2PEGB

Crystal structure of trematomus bernacchii hemoglobin in a partial hemichrome state
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
146
structure length
141
Chain Sequence
VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGNAEAIIGNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ferric hemoglobins from three antarctic fish species of the suborder notothenioidei.
pubmed doi rcsb
molecule tags Oxygen storage/transport
molecule keywords Hemoglobin subunit alpha
total genus 56
structure length 141
sequence length 146
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 2pegB00
4F6JA 1SPEA 4HHBA 5EV5A 5ILEA 1J7WB 1Y4BB 1SDLA 1XZ5A 1Y8WB 2DN3A 1Y7ZA 1HV4B 2QSPB 1HABB 1IDRA 1CMYB 2D60A 3A5BA 4MQJB 1JY7B 1MBNA 1J7SB 2DN1B 1NQPB 1NEJA 2NSRA 1HLBA 2MGEA 1LFQA 1UX9A 1N9XA 1G08A 4NK2A 2G3HA 1SWMA 5E83A 1ABYA 1MTJA 1XZVB 1MBIA 2HBFA 1Y4GA 2BKMA 1DLWA 1X3KA 5EOHA 1FN3A 1Y0AB 1JP9A 1MWDA 3IC2A 1NPFA 2QMBB 1HGBB 3A59B 2O58X 4AVEA 2OH9A 3PI8B 2LH3A 4WJG1 3ONZB 2XKIA 4O1TA 2RAOB 1V75B 1OR6A 3D1KA 3ZJHA 3UHVA 3U3EA 112MA 2ZS0B 4FWXA 1G9VB 1EBCA 3D1KB 3QM7A 5CN8A 1F5OA 3E5IA 3DHTA 5KDQA 1UMOA 1BJEA 3UHSA 4DC7A 3RJNB 1U7SA 1GBVB 3VRFB 3ZJJA 1O1KB 4H0BA 1DUOA 3ORDA 2HBFB 1NWIA 1YENA 2ZLVA 4TYXA 3UHQA 5JDOC 5C6EA 4IT8A 2D5ZA 5HBIA 1F5PA 3G52A 2C0KA 4C0NA 3GKTA 1B0BA 1KD2B 2W72B 2ZLTA 1HJTA 3UHWA 2WTGA 1C7CA 2OHBA 3MJUB 1YOGA 1KR7A 1HV4A 3BJ1B 4ROMA 3PI4A 4NI0B 4N7PA 1HDSA 3HYUB 4B3WA 2D2MA 2LH6A 1CBMA 1Y2ZA 1HBSA 2HBCA 3WR1A 3PIAA 1DO7A 3ARLA 3GOUA 1A01B 4NI1A 3LR7A 4XDIA 1THBB 2DHBA 3QJBA 2VM0A 1BABB 2R4WA 1YMCA 2D2MC 2YRSA 4G1VA 3PELA 1YVTA 5CN5A 1A0UB 1GBUB 1MNJA 5HLUA 2AURA 3VREB 1UVXA 1LUEA 1WVPA 4SDHA 3MYMA 1A6NA 1X9FB 5M3SA 1EWAA 1B86A 5EUIB 3UH5A 3QM8A 3FH9B 3EU1A 4L7YA 3NG6A 5KKKA 5F2AA 1A3OA 3DHRA 3WCPB 1W92A 2XYKA 2ZSZA 2GNWA 3S66B 3GQGA 1GLIB 1MYHA 2DHBB 3QJBB 1COHA 1Y8IB 1HDBB 3D1AA 2W72C 1HACA 2D6CA 1UT0A 2Z85A 