A;  4ERT A;  4N7N B;  5EUI A;  1YHE A;  5AB8 A;  1V4U A;  1G9V B;  2ZSS A;  2ZS0 C;  1XYE A;  3QM7 A;  2W72 B;  3IC0 A;  1HBS B;  1SDL B;  1MKO A;  1OFK A;  4OOD A;  2GRH A;  1SDK B;  2GRF A;  1C7C B;  1Y8H B;  1QPW B;  3WFU A;  5D1V A;  5E83 A;  1HAC B;  1HV4 A;  1LFZ A;  2ZSX A;  3IXF A;  3V2V A;  2D2N B;  1QSH A;  2ZT4 A;  1H1X A;  4FWY A;  4M4B B;  4HRR A;  2BWH A;  2ZS1 D;  1JBO A;  4ESA A;  3CIU B;  1YEV B;  1CG8 A;  1Y7D A;  1Y5K B;  1Y0A A;  3KMF C;  2UUL D;  1NY9 A;  3G4R A;  1YG5 B;  4O4Z A;  1J3F A;  3BCQ A;  1HLB A;  2D60 A;  3ZJI A;  1NQP A;  2GTL C;  1LH3 A;  1IDR A;  4MQK A;  3OO5 A;  3LB1 A;  4HHB B;  3CY5 A;  3S66 A;  1G08 A;  3P5Q A;  1SHR B;  2HZ2 A;  1AJH A;  5HY8 B;  3RQR A;  2RI4 B;  3WCU A;  1CH4 A;  2V1F A;  1YDZ B;  4XXK A;  1YVQ A;  3ZJS A;  3ZOM A;  1O1M B;  3HYU A;  2AUR A;  4ROM A;  1SPG A;  3UHN A;  3VAU A;  2PGH B;  1TOX A;  5EYJ A;  2HBE B;  3MJU B;  3AT5 A;  1OJ6 A;  5HBI A;  1MWD A;  1FHJ B;  1GLI B;  1NS9 B;  3UHC A;  4YU4 B;  1UT0 A;  4F6J A;  2MYC A;  2H8F A;  1IBE A;  5CMV A;  1O16 A;  2MYD A;  1C7C A;  2QLS B;  3LQ9 A;  3ECZ A;  5E29 B;  3MYM A;  4YJJ B;  1GCV A;  1FN3 A;  3MBA A;  3WCT A;  2HBD B;  5EV5 A;  1RQ3 A;  2V1K A;  1GCV B;  2EKU A;  1YGF B;  2Z6T A;  2ZLW A;  3LR7 A;  3NG6 B;  2ZFO A;  2MYE A;  5C6E A;  1MYH A;  1Y4P A;  1MYF A;  1HBG A;  1DO3 A;  2MGK A;  3O18 A;  1XZ4 B;  1Y83 B;  3PI9 B;  1Y83 A;  3WCP B;  1IWH A;  4RMP B;  3D7O B;  1XDT T;  2MGD A;  3H57 A;  1JY7 B;  1MBD A;  2ZT3 A;  4H0M B;  4ERV A;  1ALL B;  1C7D B;  1HHS A;  1Y0D A;  3WCT B;  1HBA B;  1V5H A;  1UIW B;  1O1J A;  3OZW A;  1FN3 B;  1U7S A;  1AJG A;  2C7J A;  4F6I A;  3OK5 A;  2QLS A;  3E55 A;  4NI1 B;  1Y7D B;  1O1J B;  1NZ5 A;  1DUO A;  3V58 A;  4B4Y A;  5JGG A;  1SWM A;  1FDH G;  4M4B A;  1Y31 B;  2W6V A;  5EYS A;  1C40 A;  2HZ3 A;  3FH9 A;  1XZV A;  2ZS1 B;  1BUW B;  1Y5F B;  1RSE A;  1SPE A;  111M A;  4AVE A;  3GKT A;  3MKB B;  3PI3 A;  4FWX A;  3A2G A;  1SI4 B;  1O1O B;  1JZK A;  4WCH D;  1MKO B;  1RTX A;  1B33 A;  4AE0 A;  1O1P A;  2X49 A;  4HHB A;  2CMM A;  1YHE B;  3GK9 A;  3GLN A;  1A6M A;  3GOU A;  1Y7Z B;  2UUN A;  2WY4 A;  5JOM A;  1LTW A;  1PHN A;  2V1I A;  4NS2 A;  3S65 B;  1QGW C;  2XKH A;  2BV8 B;  1YHR A;  1HA7 A;  1MOD A;  1A01 B;  6HBI A;  1Y4V A;  1VXE A;  4PQB A;  4XDI A;  3R5I A;  2D2N A;  3WCV B;  3VNC A;  5ILP A;  3ORD A;  4HRR B;  3FH9 B;  1MTI A;  4NI0 A;  5CND A;  1DLW A;  2VHB A;  1K0Y B;  2LH5 A;  2UUL A;  2G0R A;  1YCB A;  1BZP A;  2HHE A;  1J7Y A;  1HHT P;  1A9W E;  2LH1 A;  3G4U A;  4C0N A;  2OH9 A;  3QM8 A;  3QJE B;  2H35 B;  5B13 A;  1Y4G A;  2SPO A;  2FRI X;  3QQQ A;  1SDL A;  1DXC A;  1NIH A;  2G0V A;  1N9H A;  2G3H A;  1C7D A;  3KVS A;  1XYE B;  4MQK B;  2DN2 A;  4F0T A;  5EUI B;  4N7N A;  1OUT B;  2ZLV B;  2MHB B;  1S61 A;  2UUM A;  2HBC A;  1Y4R B;  3BJ2 A;  3QJB A;  4F0T B;  1GDK A;  2VJH A;  2B7H A;  2VJR A;  2I88 A;  4MU5 A;  1YFF A;  2R4Z A;  4G1B A;  2NX0 A;  1MYZ A;  4PNJ A;  1HGB B;  3WCU C;  4ODC A;  2HHD B;  1J3Y A;  1GDI A;  2ZFB A;  2AA1 B;  1HAC A;  1HV4 B;  1LFZ B;  4NI0 B;  1GDJ A;  3AQ8 A;  1IT2 A;  1RQA A;  2AA1 A;  1X46 A;  5AQD A;  2D5X B;  1RQ3 B;  5CNC A;  3PT7 