3EDAA

Carbonmonoxy sperm whale myoglobin at 100 k: laser on [150 min]
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
153
structure length
153
Chain Sequence
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing breathing motion of internal cavities in concert with ligand migration in myoglobin
pubmed doi rcsb
molecule tags Oxygen transport
molecule keywords Myoglobin
total genus 64
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 3edaA00
2G0RA 2D2MD 1HBAB 5HLXA 1EWAA 1Z8UB 1MLHA 1HGAA 1Y0TA 1MOBA 3M3BA 1R1XB 4MQKB 1RQAA 3A2GA 5EV5A 1S6AA 3UHTA 1Y7CB 1YEUA 1YHEB 1HBRA 2WTHA 1VXHA 2H35A 1X9FA 1HACA 3QJEA 1YMCA 1S5YA 1XZVA 4MQHB 2RAOB 5HU6B 3WCWA 1HDSA 1VREA 3FS4A 4FC3B 3G4UA 3AQ8A 1HBGA 5C6EB 1NZ2A 4NI0A 1LFVA 3NMMB 1CH3A 2G11A 4F6DA 1G08A 2XKIA 1MBCA 5CMVA 104MA 2H35B 3G4VA 111MA 1YIEA 2OHBA 5EU2A 4NXAA 1B86B 1CLSB 2O5BX 2D60B 1DKEB 4GZGA 3OJ1A 3QM8A 2MGEA 1XZ5A 5CNGA 3DHTA 3PELB 1XYEB 1FN3B 1Y46A 2DN3B 4MQJA 2H8DA 1MKOA 3GK9A 1YEVA 2V1JA 2GDMA 3AQ5A 1O1IA 3B75A 4H07A 1Y8HB 2HBSA 1V4UB 5CNDA 3P5QB 1IOPA 2OH8A 1HDAB 4F6GA 1SI4A 3OGBA 3QM9A 1GVHA 2Z6TA 3MYNA 3G4YA 4F68A 2LH3A 1MYFA 1DUKA 3QJBA 1HV4B 1YGFB 2D2MA 1Y7DB 1RQ3B 2FRKX 3WCUA 2DN2B 2V1EA 2VYYA 4UZVA 1J7WA 1LH1A 1Y31A 3QJDA 1QSHB 1LFTA 5CN4A 4MQIA 1CG8B 4KJTA 1HHOB 4O35A 1Y4FA 2G3HA 1LJWB 5AB8A 2GRZA 3ZJPA 4MBNA 6HBIA 1OUUA 1Y09B 1TU9A 3IA3B 1BIJB 3K3UA 1NGKA 1D8UA 1HBBA 1CO9A 1O1LB 3WR1A 1LHSA 1MLOA 3HRWB 1FSXA 5ILMA 1NS9A 2VYZA 1COHB 1GZXA 1IRDA 1G0AA 1LHTA 1YCAA 3WTGB 1G0BB 4KN3A 1CBMA 1G09B 2CMMA 3UHYA 2ZSQA 1Y2ZA 1Y31B 2ZSYA 1VXGA 1XZ2A 1RQ3A 1Y8WB 4MQCA 1VXCA 1CMYB 1WMUB 1V75B 3QJBB 2LH7A 2XKGA 2ZS1D 1J7SB 1J7YB 1X9FD 1A0UA 5KDQB 2HBDB 4F6JA 1JL6A 2QU0A 1RQ4B 5SW7A 2ZSZA 4U8UA 1CO8A 2O5OX 1RTXA 5EE4D 3GKTA 1MNHA 2ZT0A 4M4AB 3LB1A 2ZS0C 1DO7A 2ZLTA 1YEQB 3D1KA 1FDHG 2ZT2A 3EDAA 1QPWA 4MAXA 1A4FB 1BIJA 1MKOB 2W6XA 2AA1B 4L7YB 1QXDA 3PI8B 3S1JA 3VRFA 2O5SX 1YENA 1A6KA 1IDRA 2EVPA 1Y4FB 1Y4BA 1VXFA 108MA 1MTKA 2G0SA 1X9FC 1YGDA 1O1KB 4FWZA 2R4ZA 2VHBA 1MNIA 3HEPA 3GKVB 2HBCA 1SDLA 2ZLXA 103MA 3QM6A 4N7OB 1CH7A 3NG6A 2ZSTA 1V4XB 3OO4A 4B3WA 3RJ6A 1NWIA 2LH6A 1F5OA 4MU5A 3NL7B 1YFFA 1CQXA 1BZPA 3ZJNA 1MLFA 1JZLA 1JP8A 2DC3A 3MJPA 4MXKA 2LH5A 1DXVB 1Y8WA 3UHKA 3ED9A 2HBCB 1ECAA 3BCQA 3WCPA 3BJ2B 4PNJA 5CNBA 1LFZB 3EOKB 1U7SA 4DWUA 2NX0A 5EETA 2Z6NA 4O4ZA 1HGBA 3R5IB 1R1XA 1UX9A 3PI8A 1B86A 1Y4PA 3OK5A 1N9IA 1NS6A 1BJEA 3K9ZA 1XZUA 1Y22A 4NZIA 3QJCB 1DUOA 2XYKA 2DN1B 1YEQA 1IWHB 3VHBA 2ZS0A 1LFYA 2ZLVA 1NIHB 3ZJQA 3KUOA 1VXEA 3KMFA 4YU4B 3SZKA 1BZZB 3UBCA 2YRSB 3HHBA 2XKHA 1CIKA 3FS4B 2MGDA 3WCWB 1CQ2A 2R4XA 1J7SA 1S56A 1Y8KA 3UI0A 1WMUA 1J41A 3HF4A 3PIAA 1HDBB 1DXUB 1YGFA 1HBRB 2MHBA 3ZOLA 3RJNB 1VWTB 109MA 4HHBB 2HZ1A 1HCOB 1YFFB 5CNEA 3UH5A 1Y4RA 2GTLD 1MLQA 3HXNB 2AV0A 4MQKA 4OF9A 3ASEA 3H58A 3NG6B 2H8FB 4FH6A 1RVWB 1Y5JB 2AUOA 1N9HA 2HZ3A 1XZ7B 2MGKA 2R4YA 1Y09A 2ZSOA 2QSPB 2ZFBB 1Y01B 2WY4A 3MVCA 3DHTB 3S48C 1Y4BB 2D2NC 1BZRA 2O58X 3IC2B 3UHDA 2V1FA 4TYXA 1T1NB 2QFKA 3MYMA 1A01B 3WCPB 1QPWB 1LFTB 1XQ5A 3ECLA 2OLPA 1JEBA 2D5ZB 1MWBA 2ZT1A 2MGIA 1C7CA 3DHRB 1Y4QA 5CNFA 1Y4VB 4MBAA 5C6YA 1DXVA 1DLYA 2HCOB 1J3YA 2O5QX 3A5BA 3ZJMA 1MYTA 2PEGB 1Y0DB 3NMMA 3WCUD 1RPSA 1G9VA 5HY8B 2FRIX 3VREB 2W6VB 3CIUB 5HU6A 1Y0DA 1YMBA 1S61A 1YMAA 3P5QA 1BABB 4MQCB 4HRRB 1EW6A 2GTLB 3D1AB 2AURA 1C7CB 1YHEA 1YEUB 4WCHD 5B85A 2H8DB 4G51A 2MYBA 3ZHWA 1FN3A 2ZT4A 4DC7A 3GYSA 3TM9A 3WCTB 1VHBA 3D4XB 1Y35B 1O16A 1IRDB 1MBAA 1VXBA 2HHBB 3V2VA 2ZFBA 1QXDB 3WCUC 2OIFA 3QQQA 1XZ7A 1O1LA 1O1JA 3QM7A 1Y22B 1JP6A 1RVWA 2R80B 1UIWB 101MA 1Y0CA 3ARKA 1MLMA 1RSEA 1BUWA 1J3FA 3UHHA 1G08B 3OO5B 2DXMA 1UX8A 4SDHA 5E29A 5EYJA 1FSLA 4PQ6A 1HJTA 1YIHB 3UHWA 3GQRA 1Y83A 1A0UB 2R4WA 1NZ3A 4MQIB 5ILPA 2RAOA 1OUTA 3MN0A 2VLYA 2W6WA 3UH7A 1XZVB 3QJEB 1J40A 2MHBB 1CBLA 4HSXA 1Y7DA 2D2NA 3WFUA 2EVKA 3MJPB 4O1TA 3E5OA 1Y2ZB 3MKBA 2OHAA 3K8BB 1LFQB 1Y7CA 4DWTA 3GQRB 1GCWB 4F4OB 2SPMA 1VRFA 2YRSA 3OZVA 4TWVA 3AQ7A 5EQMA 4YU4A 105MA 3UHBA 2BLJM 2DXMB 1LA6A 1Y0WB 4ZVAA 4ESAB 2M6ZA 1FDHA 1MOHA 1Y0CB 2ZLXB 2GKNA 1ECOA 3KMFC 1ABWA 1NZ4A 3WCWC 1IBEA 1JWNA 2SPOA 4JYQA 4MQJB 1YGDB 1Y46B 3D7OB 5CHRA 2AUQA 1X46A 1V4WA 1GCVB 2SPLA 1NEJA 1S0HA 3E4NA 3VRFB 1MYZA 1Y7ZA 4F6BA 2VRYA 1A4FA 3VRGB 5MBNA 1YHRA 1LUEA 2ZSSA 2PGHB 2DHBA 1AJ9B 1DTMA 3E5IA 1M9PB 1ABYA 1A00B 1PMBA 2QU0B 4G1VA 1HBSA 1HDSB 3GQPA 1CH5A 2EKUA 2HBEB 3ZJIA 4VHBA 1V4XA 4ZVBA 3ZOMA 1HACB 1YG5A 2HBFB 1Y8HA 1YZIB 1CG5A 6HBWB 3G4QA 2G0ZA 1OFJA 1HLMA 3UHNA 1YH9A 1A3NB 3MBAA 2DN3A 4WJG1 4NI1A 5MBAA 4N7PB 3GQGA 4IROA 1G0AB 1MNJA 2GL3A 1Y8IB 1W92A 2MGFA 1Y45B 2GNWA 1CLSA 4H2LB 5JGGB 3G4RA 1V07A 3UBVA 4L2MA 3PI3A 4KMWA 1ITHA 4UIQA 1Y5JA 3D1KB 1Y7GA 1SPEA 4JACA 1LH7A 3ARJA 4XDIA 1JZMA 3LR9A 5KERB 2HBEA 1MYHA 2VM0A 1MOAA 1QXEB 1Y5FA 3CY5B 3A5GA 5ILEA 1GBUA 3BOMB 1BBBB 1HBHA 1G9VB 4ODCB 3WCTC 2ZSNA 3QM5A 1LFQA 2ZS1B 2PEGA 2HHDA 4LPIA 1VWTA 2D6CA 4HHBA 1S5YB 3QMAA 2DN2A 3W4UA 2NSRA 1Y8KB 2HHDB 4ROLB 1O1MA 4ODCA 1SWMA 2LH1A 3QZXA 2LHBA 2G0VA 2BNLA 5F0BA 1Y5FB 5E29B 1RQAB 5HAVA 3ZJRA 3HRWA 3BA2A 1MTIA 1QSIA 1JF4A 2BKMA 2ZLVB 1MZ0A 1MBOA 4OODA 1HABB 1B0BA 1Y85B 1KD2A 1O1PA 1Y4PB 1XYEA 2M6ZB 1DO1A 1I3EA 4N7NB 1EBTA 3D4XA 1LH2A 3HXNA 5JDOD 1MWDA 3WFWA 4NXCA 4IROB 1N9FA 4NI1B 1O1MB 2QMBA 1WLAA 1HCOA 1A0ZA 1UMOA 3ZJJA 1YIEB 2W72B 3IC0B 1HDBA 5B84A 6HBWA 4HRRA 1KR7A 3WCVB 2RI4A 2GRFA 3LQDA 3UHVA 3LR7A 4UURA 1YDZB 1OJ6A 3LHBA 4M4BA 5EYSA 1MDNA 1NQPA 1J3ZA 5C6EA 1YIHA 1GBUB 3UHIA 1NWNA 3PI9A 3CY5A 1SI4B 1BINA 1J3YB 1XCHA 2GTLC 2DHBB 2HCOA 2MGGA 1LH5A 3LQDB 2RI4B 1MYJA 2EKTA 2G0XA 1BZ0A 4HRTA 2BMMA 1JEBB 102MA 1O1JB 3GKVA 2BWHA 1A0ZB 5JGGA 3UHQA 3QZZA 3UH3A 2HHBA 1BZ6A 1MBIA 4MQGB 3NMLA 110MA 3R5IA 1NPGA 3SDNA 3GOUB 4N7NA 4DC8A 3WI8A 5EUIA 2D60A 1NZ5A 5E6EA 1DLWA 1O1PB 1A3NA 1ABWB 1S5XA 1HABA 1MNOA 5D5RA 1LFLA 1J52A 1C7DA 1THBB 3ZJLA 1A9WE 1H97A 2G10A 3EDBA 2KSCA 1CP0A 1DWTA 4FH7A 1GDJA 1HBSB 3DR9A 2ZLUB 5E83B 1JPBA 2HBDA 3H57A 1ASHA 1BVDA 2QSSB 3K8BA 1DXDA 3OO4B 2GKMA 5JDOF 3UHUA 1Y5KA 3AT6B 3S1IA 2GNVA 2Z6SA 1Y83B 2BW9M 2VEBA 1FAWA 2JHOA 1NEJB 1S0HB 2EF2A 2ZFOA 1YE0A 1ECDA 1FCSA 2ZSPA 3A5AA 1COHA 3UHEA 2GLNA 1CH9A 4C44A 1AZIA 2NRLA 3WCWD 4YU3B 1Y85A 1I3DA 2ZS0B 2ZS1C 2DN1A 3WHMA 1GLIA 1DWSA 4H2LA 1MBNA 1OUUB 1F65A 2MGLA 4XS0B 3ECXA 1O1NB 1JW8A 3A0GA 1HGBB 5IKSA 3S66B 1C7BA 1K0YA 4MPMA 1XZ4B 3OVUC 1YE2A 4NK1A 1N9XA 4F6FA 5F2AA 1BVCA 3G4WA 1YVQB 3TLDA 1DO4A 2B7HA 2LH2A 2D2NB 2D2MB 1UT0A 3QQRA 1OUTB 3ECZA 1KFRA 2QSSA 3GQPB 3CIUA 1OFKA 1BBBA 4BJAA 1C7BB 1K0YB 1GBVA 3S66A 1G0BA 4AVEA 1U7RA 5CHQA 1QXEA 1M9PA 2FAMA 4XS0A 2HBSB 3GLNA 1XXTB 1HGCA 1UIWA 1SDLB 1YHRB 1A3OB 1S5XB 3EU1B 5CNCA 1XZUB 1H1XA 1VXDA 1UVYA 3KUNA 1ECNA 1SHRB 1A01A 5E6EB 3TM3A 2HZ2A 3PELA 2BLHA 2R1HA 4MQGA 3UHCA 3GQGB 4N7PA 2QSPA 3EOKA 1LH3A 5HBIA 1CG8A 1XY0B 1DXTA 1MBDA 3ONZA 2H8FA 2GTLA 3M39A 1XXTA 5ILRA 2ZFOC 2HBFA 1HV4A 3MJUB 4QAUA 3ZJOA 4F6IA 2HBGA 1GCWA 2EB9A 4F4OA 4FC3A 1YDZA 3RGKA 4MQHA 1OR4A 1YOHA 1DXUA 3WCVA 3HF4B 3AQ6A 2W31A 1Y4VA 4MXLA 1DXTB 1MYIA 3PT8B 1UC3A 2QLSA 1JDOA 1YVTB 1GCVA 1BZZA 2AUPA 2ZFOD 3GOUA 4O2GA 2R1HB 1YENB 1FSXB 3UHRA 1BUWB 1KD2B 3WR1B 2V1KA 1MGNA 2Z85A 5JOMA 1Q1FA 1A3OA 3EU1A 1C40A 2QRWA 1HGCB 1NS6B 4YU3A 1QSIB 2AV3A 4N8TA 1GDLA 4U8UB 1Y35A 2G12A 1HHOA 2GRHA 3FH9A 2MGBA 3GYSB 2QLSB 1IT3A 1SDKA 1Y4RB 3BJ2A 5KDQA 4ROLA 3DUTB 3AT5B 1SPGA 1ABSA 4ROMB 2VYWA 3IXFA 3O89A 4F69A 2W72A 1YEOA 2ZLWA 4PQBA 1QI8B 3ZJHA 4AVDA 1SPGB 1MLUA 2E2YA 4IT8A 2OH9A 3FH9B 3PI4A 2MBWA 5HLQA 1MBSA 4U8UC 1BZ1A 3UHSA 1YCBA 1NS9B 1MLGA 1Y0TB 3OO5A 3UGYA 2BK9A 5JDOE 1DWRA 1JL7A 4N7OA 1HBAA 1HBIA 1LFYB 1O1IB 3B75B 3WCVD 2O5MX 2ZWJA 2Z8AA 1O1KA 1F63A 3S65B 1TESA 1YOIA 1NPFA 3IC2A 1JF3A 1GDKA 2D2MC 7HBIA 2WTGA 3AG0A 1M6MA 1UVXA 2AA1A 4L7YA 3R0GA 4X0LB 1SHRA 3UH6A 3PT8A 1FHJA 2ZSXA 3BCQB 1YH9B 1YOGA 4U8UD 1L2KA 2ZLTB 1S69A 4HRTB 3D1AA 2MGAA 3A9MA 3UHZA 1CG5B 3LB2A 1O1OB 1BABA 1X3KA 3UGZA 3PI9B 2MGMA 3WCVC 5SW7B 1A6MA 1MNKA 3OZUA 3PT7A 1RPSB 1AJHA 1J7YA 2MYCA 4NS2A 1MYMA 2C0KA 1DTIA 1CPWA 1QI8A 1V75A 1MLRA 2PGHA 1O1OA 1X9FB 2D5XB 1Y0AB 3VAUA 3IC0A 3ORDA 1Y4QB 1XZ2B 2FRJX 3MOUA 3AT5A 3DUTA 1A6NA 1FHJB 1A6GA 5CN5A 1Y7ZB 4X0LA 1MLSA 3HYUA 1SDKB 3HEOA 1GJNA 1DO3A 5EUIB 3WTGA 2SPNA 2MYDA 2MYAA 1JP9A 1MLNA 5AZQA 3S65A 3PI1A 1IBEB 4B4YA 2R50A 1JY7A 4NK2A 1MOCA 1PBXB 2QFNA 1HRMA 3ODQA 1YG5B 4ILZA 5EOHA 1IT2A 3BJ1B 4HBIA 1LJWA 3G53A 3ARLA 1NAZA 2Z6NB 2MGJA 3HENA 3WFTA 1RQ4A 1YVTA 3A59A 2VLZA 3SDHA 1LFZA 1A00A 1MYGA 3D17A 1F5PA 1QSHA 4O4TA 2ZLWB 1UFJA 4PQCA 1MLLA 1YEOB 3ZJSA 3W4UB 1J40B 2IG3A 1J41B 3OZWA 1MWCA 1V5HA 1YVQA 2FALA 2BLIA 2MGHA 2W6YA 3HHBB 3NL7A 1URYA 3V2ZA 3WFXA 2ZLUA 5E83A 4FWXA 1V4WB 5EE4C 3UHXA 3SZKB 1YHUC 2IN4A 2VLXA 1HDAA 1OR6A 3BJ1A 5KERA 1HGAB 3ZH0A 107MA 3ODQB 1DM1A 1PBXA 2V1GA 1C7DB 1THBA 1IWHA 3ONZB 5KKKA 3WHMB 1JY7B 1C40B 1XY0A 3G52A 1VXAA 2MYEA 5CN7A 3NFEB 1LH6A 1MTJA 1MLKA 1LA6B 1Y0WA 1CP5A 1Y4GB 1YE0B 3WCTA 1DKEA 1MLJA 2V1HA 3GDJB 1FAWB 3HYUB 4G51B 4HSWA 1V9QA 3MKBB 1R1YA 1Y5KB 3AT6A 1YHUD 4H0BA 1K1KA 4KMVA 1Y0AA 1YZIA 5D1VA 1RTEA 3LB3A 2NRMA 2EB8A 1OBMA 1LFVB 2W6VA 3PT7B 1GDIA 1HBHB 1GBVB 1WVPA 1J3ZB 3BOMA 3VREA 5HY8A 3UHGA 1ABYB 4C0NA 1NQPB 4M4BB 1CH4A 5M3SA 1NXFA 3MJUA 1CMYA 1AJ9A 1AJGA 2ZSRA 2FRFA 1HLBA 2MGCA 1DXCA 2R80A 1IRCA 1Y7GB 1LFLB 3BJ3A 1YEVB 1R1YB 1XQ5B 2HHEA 3VRGA 2O5LX 4TWUA 2QMBB 1YE2B 2O5TX 3GDJA 1Y45A 2ZS0D 1UFPA 106MA 1Y8IA 1T1NA 1CH2A 3U3EA 3PI2A 3E55A 1XZ5B 3A0GB 1GZXB 4FWYA 1O1NA 1MODA 3M3AA 3NFEA 3M38A 1A9WA 1CH1A 2VEEA 1GLIB 2HHEB 2ZT3A 5CN6A 1FLPA 3BJ3B 1BZ0B 5CN9A 4M4AA 2D5XA 4ESAA 3G46A 2G14A 4WJGA 3HC9A 1BZ1B 2ZFOB 1JZKA 4NI0B 1YHUB 1M6CA 3QJDB 1J7WB 2W72C 3PIAB 3WCUB 2NSSA 5AZRA 1K1KB 2B7HB 3LB4A 3DHRA 1CIOA 2D5ZA 5JDOC 4ROMA 2ZS1A 3O7NA 2V1IA 3D17B 112MA 1XZ4A 1G09A 3A59B 1YHUA 3AQ9A 1HSYA 1LTWA 1URVA 1Y4GA 1MCYA 3D7OA 1EBCA 1V4UA 5HLUA 4N8TB 2MB5A 5CN8A 1NIHA 1EMYA 1HBBB 3WCTD 3QJCA 4G1BA 2D2ND