1G09A 1K0YB 1CQXA 1CG5B 3LB2A 3O89A 4H07A 1MZ0A 1BZPA 4N7PB 1A3NA 1Y5KB 2Z6NA 3BCQB 4DWUA 1JZLA 1YGFA 3K9ZA 4UURA 1YIEB 1M6CA 5MBNA 3MVCA 4OF9A 3S48C 2MYCA 3GKVB 1FSLA 1DO3A 1YGDB 1HBGA 3AQ7A 1V4WA 2ZS1A 1XZ4A 3WCTC 1HBBB 3GQRA 3OO5B 1V4WB 5HU6B 1DXVA 1YG5B 2Z6SA 3ZJOA 4M4AA 1CP5A 1FSXB 2HBEA 4G51A 3A0GA 1HBRB 5EYJA 2ZLUB 1Y0CA 3MYNA 1DLYA 4XS0B 2Z6NB 1J40B 3BCQA 1LA6A 1N9FA 1C7DB 1HBHA 4N7NA 1NZ2A 1O1MA 1QPWB 5HLXA 5EE4D 1OUTA 3AQ5A 3OO4B 2HBSB 1QXDA 1YHEA 1XZUA 1Y4QB 3S66A 1NZ5A 2D2NC 4TWVA 2BLJM 4NZIA 1YEQB 3PI8A 1DXUA 2QU0B 1XYEA 3QJEB 3QJDB 3OK5A 2MYDA 2ZFOA 1DTIA 3AT5B 1YE2A 4XS0A 1Y0CB 1YFFB 1M6MA 1SHRA 4MQIB 4FC3A 1CQ2A 2ZFOB 1XZ7B 1YVQB 1CH4A 2DC3A 1G0BA 4N7OA 1YVTB 2ZS1C 1MKOA 1HABA 5CNCA 5HY8A 1NWNA 1FDHG 2DN3B 1RSEA 2FRJX 2OHAA 1AZIA 1CBLA 1YHEB 1THBA 1GZXB 1LH5A 3HENA 3UHIA 1A01A 2LH2A 2HBCB 3WR1B 2GRFA 1D8UA 1RQ4A 1YGFB 3G4WA 1HBAA 1MLSA 5CHQA 2NSSA 5JOMA 5CN7A 1MLKA 5ILPA 3WTGA 2NX0A 3A0GB 3UHRA 2ZT1A 2HBEB 3LB1A 1Y01B 4MXLA 5MBAA 3QM6A 1LFLB 3WCTD 1MYGA 1C7BA 1QI8B 2O5OX 1YG5A 3ZJPA 1BZ0B 5CN4A 2ZFOD 2ZS1B 1YVQA 1CH1A 1JEBA 2BWHA 3DUTB 1Y0TB 3UHKA 2O5MX 1HGAA 1IOPA 4HBIA 2ZFOC 3EOKA 6HBIA 3VRFA 3M39A 1CG8B 1YIEA 3WCWB 5E29A 3WCUC 4KMVA 3P5QA 1YE2B 1N9HA 3PI1A 1GVHA 3BOMB 1Y4FB 1JL7A 109MA 4PQ6A 1IWHA 1J3YA 1MYMA 3NL7A 3HHBA 2HBDA 1ABWA 3SDNA 2VLXA 2QLSA 2HBGA 3A2GA 4F69A 4JYQA 1YEQA 1CH9A 1J52A 1JDOA 5JGGA 1GLIA 1XZ2B 1BINA 1MOCA 1A00A 1M9PB 3GOUB 1Y83B 1UIWB 1O1MB 3UH3A 2VYYA 3HHBB 1BZ1B 3KUNA 4NI0A 1OUUB 5E29B 2AUPA 3ODQA 2G0SA 2GL3A 1O1JB 4OODA 4JACA 1UFJA 2RI4A 3S1JA 3PI2A 3D17A 2QFNA 3OJ1A 2GRZA 2LH7A 1XZ4B 2ZSTA 2D5ZB 1Y45B 1L2KA 1QI8A 3PI3A 2ZLXA 2D2NA 1GBVA 4MBNA 2GNVA 1V4XA 3MBAA 1HDSB 5EQMA 5KDQB 1IRCA 1LA6B 1MLLA 3A5AA 1QXEB 1V4UA 2ZLUA 1V4XB 4G51B 1Y4RB 3UHZA 2HHBA 4F4OB 4YU3B 1HDBA 3D1AB 3AT6B 4HRRB 1Y8HB 1URYA 3AQ8A 1EBTA 5EE4C 3SZKB 3OZUA 3G4QA 1RQ3B 2MGFA 1G0BB 4H2LA 2MGMA 1OUUA 3NG6B 