B;  4TWU A;  1A00 A;  3AQ9 A;  1YMC A;  4PQC A;  4H07 A;  2O5O X;  4DWT A;  2D2M C;  1YEO B;  1YZI B;  3WCW C;  5HU6 A;  2AUQ A;  2BLH A;  2MHB A;  2MGM A;  1FDH A;  2BV8 A;  2O5Q X;  3ARL A;  3MWN A;  3MYN A;  2ZWJ A;  1DM1 A;  1OBM A;  2VRY A;  1Y85 A;  1Y46 A;  4N7P B;  3UHD A;  2MGI A;  3OO4 A;  1YHU D;  1CBM A;  1G0B B;  1S5X B;  4G51 A;  5FVB M;  1LFV B;  3O2C A;  2NSS A;  1A87 A;  3UGY A;  1MLG A;  4HH1 A;  2G0S A;  3V58 B;  1DXV B;  2UUL H;  2VLZ A;  1UVM A;  1XZV B;  1RQ4 B;  1RQ4 A;  3FS4 A;  3ZJJ A;  1HCO A;  1LFY A;  3ASE A;  4Z8K A;  2FRJ X;  4MQG B;  4ZIZ A;  2MGE A;  2M6Z A;  4IT8 A;  3DBJ B;  2C7L A;  1FHJ A;  1YOI A;  3K8B A;  4MAX A;  1DO1 A;  3AT5 B;  3UHH A;  3V2Z A;  2HBE A;  2QSS B;  1YH9 B;  1SDK A;  1Y85 B;  2HBG A;  4ROM B;  2ZS0 D;  1YDZ A;  2W6W A;  1JY7 A;  1J40 B;  5AZQ A;  2UUN D;  4B3W A;  4A8Q A;  1G0A B;  2HZ1 A;  4B02 A;  1UFP A;  4LMX B;  4TYX A;  1A0Z B;  3UH3 A;  1MBA A;  2VLY A;  1LH7 A;  4ETU A;  2GTL D;  1DTI A;  3A5A A;  1O1N A;  1K1K B;  1NPF A;  1NQP B;  3UGZ A;  1VXG A;  5JGG B;  3NFE B;  1UVN A;  1HAB B;  4G1V A;  2HBS A;  3PI8 B;  3PT7 A;  1RH1 A;  1L2K A;  1KFR A;  1QXD A;  4A8M P;  2O58 X;  2MGH A;  1CH3 A;  1S69 A;  1BZ0 A;  1NIH B;  3SZK B;  1XXT B;  3UI0 A;  1VRE A;  2Z6N A;  1R1X B;  4MQH A;  1IT3 A;  2YSK A;  1NZ2 A;  1Y2Z A;  3HYU B;  3BJ3 A;  5CNG A;  1A9W A;  3D7O A;  4Q70 B;  1XZ2 A;  3GYS A;  2UUM B;  3D17 B;  3IC0 B;  1MOB A;  2C0K A;  3S48 C;  3GQR A;  5IKS A;  1OUT A;  1HGA B;  2ZLX A;  4NZI A;  1Y0T B;  4XXI A;  2VJR B;  3NL7 A;  1JF3 A;  1GDL A;  1VXF A;  2ZT1 A;  5KDQ B;  4PQ6 A;  2IG3 A;  2ZS1 C;  1CPC A;  1Y4Q B;  5ILM A;  3UHK A;  3MOU A;  4XS0 B;  1A4F B;  4MXL A;  3ZTA A;  3UHB A;  2IN4 A;  2R1H A;  4JAC A;  2GLN A;  1JBO B;  3BOM A;  2V8A A;  1Y45 B;  1JP8 A;  1VXD A;  1GJN A;  1GH0 A;  1N9F A;  3AT6 A;  1J7Y B;  1B33 B;  1F0L A;  1UVK A;  2M6Z B;  2QMB B;  2R4Y A;  2UUL B;  1G09 B;  3TM3 A;  1YIH A;  4UIQ A;  1H97 A;  4N6S B;  2LH2 A;  2PGH A;  1CLS A;  3GQG A;  3M3B A;  1O1I A;  1YVQ B;  1Y8W A;  112M A;  2EB8 A;  1YHU B;  1Y8H A;  3WTG B;  1DWR A;  4L1E A;  1YEQ A;  5HY8 A;  1Y7Z A;  4KN3 A;  4NXA A;  2JL9 A;  3VRF B;  2ZS0 A;  1Y7G A;  4A8F A;  1O1N B;  3UHV A;  3UHR A;  2DKD A;  1BBB A;  1GVH A;  2LH6 A;  3HXN B;  5KDQ A;  3DR9 A;  1CG8 B;  2QRW A;  1LFL B;  1J7W B;  1AJ9 A;  2NRM A;  4A8K A;  3QMA A;  4N6S A;  2AV3 A;  4HSX A;  3ECX A;  1G09 A;  5CNE A;  1QI8 A;  2MGB A;  3NUH B;  3L0F B;  4U8U D;  3WI8 A;  1MNK A;  1C40 B;  3DBJ A;  1HGC B;  1V4W A;  1PBX A;  109M A;  4MQG A;  2Z85 A;  1BZR A;  1BZZ A;  1CH1 A;  3UHQ A;  1GBV B;  1JZL A;  1YGD A;  3ZJO A;  1MBO A;  1CH5 A;  1V4X B;  3IC2 B;  1LJW B;  1GBV A;  2HHB A;  4A8W A;  1EMY A;  3LR9 A;  3WHM A;  2D2M A;  1CIK A;  5KER B;  3LHB A;  4YU3 A;  1UVL A;  3PEL B;  3WCT D;  3NMM B;  2KSC A;  3LQD A;  2H8D A;  1HBB B;  1LFT A;  1FSX B;  1OUU A;  1AJ9 B;  4ROL B;  1DXT A;  1UVI A;  1DLY A;  3AQ5 A;  2ZFO B;  5C6E B;  1YEN B;  3SZK A;  6HBW B;  1LH5 A;  1NEJ B;  1Y09 B;  3ZH0 A;  1YIE A;  1YGD B;  3ONZ A;  4MPM A;  1JL7 A;  2VEE A;  2C7K B;  4F6G A;  1ABY B;  4ESU A;  1Y0T A;  3EU1 B;  2R80 A;  1ITH A;  1ECA A;  1LH1 A;  