chains in the Genus database with same CATH superfamily
2G0RA 2D2MD 1HBAB 5HLXA 1EWAA 1Z8UB 1MLHA 1HGAA 1Y0TA 1MOBA 3M3BA 1R1XB 4MQKB 1RQAA 5AQDA 3A2GA 5EV5A 2VMLA 1S6AA 3UHTA 1Y7CB 1YEUA 1YHEB 1HBRA 2WTHA 1VXHA 2H35A 2UUND 1X9FA 1HACA 3QJEA 1YMCA 1S5YA 1XZVA 4MQHB 2RAOB 5HU6B 3WCWA 1HDSA 1VREA 3FS4A 4FC3B 3G4UA 3AQ8A 1HBGA 5C6EB 1NZ2A 4NI0A 2WCQA 1LFVA 3NMMB 1CH3A 2G11A 4F6DA 1GH0B 1G08A 2XKIA 1MBCA 5CMVA 104MA 2H35B 3G4VA 111MA 3L0FA 1YIEA 2OHBA 2DKCA 1B8DA 5EU2A 4NXAA 3O2CB 1B86B 1CLSB 4B02A 2O5BX 2D60B 1DKEB 4GZGA 3OJ1A 3QM8A 2MGEA 1XZ5A 5CNGA 1LIAB 3DHTA 3PELB 1XYEB 1FN3B 1Y46A 2DN3B 4MQJA 2H8DA 1MKOA 1B8DB 3GK9A 1YEVA 2V1JA 2GDMA 3AQ5A 1ON7A 1O1IA 3B75A 4H07A 4N6SB 1Y8HB 2HBSA 1V4UB 5CNDA 3P5QB 1IOPA 2OH8A 1HDAB 4F6GA 1SI4A 3OGBA 3QM9A 1GVHA 2Z6TA 3MYNA 1CIIA 3G4YA 4F68A 2LH3A 1MYFA 1DUKA 3QJBA 1HV4B 1YGFB 2D2MA 3PMDA 1Y7DB 1RQ3B 2FRKX 3WCUA 2DN2B 2V1EA 2VYYA 1TOXA 4UZVA 3V58A 1J7WA 1LH1A 1Y31A 3QJDA 1QSHB 1LFTA 1NY9A 5CN4A 4MQIA 1CG8B 4KJTA 1HHOB 4O35A 1Y4FA 2G3HA 4ERVA 1LJWB 5AB8A 2GRZA 3ZJPA 1MDTA 4MBNA 6HBIA 1OUUA 1Y09B 1TU9A 4F0TA 3IA3B 1BIJB 3FEWX 3K3UA 1NGKA 4GXEA 1D8UA 1HBBA 1CO9A 1O1LB 3WR1A 1LHSA 1MLOA 5B13G 4F0TB 3HRWB 1FSXA 5ILMA 1NS9A 2VYZA 1COHB 1GZXA 1IRDA 1G0AA 1LHTA 1UVLA 1YCAA 3WTGB 1G0BB 4KN3A 1CBMA 1G09B 2CMMA 3UHYA 2ZSQA 2UUMX 1Y2ZA 1Y31B 2ZSYA 1VXGA 4YJJB 1XZ2A 3GIOA 1RQ3A 1Y8WB 4MQCA 1VXCA 1CMYB 1WMUB 1V75B 3QJBB 2LH7A 2XKGA 2ZS1D 1J7SB 1J7YB 1X9FD 1A0UA 5KDQB 2HBDB 4F6JA 1JL6A 2QU0A 1RQ4B 5SW7A 2ZSZA 4U8UA 1CO8A 2O5OX 2BV8A 1RTXA 5EE4D 3GKTA 1MNHA 2ZT0A 4M4AB 3LB1A 2ZS0C 1DO7A 2ZLTA 1YEQB 3D1KA 1FDHG 2ZT2A 4RMPA 3EDAA 1QPWA 4MAXA 1A4FB 2JL9A 1BIJA 1MKOB 2W6XA 2AA1B 4L7YB 1KTPB 1QXDA 3PI8B 3S1JA 1UVMA 3VRFA 2O5SX 1YENA 1A6KA 1LIAA 1IDRA 2EVPA 1Y4FB 1Y4BA 1CPCA 1VXFA 108MA 5FVBM 1MTKA 2G0SA 1X9FC 1YGDA 1O1KB 4FWZA 3O2CA 2R4ZA 2VHBA 1MNIA 3HEPA 3GKVB 2HBCA 1SDLA 1UVIA 2ZLXA 103MA 3QM6A 4N7OB 1CH7A 3NG6A 2ZSTA 1V4XB 3OO4A 4B3WA 3RJ6A 1NWIA 2LH6A 1F5OA 4MU5A 3BRPA 3NL7B 1YFFA 2X4AA 1CQXA 1BZPA 3ZJNA 1MLFA 1JZLA 1ALLA 1JP8A 2DC3A 3MJPA 4MXKA 4A8KA 2LH5A 1DXVB 1Y8WA 3UHKA 3ED9A 2HBCB 1ECAA 3BCQA 3WCPA 3BJ2B 4PNJA 5CNBA 1LFZB 3EOKB 1U7SA 4DWUA 2NX0A 5EETA 2Z6NA 4O4ZA 1HGBA 3R5IB 1R1XA 1UX9A 3PI8A 1B86A 1F0LA 1Y4PA 3OK5A 1HA7A 1N9IA 1NS6A 1BJEA 3K9ZA 1XZUA 1Y22A 4NZIA 3QJCB 4L1EA 1DUOA 2XYKA 2DN1B 1YEQA 1IWHB 3VHBA 2ZS0A 1LFYA 2ZLVA 1NIHB 2BV8B 3ZJQA 3KUOA 1VXEA 3KMFA 4Q70B 4YU4B 3SZKA 1BZZB 1B33A 3UBCA 2YRSB 3HHBA 2XKHA 1CIKA 3FS4B 2MGDA 3WCWB 1CQ2A 2R4XA 1J7SA 1S56A 1Y8KA 3UI0A 1WMUA 3V58B 1J41A 1WACA 3HF4A 3PIAA 1HDBB 1DXUB 1YGFA 1HBRB 2MHBA 3ZOLA 3RJNB 1VWTB 109MA 4HHBB 2HZ1A 4ESUA 1HCOB 2YSKA 1YFFB 5CNEA 3UH5A 1Y4RA 2GTLD 1MLQA 3HXNB 1HI1A 2AV0A 4MQKA 4OF9A 3ASEA 3H58A 3NG6B 2H8FB 4FH6A 1RVWB 1Y5JB 2AUOA 1N9HA 2HZ3A 1XZ7B 2MGKA 1HA7B 2R4YA 1Y09A 2ZSOA 2QSPB 2ZFBB 1Y01B 2WY4A 3MVCA 3DHTB 3S48C 1Y4BB 2D2NC 1BZRA 2O58X 3IC2B 3UHDA 2V1FA 4TYXA 1T1NB 2QFKA 3MYMA 1A01B 3WCPB 1QPWB 1LFTB 1XQ5A 3ECLA 2OLPA 1JEBA 2D5ZB 1MWBA 2ZT1A 2MGIA 1C7CA 3DHRB 1Y4QA 5CNFA 1Y4VB 1HHTP 4MBAA 4ZIZA 5C6YA 1COLA 1DXVA 1DLYA 2HCOB 1J3YA 2O5QX 3A5BA 4ETVA 3ZJMA 1MYTA 2PEGB 1Y0DB 4ETTA 3NMMA 3WCUD 1RPSA 1G9VA 5HY8B 2FRIX 3VREB 2W6VB 3CIUB 5HU6A 1Y0DA 1YMBA 1S61A 1YMAA 3P5QA 1BABB 4MQCB 4HRRB 1EW6A 2GTLB 3D1AB 2AURA 1KN1B 1C7CB 1YHEA 1YEUB 4WCHD 5B85A 2H8DB 4G51A 2MYBA 3ZHWA 1FN3A 2ZT4A 4DC7A 3GYSA 3TM9A 3WCTB 1VHBA 3D4XB 1Y35B 1O16A 1IRDB 1MBAA 1VXBA 2HHBB 4Z8KA 3V2VA 2ZFBA 1QXDB 3WCUC 2OIFA 3QQQA 1XZ7A 1O1LA 4A8MP 1O1JA 3QM7A 1Y22B 1JP6A 1RVWA 2R80B 1UIWB 101MA 1Y0CA 1SGKA 3ARKA 2V8AB 1MLMA 1RSEA 1BUWA 1J3FA 3UHHA 1G08B 3OO5B 2DXMA 1GH0A 1UX8A 4SDHA 5E29A 5EYJA 2UUNB 1FSLA 4PQ6A 1HJTA 2VJRA 1YIHB 3UHWA 3GQRA 1Y83A 1A0UB 2R4WA 4TMAB 1NZ3A 4MQIB 5ILPA 2RAOA 1OUTA 3MN0A 2VLYA 2W6WA 3UH7A 1XZVB 3QJEB 1J40A 2MHBB 1CBLA 4HSXA 1Y7DA 2D2NA 3WFUA 2EVKA 3MJPB 4O1TA 3E5OA 1Y2ZB 3MKBA 2OHAA 3K8BB 1LFQB 1Y7CA 4DWTA 3GQRB 1GCWB 4F4OB 2SPMA 1VRFA 2YRSA 3OZVA 4TWVA 3AQ7A 4BJUA 5EQMA 4YU4A 105MA 3UHBA 2BLJM 2DXMB 1LA6A 1Y0WB 4ZVAA 4ESAB 2M6ZA 2VJTB 1FDHA 2I88A 2V8AA 1MOHA 3KVSA 1Y0CB 2ZLXB 2GKNA 1ECOA 3KMFC 1ABWA 1NZ4A 3WCWC 1IBEA 1JWNA 2SPOA 4JYQA 4MQJB 1YGDB 1Y46B 2VJTA 3D7OB 5CHRA 2AUQA 1X46A 1V4WA 1GCVB 2SPLA 4A8OA 1NEJA 1S0HA 3E4NA 3VRFB 3ZTAA 1MYZA 1Y7ZA 4F6BA 2VRYA 1A4FA 3VRGB 5MBNA 1YHRA 1LUEA 2ZSSA 2PGHB 2DHBA 1AJ9B 1DTMA 3E5IA 1M9PB 2C7LA 1ABYA 1A00B 1PMBA 2QU0B 4G1VA 1HBSA 1HDSB 3GQPA 1CH5A 2EKUA 2HBEB 3ZJIA 4VHBA 1V4XA 4ZVBA 3ZOMA 1HACB 1YG5A 2HBFB 2VJHA 1Y8HA 1YZIB 1CG5A 6HBWB 3G4QA 2G0ZA 4YJJA 1OFJA 1HLMA 3UHNA 1YH9A 1A3NB 2UULA 3MBAA 2DN3A 4WJG1 4NI1A 5MBAA 4N7PB 3GQGA 4IROA 1G0AB 1MNJA 2GL3A 1Y8IB 1W92A 2MGFA 1Y45B 2GNWA 1CLSA 4H2LB 5JGGB 3G4RA 4A8SA 1V07A 3UBVA 4L2MA 3PI3A 4KMWA 1ITHA 4UIQA 1Y5JA 3D1KB 1Y7GA 1SPEA 3RQRA 4JACA 1LH7A 3ARJA 4XDIA 1JZMA 3LR9A 4ETUA 5KERB 2HBEA 1MYHA 2VM0A 1MOAA 1QXEB 1Y5FA 3CY5B 3A5GA 5ILEA 1GBUA 3BOMB 1BBBB 1HBHA 1G9VB 4ODCB 3WCTC 2ZSNA 3QM5A 1LFQA 2ZS1B 2PEGA 2HHDA 4LPIA 1VWTA 2D6CA 4HHBA 1S5YB 3QMAA 2DN2A 3W4UA 2NSRA 1Y8KB 2HHDB 4H0MB 4ROLB 1O1MA 4ODCA 1SWMA 2LH1A 3QZXA 2LHBA 2G0VA 2BNLA 1XF6C 1Y5FB 5F0BA 5E29B 1RQAB 5HAVA 3ZJRA 3HRWA 3PMCA 3BA2A 1MTIA 1QSIA 1JF4A 2BKMA 2ZLVB 1MZ0A 1ON7B 1MBOA 4OODA 1HABB 4GXEB 1B0BA 1Y85B 1KD2A 1O1PA 1Y4PB 1XYEA 2UULD 2M6ZB 4HH0A 1DO1A 2JLFA 1I3EA 4N7NB 4GY3A 1EBTA 3D4XA 1LH2A 3HXNA 5JDOD 1MWDA 3WFWA 4NXCA 4IROB 1N9FA 4NI1B 1O1MB 2QMBA 1WLAA 1HCOA 1A0ZA 1UMOA 3ZJJA 1YIEB 2W72B 1XG0C 3IC0B 1HDBA 5B84A 6HBWA 4HRRA 1KR7A 3WCVB 2RI4A 2GRFA 3LQDA 3UHVA 3LR7A 2J96A 4UURA 1YDZB 1OJ6A 3LHBA 4M4BA 1MDNA 1NQPA 5EYSA 1J3ZA 5C6EA 1YIHA 1B33B 1GBUB 3UHIA 1NWNA 3PI9A 3CY5A 2UULC 1SI4B 1BINA 4LM6B 1J3YB 1XCHA 2GTLC 2DHBB 2HCOA 2MGGA 1LH5A 3LQDB 2RI4B 1MYJA 2EKTA 2G0XA 1BZ0A 4HRTA 2BMMA 1JEBB 102MA 1O1JB 3GKVA 2BWHA 3VNCA 1A0ZB 4F0UA 5JGGA 3UHQA 3QZZA 3UH3A 2HHBA 4Z8KB 1BZ6A 1MBIA 4MQGB 1CPCB 110MA 3NMLA 3R5IA 1NPGA 3SDNA 3GOUB 4N7NA 4DC8A 1A87A 3WI8A 5EUIA 2D60A 1NZ5A 5E6EA 1DLWA 1O1PB 4F0UB 1A3NA 2UULB 1ABWB 1S5XA 1HABA 1MNOA 5D5RA 1LFLA 1J52A 1C7DA 1THBB 3ZJLA 1A9WE 1H97A 2G10A 2JLGA 3EDBA 2KSCA 1CP0A 1DWTA 4FH7A 1GDJA 1HBSB 2DKDA 3DR9A 2ZLUB 5E83B 1JPBA 2HBDA 3H57A 1ASHA 1BVDA 2QSSB 3K8BA 1DXDA 3OO4B 2GKMA 5FVBA 1RH1A 5JDOF 3UHUA 1Y5KA 3AT6B 3O18A 3S1IA 2GNVA 2Z6SA 1Y83B 2BW9M 2VEBA 1FAWA 2JHOA 1NEJB 1S0HB 3DBJB 2EF2A 2ZFOA 1YE0A 1ECDA 1FCSA 2ZSPA 3A5AA 1COHA 3UHEA 2GLNA 1CH9A 4C44A 4ERTA 1AZIA 2NRLA 3WCWD 4YU3B 1EYXB 1Y85A 1I3DA 2ZS0B 2ZS1C 2DN1A 3WHMA 1GLIA 1DWSA 4H2LA 1MBNA 1OUUB 1F65A 2MGLA 4XS0B 3ECXA 1O1NB 1JW8A 3A0GA 1HGBB 5IKSA 1C7BA 1K0YA 3S66B 4MPMA 1XZ4B 3OVUC 1YE2A 4NK1A 1N9XA 4F6FA 5F2AA 1BVCA 3G4WA 1YVQB 3TLDA 1DO4A 2B7HA 2LH2A 2D2NB 2D2MB 1UT0A 3QQRA 1OUTB 3ECZA 1KFRA 2QSSA 3GQPB 3CIUA 1OFKA 1BBBA 4BJAA 1PHNB 1C7BB 1K0YB 1GBVA 3S66A 2WCRA 1G0BA 4AVEA 1U7RA 5CHQA 4Q70A 1QXEA 1M9PA 2C7LB 2FAMA 4XS0A 2HBSB 3GLNA 1XXTB 1HGCA 4ZIZB 1UIWA 1SDLB 1YHRB 1A3OB 1S5XB 3EU1B 1XZUB 1H1XA 1VXDA 3KUNA 1UVYA 5CNCA 1JBOA 1ECNA 1SHRB 1A01A 5B13A 5E6EB 3GUQA 3TM3A 2HZ2A 3PELA 2BLHA 2R1HA 1UVNA 4MQGA 3UHCA 3GQGB 4N7PA 2QSPA 3EOKA 1LH3A 5HBIA 1CG8A 1XY0B 1DXTA 1MBDA 3ONZA 2H8FA 2GTLA 3L0FB 3M39A 1XXTA 5ILRA 2ZFOC 2HBFA 1HV4A 3MJUB 4QAUA 1F99B 3ZJOA 4F6IA 2HBGA 1GCWA 2EB9A 4F4OA 4FC3A 1F99A 2C7JB 1YDZA 3RGKA 4MQHA 1OR4A 1YOHA 1DXUA 3WCVA 4N6SA 3HF4B 3AQ6A 2W31A 1Y4VA 4MXLA 2C7KA 1DXTB 1MYIA 3PT8B 2DKAA 3MWNA 1UC3A 2QLSA 1JDOA 1YVTB 1GCVA 1BZZA 2AUPA 2ZFOD 3GOUA 4O2GA 2R1HB 1YENB 1FSXB 3UHRA 1BUWB 1KD2B 3WR1B 2V1KA 1MGNA 2Z85A 5JOMA 1Q1FA 1A3OA 3EU1A 1C40A 2QRWA 4XXKA 1HGCB 3KVSB 1NS6B 4YU3A 1QSIB 2AV3A 4N8TA 1GDLA 4U8UB 1Y35A 2G12A 4A8WA 1HHOA 2GRHA 3FH9A 2MGBA 3GYSB 2QLSB 1IT3A 1SDKA 1Y4RB 3BJ2A 5KDQA 4ROLA 3DUTB 3AT5B 1SPGA 1ABSA 4ROMB 4PO5A 2C7KB 2VYWA 3IXFA 3O89A 5AQDM 4F69A 2W72A 1YEOA 2ZLWA 4LMXB 4PQBA 1QI8B 3ZJHA 4AVDA 1SPGB 1MLUA 2E2YA 4IT8A 2OH9A 1I7YA 3FH9B 3PI4A 2MBWA 5HLQA 1MBSA 4U8UC 1BZ1A 4GY3B 3UHSA 1YCBA 1NS9B 1MLGA 1Y0TB 3OO5A 1HI0P 3UGYA 2BK9A 5JDOE 1DWRA 1JL7A 4N7OA 1HBAA 1HBIA 1LFYB 1O1IB 3B75B 3WCVD 2O5MX 2ZWJA 2Z8AA 1DDTA 1O1KA 1F63A 3S65B 1TESA 1YOIA 1NPFA 3IC2A 1JF3A 1GDKA 2D2MC 7HBIA 2WTGA 3V57A 3AG0A 1M6MA 1UVXA 2UUMA 2AA1A 4L7YA 3R0GA 4X0LB 1SHRA 3UH6A 3PT8A 1FHJA 2ZSXA 3BCQB 1YH9B 4RMPB 1YOGA 4U8UD 1L2KA 2ZLTB 1S69A 4HRTB 3D1AA 2MGAA 1HHSA 3A9MA 3UHZA 1CG5B 3LB2A 1O1OB 1BABA 1ALLB 1X3KA 4LMSB 3UGZA 3PI9B 2MGMA 3WCVC 5SW7B 1A6MA 1MNKA 3BRPB 3OZUA 3PT7A 1RPSB 1AJHA 1J7YA 2MYCA 4NS2A 1MYMA 2C0KA 1DTIA 1CPWA 1QI8A 1V75A 1MLRA 2PGHA 1O1OA 1X9FB 2D5XB 1Y0AB 3VAUA 3IC0A 3ORDA 1Y4QB 1XZ2B 2FRJX 3MOUA 3AT5A 3DUTA 1A6NA 1FHJB 1A6GA 5CN5A 1Y7ZB 4X0LA 1MLSA 