3UBVA 3IC2B 1G0AB 1XZ7A 5EYSA 3GQPB 1YH9A 3D17B 4YU4A 1IRDB 1OR4A 3WCWC 1H1XA 101MA 3UH6A 2GKMA 3ED9A 1MBSA 1YFFA 6HBWB 1AJGA 1Y5KA 5C6YA 2W6XA 1VXCA 1UC3A 1DWSA 1BZ1A 1NQPA 1MBOA 1J7SA 1YMAA 2FRIX 3GYSA 1DO4A 5EU2A 1HHOA 1NZ4A 3LB4A 4F6BA 1TU9A 1CH5A 3R5IA 1YIHB 3K8BA 4HRTA 1Y7CA 6HBWA 1ECNA 3MKBB 3VRGA 1FLPA 3HYUA 1GCVA 1XXTB 1Y4FA 1O1LB 1G0AA 1U7RA 1LH6A 3DR9A 3HF4B 1LFTB 1CLSB 1HBRA 1I3DA 1HLMA 1BZ0A 2ZT2A 4F68A 2G0RA 3ARJA 2WY4A 2G11A 3AT6A 2DN1A 1MDNA 4HRRA 1JF3A 5CNGA 5HU6A 4LPIA 1JF4A 1MLUA 2HZ1A 5SW7A 1LFZA 1VXGA 2VEEA 2YRSB 1V4UB 1DM1A 3BJ2A 2ZT3A 1S69A 1VRFA 2ZSRA 3WTGB 106MA 1MNIA 2D2MB 1BBBA 1VXDA 1HBAB 4ROMB 1V07A 3UI0A 1SI4B 1AJHA 3D4XB 4N7OB 3PI9B 108MA 1C7CB 3LB3A 3OGBA 4MQHA 103MA 4UZVA 7HBIA 1MLMA 2OLPA 1FAWB 4FC3B 3M38A 1J41B 3ODQB 3A59A 1CLSA 1DXTB 2D5XA 4MPMA 1DWTA 3WCTB 1YEOB 2Z8AA 3WCVC 3V2ZA 1Y4GB 1YEOA 1XZVA 3QMAA 3UHTA 1DXUB 4ROLA 3NMMB 1Y7CB 3H58A 3SZKA 2R1HA 4MXKA 1FAWA 2FRFA 4QAUA 1Y4QA 5JGGB 1YEVA 1ECAA 3G4RA 3D4XA 3UHBA 3UGZA 3PELB 2QSPA 4F6GA 1CIOA 3B75B 1XZUB 2R1HB 3G53A 1QXDB 1MODA 5AZQA 2OIFA 1Y8KA 3OO4A 5B85A 1CG8A 2O5LX 1RVWB 3GLNA 1LFVB 1Y31A 1YEUB 3LQDA 1HDAA 1YH9B 4YU4B 1MYIA 1ECDA 3ZJSA 2ZSQA 3MN0A 2R4XA 1OJ6A 2R4YA 2M6ZA 2BW9M 3ZHWA 1O1PB 3UH7A 5CHRA 2AUQA 4U8UD 1HGCB 1FSXA 1IBEA 1PBXB 4KN3A 3WFWA 2D2MD 1ECOA 2QSSA 1UVYA 4O2GA 4MQHB 3OZWA 1Y7DA 3UHEA 3GQRB 3OO5A 1O1OA 4MQKA 1MBAA 1LFTA 1O16A 1ABSA 1S61A 1LH2A 1A6MA 2ZLWA 1O1KA 1JW8A 1RVWA 3WCVB 1S6AA 2D2NB 1LH1A 1VXHA 2MBWA 3S1IA 3HC9A 1A4FB 4KMWA 2MHBA 3PT7B 2QFKA 1URVA 1Y46B 2NRLA 1S5XA 4NXCA 3TM3A 1J3ZB 1HSYA 3VAUA 107MA 1EMYA 1YE0B 1RTEA 3ECZA 1MCYA 3ZH0A 1DWRA 4M4BB 3AG0A 3NL7B 3P5QB 3PT8B 5E6EB 4FWYA 1O1JA 2O5QX 2ZT4A 2ZS0D 3D7OA 2G0ZA 1FHJB 3AT5A 1Y5JA 5F0BA 2XKGA 1FN3B 1Y0AA 1XXTA 105MA 4ESAA 3VREA 5EUIA 1FHJA 2QU0A 1YHRA 3D7OB 1GCWA 1NPGA 3ASEA 3ECLA 1RQ3A 3PT8A 5CN9A 2XKHA 4WCHD 1YIHA 1OFJA 4MU5A 2KSCA 2HHBB 4F4OA 4TWUA 