3A59 B;  5CN8 A;  3PT8 B;  3QJC B;  4HRT A;  4Q70 A;  3ODQ B;  4GXE B;  2H8F B;  4MBN A;  4ESA B;  1Y8I B;  3K9Z A;  1ECD A;  1VXA A;  5SW7 A;  2MYB A;  1J40 A;  1BAB B;  1Y01 B;  4U8U B;  3DHR B;  3M3A A;  3WCW A;  1FSX A;  3S65 A;  2UUL C;  2PEG B;  1KTP A;  2SPN A;  1WVP A;  1F65 A;  1BIJ B;  1R1Y B;  2BKM A;  106M A;  3CY5 B;  1HJT A;  3LB2 A;  1V4U B;  3S1I A;  1KD2 B;  3KVS B;  4F69 A;  1SGK A;  3DHT B;  1CH9 A;  3O89 A;  3WTG A;  4MXK A;  2DXM B;  1HDA B;  1X9F A;  2D2M D;  1UMO A;  3D1K A;  5CNF A;  1Y35 B;  3GYS B;  1XZ5 B;  1HGC A;  1CP5 A;  3EOK B;  1QSI B;  3D1K B;  4G51 B;  5CN6 A;  1BIN A;  2JLG A;  3HRW A;  2OLP A;  2NRL A;  1QSI A;  1YHU C;  2HHD A;  1T1N A;  2D2N D;  2DN1 B;  5M3S A;  1YFF B;  2OH8 A;  5EE4 D;  1HCO B;  1LFL A;  2B7H B;  2O5B X;  5E6E B;  5E6E A;  3QJD B;  3FS4 B;  3HXN A;  4MQC A;  3UBV A;  1B86 B;  1S5Y A;  4FWZ A;  1R1Y A;  4A8S A;  3G4Q A;  1MYJ A;  1CO9 A;  5ILE A;  1UVY A;  1I3D A;  1HLM A;  3EOK A;  1O1O A;  1HBI A;  3QJE A;  2D2N C;  1J7S B;  3HRW B;  3BJ3 B;  2FAM A;  3W4U A;  2HHE B;  4L7Y B;  1AZI A;  5C6Y A;  2BLI A;  1O1I B;  3A0G B;  3WCV D;  4HRT B;  1A01 A;  1RVW B;  3DUT B;  3R0G A;  3UHW A;  2R80 B;  1HA7 B;  4FC3 B;  1V75 A;  2HBF A;  2EKT A;  3WCV A;  4NI1 A;  3PI2 A;  1YEU B;  1MBN A;  2LH3 A;  3HEP A;  4F4O B;  3WFX A;  3WCU D;  4MQI B;  4TWV A;  1KD2 A;  4NK2 A;  5D5R A;  4C44 A;  4KMV A;  3PIA A;  2AUO A;  2MGL A;  1DXT B;  3O2C B;  1LFV A;  1Y5J A;  5CN5 A;  4U8U A;  5ILR A;  4ILZ A;  1KN1 B;  1JL6 A;  1Y0C A;  1HBB A;  1Y4G B;  2DN3 A;  3G52 A;  1VRF A;  1J7S A;  1ASH A;  3A5G A;  1BJE A;  4F68 A;  1KN1 A;  1O1P B;  1D8U A;  3S66 B;  1TU9 A;  1XY0 B;  4F0U B;  1Y4R A;  3QJB B;  1Y8I A;  1N9X A;  1YEU A;  107M A;  3IC2 A;  4WJG A;  3M39 A;  2BMM A;  2OIF A;  1ABY A;  5B84 A;  4M4A B;  1CH2 A;  4YJJ A;  1THB B;  3KUO A;  3QZX A;  1JEB A;  4PO5 B;  1HBR B;  3OGB A;  4LMS B;  1QPW A;  1IRC A;  2GTL A;  1MZ0 A;  1HAB A;  3QM6 A;  1MLK A;  1GLI A;  1NS9 A;  4YU4 A;  2VYZ A;  4L2M A;  3BRP A;  2FAL A;  1Q1F A;  2G0X A;  2H8D B;  1DKE A;  1QI8 B;  1HRM A;  1X9F B;  2ZSN A;  3OVU C;  4HBI A;  2V1E A;  3UHS A;  5AZR A;  3NG6 A;  2ZSQ A;  1Y0C B;  1HI0 P;  4OF9 A;  2LHB A;  3E5O A;  3D1A B;  2ZLU A;  2QSS A;  1FLP A;  1MLQ A;  4O4T A;  1MLH A;  1FAW B;  2HHB B;  1PBX B;  1HBR A;  1V4X A;  3E5I A;  3UHX A;  3ZJR A;  1IBE B;  2W31 A;  108M A;  2G14 A;  2X4A A;  1YEV A;  1UIW A;  3WCW D;  1ON7 B;  1MGN A;  1ALL A;  1BAB A;  1XZ5 A;  4ETT A;  1J3Z A;  1DXV A;  1Y7C B;  1HDB A;  1BZ1 A;  1ABS A;  1LIA A;  2ZSY A;  4H0B A;  5CHQ A;  3EDB A;  1J3Z B;  3ZJN A;  1HGB A;  1YMB A;  1BBB B;  1COL A;  1YIH B;  3G53 A;  1DTM A;  3QM9 A;  1SHR A;  1XG0 C;  3P5Q B;  1Y4B A;  1Y09 A;  1GH0 B;  2ZT0 A;  3KMF A;  1NS6 A;  1Y0W A;  1MYT A;  4QAU A;  2DN2 B;  3GDJ A;  4N8T A;  1UC3 A;  1M9P A;  1J41 A;  4H0M A;  1CQX A;  4LPI A;  3UH7 A;  1GCW B;  1YEO A;  1F5P A;  2MBW A;  2NSR A;  1S56 A;  2VML B;  2WCR A;  2W6Y A;  1MLS A;  1S0H B;  1MNH A;  1HGA A;  2ZLX B;  1A3O B;  3GQR B;  3HHB B;  3DUT A;  3UHG A;  2LH7 A;  5AQD M;  1A3O A;  2JHO A;  2ZLW B;  3G4Y A;  3A9M A;  1A4F A;  4TMA B;  1QXD B;  2YRS B;  1JDO A;  