3HYUA 1SDKB 3HEOA 1GJNA 1DO3A 5EUIB 3WTGA 2SPNA 2MYDA 2MYAA 1JP9A 1MLNA 5AZQA 3S65A 3PI1A 1IBEB 2X49A 4B4YA 2R50A 1JY7A 4NK2A 1MOCA 1PBXB 2QFNA 1EYXA 1HRMA 3ODQA 1YG5B 2VJHB 4ILZA 5EOHA 1IT2A 3BJ1B 4HBIA 1LJWA 3G53A 3ARLA 1NAZA 2Z6NB 2MGJA 3HENA 3WFTA 1RQ4A 1YVTA 3A59A 1I7YB 2VLZA 1LFZA 3SDHA 1A00A 1MYGA 3D17A 1F5PA 3O18B 1QSHA 4O4TA 2ZLWB 1UFJA 4PQCA 1MLLA 1YEOB 3ZJSA 3W4UB 1J40B 2IG3A 1J41B 3OZWA 1MWCA 1V5HA 3LQ9A 1YVQA 2FALA 4PO5B 2BLIA 2MGHA 2W6YA 3HHBB 3NL7A 1URYA 3V2ZA 3WFXA 2ZLUA 5E83A 4FWXA 1V4WB 5EE4C 3UHXA 3SZKB 4A8QA 1YHUC 2IN4A 2VLXA 1HDAA 1OR6A 4AE0A 3BJ1A 5KERA 1HGAB 3ZH0A 107MA 3ODQB 1DM1A 1PBXA 2V1GA 1C7DB 1THBA 1IWHA 3ONZB 5KKKA 3WHMB 1JY7B 1C40B 1XY0A 3G52A 1VXAA 2MYEA 1XDTT 5CN7A 3NFEB 1LH6A 1MTJA 1MLKA 1LA6B 1Y0WA 1CP5A 1Y4GB 1YE0B 3WCTA 1DKEA 1MLJA 2V1HA 3GDJB 1FAWB 1KTPA 3HYUB 4G51B 1JBOB 4H0MA 4HSWA 1V9QA 3MKBB 1R1YA 1Y5KB 3AT6A 1YHUD 4H0BA 1K1KA 4KMVA 1Y0AA 1YZIA 5D1VA 1RTEA 3LB3A 2NRMA 2EB8A 2C7JA 1OBMA 1LFVB 2W6VA 3PT7B 1GDIA 1HBHB 1GBVB 1WVPA 1J3ZB 3BOMA 3VREA 5HY8A 3UHGA 1ABYB 2UUNA 4AE1A 4C0NA 1NQPB 4M4BB 1CH4A 5M3SA 2UULH 1NXFA 3MJUA 1CMYA 1AJ9A 4A8FA 1AJGA 2ZSRA 2FRFA 1HLBA 2MGCA 1DXCA 2R80A 1IRCA 1Y7GB 1LFLB 3BJ3A 1YEVB 1R1YB 4BS9A 1XQ5B 2HHEA 3VRGA 2O5LX 4TWUA 1HI8A 4A8YA 2QMBB 1YE2B 1UVJA 2O5TX 3GDJA 1Y45A 2ZS0D 2VMLB 1UFPA 106MA 1Y8IA 1T1NA 1CH2A 3U3EA 3PI2A 3E55A 1XZ5B 3A0GB 1GZXB 4FWYA 1O1NA 1MODA 3M3AA 3NFEA 3M38A 1A9WA 1CH1A 2VEEA 1GLIB 2HHEB 2ZT3A 4XXIA 5CN6A 1FLPA 3BJ3B 1KN1A 1BZ0B 5CN9A 4M4AA 2D5XA 1QGWC 4ESAA 3G46A 2G14A 4WJGA 3HC9A 1BZ1B 2ZFOB 1JZKA 3DBJA 4NI0B 1YHUB 1PHNA 4HH1A 1M6CA 3QJDB 1J7WB 2W72C 3PIAB 3WCUB 2NSSA 5AZRA 1K1KB 2B7HB 3LB4A 3DHRA 1CIOA 2D5ZA 5JDOC 4ROMA 2ZS1A 3O7NA 2V1IA 3D17B 112MA 1XZ4A 2UUMB 1G09A 3A59B 1YHUA 3AQ9A 2VJRB 3V57B 1HSYA 1LTWA 1URVA 1Y4GA 3NUHB 1MCYA 3D7OA 1EBCA 1V4UA 5HLUA 4N8TB 2MB5A 5CN8A 1NIHA 1UVKA 1EMYA 1HBBB 3WCTD 3QJCA 4L1EB 4G1BA 2D2ND
chains in the Genus database with same CATH topology
2G0RA 2D2MD 1HBAB 5HLXA 1EWAA 1Z8UB 1MLHA 1HGAA 1Y0TA 1MOBA 3M3BA 1R1XB 4MQKB 1RQAA 3A2GA 5EV5A 1S6AA 3UHTA 1Y7CB 1YEUA 1YHEB 1HBRA 2WTHA 1VXHA 2H35A 1X9FA 1HACA 3QJEA 1YMCA 1S5YA 1XZVA 4MQHB 2RAOB 5HU6B 3WCWA 1HDSA 1VREA 3FS4A 4FC3B 3G4UA 3AQ8A 1HBGA 5C6EB 1NZ2A 4NI0A 1LFVA 3NMMB 1CH3A 2G11A 4F6DA 1G08A 2XKIA 1MBCA 5CMVA 104MA 2H35B 3G4VA 111MA 1YIEA 2OHBA 5EU2A 4NXAA 1B86B 1CLSB 2O5BX 2D60B 1DKEB 4GZGA 3OJ1A 3QM8A 2MGEA 1XZ5A 5CNGA 3DHTA 3PELB 1XYEB 1FN3B 1Y46A 2DN3B 4MQJA 2H8DA 1MKOA 3GK9A 1YEVA 2V1JA 2GDMA 3AQ5A 1O1IA 3B75A 4H07A 1Y8HB 2HBSA 1V4UB 5CNDA 3P5QB 1IOPA 2OH8A 1HDAB 4F6GA 1SI4A 3OGBA 3QM9A 1GVHA 2Z6TA 3MYNA 3G4YA 4F68A 2LH3A 1MYFA 1DUKA 3QJBA 1HV4B 1YGFB 2D2MA 1Y7DB 1RQ3B 2FRKX 3WCUA 2DN2B 2V1EA 2VYYA 4UZVA 1J7WA 1LH1A 1Y31A 3QJDA 1QSHB 1LFTA 5CN4A 4MQIA 1CG8B 4KJTA 1HHOB 4O35A 1Y4FA 2G3HA 1LJWB 5AB8A 2GRZA 3ZJPA 4MBNA 6HBIA 1OUUA 1Y09B 1TU9A 3IA3B 1BIJB 3K3UA 1NGKA 1D8UA 1HBBA 1CO9A 1O1LB 3WR1A 1LHSA 1MLOA 3HRWB 1FSXA 5ILMA 1NS9A 2VYZA 1COHB 1GZXA 1IRDA 1G0AA 1LHTA 1YCAA 3WTGB 1G0BB 4KN3A 1CBMA 1G09B 2CMMA 3UHYA 2ZSQA 1Y2ZA 1Y31B 2ZSYA 1VXGA 1XZ2A 1RQ3A 1Y8WB 4MQCA 1VXCA 1CMYB 1WMUB 1V75B 3QJBB 2LH7A 2XKGA 2ZS1D 1J7SB 1J7YB 1X9FD 1A0UA 5KDQB 2HBDB 4F6JA 1JL6A 2QU0A 1RQ4B 5SW7A 2ZSZA 4U8UA 1CO8A 2O5OX 1RTXA 5EE4D 3GKTA 1MNHA 2ZT0A 4M4AB 3LB1A 2ZS0C 1DO7A 2ZLTA 1YEQB 3D1KA 1FDHG 2ZT2A 3EDAA 1QPWA 4MAXA 1A4FB 1BIJA 1MKOB 2W6XA 2AA1B 4L7YB 1QXDA 3PI8B 3S1JA 3VRFA 2O5SX 1YENA 1A6KA 1IDRA 2EVPA 1Y4FB 1Y4BA 1VXFA 108MA 1MTKA 2G0SA 1X9FC 1YGDA 1O1KB 4FWZA 2R4ZA 2VHBA 1MNIA 3HEPA 3GKVB 2HBCA 1SDLA 2ZLXA 103MA 3QM6A 4N7OB 1CH7A 3NG6A 2ZSTA 1V4XB 3OO4A 4B3WA 3RJ6A 1NWIA 2LH6A 1F5OA 4MU5A 3NL7B 1YFFA 1CQXA 1BZPA 3ZJNA 1MLFA 1JZLA 1JP8A 2DC3A 3MJPA 4MXKA 2LH5A 1DXVB 1Y8WA 3UHKA 3ED9A 2HBCB 1ECAA 3BCQA 3WCPA 3BJ2B 4PNJA 5CNBA 1LFZB 3EOKB 1U7SA 4DWUA 2NX0A 5EETA 2Z6NA 4O4ZA 1HGBA 3R5IB 1R1XA 1UX9A 3PI8A 1B86A 1Y4PA 3OK5A 1N9IA 1NS6A 1BJEA 3K9ZA 1XZUA 1Y22A 4NZIA 3QJCB 1DUOA 2XYKA 2DN1B 1YEQA 1IWHB 3VHBA 2ZS0A 1LFYA 2ZLVA 1NIHB 3ZJQA 3KUOA 1VXEA 3KMFA 4YU4B 3SZKA 1BZZB 3UBCA 2YRSB 3HHBA 2XKHA 1CIKA 3FS4B 2MGDA 3WCWB 1CQ2A 2R4XA 1J7SA 1S56A 1Y8KA 3UI0A 1WMUA 1J41A 3HF4A 3PIAA 1HDBB 1DXUB 1YGFA 1HBRB 2MHBA 3ZOLA 3RJNB 1VWTB 109MA 4HHBB 2HZ1A 1HCOB 1YFFB 5CNEA 3UH5A 1Y4RA 2GTLD 1MLQA 3HXNB 2AV0A 4MQKA 4OF9A 3ASEA 3H58A 3NG6B 2H8FB 4FH6A 1RVWB 1Y5JB 2AUOA 1N9HA 2HZ3A 1XZ7B 2MGKA 2R4YA 1Y09A 2ZSOA 2QSPB 2ZFBB 1Y01B 2WY4A 3MVCA 3DHTB 3S48C 1Y4BB 2D2NC 1BZRA 2O58X 3IC2B 3UHDA 2V1FA 4TYXA 1T1NB 2QFKA 3MYMA 1A01B 3WCPB 1QPWB 1LFTB 1XQ5A 3ECLA 2OLPA 1JEBA 2D5ZB 1MWBA 2ZT1A 2MGIA 1C7CA 3DHRB 1Y4QA 5CNFA 1Y4VB 4MBAA 5C6YA 1DXVA 1DLYA 2HCOB 1J3YA 2O5QX 3A5BA 3ZJMA 1MYTA 2PEGB 1Y0DB 3NMMA 3WCUD 1RPSA 1G9VA 5HY8B 2FRIX 3VREB 2W6VB 3CIUB 5HU6A 1Y0DA 1YMBA 1S61A 1YMAA 3P5QA 1BABB 4MQCB 4HRRB 1EW6A 2GTLB 3D1AB 2AURA 1C7CB 1YHEA 1YEUB 4WCHD 5B85A 2H8DB 4G51A 2MYBA 3ZHWA 1FN3A 2ZT4A 4DC7A 3GYSA 3TM9A 3WCTB 1VHBA 3D4XB 1Y35B 1O16A 1IRDB 1MBAA 1VXBA 2HHBB 3V2VA 2ZFBA 1QXDB 3WCUC 2OIFA 3QQQA 1XZ7A 1O1LA 1O1JA 3QM7A 1Y22B 1JP6A 1RVWA 2R80B 1UIWB 101MA 1Y0CA 3ARKA 1MLMA 1RSEA 1BUWA 1J3FA 3UHHA 1G08B 3OO5B 2DXMA 1UX8A 4SDHA 5E29A 5EYJA 1FSLA 4PQ6A 1HJTA 1YIHB 3UHWA 3GQRA 1Y83A 1A0UB 2R4WA 1NZ3A 4MQIB 5ILPA 2RAOA 1OUTA 3MN0A 2VLYA 2W6WA 3UH7A 1XZVB 3QJEB 1J40A 2MHBB 1CBLA 4HSXA 1Y7DA 2D2NA 3WFUA 2EVKA 3MJPB 4O1TA 3E5OA 1Y2ZB 3MKBA 2OHAA 3K8BB 1LFQB 1Y7CA 4DWTA 3GQRB 1GCWB 4F4OB 2SPMA 1VRFA 2YRSA 3OZVA 4TWVA 3AQ7A 5EQMA 4YU4A 105MA 3UHBA 2BLJM 2DXMB 1LA6A 1Y0WB 4ZVAA 4ESAB 2M6ZA 1FDHA 1MOHA 1Y0CB 2ZLXB 2GKNA 1ECOA 3KMFC 1ABWA 1NZ4A 3WCWC 1IBEA 1JWNA 2SPOA 4JYQA 4MQJB 1YGDB 1Y46B 3D7OB 5CHRA 2AUQA 1X46A 1V4WA 1GCVB 2SPLA 1NEJA 1S0HA 3E4NA 3VRFB 1MYZA 1Y7ZA 4F6BA 2VRYA 1A4FA 3VRGB 5MBNA 1YHRA 1LUEA 2ZSSA 2PGHB 2DHBA 1AJ9B 1DTMA 3E5IA 1M9PB 1ABYA 1A00B 1PMBA 2QU0B 4G1VA 1HBSA 1HDSB 3GQPA 1CH5A 2EKUA 2HBEB 3ZJIA 4VHBA 1V4XA 4ZVBA 3ZOMA 1HACB 1YG5A 2HBFB 1Y8HA 1YZIB 1CG5A 6HBWB 3G4QA 2G0ZA 1OFJA 1HLMA 3UHNA 1YH9A 1A3NB 3MBAA 2DN3A 4WJG1 4NI1A 5MBAA 4N7PB 3GQGA 4IROA 1G0AB 1MNJA 2GL3A 1Y8IB 1W92A 2MGFA 1Y45B 2GNWA 1CLSA 4H2LB 5JGGB 3G4RA 1V07A 3UBVA 4L2MA 3PI3A 4KMWA 1ITHA 4UIQA 1Y5JA 3D1KB 1Y7GA 1SPEA 4JACA 1LH7A 3ARJA 4XDIA 1JZMA 3LR9A 5KERB 2HBEA 1MYHA 2VM0A 1MOAA 1QXEB 1Y5FA 3CY5B 3A5GA 5ILEA 1GBUA 3BOMB 1BBBB 1HBHA 1G9VB 4ODCB 3WCTC 2ZSNA 3QM5A 1LFQA 2ZS1B 2PEGA 2HHDA 4LPIA 1VWTA 2D6CA 4HHBA 1S5YB 3QMAA 2DN2A 3W4UA 2NSRA 1Y8KB 2HHDB 4ROLB 1O1MA 4ODCA 1SWMA 2LH1A 3QZXA 2LHBA 2G0VA 2BNLA 5F0BA 1Y5FB 5E29B 1RQAB 5HAVA 3ZJRA 3HRWA 3BA2A 1MTIA 1QSIA 1JF4A 2BKMA 2ZLVB 1MZ0A 1MBOA 4OODA 1HABB 1B0BA 1Y85B 1KD2A 1O1PA 1Y4PB 1XYEA 2M6ZB 1DO1A 1I3EA 4N7NB 1EBTA 3D4XA 1LH2A 3HXNA 5JDOD 1MWDA 3WFWA 4NXCA 4IROB 1N9FA 4NI1B 1O1MB 2QMBA 1WLAA 1HCOA 1A0ZA 1UMOA 3ZJJA 1YIEB 2W72B 3IC0B 1HDBA 5B84A 6HBWA 4HRRA 1KR7A 3WCVB 2RI4A 2GRFA 3LQDA 3UHVA 3LR7A 4UURA 1YDZB 1OJ6A 3LHBA 4M4BA 5EYSA 1MDNA 1NQPA 1J3ZA 5C6EA 1YIHA 1GBUB 3UHIA 1NWNA 3PI9A 3CY5A 1SI4B 1BINA 1J3YB 1XCHA 2GTLC 2DHBB 2HCOA 2MGGA 1LH5A 3LQDB 2RI4B 1MYJA 2EKTA 2G0XA 1BZ0A 4HRTA 2BMMA 1JEBB 102MA 1O1JB 3GKVA 2BWHA 1A0ZB 5JGGA 3UHQA 3QZZA 3UH3A 2HHBA 1BZ6A 1MBIA 4MQGB 3NMLA 110MA 3R5IA 1NPGA 3SDNA 3GOUB 4N7NA 4DC8A 3WI8A 5EUIA 2D60A 1NZ5A 5E6EA 1DLWA 1O1PB 1A3NA 1ABWB 1S5XA 1HABA 1MNOA 5D5RA 1LFLA 1J52A 1C7DA 1THBB 3ZJLA 1A9WE 1H97A 2G10A 3EDBA 2KSCA 1CP0A 1DWTA 4FH7A 1GDJA 1HBSB 3DR9A 2ZLUB 5E83B 1JPBA 2HBDA 3H57A 1ASHA 1BVDA 2QSSB 3K8BA 1DXDA 3OO4B 2GKMA 5JDOF 3UHUA 1Y5KA 3AT6B 3S1IA 2GNVA 2Z6SA 1Y83B 2BW9M 2VEBA 1FAWA 2JHOA 1NEJB 1S0HB 2EF2A 2ZFOA 1YE0A 1ECDA 1FCSA 2ZSPA 3A5AA 1COHA 3UHEA 2GLNA 1CH9A 4C44A 1AZIA 2NRLA 3WCWD 4YU3B 1Y85A 1I3DA 2ZS0B 2ZS1C 2DN1A 3WHMA 1GLIA 1DWSA 4H2LA 1MBNA 1OUUB 1F65A 2MGLA 4XS0B 3ECXA 1O1NB 1JW8A 3A0GA 1HGBB 5IKSA 3S66B 1C7BA 1K0YA 4MPMA 1XZ4B 3OVUC 1YE2A 4NK1A 1N9XA 4F6FA 5F2AA 1BVCA 3G4WA 1YVQB 3TLDA 1DO4A 2B7HA 2LH2A 2D2NB 2D2MB 1UT0A 3QQRA 1OUTB 3ECZA 1KFRA 2QSSA 3GQPB 3CIUA 1OFKA 1BBBA 4BJAA 1C7BB 1K0YB 1GBVA 3S66A 1G0BA 4AVEA 1U7RA 5CHQA 1QXEA 1M9PA 2FAMA 4XS0A 2HBSB 3GLNA 1XXTB 1HGCA 1UIWA 1SDLB 1YHRB 1A3OB 1S5XB 3EU1B 5CNCA 1XZUB 1H1XA 1VXDA 1UVYA 3KUNA 1ECNA 1SHRB 1A01A 5E6EB 3TM3A 2HZ2A 3PELA 2BLHA 2R1HA 4MQGA 3UHCA 3GQGB 4N7PA 2QSPA 3EOKA 1LH3A 5HBIA 1CG8A 1XY0B 1DXTA 1MBDA 3ONZA 2H8FA 2GTLA 3M39A 1XXTA 5ILRA 2ZFOC 2HBFA 1HV4A 3MJUB 4QAUA 3ZJOA 4F6IA 2HBGA 1GCWA 2EB9A 4F4OA 4FC3A 1YDZA 3RGKA 4MQHA 1OR4A 1YOHA 1DXUA 3WCVA 3HF4B 3AQ6A 2W31A 1Y4VA 4MXLA 1DXTB 1MYIA 3PT8B 1UC3A 2QLSA 1JDOA 1YVTB 1GCVA 1BZZA 2AUPA 2ZFOD 3GOUA 4O2GA 2R1HB 1YENB 1FSXB 3UHRA 1BUWB 1KD2B 3WR1B 2V1KA 1MGNA 2Z85A 5JOMA 1Q1FA 1A3OA 3EU1A 1C40A 2QRWA 1HGCB 1NS6B 4YU3A 1QSIB 2AV3A 4N8TA 1GDLA 4U8UB 1Y35A 2G12A 1HHOA 2GRHA 3FH9A 2MGBA 3GYSB 2QLSB 1IT3A 1SDKA 1Y4RB 3BJ2A 5KDQA 4ROLA 3DUTB 3AT5B 1SPGA 1ABSA 4ROMB 2VYWA 3IXFA 3O89A 4F69A 2W72A 1YEOA 2ZLWA 4PQBA 1QI8B 3ZJHA 4AVDA 1SPGB 1MLUA 2E2YA 4IT8A 2OH9A 3FH9B 3PI4A 2MBWA 5HLQA 1MBSA 4U8UC 1BZ1A 3UHSA 1YCBA 1NS9B 1MLGA 1Y0TB 3OO5A 3UGYA 2BK9A 5JDOE 1DWRA 1JL7A 4N7OA 1HBAA 1HBIA 1LFYB 1O1IB 3B75B 3WCVD 2O5MX 2ZWJA 2Z8AA 1O1KA 1F63A 3S65B 1TESA 1YOIA 1NPFA 3IC2A 1JF3A 1GDKA 2D2MC 7HBIA 2WTGA 3AG0A 1M6MA 1UVXA 2AA1A 4L7YA 3R0GA 4X0LB 