2ZSNA 2EB9A 4C44A 1CH7A 2V1JA 2G10A 2DN2A 2H35A 2HBDB 1NAZA 1CH3A 1IWHB 1J3YB 2GTLD 1ITHA 1CP0A 3G4VA 1MGNA 1BBBB 2FALA 1J40A 3V2VA 1A4FA 4HHBB 2AUOA 3WCWA 1MTIA 1Y0WA 2PEGB 1HGAB 1TESA 2GTLC 1FCSA 3HEPA 2HZ3A 1VHBA 1J7YA 3HXNA 3MJUA 3TM9A 1MLJA 1DO1A 2BNLA 1Y8HA 1Y09A 2ZLTB 1PBXA 2W6WA 1C7BB 5IKSA 1JL6A 1LFLA 1IBEB 3OZVA 1RPSA 1IT2A 1R1XA 2RI4B 2HHEA 1Y4RA 4ZVBA 2AA1B 1MNKA 2W6VB 3IA3B 1MLQA 1YENB 3BA2A 2G12A 5CNBA 1GCVB 1WMUB 1C40A 3QJCB 1CG5A 1Y35A 3QJEA 5CN6A 2ZS0C 1XYEB 1LHTA 3S65B 1VXBA 1HACB 2OH8A 3K8BB 2EVKA 4HRTB 1COHB 2QRWA 3R5IB 3WCWD 4NS2A 3BJ3B 2ZSXA 1Y4VA 2ZS0A 3DHRB 3TLDA 2MGGA 3WCPA 1OUTB 3WHMB 2QLSB 1Y85B 2R4ZA 2VYZA 1C7DA 2V1GA 2V1EA 2W6VA 4HSWA 2MGHA 4WJGA 2QMBA 3ZJQA 1R1XB 4MQCA 1X46A 4M4AB 1BZZB 1QSHB 3GQPA 1ASHA 1X9FC 5AZRA 4VHBA 2ZSPA 1JY7A 1JP8A 2D60B 4MQJA 1Y0DA 5CNDA 1S0HB 4AVDA 4U8UB 2VLZA 2ZSOA 2B7HB 4N8TA 1MOBA 3AQ9A 3NFEB 1LFQB 4PNJA 2MGDA 5KERB 1YHUC 3ECXA 3MOUA 3PIAB 1QPWA 1ABWB 4N7NB 1MBDA 1GDJA 3NMLA 3BOMA 2R50A 3E4NA 1DXDA 1MYFA 1MYZA 1YHUA 4FH6A 2ZLXB 1DTMA 2ZT0A 2VEBA 4B4YA 1Y8IA 1SDKA 2HHDA 3DUTA 3GQGB 4FWZA 1JEBB 1HBBA 1Q1FA 1LFZB 1F65A 4U8UC 1YHUD 1A3OB 111MA 1Y0DB 3ARKA 1GCWB 1A6KA 2W31A 2V1HA 3GDJB 1JWNA 1A6GA 3GKVA 2EB8A 2IN4A 3MJPA 3FS4B 1K1KB 1SHRB 2E2YA 1A0ZB 1QSIB 2V1IA 3FS4A 3HF4A 3HEOA 3QZXA 2R80B 2SPOA 3ZJIA 2MGAA 3MKBA 3VRGB 1YCBA 3HRWB 1G9VA 2MYBA 3QM9A 4F6DA 1VXFA 1A0UA 1NGKA 1CH2A 1JZMA 1A00B 1M9PA 1V9QA 3UHCA 4MQGA 1T1NB 1BZ6A 2LH1A 1LTWA 2GRHA 3G46A 3UHUA 1XQ5B 3WCUB 3G4UA 5CNEA 4MQGB 1MKOB 3UHDA 3S65A 3GYSB 1YHUB 5JDOF 1WMUA 2EKTA 1S5YA 1V5HA 1YCAA 4NK1A 2PGHA 5E83B 1MWCA 4MQIA 1MTKA 4MQKB 2H8DA 5EETA 2ZSYA 3MJPB 2HHEB 3EOKB 3SDHA 3GK9A 2FAMA 3QJDA 2MGCA 3GDJA 1A9WA 1KD2A 4H2LB 4N8TB 1NIHB 3ZJMA 3E5OA 4U8UA 1JZKA 3K3UA 1BABA 1HBIA 3QM5A 1O1IA 2H8FA 3A5GA 2MGIA 1Y4BA 1J7WA 1NZ3A 2G0VA 1LFVA 2MYAA 1LJWB 1Y22A 1HBSB 2O5BX 2MGJA 1NS9B 1LFYA 1N9IA 1VWTA 4PQBA 1SPGB 1RTXA 