1XXT A;  3BOM B;  5JDO C;  1MBS A;  2E2Y A;  1J41 B;  1MLU A;  3RJN B;  1Y4F B;  1I3E A;  101M A;  4ROL A;  1WMU B;  2XYK A;  1JZM A;  6HBW A;  1YVT A;  1NS6 B;  3L0F A;  4O1T A;  1XZ2 B;  3E4N A;  4O35 A;  2V1H A;  4AVD A;  2AUP A;  1BZ6 A;  4N7O B;  1JF4 A;  2WTG A;  1FSL A;  4IRO B;  1BZ1 B;  1LIA B;  2BNL A;  1MNJ A;  2V1G A;  1CP0 A;  4UZV A;  4M4A A;  1K0Y A;  2HBS B;  1UX9 A;  102M A;  3PI4 A;  1JW8 A;  1CG5 B;  4F4O A;  2ZFO C;  1JPB A;  1U7R A;  1MYI A;  3S1J A;  1Y0A B;  1LHS A;  1W92 A;  3ZHW A;  3RGK A;  4Z8K B;  3NFE A;  1HBH B;  1F99 A;  1EYX A;  1XZU A;  2DC3 A;  4A8Y A;  1ECN A;  1M6C A;  1EWA A;  1MDN A;  3SDH A;  1F63 A;  1LUE A;  3AG0 A;  1EBC A;  3GQP A;  4IRO A;  2ZLT A;  2VML A;  3VRG A;  2GNV A;  3WCU B;  3OO4 B;  1ECO A;  2EVK A;  5MBA A;  3GQP B;  4WJG 1;  2R50 A;  2G11 A;  5SW7 B;  5KER A;  3ECL A;  1A0U B;  1Y46 B;  4N7P A;  3QM5 A;  5EQM A;  3MVC A;  1JEB B;  1IRD B;  3ODQ A;  1MYG A;  3QJD A;  4X0L B;  1V75 B;  2VEB A;  4ETV A;  3CIU A;  1RPS A;  1O1L A;  5CHR A;  3ZJM A;  4X0L A;  1MNI A;  3G4V A;  4DC7 A;  1Y7C A;  4F0U A;  1Y2Z B;  1GBU B;  1CPW A;  3WFW A;  4BJA A;  3GIO A;  1FCS A;  1VHB A;  3A0G A;  4MBA A;  3QQR A;  4A8O A;  3VRE B;  1G9V A;  3WCT C;  2RI4 A;  2ZSR A;  1GCW A;  4RMP A;  3BJ2 B;  2FRK X;  1YZI A;  1A3N A;  4NXC A;  5JDO D;  5HLU A;  1I7Y B;  1JWN A;  1YOH A;  1DXD A;  3GKV A;  4KMW A;  4DWU A;  4XS0 A;  2ZST A;  4MQI A;  2D2M B;  2W72 C;  1I7Y A;  2R4X A;  1B8D B;  1DXU A;  2ZSZ A;  1Y5K A;  1RQA B;  1ABW B;  2HBD A;  3KUN A;  3OZV A;  2QU0 A;  3OJ1 A;  2YRS A;  1N9I A;  1MDT A;  2D5X A;  1LA6 A;  5EOH A;  2QMB A;  2WCQ A;  2GRZ A;  3AT6 B;  3LB4 A;  1Y8K B;  5F2A A;  1X9F D;  1MTK A;  2W72 A;  1SPG B;  1LFQ B;  5HAV A;  2VM0 A;  3PI1 A;  1BZ0 B;  2C7K A;  3ZJQ A;  3G4W A;  3G46 A;  3M38 A;  3GUQ A;  4N8T B;  1CQ2 A;  1F5O A;  1JP6 A;  1RTE A;  2GL3 A;  2UUN B;  103M A;  1CBL A;  4BS9 A;  1A3N B;  1YVT B;  1YHR B;  1CMY B;  4JYQ A;  2ZS0 B; 
#chains in the Genus database with same CATH homology
 1MLM A;  2MYA A;  1IRD A;  3UHY A;  4H2L B;  5CN9 A;  2BK9 A;  1LH2 A;  1NPG A;  2MGF A;  7HBI A;  2QFK A;  3D17 A;  1VXH A;  1G0A A;  3UHT A;  3MJP B;  4ZVB A;  3HC9 A;  3PEL A;  2D5Z A;  3AQ7 A;  2VYW A;  110M A;  3K8B B;  2BLJ M;  1XZU B;  1O1L B;  2O5M X;  2GNW A;  2ZS1 A;  3ED9 A;  1HDA A;  1YIE B;  3ONZ B;  2GDM A;  1XZ7 B;  3A59 A;  4NK1 A;  3GOU B;  2WTH A;  1YCA A;  2ZLU B;  5CN7 A;  1QXE B;  2SPL A;  4L7Y A;  2EVP A;  1NWI A;  3MJP A;  1A0Z A;  3VHB A;  1UX8 A;  3WR1 B;  3WCV C;  3HF4 A;  1Y0D B;  5B85 A;  1DO7 A;  2O5S X;  1HDS B;  2XKG A;  2ZSP A;  1MBI A;  1S5X A;  4HSW A;  2VYY A;  1HDS A;  2O5L X;  1XQ5 B;  1DKE B;  1HDB B;  2MB5 A;  2QSP A;  1B86 A;  2SPM A;  3PI9 A;  2Z8A A;  2W6V B;  1Y31 A;  2HCO B;  1DUK A;  1Y4F A;  1CG5 A;  2RAO A;  2GKM A;  1R1X A;  1S6A A;  1HHO A;  1HHO B;  1VXB A;  1A00 B;  4KJT A;  1LFY B;  1TES A;  1YGF A;  2RAO B;  3LB3 A;  1GZX A;  1KR7 A;  1EBT A;  1C7B B;  4F6D A;  1BZZ B;  5HLQ A;  4MQJ B;  1MLN A;  1IOP A;  1V4W B;  1CLS B;  3D1A A;  1MYM A;  1M6M A;  3D4X B;  1J52 A;  4O2G A;  3WCP A;  4N7O A;  3ZJH A;  3RJ6 A;  3W4U B;  1MLJ A;  1XQ5 A;  1G0B A;  