1SHRA 3UH6A 3PT8A 1FHJA 2ZSXA 3BCQB 1YH9B 1YOGA 4U8UD 1L2KA 2ZLTB 1S69A 4HRTB 3D1AA 2MGAA 3A9MA 3UHZA 1CG5B 3LB2A 1O1OB 1BABA 1X3KA 3UGZA 3PI9B 2MGMA 3WCVC 5SW7B 1A6MA 1MNKA 3OZUA 3PT7A 1RPSB 1AJHA 1J7YA 2MYCA 4NS2A 1MYMA 2C0KA 1DTIA 1CPWA 1QI8A 1V75A 1MLRA 2PGHA 1O1OA 1X9FB 2D5XB 1Y0AB 3VAUA 3IC0A 3ORDA 1Y4QB 1XZ2B 2FRJX 3MOUA 3AT5A 3DUTA 1A6NA 1FHJB 1A6GA 5CN5A 1Y7ZB 4X0LA 1MLSA 3HYUA 1SDKB 3HEOA 1GJNA 1DO3A 5EUIB 3WTGA 2SPNA 2MYDA 2MYAA 1JP9A 1MLNA 5AZQA 3S65A 3PI1A 1IBEB 4B4YA 2R50A 1JY7A 4NK2A 1MOCA 1PBXB 2QFNA 1HRMA 3ODQA 1YG5B 4ILZA 5EOHA 1IT2A 3BJ1B 4HBIA 1LJWA 3G53A 3ARLA 1NAZA 2Z6NB 2MGJA 3HENA 3WFTA 1RQ4A 1YVTA 3A59A 2VLZA 3SDHA 1LFZA 1A00A 1MYGA 3D17A 1F5PA 1QSHA 4O4TA 2ZLWB 1UFJA 4PQCA 1MLLA 1YEOB 3ZJSA 3W4UB 1J40B 2IG3A 1J41B 3OZWA 1MWCA 1V5HA 1YVQA 2FALA 2BLIA 2MGHA 2W6YA 3HHBB 3NL7A 1URYA 3V2ZA 3WFXA 2ZLUA 5E83A 4FWXA 1V4WB 5EE4C 3UHXA 3SZKB 1YHUC 2IN4A 2VLXA 1HDAA 1OR6A 3BJ1A 5KERA 1HGAB 3ZH0A 107MA 3ODQB 1DM1A 1PBXA 2V1GA 1C7DB 1THBA 1IWHA 3ONZB 5KKKA 3WHMB 1JY7B 1C40B 1XY0A 3G52A 1VXAA 2MYEA 5CN7A 3NFEB 1LH6A 1MTJA 1MLKA 1LA6B 1Y0WA 1CP5A 1Y4GB 1YE0B 3WCTA 1DKEA 1MLJA 2V1HA 3GDJB 1FAWB 3HYUB 4G51B 4HSWA 1V9QA 3MKBB 1R1YA 1Y5KB 3AT6A 1YHUD 4H0BA 1K1KA 4KMVA 1Y0AA 1YZIA 5D1VA 1RTEA 3LB3A 2NRMA 2EB8A 1OBMA 1LFVB 2W6VA 3PT7B 1GDIA 1HBHB 1GBVB 1WVPA 1J3ZB 3BOMA 3VREA 5HY8A 3UHGA 1ABYB 4C0NA 1NQPB 4M4BB 1CH4A 5M3SA 1NXFA 3MJUA 1CMYA 1AJ9A 1AJGA 2ZSRA 2FRFA 1HLBA 2MGCA 1DXCA 2R80A 1IRCA 1Y7GB 1LFLB 3BJ3A 1YEVB 1R1YB 1XQ5B 2HHEA 3VRGA 2O5LX 4TWUA 2QMBB 1YE2B 2O5TX 3GDJA 1Y45A 2ZS0D 1UFPA 106MA 1Y8IA 1T1NA 1CH2A 3U3EA 3PI2A 3E55A 1XZ5B 3A0GB 1GZXB 4FWYA 1O1NA 1MODA 3M3AA 3NFEA 3M38A 1A9WA 1CH1A 2VEEA 1GLIB 2HHEB 2ZT3A 5CN6A 1FLPA 3BJ3B 1BZ0B 5CN9A 4M4AA 2D5XA 4ESAA 3G46A 2G14A 4WJGA 3HC9A 1BZ1B 2ZFOB 1JZKA 4NI0B 1YHUB 1M6CA 3QJDB 1J7WB 2W72C 3PIAB 3WCUB 2NSSA 5AZRA 1K1KB 2B7HB 3LB4A 3DHRA 1CIOA 2D5ZA 5JDOC 4ROMA 2ZS1A 3O7NA 2V1IA 3D17B 112MA 1XZ4A 1G09A 3A59B 1YHUA 3AQ9A 1HSYA 1LTWA 1URVA 1Y4GA 1MCYA 3D7OA 1EBCA 1V4UA 5HLUA 4N8TB 2MB5A 5CN8A 1NIHA 1EMYA 1HBBB 3WCTD 3QJCA 4G1BA 2D2ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0R A;  2D2M D;  1HBA B;  5HLX A;  1EWA A;  1Z8U B;  1MLH A;  1HGA A;  1Y0T A;  1MOB A;  3M3B A;  1R1X B;  4MQK B;  1RQA A;  3A2G A;  5EV5 A;  1S6A A;  3UHT A;  1Y7C B;  1YEU A;  1YHE B;  1HBR A;  2WTH A;  1VXH A;  2H35 A;  1X9F A;  1HAC A;  3QJE A;  1YMC A;  1S5Y A;  1XZV A;  4MQH B;  2RAO B;  5HU6 B;  3WCW A;  1HDS A;  1VRE A;  3FS4 A;  4FC3 B;  3G4U A;  3AQ8 A;  1HBG A;  5C6E B;  1NZ2 A;  4NI0 A;  1LFV A;  3NMM B;  1CH3 A;  2G11 A;  4F6D A;  1G08 A;  2XKI A;  1MBC A;  5CMV A;  104M A;  2H35 B;  3G4V A;  111M A;  1YIE A;  2OHB A;  5EU2 A;  4NXA A;  1B86 B;  1CLS B;  2O5B X;  2D60 B;  1DKE B;  4GZG A;  3OJ1 A;  3QM8 A;  2MGE A;  1XZ5 A;  5CNG A;  3DHT A;  3PEL B;  1XYE B;  1FN3 B;  1Y46 A;  2DN3 B;  4MQJ A;  2H8D A;  1MKO A;  3GK9 A;  1YEV A;  2V1J A;  2GDM A;  3AQ5 A;  1O1I A;  3B75 A;  4H07 A;  1Y8H B;  2HBS A;  1V4U B;  5CND A;  3P5Q B;  1IOP A;  2OH8 A;  1HDA B;  4F6G A;  1SI4 A;  3OGB A;  3QM9 A;  1GVH A;  2Z6T A;  3MYN A;  3G4Y A;  4F68 A;  2LH3 A;  1MYF A;  1DUK A;  3QJB A;  1HV4 B;  1YGF B;  2D2M A;  1Y7D B;  1RQ3 B;  2FRK X;  3WCU A;  2DN2 B;  2V1E A;  2VYY A;  4UZV A;  1J7W A;  1LH1 A;  1Y31 A;  3QJD A;  1QSH B;  1LFT A;  5CN4 A;  4MQI A;  1CG8 B;  4KJT A;  1HHO B;  4O35 A;  1Y4F A;  2G3H A;  1LJW B;  5AB8 A;  2GRZ A;  3ZJP A;  4MBN A;  6HBI A;  1OUU A;  1Y09 B;  1TU9 A;  3IA3 B;  1BIJ B;  3K3U A;  1NGK A;  1D8U A;  1HBB A;  1CO9 A;  1O1L B;  3WR1 A;  1LHS A;  1MLO A;  3HRW B;  1FSX A;  5ILM A;  1NS9 A;  2VYZ A;  1COH B;  1GZX A;  1IRD A;  1G0A A;  1LHT A;  1YCA A;  3WTG B;  1G0B B;  4KN3 A;  1CBM A;  1G09 B;  2CMM A;  3UHY A;  2ZSQ A;  1Y2Z A;  1Y31 B;  2ZSY A;  1VXG A;  1XZ2 A;  1RQ3 A;  1Y8W B;  4MQC A;  1VXC A;  1CMY B;  1WMU B;  1V75 B;  3QJB B;  2LH7 A;  2XKG A;  2ZS1 D;  1J7S B;  1J7Y B;  1X9F D;  1A0U A;  5KDQ B;  2HBD B;  4F6J A;  1JL6 A;  2QU0 A;  1RQ4 B;  5SW7 A;  2ZSZ A;  4U8U A;  1CO8 A;  2O5O X;  1RTX A;  5EE4 D;  3GKT A;  1MNH A;  2ZT0 A;  4M4A B;  3LB1 A;  2ZS0 C;  1DO7 A;  2ZLT A;  1YEQ B;  3D1K A;  1FDH G;  2ZT2 A;  3EDA A;  1QPW A;  4MAX A;  1A4F B;  1BIJ A;  1MKO B;  2W6X A;  2AA1 B;  4L7Y B;  1QXD A;  3PI8 B;  3S1J A;  3VRF A;  2O5S X;  1YEN A;  1A6K A;  1IDR A;  2EVP A;  1Y4F B;  1Y4B A;  1VXF A;  108M A;  1MTK A;  2G0S A;  1X9F C;  1YGD A;  1O1K B;  4FWZ A;  2R4Z A;  2VHB A;  1MNI A;  3HEP A;  3GKV B;  2HBC A;  1SDL A;  2ZLX A;  103M A;  3QM6 A;  4N7O B;  1CH7 A;  3NG6 A;  2ZST A;  1V4X B;  3OO4 A;  4B3W A;  3RJ6 A;  1NWI A;  2LH6 A;  1F5O A;  4MU5 A;  3NL7 B;  1YFF A;  1CQX A;  1BZP A;  3ZJN A;  1MLF A;  1JZL A;  1JP8 A;  2DC3 A;  3MJP A;  4MXK A;  2LH5 A;  1DXV B;  1Y8W A;  3UHK A;  3ED9 A;  2HBC B;  1ECA A;  3BCQ A;  3WCP A;  3BJ2 B;  4PNJ A;  5CNB A;  1LFZ B;  3EOK B;  1U7S A;  4DWU A;  2NX0 A;  5EET A;  2Z6N A;  4O4Z A;  1HGB A;  3R5I B;  1R1X A;  1UX9 A;  3PI8 A;  1B86 A;  1Y4P A;  3OK5 A;  1N9I A;  1NS6 A;  1BJE A;  3K9Z A;  1XZU A;  1Y22 A;  4NZI A;  3QJC B;  1DUO A;  2XYK A;  2DN1 B;  1YEQ A;  1IWH B;  3VHB A;  2ZS0 A;  1LFY A;  2ZLV A;  1NIH B;  3ZJQ A;  3KUO A;  1VXE A;  3KMF A;  4YU4 B;  3SZK A;  1BZZ B;  3UBC A;  2YRS B;  3HHB A;  2XKH A;  1CIK A;  3FS4 B;  2MGD A;  3WCW B;  1CQ2 A;  2R4X A;  1J7S A;  1S56 A;  1Y8K A;  3UI0 A;  1WMU A;  1J41 A;  3HF4 A;  3PIA A;  1HDB B;  1DXU B;  1YGF A;  1HBR B;  2MHB A;  3ZOL A;  3RJN B;  1VWT B;  109M A;  4HHB B;  2HZ1 A;  1HCO B;  1YFF B;  5CNE A;  3UH5 A;  1Y4R A;  2GTL D;  1MLQ A;  3HXN B;  2AV0 A;  4MQK A;  4OF9 A;  3ASE A;  3H58 A;  3NG6 B;  2H8F B;  4FH6 A;  1RVW B;  1Y5J B;  2AUO A;  1N9H A;  2HZ3 A;  1XZ7 B;  2MGK A;  2R4Y A;  1Y09 A;  2ZSO A;  2QSP B;  2ZFB B;  1Y01 B;  2WY4 A;  3MVC A;  3DHT B;  3S48 C;  1Y4B B;  2D2N C;  1BZR A;  2O58 X;  3IC2 B;  3UHD A;  2V1F A;  4TYX A;  1T1N B;  2QFK A;  3MYM A;  1A01 B;  3WCP B;  1QPW B;  1LFT B;  1XQ5 A;  3ECL A;  2OLP A;  1JEB A;  2D5Z B;  1MWB A;  2ZT1 A;  2MGI A;  1C7C A;  3DHR B;  1Y4Q A;  5CNF A;  1Y4V B;  4MBA A;  5C6Y A;  1DXV A;  1DLY A;  2HCO B;  1J3Y A;  2O5Q X;  3A5B A;  3ZJM A;  1MYT A;  2PEG B;  1Y0D B;  3NMM A;  3WCU D;  1RPS A;  1G9V A;  5HY8 B;  2FRI X;  3VRE B;  2W6V B;  3CIU B;  5HU6 A;  1Y0D A;  1YMB A;  1S61 A;  1YMA A;  3P5Q A;  1BAB B;  4MQC B;  4HRR B;  1EW6 A;  2GTL B;  3D1A B;  2AUR A;  1C7C B;  1YHE A;  1YEU B;  4WCH D;  5B85 A;  2H8D B;  4G51 A;  2MYB A;  3ZHW A;  1FN3 A;  2ZT4 A;  4DC7 A;  3GYS A;  3TM9 A;  3WCT B;  1VHB A;  3D4X B;  1Y35 B;  1O16 A;  1IRD B;  1MBA A;  1VXB A;  2HHB B;  3V2V A;  2ZFB A;  1QXD B;  3WCU C;  2OIF A;  3QQQ A;  1XZ7 A;  1O1L A;  1O1J A;  3QM7 A;  1Y22 B;  1JP6 A;  1RVW A;  2R80 B;  1UIW B;  101M A;  1Y0C A;  3ARK A;  1MLM A;  1RSE A;  1BUW A;  1J3F A;  3UHH A;  1G08 B;  3OO5 B;  2DXM A;  1UX8 A;  4SDH A;  5E29 A;  5EYJ A;  1FSL A;  4PQ6 A;  1HJT A;  1YIH B;  3UHW A;  3GQR A;  1Y83 A;  1A0U B;  2R4W A;  1NZ3 A;  4MQI B;  5ILP A;  2RAO A;  1OUT A;  3MN0 A;  2VLY A;  2W6W A;  3UH7 A;  1XZV B;  3QJE B;  1J40 A;  2MHB B;  1CBL A;  4HSX A;  1Y7D A;  2D2N A;  3WFU A;  2EVK A;  3MJP B;  4O1T A;  3E5O A;  1Y2Z B;  3MKB A;  2OHA A;  3K8B B;  1LFQ B;  1Y7C A;  4DWT A;  3GQR B;  1GCW B;  4F4O B;  2SPM A;  1VRF A;  2YRS A;  3OZV A;  4TWV A;  3AQ7 A;  5EQM A;  4YU4 A;  105M A;  3UHB A;  2BLJ M;  2DXM B;  1LA6 A;  1Y0W B;  4ZVA A;  4ESA B;  2M6Z A;  1FDH A;  1MOH A;  1Y0C B;  2ZLX B;  2GKN A;  1ECO A;  3KMF C;  1ABW A;  1NZ4 A;  3WCW C;  1IBE A;  1JWN A;  2SPO A;  4JYQ A;  4MQJ B;  1YGD B;  1Y46 B;  3D7O B;  5CHR A;  2AUQ A;  1X46 A;  1V4W A;  1GCV B;  2SPL A;  1NEJ A;  1S0H A;  3E4N A;  3VRF B;  1MYZ A;  1Y7Z A;  4F6B A;  2VRY A;  1A4F A;  3VRG B;  5MBN A;  1YHR A;  1LUE A;  2ZSS A;  2PGH B;  2DHB A;  1AJ9 B;  1DTM A;  3E5I A;  1M9P B;  1ABY A;  1A00 B;  1PMB A;  2QU0 B;  4G1V A;  1HBS A;  1HDS B;  3GQP A;  1CH5 A;  2EKU A;  2HBE B;  3ZJI A;  4VHB A;  1V4X A;  4ZVB A;  3ZOM A;  1HAC B;  1YG5 A;  2HBF B;  1Y8H A;  1YZI B;  1CG5 A;  6HBW B;  3G4Q A;  2G0Z A;  1OFJ A;  1HLM A;  3UHN A;  1YH9 A;  1A3N B;  3MBA A;  2DN3 A;  4WJG 1;  4NI1 A;  5MBA A;  4N7P B;  3GQG A;  4IRO A;  1G0A B;  1MNJ A;  2GL3 A;  1Y8I B;  1W92 A;  2MGF A;  1Y45 B;  2GNW A;  1CLS A;  4H2L B;  5JGG B;  3G4R A;  1V07 A;  3UBV A;  4L2M A;  3PI3 A;  4KMW A;  1ITH A;  4UIQ A;  1Y5J A;  3D1K B;  1Y7G A;  1SPE A;  4JAC A;  1LH7 A;  3ARJ A;  4XDI A;  1JZM A;  3LR9 A;  5KER B;  2HBE A;  1MYH A;  2VM0 A;  1MOA A;  1QXE B;  1Y5F A;  3CY5 B;  3A5G A;  5ILE A;  1GBU A;  3BOM B;  1BBB B;  1HBH A;  1G9V B;  4ODC B;  3WCT C;  2ZSN A;  3QM5 A;  1LFQ A;  2ZS1 B;  2PEG A;  2HHD A;  4LPI A;  1VWT A;  2D6C A;  4HHB A;  1S5Y B;  3QMA A;  2DN2 A;  3W4U A;  2NSR A;  1Y8K B;  2HHD B;  4ROL B;  1O1M A;  4ODC A;  1SWM A;  2LH1 A;  3QZX A;  2LHB A;  2G0V A;  2BNL A;  5F0B A;  1Y5F B;  5E29 B;  1RQA B;  5HAV A;  3ZJR A;  3HRW A;  3BA2 A;  1MTI A;  1QSI A;  1JF4 A;  2BKM A;  2ZLV B;  1MZ0 A;  1MBO A;  4OOD A;  1HAB B;  1B0B A;  1Y85 B;  1KD2 A;  1O1P A;  1Y4P B;  1XYE A;  2M6Z B;  1DO1 A;  1I3E A;  4N7N B;  1EBT A;  3D4X A;  1LH2 A;  3HXN A;  5JDO D;  1MWD A;  3WFW A;  4NXC A;  4IRO B;  1N9F A;  4NI1 B;  1O1M B;  2QMB A;  1WLA A;  1HCO A;  1A0Z A;  1UMO A;  3ZJJ A;  1YIE B;  2W72 B;  3IC0 B;  1HDB A;  5B84 A;  6HBW A;  4HRR A;  1KR7 A;  3WCV B;  2RI4 A;  2GRF A;  3LQD A;  3UHV A;  3LR7 A;  4UUR A;  1YDZ B;  1OJ6 A;  3LHB A;  4M4B A;  5EYS A;  1MDN A;  1NQP A;  1J3Z A;  5C6E A;  1YIH A;  1GBU B;  3UHI A;  1NWN A;  3PI9 A;  3CY5 A;  1SI4 B;  1BIN A;  1J3Y B;  1XCH A;  2GTL C;  2DHB B;  2HCO A;  2MGG A;  1LH5 A;  3LQD B;  2RI4 B;  1MYJ A;  2EKT A;  2G0X A;  1BZ0 A;  4HRT A;  2BMM A;  1JEB B;  102M A;  1O1J B;  3GKV A;  2BWH A;  1A0Z B;  5JGG A;  3UHQ A;  3QZZ A;  3UH3 A;  2HHB A;  1BZ6 A;  1MBI A;  4MQG B;  3NML A;  110M A;  3R5I A;  1NPG A;  3SDN A;  3GOU B;  4N7N A;  4DC8 A;  3WI8 A;  5EUI A;  2D60 A;  1NZ5 A;  5E6E A;  1DLW A;  1O1P B;  1A3N A;  1ABW B;  1S5X A;  1HAB A;  1MNO A;  5D5R A;  1LFL A;  1J52 A;  1C7D A;  1THB B;  3ZJL A;  1A9W E;  1H97 A;  2G10 A;  3EDB A;  2KSC A;  1CP0 A;  1DWT A;  4FH7 A;  1GDJ A;  1HBS B;  3DR9 A;  2ZLU B;  5E83 B;  1JPB A;  2HBD A;  3H57 A;  1ASH A;  1BVD A;  2QSS B;  3K8B A;  1DXD A;  3OO4 B;  2GKM A;  5JDO F;  3UHU A;  1Y5K A;  3AT6 B;  3S1I A;  2GNV A;  2Z6S A;  1Y83 B;  2BW9 M;  2VEB A;  1FAW A;  2JHO A;  1NEJ B;  1S0H B;  2EF2 A;  2ZFO A;  1YE0 A;  1ECD A;  1FCS A;  2ZSP A;  3A5A A;  1COH A;  3UHE A;  2GLN A;  1CH9 A;  4C44 A;  1AZI A;  2NRL A;  3WCW D;  4YU3 B;  1Y85 A;  1I3D A;  2ZS0 B;  2ZS1 C;  2DN1 A;  3WHM A;  1GLI A;  1DWS A;  4H2L A;  1MBN A;  1OUU B;  1F65 A;  2MGL A;  4XS0 B;  3ECX A;  1O1N B;  1JW8 A;  3A0G A;  1HGB B;  5IKS A;  3S66 B;  1C7B A;  1K0Y A;  4MPM A;  1XZ4 B;  3OVU C;  1YE2 A;  4NK1 A;  1N9X A;  4F6F A;  5F2A A;  1BVC A;  3G4W A;  1YVQ B;  3TLD A;  1DO4 A;  2B7H A;  2LH2 A;  2D2N B;  2D2M B;  1UT0 A;  3QQR A;  1OUT B;  3ECZ A;  1KFR A;  2QSS A;  3GQP B;  3CIU A;  1OFK A;  1BBB A;  4BJA A;  1C7B B;  1K0Y B;  1GBV A;  3S66 A;  1G0B A;  4AVE A;  1U7R A;  5CHQ A;  1QXE A;  1M9P A;  2FAM A;  4XS0 A;  2HBS B;  3GLN A;  1XXT B;  1HGC A;  1UIW A;  1SDL B;  1YHR B;  1A3O B;  1S5X B;  3EU1 B;  5CNC A;  1XZU B;  1H1X A;  1VXD A;  1UVY A;  3KUN A;  1ECN A;  1SHR B;  1A01 A;  5E6E B;  3TM3 A;  2HZ2 A;  3PEL A;  2BLH A;  2R1H A;  4MQG A;  3UHC A;  3GQG B;  4N7P A;  2QSP A;  3EOK A;  1LH3 A;  5HBI A;  1CG8 A;  1XY0 B;  1DXT A;  1MBD A;  3ONZ A;  2H8F A;  2GTL A;  3M39 A;  1XXT A;  5ILR A;  2ZFO C;  2HBF A;  1HV4 A;  3MJU B;  4QAU A;  3ZJO A;  4F6I A;  2HBG A;  1GCW A;  2EB9 A;  4F4O A;  4FC3 A;  1YDZ A;  3RGK A;  4MQH A;  1OR4 A;  1YOH A;  1DXU A;  3WCV A;  3HF4 B;  3AQ6 A;  2W31 A;  1Y4V A;  4MXL A;  1DXT B;  1MYI A;  3PT8 B;  1UC3 A;  2QLS A;  1JDO A;  1YVT B;  1GCV A;  1BZZ A;  2AUP A;  2ZFO D;  3GOU A;  4O2G A;  2R1H B;  1YEN B;  1FSX B;  3UHR A;  1BUW B;  1KD2 B;  3WR1 B;  2V1K A;  1MGN A;  2Z85 A;  5JOM A;  1Q1F A;  1A3O A;  3EU1 A;  1C40 A;  2QRW A;  1HGC B;  1NS6 B;  4YU3 A;  1QSI B;  2AV3 A;  4N8T A;  1GDL A;  4U8U B;  1Y35 A;  2G12 A;  1HHO A;  2GRH A;  3FH9 A;  2MGB A;  3GYS B;  2QLS B;  1IT3 A;  1SDK A;  1Y4R B;  3BJ2 A;  5KDQ A;  4ROL A;  3DUT B;  3AT5 B;  1SPG A;  1ABS A;  4ROM B;  2VYW A;  3IXF A;  3O89 A;  4F69 A;  2W72 A;  1YEO A;  2ZLW A;  4PQB A;  1QI8 B;  3ZJH A;  4AVD A;  1SPG B;  1MLU A;  2E2Y A;  4IT8 A;  2OH9 A;  3FH9 B;  3PI4 A;  2MBW A;  5HLQ A;  1MBS A;  4U8U C;  1BZ1 A;  3UHS A;  1YCB A;  1NS9 B;  1MLG A;  1Y0T B;  3OO5 A;  3UGY A;  2BK9 A;  5JDO E;  1DWR A;  1JL7 A;  4N7O A;  1HBA A;  1HBI A;  1LFY B;  1O1I B;  3B75 B;  3WCV D;  2O5M X;  2ZWJ A;  2Z8A A;  1O1K A;  1F63 A;  3S65 B;  1TES A;  1YOI A;  1NPF A;  3IC2 A;  1JF3 A;  1GDK A;  2D2M C;  7HBI A;  2WTG A;  3AG0 A;  1M6M A;  1UVX A;  2AA1 A;  4L7Y A;  3R0G A;  4X0L B;  1SHR A;  3UH6 A;  3PT8 A;  1FHJ A;  2ZSX A;  3BCQ B;  1YH9 B;  1YOG A;  4U8U D;  1L2K A;  2ZLT B;  1S69 A;  4HRT B;  3D1A A;  2MGA A;  3A9M A;  3UHZ A;  1CG5 B;  3LB2 A;  1O1O B;  1BAB A;  1X3K A;  3UGZ A;  3PI9 B;  2MGM A;  3WCV C;  5SW7 B;  1A6M A;  1MNK A;  3OZU A;  3PT7 A;  1RPS B;  1AJH A;  1J7Y A;  2MYC A;  4NS2 A;  1MYM A;  2C0K A;  1DTI A;  1CPW A;  1QI8 A;  1V75 A;  1MLR A;  2PGH A;  1O1O A;  1X9F B;  2D5X B;  1Y0A B;  3VAU A;  3IC0 A;  3ORD A;  1Y4Q B;  1XZ2 B;  2FRJ X;  3MOU A;  3AT5 A;  3DUT A;  1A6N A;  1FHJ B;  1A6G A;  5CN5 A;  1Y7Z B;  4X0L A;  1MLS A;  3HYU A;  1SDK B;  3HEO A;  1GJN A;  1DO3 A;  5EUI B;  3WTG A;  2SPN A;  2MYD A;  2MYA A;  1JP9 A;  1MLN A;  5AZQ A;  3S65 A;  3PI1 A;  1IBE B;  4B4Y A;  2R50 A;  1JY7 A;  4NK2 A;  1MOC A;  1PBX B;  2QFN A;  1HRM A;  3ODQ A;  1YG5 B;  4ILZ A;  5EOH A;  1IT2 A;  3BJ1 B;  4HBI A;  1LJW A;  3G53 A;  3ARL A;  1NAZ A;  2Z6N B;  2MGJ A;  3HEN A;  3WFT A;  1RQ4 A;  1YVT A;  3A59 A;  2VLZ A;  3SDH A;  1LFZ A;  1A00 A;  1MYG A;  3D17 A;  1F5P A;  1QSH A;  4O4T A;  2ZLW B;  1UFJ A;  4PQC A;  1MLL A;  1YEO B;  3ZJS A;  3W4U B;  1J40 B;  2IG3 A;  1J41 B;  3OZW A;  1MWC A;  1V5H A;  1YVQ A;  2FAL A;  2BLI A;  2MGH A;  2W6Y A;  3HHB B;  3NL7 A;  1URY A;  3V2Z A;  3WFX A;  2ZLU A;  5E83 A;  4FWX A;  1V4W B;  5EE4 C;  3UHX A;  3SZK B;  1YHU C;  2IN4 A;  2VLX A;  1HDA A;  1OR6 A;  3BJ1 A;  5KER A;  1HGA B;  3ZH0 A;  107M A;  3ODQ B;  1DM1 A;  1PBX A;  2V1G A;  1C7D B;  1THB A;  1IWH A;  3ONZ B;  5KKK A;  3WHM B;  1JY7 B;  1C40 B;  1XY0 A;  3G52 A;  1VXA A;  2MYE A;  5CN7 A;  3NFE B;  1LH6 A;  1MTJ A;  1MLK A;  1LA6 B;  1Y0W A;  1CP5 A;  1Y4G B;  1YE0 B;  3WCT A;  1DKE A;  1MLJ A;  2V1H A;  3GDJ B;  1FAW B;  3HYU B;  4G51 B;  4HSW A;  1V9Q A;  3MKB B;  1R1Y A;  1Y5K B;  3AT6 A;  1YHU D;  4H0B A;  1K1K A;  4KMV A;  1Y0A A;  1YZI A;  5D1V A;  1RTE A;  3LB3 A;  2NRM A;  2EB8 A;  1OBM A;  1LFV B;  2W6V A;  3PT7 B;  1GDI A;  1HBH B;  1GBV B;  1WVP A;  1J3Z B;  3BOM A;  3VRE A;  5HY8 A;  3UHG A;  1ABY B;  4C0N A;  1NQP B;  4M4B B;  1CH4 A;  5M3S A;  1NXF A;  3MJU A;  1CMY A;  1AJ9 A;  1AJG A;  2ZSR A;  2FRF A;  1HLB A;  2MGC A;  1DXC A;  2R80 A;  1IRC A;  1Y7G B;  1LFL B;  3BJ3 A;  1YEV B;  1R1Y B;  1XQ5 B;  2HHE A;  3VRG A;  2O5L X;  4TWU A;  2QMB B;  1YE2 B;  2O5T X;  3GDJ A;  1Y45 A;  2ZS0 D;  1UFP A;  106M A;  1Y8I A;  1T1N A;  1CH2 A;  3U3E A;  3PI2 A;  3E55 A;  1XZ5 B;  3A0G B;  1GZX B;  4FWY A;  1O1N A;  1MOD A;  3M3A A;  3NFE A;  3M38 A;  1A9W A;  1CH1 A;  2VEE A;  1GLI B;  2HHE B;  2ZT3 A;  5CN6 A;  1FLP A;  3BJ3 B;  1BZ0 B;  5CN9 A;  4M4A A;  2D5X A;  4ESA A;  3G46 A;  2G14 A;  4WJG A;  3HC9 A;  1BZ1 B;  2ZFO B;  1JZK A;  4NI0 B;  1YHU B;  1M6C A;  3QJD B;  1J7W B;  2W72 C;  3PIA B;  3WCU B;  2NSS A;  5AZR A;  1K1K B;  2B7H B;  3LB4 A;  3DHR A;  1CIO A;  2D5Z A;  5JDO C;  4ROM A;  2ZS1 A;  3O7N A;  2V1I A;  3D17 B;  112M A;  1XZ4 A;  1G09 A;  3A59 B;  1YHU A;  3AQ9 A;  1HSY A;  1LTW A;  1URV A;  1Y4G A;  1MCY A;  3D7O A;  1EBC A;  1V4U A;  5HLU A;  4N8T B;  2MB5 A;  5CN8 A;  1NIH A;  1EMY A;  1HBB B;  3WCT D;  3QJC A;  4G1B A;  2D2N D; 
#chains in the Genus database with same CATH topology
 2G0R A;  2D2M D;  1HBA B;  5HLX A;  1EWA A;  1Z8U B;  1MLH A;  1HGA A;  1Y0T A;  1MOB A;  3M3B A;  1R1X B;  4MQK B;  1RQA A;  5AQD A;  3A2G A;  5EV5 A;  2VML A;  1S6A A;  3UHT A;  1Y7C B;  1YEU A;  1YHE B;  1HBR A;  2WTH A;  1VXH A;  2H35 A;  2UUN D;  1X9F A;  1HAC A;  3QJE A;  1YMC A;  1S5Y A;  1XZV A;  4MQH B;  2RAO B;  5HU6 B;  3WCW A;  1HDS A;  1VRE A;  3FS4 A;  4FC3 B;  3G4U A;  3AQ8 A;  1HBG A;  5C6E B;  1NZ2 A;  4NI0 A;  2WCQ A;  1LFV A;  3NMM B;  1CH3 A;  2G11 A;  4F6D A;  1GH0 B;  1G08 A;  2XKI A;  1MBC A;  5CMV A;  104M A;  2H35 B;  3G4V A;  111M A;  3L0F A;  1YIE A;  2OHB A;  2DKC A;  1B8D A;  5EU2 A;  4NXA A;  3O2C B;  1B86 B;  1CLS B;  4B02 A;  2O5B X;  2D60 B;  1DKE B;  4GZG A;  3OJ1 A;  3QM8 A;  2MGE A;  1XZ5 A;  5CNG A;  1LIA B;  3DHT A;  3PEL B;  1XYE B;  1FN3 B;  1Y46 A;  2DN3 B;  4MQJ A;  2H8D A;  1MKO A;  1B8D B;  3GK9 A;  1YEV A;  2V1J A;  2GDM A;  3AQ5 A;  1ON7 A;  1O1I A;  3B75 A;  4H07 A;  4N6S B;  1Y8H B;  2HBS A;  1V4U B;  5CND A;  3P5Q B;  1IOP A;  2OH8 A;  1HDA B;  4F6G A;  1SI4 A;  3OGB A;  3QM9 A;  1GVH A;  2Z6T A;  3MYN A;  1CII A;  3G4Y A;  4F68 A;  2LH3 A;  1MYF A;  1DUK A;  3QJB A;  1HV4 B;  1YGF B;  2D2M A;  3PMD A;  1Y7D B;  1RQ3 B;  2FRK X;  3WCU A;  2DN2 B;  2V1E A;  2VYY A;  1TOX A;  4UZV A;  3V58 A;  1J7W A;  1LH1 A;  1Y31 A;  3QJD A;  1QSH B;  1LFT A;  1NY9 A;  5CN4 A;  4MQI A;  1CG8 B;  4KJT A;  1HHO B;  4O35 A;  1Y4F A;  2G3H A;  4ERV A;  1LJW B;  5AB8 A;  2GRZ A;  3ZJP A;  1MDT A;  4MBN A;  6HBI A;  1OUU A;  1Y09 B;  1TU9 A;  4F0T A;  3IA3 B;  1BIJ B;  3FEW X;  3K3U A;  1NGK A;  4GXE A;  1D8U A;  1HBB A;  1CO9 A;  1O1L B;  3WR1 A;  1LHS A;  1MLO A;  5B13 G;  4F0T B;  3HRW B;  1FSX A;  5ILM A;  1NS9 A;  2VYZ A;  1COH B;  1GZX A;  1IRD A;  1G0A A;  1LHT A;  1UVL A;  1YCA A;  3WTG B;  1G0B B;  4KN3 A;  1CBM A;  1G09 B;  2CMM A;  3UHY A;  2ZSQ A;  2UUM X;  1Y2Z A;  1Y31 B;  2ZSY A;  1VXG A;  4YJJ B;  1XZ2 A;  3GIO A;  1RQ3 A;  1Y8W B;  4MQC A;  1VXC A;  1CMY B;  1WMU B;  1V75 B;  3QJB B;  2LH7 A;  2XKG A;  2ZS1 D;  1J7S B;  1J7Y B;  1X9F D;  1A0U A;  5KDQ B;  2HBD B;  4F6J A;  1JL6 A;  2QU0 A;  1RQ4 B;  5SW7 A;  2ZSZ A;  4U8U A;  1CO8 A;  2O5O