1MLO A;  3HF4 B;  4FH7 A;  2HBC B;  1EW6 A;  2G10 A;  4YU3 B;  1OR6 A;  3HHB A;  4H2L A;  1NGK A;  1Y7G B;  3VRF A;  3U3E A;  1NAZ A;  1O1K B;  3WHM B;  2OHA A;  2DN3 B;  2GTL B;  1MBC A;  1YG5 A;  1Y5J B;  3OZU A;  4U8U C;  5MBN A;  3UH5 A;  3OO5 B;  3GDJ B;  3BCQ B;  3GQG B;  1Y0W B;  1XZ7 A;  3K3U A;  1YEQ B;  2G12 A;  1GBU A;  1NWN A;  1Y4B B;  2FRF A;  1MLF A;  1XY0 A;  2V1J A;  4GZG A;  2QFN A;  2EF2 A;  3D4X A;  1J3Y B;  1YE0 A;  1NZ3 A;  3AQ6 A;  1O1M A;  1RPS B;  1URY A;  1MLL A;  2D6C A;  2VLX A;  1M9P B;  5KKK A;  3WR1 A;  1A6K A;  1A0U A;  1Y22 A;  3HEN A;  1CH7 A;  3NL7 B;  3EDA A;  3H58 A;  1K1K A;  1CO8 A;  1BIJ A;  1OUU B;  1SI4 A;  2QSP B;  1VWT B;  4MQC B;  5CN4 A;  1O1K A;  1MCY A;  1X3K A;  2H35 A;  1JP9 A;  3WCW B;  1MTJ A;  1LFQ A;  1XZ4 A;  1LA6 B;  4MQH B;  1Y8K A;  1Y4P B;  2Z6N B;  1MOA A;  1A6N A;  1HBH A;  3TM9 A;  1HBS A;  5EU2 A;  2GKN A;  1LJW A;  2XKI A;  3UHZ A;  1GZX B;  3QJC A;  1THB A;  2G0Z A;  4VHB A;  1A6G A;  1Y35 A;  1FAW A;  2R4W A;  1YOG A;  3IA3 B;  5HLX A;  4FH6 A;  1DO4 A;  1URV A;  1Y4Q A;  2ZT2 A;  3ZOL A;  1DXU B;  1S5Y B;  2Z6S A;  1YEN A;  3UHI A;  1VXC A;  1LFT B;  1Y22 B;  1J7W A;  2MGC A;  1DWT A;  1OR4 A;  2D5Z B;  2ZSO A;  2PEG A;  3MKB A;  1IWH B;  2AV0 A;  3VRG B;  2EB9 A;  1BUW A;  1Y5F A;  1WMU A;  3A5B A;  4DC8 A;  3MN0 A;  1YE0 B;  4SDH A;  2W6X A;  1YH9 A;  3UHE A;  105M A;  1C7B A;  3EU1 A;  1BVC A;  5JDO E;  4ZVA A;  1V07 A;  3UH6 A;  2DXM A;  3ZJL A;  1YHU A;  1COH B;  3B75 B;  1Y4V B;  104M A;  5JDO F;  3NML A;  1WLA A;  1YMA A;  1LH6 A;  2HBF B;  4FC3 A;  3O7N A;  1MWC A;  3LQD B;  2BW9 M;  4F6F A;  1PMB A;  2OHB A;  2ZFB B;  2DHB B;  3NMM A;  1X9F C;  4UUR A;  1Y45 A;  3DHR A;  5EE4 C;  2QU0 B;  4F6B A;  3HEO A;  2ZFO D;  3PIA B;  1ABW A;  1XCH A;  2DHB A;  2O5T X;  1UFJ A;  2ZLT B;  1MWB A;  5CNB A;  3WFT A;  3SDN A;  1QXE A;  1LHT A;  1YE2 B;  2ZLV A;  3BJ1 B;  1OFJ A;  1BVD A;  1CMY A;  3ARJ A;  3PT8 A;  3GKV B;  4MQJ A;  3TLD A;  5HU6 B;  1RVW A;  3UHU A;  5EET A;  1COH A;  3B75 A;  1T1N B;  2DN1 A;  2MGA A;  1NEJ A;  1HSY A;  5F0B A;  5E29 A;  1DWS A;  1Y8W B;  3ARK A;  1NZ4 A;  3VRE A;  3BA2 A;  1HBA A;  2MGG A;  3QZZ A;  1QSH B;  4ODC B;  2HCO A;  3MJU A;  5E83 B;  3ZJP A;  1MOC A;  1MNO A;  1CIO A;  1S0H A;  1V9Q A;  1NXF A;  3R5I B;  1MLR A;  1B0B A;  1VWT A;  3PI8 A;  3UBC A;  1MOH A;  2R1H B;  1G08 B;  1UVX A;  3BJ1 A;  1YE2 A;  1Z8U B;  2D60 B;  2MGJ A;  3DHT A;  4N7N B;  5EUI A;  1YHE A;  5AB8 A;  1V4U A;  1G9V B;  2ZSS A;  2ZS0 C;  1XYE A;  3QM7 A;  2W72 B;  3IC0 A;  1HBS B;  1SDL B;  1MKO A;  1OFK A;  4OOD A;  2GRH A;  1SDK B;  2GRF A;  1C7C B;  1Y8H B;  1QPW B;  3WFU A;  5D1V A;  5E83 A;  1HAC B;  1HV4 A;  1LFZ A;  2ZSX A;  3IXF A;  3V2V A;  2D2N B;  1QSH A;  2ZT4 A;  1H1X A;  4FWY A;  4M4B B;  4HRR A;  2BWH A;  2ZS1 D;  4ESA A;  3CIU B;  1YEV B;  1CG8 A;  1Y7D A;  1Y5K B;  1Y0A A;  3KMF C;  3G4R A;  1YG5 B;  4O4Z A;  1J3F A;  3BCQ A;  1HLB A;  2D60 A;  3ZJI A;  1NQP A;  2GTL C;  1LH3 A;  1IDR A;  4MQK A;  3OO5 A;  3LB1 A;  4HHB B;  3CY5 A;  3S66 A;  1G08 A;  3P5Q A;  1SHR B;  2HZ2 A;  1AJH A;  5HY8 B;  2RI4 B;  3WCU A;  1CH4 A;  2V1F A;  1YDZ B;  1YVQ A;  