X;  2BV8 A;  1RTX A;  5EE4 D;  3GKT A;  1MNH A;  2ZT0 A;  4M4A B;  3LB1 A;  2ZS0 C;  1DO7 A;  2ZLT A;  1YEQ B;  3D1K A;  1FDH G;  2ZT2 A;  4RMP A;  3EDA A;  1QPW A;  4MAX A;  1A4F B;  2JL9 A;  1BIJ A;  1MKO B;  2W6X A;  2AA1 B;  4L7Y B;  1KTP B;  1QXD A;  3PI8 B;  3S1J A;  1UVM A;  3VRF A;  2O5S X;  1YEN A;  1A6K A;  1LIA A;  1IDR A;  2EVP A;  1Y4F B;  1Y4B A;  1CPC A;  1VXF A;  108M A;  5FVB M;  1MTK A;  2G0S A;  1X9F C;  1YGD A;  1O1K B;  4FWZ A;  3O2C A;  2R4Z A;  2VHB A;  1MNI A;  3HEP A;  3GKV B;  2HBC A;  1SDL A;  1UVI A;  2ZLX A;  103M A;  3QM6 A;  4N7O B;  1CH7 A;  3NG6 A;  2ZST A;  1V4X B;  3OO4 A;  4B3W A;  3RJ6 A;  1NWI A;  2LH6 A;  1F5O A;  4MU5 A;  3BRP A;  3NL7 B;  1YFF A;  2X4A A;  1CQX A;  1BZP A;  3ZJN A;  1MLF A;  1JZL A;  1ALL A;  1JP8 A;  2DC3 A;  3MJP A;  4MXK A;  4A8K A;  2LH5 A;  1DXV B;  1Y8W A;  3UHK A;  3ED9 A;  2HBC B;  1ECA A;  3BCQ A;  3WCP A;  3BJ2 B;  4PNJ A;  5CNB A;  1LFZ B;  3EOK B;  1U7S A;  4DWU A;  2NX0 A;  5EET A;  2Z6N A;  4O4Z A;  1HGB A;  3R5I B;  1R1X A;  1UX9 A;  3PI8 A;  1B86 A;  1F0L A;  1Y4P A;  3OK5 A;  1HA7 A;  1N9I A;  1NS6 A;  1BJE A;  3K9Z A;  1XZU A;  1Y22 A;  4NZI A;  3QJC B;  4L1E A;  1DUO A;  2XYK A;  2DN1 B;  1YEQ A;  1IWH B;  3VHB A;  2ZS0 A;  1LFY A;  2ZLV A;  1NIH B;  2BV8 B;  3ZJQ A;  3KUO A;  1VXE A;  3KMF A;  4Q70 B;  4YU4 B;  3SZK A;  1BZZ B;  1B33 A;  3UBC A;  2YRS B;  3HHB A;  2XKH A;  1CIK A;  3FS4 B;  2MGD A;  3WCW B;  1CQ2 A;  2R4X A;  1J7S A;  1S56 A;  1Y8K A;  3UI0 A;  1WMU A;  3V58 B;  1J41 A;  1WAC A;  3HF4 A;  3PIA A;  1HDB B;  1DXU B;  1YGF A;  1HBR B;  2MHB A;  3ZOL A;  3RJN B;  1VWT B;  109M A;  4HHB B;  2HZ1 A;  4ESU A;  1HCO B;  2YSK A;  1YFF B;  5CNE A;  3UH5 A;  1Y4R A;  2GTL D;  1MLQ A;  3HXN B;  1HI1 A;  2AV0 A;  4MQK A;  4OF9 A;  3ASE A;  3H58 A;  3NG6 B;  2H8F B;  4FH6 A;  1RVW B;  1Y5J B;  2AUO A;  1N9H A;  2HZ3 A;  1XZ7 B;  2MGK A;  1HA7 B;  2R4Y A;  1Y09 A;  2ZSO A;  2QSP B;  2ZFB B;  1Y01 B;  2WY4 A;  3MVC A;  3DHT B;  3S48 C;  1Y4B B;  2D2N C;  1BZR A;  2O58 X;  3IC2 B;  3UHD A;  2V1F A;  4TYX A;  1T1N B;  2QFK A;  3MYM A;  1A01 B;  3WCP B;  1QPW B;  1LFT B;  1XQ5 A;  3ECL A;  2OLP A;  1JEB A;  2D5Z B;  1MWB A;  2ZT1 A;  2MGI A;  1C7C A;  3DHR B;  1Y4Q A;  5CNF A;  1Y4V B;  1HHT P;  4MBA A;  4ZIZ A;  5C6Y A;  1COL A;  1DXV A;  1DLY A;  2HCO B;  1J3Y A;  2O5Q X;  3A5B A;  4ETV A;  3ZJM A;  1MYT A;  2PEG B;  1Y0D B;  4ETT A;  3NMM A;  3WCU D;  1RPS A;  1G9V A;  5HY8 B;  2FRI X;  3VRE B;  2W6V B;  3CIU B;  5HU6 A;  1Y0D A;  1YMB A;  1S61 A;  1YMA A;  3P5Q A;  1BAB B;  4MQC B;  4HRR B;  1EW6 A;  2GTL B;  3D1A B;  2AUR A;  1KN1 B;  1C7C B;  1YHE A;  1YEU B;  4WCH D;  5B85 A;  2H8D B;  4G51 A;  2MYB A;  3ZHW A;  1FN3 A;  2ZT4 A;  4DC7 A;  3GYS A;  3TM9 A;  3WCT B;  1VHB A;  3D4X B;  1Y35 B;  1O16 A;  1IRD B;  1MBA A;  1VXB A;  2HHB B;  4Z8K A;  3V2V A;  2ZFB A;  1QXD B;  3WCU C;  2OIF A;  3QQQ A;  1XZ7 A;  1O1L A;  4A8M P;  1O1J A;  3QM7 A;  1Y22 B;  1JP6 A;  1RVW A;  2R80 B;  1UIW B;  101M A;  1Y0C A;  1SGK A;  3ARK A;  2V8A B;  1MLM A;  1RSE A;  1BUW A;  1J3F A;  3UHH A;  1G08 B;  3OO5 B;  2DXM A;  1GH0 A;  1UX8 A;  4SDH A;  5E29 A;  5EYJ A;  2UUN B;  1FSL A;  4PQ6 A;  1HJT A;  2VJR A;  1YIH B;  3UHW A;  3GQR A;  1Y83 A;  1A0U B;  2R4W A;  4TMA B;  1NZ3 A;  4MQI B;  5ILP A;  2RAO A;  1OUT A;  3MN0 A;  2VLY A;  2W6W A;  3UH7 A;  1XZV B;  3QJE B;  1J40 A;  2MHB B;  1CBL A;  4HSX A;  1Y7D A;  2D2N A;  3WFU A;  2EVK A;  3MJP B;  4O1T A;  3E5O A;  1Y2Z B;  3MKB A;  2OHA A;  3K8B B;  1LFQ B;  1Y7C A;  4DWT A;  3GQR B;  1GCW B;  4F4O B;  2SPM A;  1VRF A;  2YRS A;  3OZV A;  4TWV A;  3AQ7 A;  4BJU A;  5EQM A;  4YU4 A;  105M A;  3UHB A;  2BLJ M;  2DXM B;  1LA6 A;  1Y0W B;  4ZVA A;  4ESA B;  2M6Z A;  2VJT B;  1FDH A;  2I88 A;  2V8A A;  1MOH A;  3KVS A;  1Y0C B;  2ZLX B;  2GKN A;  1ECO A;  3KMF C;  1ABW A;  1NZ4 A;  3WCW C;  1IBE A;  1JWN A;  2SPO A;  4JYQ A;  4MQJ B;  1YGD B;  1Y46 B;  2VJT A;  3D7O B;  5CHR A;  2AUQ A;  1X46 A;  1V4W A;  1GCV B;  2SPL A;  4A8O A;  1NEJ A;  1S0H A;  3E4N A;  3VRF B;  3ZTA A;  1MYZ A;  1Y7Z A;  4F6B A;  2VRY A;  1A4F A;  3VRG B;  5MBN A;  1YHR A;  1LUE A;  2ZSS A;  2PGH B;  2DHB A;  1AJ9 B;  1DTM A;  3E5I A;  1M9P B;  2C7L A;  1ABY A;  1A00 B;  1PMB A;  2QU0 B;  4G1V A;  1HBS A;  1HDS B;  3GQP A;  1CH5 A;  2EKU A;  2HBE B;  3ZJI A;  4VHB A;  1V4X A;  4ZVB A;  3ZOM A;  1HAC B;  1YG5 A;  2HBF B;  2VJH A;  1Y8H A;  1YZI B;  1CG5 A;  6HBW B;  3G4Q A;  2G0Z A;  4YJJ A;  1OFJ A;  1HLM A;  3UHN A;  1YH9 A;  1A3N B;  2UUL A;  3MBA A;  2DN3 A;  4WJG 1;  4NI1 A;  5MBA A;  4N7P B;  3GQG A;  4IRO A;  1G0A B;  1MNJ A;  2GL3 A;  1Y8I B;  1W92 A;  2MGF A;  1Y45 B;  2GNW A;  1CLS A;  4H2L B;  5JGG B;  3G4R A;  4A8S A;  1V07 A;  3UBV A;  4L2M A;  3PI3 A;  4KMW A;  1ITH A;  4UIQ A;  1Y5J A;  3D1K B;  1Y7G A;  1SPE A;  3RQR A;  4JAC A;  1LH7 A;  3ARJ A;  4XDI A;  1JZM A;  3LR9 A;  4ETU A;  5KER B;  2HBE A;  1MYH A;  2VM0 A;  1MOA A;  1QXE B;  1Y5F A;  3CY5 B;  3A5G A;  5ILE A;  1GBU A;  3BOM B;  1BBB B;  1HBH A;  1G9V B;  4ODC B;  3WCT C;  2ZSN A;  3QM5 A;  1LFQ A;  2ZS1 B;  2PEG A;  2HHD A;  4LPI A;  1VWT A;  2D6C A;  4HHB A;  1S5Y B;  3QMA A;  2DN2 A;  3W4U A;  2NSR A;  1Y8K B;  2HHD B;  4H0M B;  4ROL B;  1O1M A;  4ODC A;  1SWM A;  2LH1 A;  3QZX A;  2LHB A;  2G0V A;  2BNL A;  1XF6 C;  1Y5F B;  5F0B A;  5E29 B;  1RQA B;  5HAV A;  3ZJR A;  3HRW A;  3PMC A;  3BA2 A;  1MTI A;  1QSI A;  1JF4 A;  2BKM A;  2ZLV B;  1MZ0 A;  1ON7 B;  1MBO A;  4OOD A;  1HAB B;  4GXE B;  1B0B A;  1Y85 B;  1KD2 A;  1O1P A;  1Y4P B;  1XYE A;  2UUL D;  2M6Z B;  4HH0 A;  1DO1 A;  2JLF A;  1I3E A;  4N7N B;  4GY3 A;  1EBT A;  3D4X A;  1LH2 A;  3HXN A;  5JDO D;  1MWD A;  3WFW A;  4NXC A;  4IRO B;  1N9F A;  4NI1 B;  1O1M B;  2QMB A;  1WLA A;  1HCO A;  1A0Z A;  1UMO A;  3ZJJ A;  1YIE B;  2W72 B;  1XG0 C;  3IC0 B;  1HDB A;  5B84 A;  6HBW A;  4HRR A;  1KR7 A;  3WCV B;  2RI4 A;  2GRF A;  3LQD A;  3UHV A;  3LR7 A;  2J96 A;  4UUR A;  1YDZ B;  1OJ6 A;  3LHB A;  4M4B A;  1MDN A;  1NQP A;  5EYS A;  1J3Z A;  5C6E A;  1YIH A;  1B33 B;  1GBU B;  3UHI A;  1NWN A;  3PI9 A;  3CY5 A;  2UUL C;  1SI4 B;  1BIN A;  4LM6 B;  1J3Y B;  1XCH A;  2GTL C;  2DHB B;  2HCO A;  2MGG A;  1LH5 A;  3LQD B;  2RI4 B;  1MYJ A;  2EKT A;  2G0X A;  1BZ0 A;  4HRT A;  2BMM A;  1JEB B;  102M A;  1O1J B;  3GKV A;  2BWH A;  3VNC A;  1A0Z B;  4F0U A;  5JGG A;  3UHQ A;  3QZZ A;  3UH3 A;  2HHB A;  4Z8K B;  1BZ6 A;  1MBI A;  4MQG B;  1CPC B;  110M A;  3NML A;  3R5I A;  1NPG A;  3SDN A;  3GOU B;  4N7N A;  4DC8 A;  1A87 A;  3WI8 A;  5EUI A;  2D60 A;  1NZ5 A;  5E6E A;  1DLW A;  1O1P B;  4F0U B;  1A3N A;  2UUL B;  1ABW B;  1S5X A;  1HAB A;  1MNO A;  5D5R A;  1LFL A;  1J52 A;  1C7D A;  1THB B;  3ZJL A;  1A9W E;  1H97 A;  2G10 A;  2JLG A;  3EDB A;  2KSC A;  1CP0 A;  1DWT A;  4FH7 A;  1GDJ A;  1HBS B;  2DKD A;  3DR9 A;  2ZLU B;  5E83 B;  1JPB A;  2HBD A;  3H57 A;  1ASH A;  1BVD A;  2QSS B;  3K8B A;  1DXD A;  3OO4 B;  2GKM A;  5FVB A;  1RH1 A;  5JDO F;  3UHU A;  1Y5K A;  3AT6 B;  3O18 A;  3S1I A;  2GNV A;  2Z6S A;  1Y83 B;  2BW9 M;  2VEB A;  1FAW A;  2JHO A;  1NEJ B;  1S0H B;  3DBJ B;  2EF2 A;  2ZFO A;  1YE0 A;  1ECD A;  1FCS A;  2ZSP A;  3A5A A;  1COH A;  3UHE A;  2GLN A;  1CH9 A;  4C44 A;  4ERT A;  1AZI A;  2NRL A;  3WCW D;  4YU3 B;  1EYX B;  1Y85 A;  1I3D A;  2ZS0 B;  2ZS1 C;  2DN1 A;  3WHM A;  1GLI A;  1DWS A;  4H2L A;  1MBN A;  1OUU B;  1F65 A;  2MGL A;  4XS0 B;  3ECX A;  1O1N B;  1JW8 A;  3A0G A;  1HGB B;  5IKS A;  1C7B A;  1K0Y A;  3S66 B;  4MPM A;  1XZ4 B;  3OVU C;  1YE2 A;  4NK1 A;  1N9X A;  4F6F A;  5F2A A;  1BVC A;  3G4W A;  1YVQ B;  3TLD A;  1DO4 A;  2B7H A;  2LH2 A;  2D2N B;  2D2M B;  1UT0 A;  3QQR A;  1OUT B;  3ECZ A;  1KFR A;  2QSS A;  3GQP B;  3CIU A;  1OFK A;  1BBB A;  4BJA A;  1PHN B;  1C7B B;  1K0Y B;  1GBV A;  3S66 A;  2WCR A;  1G0B A;  4AVE A;  1U7R A;  5CHQ A;  4Q70 A;  1QXE A;  1M9P A;  2C7L B;  2FAM A;  4XS0 A;  2HBS B;  3GLN A;  1XXT B;  1HGC A;  4ZIZ B;  1UIW A;  1SDL B;  1YHR B;  1A3O B;  1S5X B;  3EU1 B;  1XZU B;  1H1X A;  1VXD A;  3KUN A;  1UVY A;  5CNC A;  1JBO A;  1ECN A;  1SHR B;  1A01 A;  5B13 A;  5E6E B;  3GUQ A;  3TM3 A;  2HZ2 A;  3PEL A;  2BLH A;  2R1H A;  1UVN A;  4MQG A;  3UHC A;  3GQG B;  4N7P A;  2QSP A;  3EOK A;  1LH3 A;  5HBI A;  1CG8 A;  1XY0 B;  1DXT A;  1MBD A;  3ONZ A;  2H8F A;  2GTL A;  3L0F B;  3M39 A;  1XXT A;  5ILR A;  2ZFO C;  2HBF A;  1HV4 A;  3MJU B;  4QAU A;  1F99 B;  3ZJO A;  4F6I A;  2HBG A;  1GCW A;  2EB9 A;  4F4O A;  4FC3 A;  1F99 A;  2C7J B;  1YDZ A;  3RGK A;  4MQH A;  1OR4 A;  1YOH A;  1DXU A;  3WCV A;  4N6S A;  3HF4 B;  3AQ6 A;  2W31 A;  1Y4V A;  4MXL A;  2C7K A;  1DXT B;  1MYI A;  3PT8 B;  2DKA A;  3MWN A;  1UC3 A;  2QLS A;  1JDO A;  1YVT B;  1GCV A;  1BZZ A;  2AUP A;  2ZFO D;  3GOU A;  4O2G A;  2R1H B;  1YEN B;  1FSX B;  3UHR A;  1BUW B;  1KD2 B;  3WR1 B;  2V1K A;  1MGN A;  2Z85 A;  5JOM A;  1Q1F A;  1A3O A;  3EU1 A;  1C40 A;  2QRW A;  4XXK A;  1HGC B;  3KVS B;  1NS6 B;  4YU3 A;  1QSI B;  2AV3 A;  4N8T A;  1GDL A;  4U8U B;  1Y35 A;  2G12 A;  4A8W A;  1HHO A;  2GRH A;  3FH9 A;  2MGB A;  3GYS B;  2QLS B;  1IT3 A;  1SDK A;  