3ZJS A;  3ZOM A;  1O1M B;  3HYU A;  2AUR A;  4ROM A;  1SPG A;  3UHN A;  3VAU A;  2PGH B;  5EYJ A;  2HBE B;  3MJU B;  3AT5 A;  1OJ6 A;  5HBI A;  1MWD A;  1FHJ B;  1GLI B;  1NS9 B;  3UHC A;  4YU4 B;  1UT0 A;  4F6J A;  2MYC A;  2H8F A;  1IBE A;  5CMV A;  1O16 A;  2MYD A;  1C7C A;  2QLS B;  3ECZ A;  5E29 B;  3MYM A;  1GCV A;  1FN3 A;  3MBA A;  3WCT A;  2HBD B;  5EV5 A;  1RQ3 A;  2V1K A;  1GCV B;  2EKU A;  1YGF B;  2Z6T A;  2ZLW A;  3LR7 A;  3NG6 B;  2ZFO A;  2MYE A;  5C6E A;  1MYH A;  1Y4P A;  1MYF A;  1HBG A;  1DO3 A;  2MGK A;  3PI9 B;  1XZ4 B;  1Y83 B;  1Y83 A;  3WCP B;  1IWH A;  3D7O B;  2MGD A;  3H57 A;  1JY7 B;  1MBD A;  2ZT3 A;  1C7D B;  1Y0D A;  3WCT B;  1HBA B;  1V5H A;  1UIW B;  1O1J A;  3OZW A;  1FN3 B;  1U7S A;  1AJG A;  4F6I A;  3OK5 A;  2QLS A;  3E55 A;  4NI1 B;  1Y7D B;  1O1J B;  1NZ5 A;  1DUO A;  4B4Y A;  5JGG A;  1SWM A;  1FDH G;  4M4B A;  1Y31 B;  2W6V A;  5EYS A;  1C40 A;  2HZ3 A;  3FH9 A;  1XZV A;  2ZS1 B;  1BUW B;  1Y5F B;  1RSE A;  1SPE A;  111M A;  4AVE A;  3GKT A;  3MKB B;  3PI3 A;  4FWX A;  3A2G A;  1SI4 B;  1O1O B;  1JZK A;  4WCH D;  1MKO B;  1RTX A;  1O1P A;  4HHB A;  2CMM A;  1YHE B;  3GK9 A;  3GLN A;  1A6M A;  3GOU A;  1Y7Z B;  2WY4 A;  5JOM A;  1LTW A;  2V1I A;  4NS2 A;  3S65 B;  2XKH A;  1YHR A;  1MOD A;  1A01 B;  6HBI A;  1Y4V A;  1VXE A;  4PQB A;  4XDI A;  3R5I A;  2D2N A;  3WCV B;  5ILP A;  3ORD A;  4HRR B;  3FH9 B;  1MTI A;  4NI0 A;  5CND A;  1DLW A;  2VHB A;  1K0Y B;  2LH5 A;  2G0R A;  1YCB A;  1BZP A;  2HHE A;  1J7Y A;  1A9W E;  2LH1 A;  3G4U A;  4C0N A;  2OH9 A;  3QM8 A;  3QJE B;  2H35 B;  1Y4G A;  2SPO A;  2FRI X;  3QQQ A;  1SDL A;  1DXC A;  1NIH A;  2G0V A;  1N9H A;  2G3H A;  1C7D A;  1XYE B;  4MQK B;  2DN2 A;  5EUI B;  4N7N A;  1OUT B;  2ZLV B;  2MHB B;  1S61 A;  2HBC A;  1Y4R B;  3BJ2 A;  3QJB A;  1GDK A;  2B7H A;  4MU5 A;  1YFF A;  2R4Z A;  4G1B A;  2NX0 A;  1MYZ A;  4PNJ A;  1HGB B;  3WCU C;  4ODC A;  2HHD B;  1J3Y A;  1GDI A;  2ZFB A;  2AA1 B;  1HAC A;  1HV4 B;  1LFZ B;  4NI0 B;  1GDJ A;  3AQ8 A;  1IT2 A;  1RQA A;  2AA1 A;  1X46 A;  2D5X B;  1RQ3 B;  5CNC A;  3PT7 B;  4TWU A;  1A00 A;  3AQ9 A;  1YMC A;  4PQC A;  4H07 A;  2O5O X;  4DWT A;  2D2M C;  1YEO B;  1YZI B;  3WCW C;  5HU6 A;  2AUQ A;  2BLH A;  2MHB A;  2MGM A;  1FDH A;  2O5Q X;  3ARL A;  3MYN A;  2ZWJ A;  1DM1 A;  1OBM A;  2VRY A;  1Y85 A;  1Y46 A;  4N7P B;  3UHD A;  2MGI A;  3OO4 A;  1YHU D;  1CBM A;  1G0B B;  1S5X B;  4G51 A;  1LFV B;  2NSS A;  3UGY A;  1MLG A;  2G0S A;  1DXV B;  2VLZ A;  1XZV B;  1RQ4 B;  1RQ4 A;  3FS4 A;  3ZJJ A;  1HCO A;  1LFY A;  3ASE A;  2FRJ X;  4MQG B;  2MGE A;  2M6Z A;  4IT8 A;  1FHJ A;  1YOI A;  3K8B A;  4MAX A;  1DO1 A;  3AT5 B;  3UHH A;  3V2Z A;  2HBE A;  2QSS B;  1YH9 B;  1SDK A;  1Y85 B;  2HBG A;  4ROM B;  2ZS0 D;  1YDZ A;  2W6W A;  1JY7 A;  1J40 B;  5AZQ A;  4B3W A;  1G0A B;  2HZ1 A;  1UFP A;  4TYX A;  1A0Z B;  3UH3 A;  1MBA A;  2VLY A;  1LH7 A;  2GTL D;  1DTI A;  3A5A A;  1O1N A;  1K1K B;  1NPF A;  1NQP B;  3UGZ A;  1VXG A;  5JGG B;  3NFE B;  1HAB B;  4G1V A;  2HBS A;  3PI8 B;  3PT7 A;  1L2K A;  1KFR A;  1QXD A;  2O58 X;  2MGH A;  1CH3 A;  1S69 A;  1BZ0 A;  1NIH B;  3SZK B;  1XXT B;  3UI0 A;  1VRE A;  2Z6N A;  1R1X B;  4MQH A;  1IT3 A;  1NZ2 A;  1Y2Z A;  3HYU B;  3BJ3 A;  5CNG A;  1A9W A;  3D7O A;  1XZ2 A;  3GYS A;  3D17 B;  3IC0 B;  1MOB A;  2C0K A;  3S48 C;  3GQR A;  5IKS A;  1OUT A;  1HGA B;  2ZLX A;  4NZI A;  1Y0T B;  3NL7 A;  1JF3 A;  1GDL A;  1VXF A;  2ZT1 A;  5KDQ B;  4PQ6 A;  2IG3 A;  2ZS1 C;  1Y4Q B;  5ILM A;  3UHK A;  3MOU A;  4XS0 B;  1A4F B;  4MXL A;  3UHB A;  2IN4 A;  2R1H A;  4JAC A;  2GLN A;  3BOM A;  1Y45 B;  1JP8 A;  1VXD A;  1GJN A;  1N9F A;  3AT6 A;  1J7Y B;  2M6Z B;  2QMB B;  2R4Y A;  1G09 B;  3TM3 A;  1YIH A;  4UIQ A;  1H97 A;  2LH2 A;  2PGH A;  1CLS A;  3GQG A;  3M3B A;  1O1I A;  1YVQ B;  1Y8W A;  112M A;  2EB8 A;  1YHU B;  1Y8H A;  3WTG B;  1DWR A;  1YEQ A;  5HY8 A;  1Y7Z A;  4KN3 A;  4NXA A;  3VRF B;  2ZS0 A;  1Y7G A;  1O1N B;  3UHV A;  3UHR A;  1BBB A;  1GVH A;  2LH6 A;  3HXN B;  5KDQ A;  3DR9 A;  1CG8 B;  2QRW A;  1LFL B;  1J7W B;  1AJ9 A;  2NRM A;  3QMA A;  2AV3 A;  4HSX A;  3ECX A;  1G09 A;  5CNE A;  1QI8 A;  2MGB A;  4U8U D;  3WI8 A;  1MNK A;  1C40 B;  1HGC B;  1V4W A;  1PBX A;  109M A;  4MQG A;  2Z85 A;  1BZR A;  1BZZ A;  1CH1 A;  3UHQ A;  1GBV B;  1JZL A;  1YGD A;  3ZJO A;  1MBO A;  1CH5 A;  1V4X B;  3IC2 B;  1LJW B;  1GBV A;  2HHB A;  1EMY A;  3LR9 A;  3WHM A;  2D2M A;  1CIK A;  5KER B;  3LHB A;  4YU3 A;  3PEL B;  3WCT D;  3NMM B;  2KSC A;  3LQD A;  2H8D A;  1HBB B;  1LFT A;  1FSX B;  1OUU A;  1AJ9 B;  4ROL B;  1DXT A;  1DLY A;  3AQ5 A;  2ZFO B;  5C6E B;  1YEN B;  3SZK A;  6HBW B;  1LH5 A;  1NEJ B;  1Y09 B;  3ZH0 A;  1YIE A;  1YGD B;  3ONZ A;  4MPM A;  1JL7 A;  2VEE A;  4F6G A;  1ABY B;  1Y0T A;  3EU1 B;  2R80 A;  1ITH A;  1ECA A;  1LH1 A;  3A59 B;  5CN8 A;  3PT8 B;  3QJC B;  4HRT A;  3ODQ B;  2H8F B;  4MBN A;  4ESA B;  1Y8I B;  3K9Z A;  1ECD A;  1VXA A;  5SW7 A;  2MYB A;  1J40 A;  1BAB B;  1Y01 B;  4U8U B;  3DHR B;  3M3A A;  3WCW A;  1FSX A;  3S65 A;  2PEG B;  2SPN A;  1WVP A;  1F65 A;  1BIJ B;  1R1Y B;  2BKM A;  106M A;  3CY5 B;  1HJT A;  3LB2 A;  1V4U B;  3S1I A;  1KD2 B;  4F69 A;  3DHT B;  1CH9 A;  3O89 A;  3WTG A;  4MXK A;  2DXM B;  1HDA B;  1X9F A;  2D2M D;  1UMO A;  3D1K A;  5CNF A;  1Y35 B;  3GYS B;  1XZ5 B;  1HGC A;  1CP5 A;  3EOK B;  1QSI B;  3D1K B;  4G51 B;  5CN6 A;  1BIN A;  3HRW A;  2OLP A;  2NRL A;  1QSI A;  1YHU C;  2HHD A;  1T1N A;  2D2N D;  2DN1 B;  5M3S A;  1YFF B;  2OH8 A;  5EE4 D;  1HCO B;  1LFL A;  2B7H B;  2O5B X;  5E6E B;  5E6E A;  3QJD B;  3FS4 B;  3HXN A;  4MQC A;  3UBV A;  1B86 B;  1S5Y A;  4FWZ A;  1R1Y A;  3G4Q A;  1MYJ A;  1CO9 A;  5ILE A;  1UVY A;  1I3D A;  1HLM A;  3EOK A;  1O1O A;  1HBI A;  3QJE A;  2D2N C;  1J7S B;  3HRW B;  3BJ3 B;  2FAM A;  3W4U A;  2HHE B;  4L7Y B;  1AZI A;  5C6Y A;  2BLI A;  1O1I B;  3A0G B;  3WCV D;  4HRT B;  1A01 A;  1RVW B;  3DUT B;  3R0G A;  3UHW A;  2R80 B;  4FC3 B;  1V75 A;  2HBF A;  2EKT A;  3WCV A;  4NI1 A;  3PI2 A;  1YEU B;  1MBN A;  2LH3 A;  3HEP A;  4F4O B;  3WFX A;  3WCU D;  4MQI B;  4TWV A;  1KD2 A;  4NK2 A;  5D5R A;  4C44 A;  4KMV A;  3PIA A;  2AUO A;  2MGL A;  1DXT B;  1LFV A;  1Y5J A;  5CN5 A;  4U8U A;  5ILR A;  4ILZ A;  1JL6 A;  1Y0C A;  1HBB A;  1Y4G B;  2DN3 A;  3G52 A;  1VRF A;  1J7S A;  1ASH A;  3A5G A;  1BJE A;  4F68 A;  1O1P B;  1D8U A;  3S66 