1Y4R B;  3BJ2 A;  5KDQ A;  4ROL A;  3DUT B;  3AT5 B;  1SPG A;  1ABS A;  4ROM B;  4PO5 A;  2C7K B;  2VYW A;  3IXF A;  3O89 A;  5AQD M;  4F69 A;  2W72 A;  1YEO A;  2ZLW A;  4LMX B;  4PQB A;  1QI8 B;  3ZJH A;  4AVD A;  1SPG B;  1MLU A;  2E2Y A;  4IT8 A;  2OH9 A;  1I7Y A;  3FH9 B;  3PI4 A;  2MBW A;  5HLQ A;  1MBS A;  4U8U C;  1BZ1 A;  4GY3 B;  3UHS A;  1YCB A;  1NS9 B;  1MLG A;  1Y0T B;  3OO5 A;  1HI0 P;  3UGY A;  2BK9 A;  5JDO E;  1DWR A;  1JL7 A;  4N7O A;  1HBA A;  1HBI A;  1LFY B;  1O1I B;  3B75 B;  3WCV D;  2O5M X;  2ZWJ A;  2Z8A A;  1DDT A;  1O1K A;  1F63 A;  3S65 B;  1TES A;  1YOI A;  1NPF A;  3IC2 A;  1JF3 A;  1GDK A;  2D2M C;  7HBI A;  2WTG A;  3V57 A;  3AG0 A;  1M6M A;  1UVX A;  2UUM A;  2AA1 A;  4L7Y A;  3R0G A;  4X0L B;  1SHR A;  3UH6 A;  3PT8 A;  1FHJ A;  2ZSX A;  3BCQ B;  1YH9 B;  4RMP B;  1YOG A;  4U8U D;  1L2K A;  2ZLT B;  1S69 A;  4HRT B;  3D1A A;  2MGA A;  1HHS A;  3A9M A;  3UHZ A;  1CG5 B;  3LB2 A;  1O1O B;  1BAB A;  1ALL B;  1X3K A;  4LMS B;  3UGZ A;  3PI9 B;  2MGM A;  3WCV C;  5SW7 B;  1A6M A;  1MNK A;  3BRP B;  3OZU A;  3PT7 A;  1RPS B;  1AJH A;  1J7Y A;  2MYC A;  4NS2 A;  1MYM A;  2C0K A;  1DTI A;  1CPW A;  1QI8 A;  1V75 A;  1MLR A;  2PGH A;  1O1O A;  1X9F B;  2D5X B;  1Y0A B;  3VAU A;  3IC0 A;  3ORD A;  1Y4Q B;  1XZ2 B;  2FRJ X;  3MOU A;  3AT5 A;  3DUT A;  1A6N A;  1FHJ B;  1A6G A;  5CN5 A;  1Y7Z B;  4X0L A;  1MLS A;  3HYU A;  1SDK B;  3HEO A;  1GJN A;  1DO3 A;  5EUI B;  3WTG A;  2SPN A;  2MYD A;  2MYA A;  1JP9 A;  1MLN A;  5AZQ A;  3S65 A;  3PI1 A;  1IBE B;  2X49 A;  4B4Y A;  2R50 A;  1JY7 A;  4NK2 A;  1MOC A;  1PBX B;  2QFN A;  1EYX A;  1HRM A;  3ODQ A;  1YG5 B;  2VJH B;  4ILZ A;  5EOH A;  1IT2 A;  3BJ1 B;  4HBI A;  1LJW A;  3G53 A;  3ARL A;  1NAZ A;  2Z6N B;  2MGJ A;  3HEN A;  3WFT A;  1RQ4 A;  1YVT A;  3A59 A;  1I7Y B;  2VLZ A;  1LFZ A;  3SDH A;  1A00 A;  1MYG A;  3D17 A;  1F5P A;  3O18 B;  1QSH A;  4O4T A;  2ZLW B;  1UFJ A;  4PQC A;  1MLL A;  1YEO B;  3ZJS A;  3W4U B;  1J40 B;  2IG3 A;  1J41 B;  3OZW A;  1MWC A;  1V5H A;  3LQ9 A;  1YVQ A;  2FAL A;  4PO5 B;  2BLI A;  2MGH A;  2W6Y A;  3HHB B;  3NL7 A;  1URY A;  3V2Z A;  3WFX A;  2ZLU A;  5E83 A;  4FWX A;  1V4W B;  5EE4 C;  3UHX A;  3SZK B;  4A8Q A;  1YHU C;  2IN4 A;  2VLX A;  1HDA A;  1OR6 A;  4AE0 A;  3BJ1 A;  5KER A;  1HGA B;  3ZH0 A;  107M A;  3ODQ B;  1DM1 A;  1PBX A;  2V1G A;  1C7D B;  1THB A;  1IWH A;  3ONZ B;  5KKK A;  3WHM B;  1JY7 B;  1C40 B;  1XY0 A;  3G52 A;  1VXA A;  2MYE A;  1XDT T;  5CN7 A;  3NFE B;  1LH6 A;  1MTJ A;  1MLK A;  1LA6 B;  1Y0W A;  1CP5 A;  1Y4G B;  1YE0 B;  3WCT A;  1DKE A;  1MLJ A;  2V1H A;  3GDJ B;  1FAW B;  1KTP A;  3HYU B;  4G51 B;  1JBO B;  4H0M A;  4HSW A;  1V9Q A;  3MKB B;  1R1Y A;  1Y5K B;  3AT6 A;  1YHU D;  4H0B A;  1K1K A;  4KMV A;  1Y0A A;  1YZI A;  5D1V A;  1RTE A;  3LB3 A;  2NRM A;  2EB8 A;  2C7J A;  1OBM A;  1LFV B;  2W6V A;  3PT7 B;  1GDI A;  1HBH B;  1GBV B;  1WVP A;  1J3Z B;  3BOM A;  3VRE A;  5HY8 A;  3UHG A;  1ABY B;  2UUN A;  4AE1 A;  4C0N A;  1NQP B;  4M4B B;  1CH4 A;  5M3S A;  2UUL H;  1NXF A;  3MJU A;  1CMY A;  1AJ9 A;  4A8F A;  1AJG A;  2ZSR A;  2FRF A;  1HLB A;  2MGC A;  1DXC A;  2R80 A;  1IRC A;  1Y7G B;  1LFL B;  3BJ3 A;  1YEV B;  1R1Y B;  4BS9 A;  1XQ5 B;  2HHE A;  3VRG A;  2O5L X;  4TWU A;  1HI8 A;  4A8Y A;  2QMB B;  1YE2 B;  1UVJ A;  2O5T X;  3GDJ A;  1Y45 A;  2ZS0 D;  2VML B;  1UFP A;  106M A;  1Y8I A;  1T1N A;  1CH2 A;  3U3E A;  3PI2 A;  3E55 A;  1XZ5 B;  3A0G B;  1GZX B;  4FWY A;  1O1N A;  1MOD A;  3M3A A;  3NFE A;  3M38 A;  1A9W A;  1CH1 A;  2VEE A;  1GLI B;  2HHE B;  2ZT3 A;  4XXI A;  5CN6 A;  1FLP A;  3BJ3 B;  1KN1 A;  1BZ0 B;  5CN9 A;  4M4A A;  2D5X A;  1QGW C;  4ESA A;  3G46 A;  2G14 A;  4WJG A;  3HC9 A;  1BZ1 B;  2ZFO B;  1JZK A;  3DBJ A;  4NI0 B;  1YHU B;  1PHN A;  4HH1 A;  1M6C A;  3QJD B;  1J7W B;  2W72 C;  3PIA B;  3WCU B;  2NSS A;  5AZR A;  1K1K B;  2B7H B;  3LB4 A;  3DHR A;  1CIO A;  2D5Z A;  5JDO C;  4ROM A;  2ZS1 A;  3O7N A;  2V1I A;  3D17 B;  112M A;  1XZ4 A;  2UUM B;  1G09 A;  3A59 B;  1YHU A;  3AQ9 A;  2VJR B;  3V57 B;  1HSY A;  1LTW A;  1URV A;  1Y4G A;  3NUH B;  1MCY A;  3D7O A;  1EBC A;  1V4U A;  5HLU A;  4N8T B;  2MB5 A;  5CN8 A;  1NIH A;  1UVK A;  1EMY A;  1HBB B;  3WCT D;  3QJC A;  4L1E B;  4G1B A;  2D2N D; 
#chains in the Genus database with same CATH homology
 2G0R A;  2D2M D;  1HBA B;  5HLX A;  1EWA A;  1Z8U B;  1MLH A;  1HGA A;  1Y0T A;  1MOB A;  3M3B A;  1R1X B;  4MQK B;  1RQA A;  3A2G A;  5EV5 A;  1S6A A;  3UHT A;  1Y7C B;  1YEU A;  1YHE B;  1HBR A;  2WTH A;  1VXH A;  2H35 A;  1X9F A;  1HAC A;  3QJE A;  1YMC A;  1S5Y A;  1XZV A;  4MQH B;  2RAO B;  5HU6 B;  3WCW A;  1HDS A;  1VRE A;  3FS4 A;  4FC3 B;  3G4U A;  3AQ8 A;  1HBG A;  5C6E B;  1NZ2 A;  4NI0 A;  1LFV A;  3NMM B;  1CH3 A;  2G11 A;  4F6D A;  1G08 A;  2XKI A;  1MBC A;  5CMV A;  104M A;  2H35 B;  3G4V A;  111M A;  1YIE A;  2OHB A;  5EU2 A;  4NXA A;  1B86 B;  1CLS B;  2O5B X;  2D60 B;  1DKE B;  4GZG A;  3OJ1 A;  3QM8 A;  2MGE A;  1XZ5 A;  5CNG A;  3DHT A;  3PEL B;  1XYE B;  1FN3 B;  1Y46 A;  2DN3 B;  4MQJ A;  2H8D A;  1MKO A;  3GK9 A;  1YEV A;  2V1J A;  2GDM A;  3AQ5 A;  1O1I A;  3B75 A;  4H07 A;  1Y8H B;  2HBS A;  1V4U B;  5CND A;  3P5Q B;  1IOP A;  2OH8 A;  1HDA B;  4F6G A;  1SI4 A;  3OGB A;  3QM9 A;  1GVH A;  2Z6T A;  3MYN A;  3G4Y A;  4F68 A;  2LH3 A;  1MYF A;  1DUK A;  3QJB A;  1HV4 B;  1YGF B;  2D2M A;  1Y7D B;  1RQ3 B;  2FRK X;  3WCU A;  2DN2 B;  2V1E A;  2VYY A;  4UZV A;  1J7W A;  1LH1 A;  1Y31 A;  3QJD A;  1QSH B;  1LFT A;  5CN4 A;  4MQI A;  1CG8 B;  4KJT A;  1HHO B;  4O35 A;  1Y4F A;  2G3H A;  1LJW B;  5AB8 A;  2GRZ A;  3ZJP A;  4MBN A;  6HBI A;  1OUU A;  1Y09 B;  1TU9 A;  3IA3 B;  1BIJ B;  3K3U A;  1NGK A;  1D8U A;  1HBB A;  1CO9 A;  1O1L B;  3WR1 A;  1LHS A;  1MLO A;  3HRW B;  1FSX A;  5ILM A;  1NS9 A;  2VYZ A;  1COH B;  1GZX A;  1IRD A;  1G0A A;  1LHT A;  1YCA A;  3WTG B;  1G0B B;  4KN3 A;  1CBM A;  1G09 B;  2CMM A;  3UHY A;  2ZSQ A;  1Y2Z A;  1Y31 B;  2ZSY A;  1VXG A;  1XZ2 A;  1RQ3 A;  1Y8W B;  4MQC A;  1VXC A;  1CMY B;  1WMU B;  1V75 B;  3QJB B;  2LH7 A;  2XKG A;  2ZS1 D;  1J7S B;  1J7Y B;  1X9F D;  1A0U A;  5KDQ B;  2HBD B;  4F6J A;  1JL6 A;  2QU0 A;  1RQ4 B;  5SW7 A;  2ZSZ A;  4U8U A;  1CO8 A;  2O5O X;  1RTX A;  5EE4 D;  3GKT A;  1MNH A;  2ZT0 A;  4M4A B;  3LB1 A;  2ZS0 C;  1DO7 A;  2ZLT A;  1YEQ B;  3D1K A;  1FDH G;  2ZT2 A;  3EDA A;  1QPW A;  4MAX A;  1A4F B;  1BIJ A;  1MKO B;  2W6X A;  2AA1 B;  4L7Y B;  1QXD A;  3PI8 B;  3S1J A;  3VRF A;  2O5S X;  1YEN A;  1A6K A;  1IDR A;  2EVP A;  1Y4F B;  1Y4B A;  1VXF A;  108M A;  1MTK A;  2G0S A;  1X9F C;  1YGD A;  1O1K B;  4FWZ A;  2R4Z A;  2VHB A;  1MNI A;  3HEP A;  3GKV B;  2HBC A;  1SDL A;  2ZLX A;  103M A;  3QM6 A;  4N7O B;  1CH7 A;  3NG6 A;  2ZST A;  1V4X B;  3OO4 A;  4B3W A;  3RJ6 A;  1NWI A;  2LH6 A;  1F5O A;  4MU5 A;  3NL7 B;  1YFF A;  1CQX A;  1BZP A;  3ZJN A;  1MLF A;  1JZL A;  1JP8 A;  2DC3 A;  3MJP A;  4MXK A;  2LH5 A;  1DXV B;  1Y8W A;  3UHK A;  3ED9 A;  2HBC B;  1ECA A;  3BCQ A;  3WCP A;  3BJ2 B;  4PNJ A;  5CNB A;  1LFZ B;  3EOK B;  1U7S A;  4DWU A;  2NX0 A;  5EET A;  2Z6N A;  4O4Z A;  1HGB A;  3R5I B;  1R1X A;  1UX9 A;  3PI8 A;  1B86 A;  1Y4P A;  3OK5 A;  1N9I A;  1NS6 A;  1BJE A;  3K9Z A;  1XZU A;  1Y22 A;  4NZI A;  3QJC B;  1DUO A;  2XYK A;  2DN1 B;  1YEQ A;  1IWH B;  3VHB A;  2ZS0 A;  1LFY A;  2ZLV A;  1NIH B;  3ZJQ A;  3KUO A;  1VXE A;  3KMF A;  4YU4 B;  3SZK A;  1BZZ B;  3UBC A;  2YRS B;  3HHB A;  2XKH A;  1CIK A;  3FS4 B;  2MGD A;  3WCW B;  1CQ2 A;  2R4X A;  1J7S A;  1S56 A;  1Y8K A;  3UI0 A;  1WMU A;  1J41 A;  3HF4 A;  3PIA A;  1HDB B;  1DXU B;  1YGF A;  1HBR B;  2MHB A;  3ZOL A;  3RJN B;  1VWT B;  109M A;  4HHB B;  2HZ1 A;  1HCO B;  1YFF B;  5CNE A;  3UH5 A;  1Y4R A;  2GTL D;  1MLQ A;  3HXN B;  2AV0 A;  4MQK A;  4OF9 A;  3ASE A;  3H58 A;  3NG6 B;  2H8F B;  4FH6 A;  1RVW B;  1Y5J B;  2AUO A;  1N9H A;  2HZ3 A;  1XZ7 B;  2MGK A;  2R4Y A;  1Y09 A;  2ZSO A;  2QSP B;  2ZFB B;  1Y01 B;  2WY4 A;  3MVC A;  3DHT B;  3S48 C;  1Y4B B;  2D2N C;  1BZR A;  2O58 X;  3IC2 B;  3UHD A;  2V1F A;  4TYX A;  1T1N B;  2QFK A;  3MYM A;  1A01 B;  3WCP B;  1QPW B;  1LFT B;  1XQ5 A;  3ECL A;  2OLP A;  1JEB A;  2D5Z B;  1MWB A;  2ZT1 A;  2MGI A;  1C7C A;  3DHR B;  1Y4Q A;  5CNF A;  1Y4V B;  4MBA A;  5C6Y A;  1DXV A;  1DLY A;  2HCO B;  1J3Y A;  2O5Q X;  3A5B A;  3ZJM A;  1MYT A;  2PEG B;  1Y0D B;  3NMM A;  3WCU D;  1RPS A;  1G9V A;  5HY8 B;  2FRI X;  3VRE B;  2W6V B;  3CIU B;  5HU6 A;  1Y0D A;  1YMB A;  1S61 A;  1YMA A;  3P5Q A;  1BAB B;  4MQC B;  4HRR B;  1EW6 A;  2GTL B;  3D1A B;  2AUR A;  1C7C B;  1YHE A;  1YEU B;  4WCH D;  5B85 A;  2H8D B;  4G51 A;  2MYB A;  3ZHW A;  1FN3 A;  2ZT4 A;  4DC7 A;  3GYS A;  3TM9 A;  3WCT B;  1VHB A;  3D4X B;  1Y35 B;  1O16 A;  1IRD B;  1MBA A;  1VXB A;  2HHB B;  3V2V A;  2ZFB A;  1QXD B;  3WCU C;  2OIF A;  3QQQ A;  1XZ7 A;  1O1L A;  1O1J A;  3QM7 A;  1Y22 B;  1JP6 A;  1RVW A;  2R80 B;  1UIW B;  101M A;  1Y0C A;  3ARK A;  1MLM A;  1RSE A;  1BUW A;  1J3F A;  3UHH A;  1G08 B;  3OO5 B;  2DXM A;  1UX8 A;  4SDH A;  5E29 A;  5EYJ A;  1FSL A;  4PQ6 A;  1HJT A;  1YIH B;  3UHW A;  3GQR A;  1Y83 A;  1A0U B;  2R4W A;  1NZ3 A;  4MQI B;  5ILP A;  2RAO A;  1OUT A;  3MN0 A;  2VLY A;  2W6W A;  3UH7 A;  1XZV B;  3QJE B;  1J40 A;  2MHB B;  1CBL A;  4HSX A;  1Y7D A;  2D2N A;  3WFU A;  2EVK A;  3MJP B;  4O1T A;  3E5O A;  1Y2Z B;  3MKB A;  2OHA A;  3K8B B;  1LFQ B;  1Y7C A;  4DWT A;  3GQR B;  1GCW B;  4F4O B;  2SPM A;  1VRF A;  2YRS A;  3OZV A;  4TWV A;  3AQ7 A;  5EQM A;  4YU4 A;  105M A;  3UHB A;  2BLJ M;  2DXM B;  1LA6 A;  1Y0W B;  4ZVA A;  4ESA B;  2M6Z A;  1FDH A;  1MOH A;  1Y0C B;  2ZLX B;  2GKN A;  1ECO A;  3KMF C;  1ABW A;  1NZ4 A;  3WCW C;  1IBE A;  1JWN A;  2SPO A;  4JYQ A;  4MQJ B;  1YGD B;  1Y46 B;  3D7O B;  5CHR A;  2AUQ A;  1X46 A;  1V4W A;  1GCV B;  2SPL A;  1NEJ A;  1S0H A;  3E4N A;  3VRF B;  1MYZ A;  1Y7Z A;  4F6B A;  2VRY A;  1A4F A;  3VRG B;  5MBN A;  1YHR A;  1LUE A;  2ZSS A;  2PGH B;  2DHB A;  1AJ9 B;  1DTM A;  3E5I A;  1M9P B;  1ABY A;  1A00 B;  1PMB A;  2QU0 B;  4G1V A;  1HBS A;  1HDS B;  3GQP A;  1CH5 A;  2EKU A;  2HBE B;  3ZJI A;  4VHB A;  1V4X A;  4ZVB A;  3ZOM A;  1HAC B;  1YG5 A;  2HBF B;  1Y8H A;  1YZI B;  1CG5 A;  6HBW B;  3G4Q A;  2G0Z A;  1OFJ A;  1HLM A;  3UHN A;  1YH9 A;  1A3N B;  3MBA A;  2DN3 A;  4WJG 1;  4NI1 A;  5MBA A;  4N7P B;  3GQG A;  4IRO A;  1G0A B;  1MNJ A;  2GL3 A;  1Y8I B;  1W92 A;  2MGF A;  1Y45 B;  2GNW A;  1CLS A;  4H2L B;  5JGG B;  3G4R A;  1V07 A;  3UBV A;  4L2M A;  3PI3 A;  4KMW A;  1ITH A;  4UIQ A;  1Y5J A;  3D1K B;  1Y7G A;  1SPE A;  4JAC A;  1LH7 A;  3ARJ A;  4XDI A;  1JZM A;  3LR9 A;  5KER B;  2HBE A;  1MYH A;  2VM0 A;  1MOA A;  1QXE B;  1Y5F A;  3CY5 B;  3A5G A;  5ILE A;  1GBU A;  3BOM B;  1BBB B;  1HBH A;  1G9V B;  4ODC B;  3WCT C;  2ZSN A;  3QM5 A;  1LFQ A;  2ZS1 B;  2PEG A;  2HHD A;  4LPI A;  1VWT A;  2D6C A;  4HHB A;  1S5Y B;  3QMA A;  2DN2 A;  3W4U A;  2NSR A;  1Y8K B;  2HHD B;  4ROL B;  1O1M A;  4ODC A;  1SWM A;  2LH1 A;  3QZX A;  2LHB A;  2G0V A;  2BNL A;  5F0B A;  1Y5F B;  5E29 B;  1RQA B;  5HAV A;  3ZJR A;  3HRW A;  3BA2 A;  1MTI A;  1QSI A;  1JF4 A;  2BKM A;  2ZLV B;  1MZ0 A;  1MBO A;  4OOD A;  1HAB B;  1B0B A;  1Y85 B;  1KD2 A;  1O1P A;  1Y4P B;  1XYE A;  2M6Z B;  1DO1 A;  1I3E A;  4N7N B;  1EBT A;  3D4X A;  1LH2 A;  3HXN A;  5JDO D;  1MWD A;  3WFW A;  4NXC A;  4IRO B;  1N9F A;  4NI1 B;  1O1M B;  2QMB A;  1WLA A;  1HCO A;  1A0Z A;  1UMO A;  3ZJJ A;  1YIE B;  2W72 B;  3IC0 B;  1HDB A;  5B84 A;  6HBW A;  4HRR A;  1KR7 A;  3WCV B;  2RI4 A;  2GRF A;  3LQD A;  3UHV A;  3LR7 A;  4UUR A;  1YDZ B;  1OJ6 A;  3LHB A;  4M4B A;  5EYS A;  1MDN A;  1NQP A;  1J3Z A;  5C6E A;  1YIH A;  1GBU B;  3UHI A;  1NWN A;  3PI9 A;  3CY5 A;  1SI4 B;  1BIN A;  1J3Y B;  1XCH A;  2GTL C;  2DHB B;  2HCO A;  2MGG A;  1LH5 A;  3LQD B;  2RI4 B;  1MYJ A;  2EKT A;  2G0X A;  1BZ0 A;  4HRT A;  2BMM A;  1JEB B;  102M A;  1O1J B;  3GKV A;  2BWH A;  1A0Z B;  5JGG A;  3UHQ A;  3QZZ A;  3UH3 A;  2HHB A;  1BZ6 A;  1MBI A;  4MQG B;  3NML A;  110M A;  3R5I A;  1NPG A;  3SDN A;  3GOU B;  4N7N A;  4DC8 A;  3WI8 A;  5EUI A;  2D60 A;  1NZ5 A;  5E6E A;  1DLW A;  1O1P B;  1A3N A;  1ABW B;  1S5X A;  1HAB A;  1MNO A;  5D5R A;  1LFL A;  1J52 A;  1C7D A;  1THB B;  3ZJL A;  1A9W E;  1H97 A;  2G10 A;  3EDB A;  2KSC A;  1CP0 A;  1DWT A;  4FH7 A;  1GDJ A;  1HBS B;  3DR9 A;  2ZLU B;  5E83 B;  1JPB A;  2HBD A;  3H57 A;  1ASH A;  1BVD A;  2QSS B;  3K8B A;  1DXD A;  3OO4 B;  2GKM A;  5JDO F;  3UHU A;  1Y5K A;  3AT6 B;  3S1I A;  2GNV A;  2Z6S A;  1Y83 B;  2BW9 M;  2VEB A;  1FAW A;  2JHO A;  1NEJ B;  1S0H B;  2EF2 A;  2ZFO A;  1YE0 A;  1ECD A;  1FCS A;  2ZSP A;  3A5A A;  1COH A;  3UHE A;  2GLN A;  1CH9 A;  4C44 A;  1AZI A;  2NRL A;  3WCW D;  4YU3 B;  1Y85 A;  1I3D A;  2ZS0 B;  2ZS1 C;  2DN1 A;  3WHM A;  1GLI A;  1DWS A;  4H2L A;  1MBN A;  1OUU B;  1F65 A;  2MGL A;  4XS0 B;  3ECX A;  1O1N B;  1JW8 A;  3A0G A;  1HGB B;  5IKS A;  3S66 B;  1C7B A;  1K0Y A;  4MPM A;  1XZ4 B;  3OVU C;  1YE2 A;  4NK1 A;  1N9X A;  4F6F A;  5F2A A;  1BVC A;  3G4W A;  1YVQ B;  3TLD A;  1DO4 A;  2B7H A;  2LH2 A;  2D2N B;  2D2M B;  1UT0 A;  3QQR A;  1OUT B;  3ECZ A;  1KFR A;  2QSS A;  3GQP B;  3CIU A;  1OFK A;  1BBB A;  4BJA A;  1C7B B;  1K0Y B;  1GBV A;  3S66 A;  1G0B A;  4AVE A;  1U7R A;  5CHQ A;  1QXE A;  1M9P A;  2FAM A;  4XS0 A;  2HBS B;  3GLN A;  1XXT B;  1HGC A;  1UIW A;  1SDL B;  1YHR B;  1A3O B;  1S5X B;  3EU1 B;  5CNC A;  1XZU B;  1H1X A;  1VXD A;  1UVY A;  3KUN A;  1ECN A;  1SHR B;  1A01 A;  5E6E B;  3TM3 A;  2HZ2 A;  3PEL A;  2BLH A;  2R1H A;  4MQG A;  3UHC A;  3GQG B;  4N7P A;  2QSP A;  3EOK A;  1LH3 A;  5HBI A;  1CG8 A;  1XY0 B;  1DXT A;  1MBD A;  3ONZ A;  2H8F A;  2GTL A;  3M39 A;  1XXT A;  5ILR A;  2ZFO C;  2HBF A;  1HV4 A;  3MJU B;  4QAU A;  3ZJO A;  4F6I A;  2HBG A;  1GCW A;  2EB9 A;  4F4O A;  4FC3 A;  1YDZ A;  3RGK A;  4MQH A;  1OR4 A;  1YOH A;  1DXU A;  3WCV A;  3HF4 B;  3AQ6 A;  2W31 A;  1Y4V A;  4MXL A;  1DXT B;  1MYI A;  3PT8 B;  1UC3 A;  2QLS A;  1JDO A;  1YVT B;  1GCV A;  1BZZ A;  2AUP A;  2ZFO D;  3GOU A;  4O2G A;  2R1H B;  1YEN B;  1FSX B;  3UHR A;  1BUW B;  1KD2 B;  3WR1 B;  2V1K A;  1MGN A;  2Z85 A;  5JOM A;  1Q1F A;  1A3O A;  3EU1 A;  1C40 A;  2QRW A;  1HGC B;  1NS6 B;  4YU3 A;  1QSI B;  2AV3 A;  4N8T A;  1GDL A;  4U8U B;  1Y35 A;  2G12 A;  1HHO A;  2GRH A;  3FH9 A;  2MGB A;  3GYS B;  2QLS B;  1IT3 A;  1SDK A;  1Y4R B;  3BJ2 A;  5KDQ A;  4ROL A;  3DUT B;  3AT5 B;  1SPG A;  1ABS A;  4ROM B;  2VYW A;  3IXF A;  3O89 A;  4F69 A;  2W72 A;  1YEO A;  2ZLW A;  4PQB A;  1QI8 B;  3ZJH A;  4AVD A;  1SPG B;  1MLU A;  2E2Y A;  4IT8 A;  2OH9 A;  3FH9 B;  3PI4 A;  2MBW A;  5HLQ A;  1MBS A;  4U8U C;  1BZ1 A;  3UHS A;  1YCB A;  1NS9 B;  1MLG A;  1Y0T B;  3OO5 A;  3UGY A;  2BK9 A;  5JDO E;  1DWR A;  1JL7 A;  4N7O A;  1HBA A;  1HBI A;  1LFY B;  1O1I B;  3B75 B;  3WCV D;  2O5M X;  2ZWJ A;  2Z8A A;  1O1K A;  1F63 A;  3S65 B;  1TES A;  1YOI A;  1NPF A;  3IC2 A;  1JF3 A;  1GDK A;  2D2M C;  7HBI A;  2WTG A;  3AG0 A;  1M6M A;  1UVX A;  2AA1 A;  4L7Y A;  3R0G A;  4X0L B;  1SHR A;  3UH6 A;  3PT8 A;  1FHJ A;  2ZSX A;  3BCQ B;  1YH9 B;  1YOG A;  4U8U D;  1L2K A;  2ZLT B;  1S69 A;  4HRT B;  3D1A A;  2MGA A;  3A9M A;  3UHZ A;  1CG5 B;  3LB2 A;  1O1O B;  1BAB A;  1X3K A;  3UGZ A;  3PI9 B;  2MGM A;  3WCV C;  5SW7 B;  1A6M A;  1MNK A;  3OZU A;  3PT7 A;  1RPS B;  1AJH A;  1J7Y A;  2MYC A;  4NS2 A;  1MYM A;  2C0K A;  1DTI A;  1CPW A;  1QI8 A;  1V75 A;  1MLR A;  2PGH A;  1O1O A;  1X9F B;  2D5X B;  1Y0A B;  3VAU A;  3IC0 A;  3ORD A;  1Y4Q B;  1XZ2 B;  2FRJ X;  3MOU A;  3AT5 A;  3DUT A;  1A6N A;  1FHJ B;  1A6G A;  5CN5 A;  1Y7Z B;  4X0L A;  1MLS A;  3HYU A;  1SDK B;  3HEO A;  1GJN A;  1DO3 A;  5EUI B;  3WTG A;  2SPN A;  2MYD A;  2MYA A;  1JP9 A;  1MLN A;  5AZQ A;  3S65 A;  3PI1 A;  1IBE B;  4B4Y A;  2R50 A;  1JY7 A;  4NK2 A;  1MOC A;  1PBX B;  2QFN A;  1HRM A;  3ODQ A;  1YG5 B;  4ILZ A;  5EOH A;  1IT2 A;  3BJ1 B;  4HBI A;  1LJW A;  3G53 A;  3ARL A;  1NAZ A;  2Z6N B;  2MGJ A;  3HEN A;  3WFT A;  1RQ4 A;  1YVT A;  3A59 A;  2VLZ A;  3SDH A;  1LFZ A;  1A00 A;  1MYG A;  3D17 A;  1F5P A;  1QSH A;  4O4T A;  2ZLW B;  1UFJ A;  4PQC A;  1MLL A;  1YEO B;  3ZJS A;  3W4U B;  1J40 B;  2IG3 A;  1J41 B;  3OZW A;  1MWC A;  1V5H A;  1YVQ A;  2FAL A;  2BLI A;  2MGH A;  2W6Y A;  3HHB B;  3NL7 A;  1URY A;  3V2Z A;  3WFX A;  2ZLU A;  5E83 A;  4FWX A;  1V4W B;  5EE4 C;  3UHX A;  3SZK B;  1YHU C;  2IN4 A;  2VLX A;  1HDA A;  1OR6 A;  3BJ1 A;  5KER A;  1HGA B;  3ZH0 A;  107M A;  3ODQ B;  1DM1 A;  1PBX A;  2V1G A;  1C7D B;  1THB A;  1IWH A;  3ONZ B;  5KKK A;  3WHM B;  1JY7 B;  1C40 B;  1XY0 A;  3G52 A;  1VXA A;  2MYE A;  5CN7 A;  3NFE B;  1LH6 A;  1MTJ A;  1MLK A;  1LA6 B;  1Y0W A;  1CP5 A;  1Y4G B;  1YE0 B;  3WCT A;  1DKE A;  1MLJ A;  2V1H A;  3GDJ B;  1FAW B;  3HYU B;  4G51 B;  4HSW A;  1V9Q A;  3MKB B;  1R1Y A;  1Y5K B;  3AT6 A;  1YHU D;  4H0B A;  1K1K A;  4KMV A;  1Y0A A;  1YZI A;  5D1V A;  1RTE A;  3LB3 A;  2NRM A;  2EB8 A;  1OBM A;  1LFV B;  2W6V A;  3PT7 B;  1GDI A;  1HBH B;  1GBV B;  1WVP A;  1J3Z B;  3BOM A;  3VRE A;  5HY8 A;  3UHG A;  1ABY B;  4C0N A;  1NQP B;  4M4B B;  1CH4 A;  5M3S A;  1NXF A;  3MJU A;  1CMY A;  1AJ9 A;  1AJG A;  2ZSR A;  2FRF A;  1HLB A;  2MGC A;  1DXC A;  2R80 A;  1IRC A;  1Y7G B;  1LFL B;  3BJ3 A;  1YEV B;  1R1Y B;  1XQ5 B;  2HHE A;  3VRG A;  2O5L X;  4TWU A;  2QMB B;  1YE2 B;  2O5T X;  3GDJ A;  1Y45 A;  2ZS0 D;  1UFP A;  106M A;  1Y8I A;  1T1N A;  1CH2 A;  3U3E A;  3PI2 A;  3E55 A;  1XZ5 B;  3A0G B;  1GZX B;  4FWY A;  1O1N A;  1MOD A;  3M3A A;  3NFE A;  3M38 A;  1A9W A;  1CH1 A;  2VEE A;  1GLI B;  2HHE B;  2ZT3 A;  5CN6 A;  1FLP A;  3BJ3 B;  1BZ0 B;  5CN9 A;  4M4A A;  2D5X A;  4ESA A;  3G46 A;  2G14 A;  4WJG A;  3HC9 A;  1BZ1 B;  2ZFO B;  1JZK A;  4NI0 B;  1YHU B;  1M6C A;  3QJD B;  1J7W B;  2W72 C;  3PIA B;  3WCU B;  2NSS A;  5AZR A;  1K1K B;  2B7H B;  3LB4 A;  3DHR A;  1CIO A;  2D5Z A;  5JDO C;  4ROM A;  2ZS1 A;  3O7N A;  2V1I A;  3D17 B;  112M A;  1XZ4 A;  1G09 A;  3A59 B;  1YHU A;  3AQ9 A;  1HSY A;  1LTW A;  1URV A;  1Y4G A;  1MCY A;  3D7O A;  1EBC A;  1V4U A;  5HLU A;  4N8T B;  2MB5 A;  5CN8 A;  1NIH A;  1EMY A;  1HBB B;  3WCT D;  3QJC A;  4G1B A;  2D2N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...