B;  1TU9 A;  1XY0 B;  1Y4R A;  3QJB B;  1Y8I A;  1N9X A;  1YEU A;  107M A;  3IC2 A;  4WJG A;  3M39 A;  2BMM A;  2OIF A;  1ABY A;  5B84 A;  4M4A B;  1CH2 A;  1THB B;  3KUO A;  3QZX A;  1JEB A;  1HBR B;  3OGB A;  1QPW A;  1IRC A;  2GTL A;  1MZ0 A;  1HAB A;  3QM6 A;  1MLK A;  1GLI A;  1NS9 A;  4YU4 A;  2VYZ A;  4L2M A;  2FAL A;  1Q1F A;  2G0X A;  2H8D B;  1DKE A;  1QI8 B;  1HRM A;  1X9F B;  2ZSN A;  3OVU C;  4HBI A;  2V1E A;  3UHS A;  5AZR A;  3NG6 A;  2ZSQ A;  1Y0C B;  4OF9 A;  2LHB A;  3E5O A;  3D1A B;  2ZLU A;  2QSS A;  1FLP A;  1MLQ A;  4O4T A;  1MLH A;  1FAW B;  2HHB B;  1PBX B;  1HBR A;  1V4X A;  3E5I A;  3UHX A;  3ZJR A;  1IBE B;  2W31 A;  108M A;  2G14 A;  1YEV A;  1UIW A;  3WCW D;  1MGN A;  1BAB A;  1XZ5 A;  1J3Z A;  1DXV A;  1Y7C B;  1HDB A;  1BZ1 A;  1ABS A;  2ZSY A;  4H0B A;  5CHQ A;  3EDB A;  1J3Z B;  3ZJN A;  1HGB A;  1YMB A;  1BBB B;  1YIH B;  3G53 A;  1DTM A;  3QM9 A;  1SHR A;  3P5Q B;  1Y4B A;  1Y09 A;  2ZT0 A;  3KMF A;  1NS6 A;  1Y0W A;  1MYT A;  4QAU A;  2DN2 B;  3GDJ A;  4N8T A;  1UC3 A;  1M9P A;  1J41 A;  1CQX A;  4LPI A;  3UH7 A;  1GCW B;  1YEO A;  1F5P A;  2MBW A;  2NSR A;  1S56 A;  2W6Y A;  1MLS A;  1S0H B;  1MNH A;  1HGA A;  2ZLX B;  1A3O B;  3GQR B;  3HHB B;  3DUT A;  3UHG A;  2LH7 A;  1A3O A;  2JHO A;  2ZLW B;  3G4Y A;  3A9M A;  1A4F A;  1QXD B;  2YRS B;  1JDO A;  1XXT A;  3BOM B;  5JDO C;  1MBS A;  2E2Y A;  1J41 B;  1MLU A;  3RJN B;  1Y4F B;  1I3E A;  101M A;  4ROL A;  1WMU B;  2XYK A;  1JZM A;  6HBW A;  1YVT A;  1NS6 B;  4O1T A;  1XZ2 B;  3E4N A;  4O35 A;  2V1H A;  4AVD A;  2AUP A;  1BZ6 A;  4N7O B;  1JF4 A;  2WTG A;  1FSL A;  4IRO B;  1BZ1 B;  2BNL A;  1MNJ A;  2V1G A;  1CP0 A;  4UZV A;  4M4A A;  1K0Y A;  2HBS B;  1UX9 A;  102M A;  3PI4 A;  1JW8 A;  1CG5 B;  4F4O A;  2ZFO C;  1JPB A;  1U7R A;  1MYI A;  3S1J A;  1Y0A B;  1LHS A;  1W92 A;  3ZHW A;  3RGK A;  3NFE A;  1HBH B;  1XZU A;  2DC3 A;  1ECN A;  1M6C A;  1EWA A;  1MDN A;  3SDH A;  1F63 A;  1LUE A;  3AG0 A;  1EBC A;  3GQP A;  4IRO A;  2ZLT A;  3VRG A;  2GNV A;  3WCU B;  3OO4 B;  1ECO A;  2EVK A;  5MBA A;  3GQP B;  4WJG 1;  2R50 A;  2G11 A;  5SW7 B;  5KER A;  3ECL A;  1A0U B;  1Y46 B;  4N7P A;  3QM5 A;  5EQM A;  3MVC A;  1JEB B;  1IRD B;  3ODQ A;  1MYG A;  3QJD A;  4X0L B;  1V75 B;  2VEB A;  3CIU A;  1RPS A;  1O1L A;  5CHR A;  3ZJM A;  4X0L A;  1MNI A;  3G4V A;  4DC7 A;  1Y7C A;  1Y2Z B;  1GBU B;  1CPW A;  3WFW A;  4BJA A;  1FCS A;  1VHB A;  3A0G A;  4MBA A;  3QQR A;  3VRE B;  1G9V A;  3WCT C;  2RI4 A;  2ZSR A;  1GCW A;  3BJ2 B;  2FRK X;  1YZI A;  1A3N A;  4NXC A;  5JDO D;  5HLU A;  1JWN A;  1YOH A;  1DXD A;  3GKV A;  4KMW A;  4DWU A;  4XS0 A;  2ZST A;  4MQI A;  2D2M B;  2W72 C;  2R4X A;  1DXU A;  2ZSZ A;  1Y5K A;  1RQA B;  1ABW B;  2HBD A;  3KUN A;  3OZV A;  2QU0 A;  3OJ1 A;  2YRS A;  1N9I A;  2D5X A;  1LA6 A;  5EOH A;  2QMB A;  2GRZ A;  3AT6 B;  3LB4 A;  1Y8K B;  5F2A A;  1X9F D;  1MTK A;  2W72 A;  1SPG B;  1LFQ B;  5HAV A;  2VM0 A;  3PI1 A;  1BZ0 B;  3ZJQ A;  3G4W A;  3G46 A;  3M38 A;  4N8T B;  1CQ2 A;  1F5O A;  1JP6 A;  1RTE A;  2GL3 A;  103M A;  1CBL A;  1A3N B;  1YVT B;  1YHR B;  1CMY B;  4JYQ A;  2ZS0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...