5ILMA 3BJ1A 3WFUA 1K0YA 3UHNA 1HCOB 1Y5FA 2VHBA 3IC0B 1MLHA 1JP6A 3VHBA 2HZ2A 2MGLA 1YEVB 3CY5A 1YOIA 3AQ6A 2W72A 2RAOA 4IROB 3QZZA 2MGKA 5HY8B 3EDAA 2V1FA 3M3BA 4DC8A 2ZFBB 3UHHA 3EU1B 4L7YB 1YGDA 3UHGA 3QJCA 5ILRA 4MBAA 2R80A 3LHBA 1KFRA 1DXTA 2DXMB 1K1KA 1MLNA 1FDHA 2AV0A 1H97A 4HSXA 2GLNA 5CNFA 3OVUC 3KMFA 2G14A 1NS6B 3IXFA 1Y83A 3WHMA 2IG3A 1CMYA 1Y4VB 1VREA 2Z6TA 3W4UA 1J7YB 2O5SX 1MNHA 1XZ2A 3CY5B 1SDKB 1Y46A 4O4ZA 2HBSA 3ONZA 1LH3A 2MHBB 3PT7A 1Z8UB 1Y0WB 2CMMA 1AJ9B 3EDBA 1HCOA 2JHOA 1HBHB 3RJ6A 1YOHA 4PQCA 1LFYB 3ZJRA 2AV3A 1G08B 2VLYA 4G1BA 2LH5A 1Y7DB 1YDZA 1Y09B 3ZOMA 1Y0TA 2MGBA 1O1IB 2H8FB 1YDZB 1F63A 2FRKX 1DKEA 1O1PA 1S0HA 4F6IA 2BK9A 5HLQA 1O1LA 1BZRA 2EF2A 1BZZA 1QSHA 3LQDB 5B84A 2PEGA 2O5TX 3UHYA 2W6YA 4L2MA 1UFPA 1A3NB 4BJAA 1BVDA 4ODCA 1MLGA 4UIQA 4KJTA 1XCHA 3H57A 1Y85A 1Y4PB 1G09B 2BLIA 1HHOB 1XY0B 4NXAA 3BJ3A 4X0LB 1GZXA 1YE0A 2LHBA 1DXCA 1CIKA 3NFEA 1XQ5A 3WCUA 1J3ZA 5D5RA 5D1VA 1BIJB 1CO9A 2B7HA 3W4UB 1LHSA 3CIUB 1T1NA 5C6EB 3NMMA 1CPWA 2ZLVB 4MAXA 1MOHA 2EKUA 1Y35B 3R0GA 3FH9A 3G4YA 5AB8A 2VYWA 1UX8A 1CO8A 1Y5JB 3WCUD 3WCTA 1B86B 1VXEA 1A0ZA 1QSIA 1YZIB 2DXMA 3ZJLA 4GZGA 3CIUA 2G0XA 4DWTA 3WCVD 1BIJA 1JPBA 1NEJB 2MB5A 4M4BA 2ZFBA 1GDLA 1PMBA 5HAVA 2ZSSA 3PI9A 3HXNB 1RQAB 4ZVAA 1QXEA 1Y7ZB 1DUKA 1V75A 2BLHA 2HHDB 1Y7GB 1NS9A 1YEUA 4NI1B 1BUWB 2GTLB 1WLAA 1HGBA 1Y2ZB 1MLRA 3ZOLA 2ZLWB 2EVPA 3RGKA 1C40B 1Y7GA 1MYTA 1SPGA 1VXAA 2VRYA 1IT3A 1Y45A 2DN2B 2H35B 1Y22B 1O1NB 1O1OB 110MA 5SW7B 1GDKA 1LJWA 1NIHA 3UBCA 3UGYA 1OFKA 5JDOD 3KUOA 5KERA 2MYEA 3O7NA 5JDOE 1HGCA 1DXVB 2ZS1D 4F6FA 3M3AA 3A9MA 1MWBA 2H8DB 4ROLB 2M6ZB 2SPMA 1YHRB 1Y8WA 2NRMA 2SPNA 2WTHA 1SDLB 1XZ5B 1S5YB 3QQRA 4ESAB 1HDAB 2GDMA 1Y31B 4MQCB 1EW6A 2ZWJA 1UIWA 2BMMA 2D5XB 1AJ9A 1J41A 1BUWA 2GTLA 5E6EA 1Y8KB 2PGHB 1MBCA 1R1YB 2HCOB 3DHTB 1MLOA 3B75A 1I3EA 1RQAA 1MLFA 1MNOA 1LH7A 1SI4A 4ILZA 1NS6A 1GJNA 2D2ND 1BVCA 4ODCB 4O4TA 1R1YA 1S56A 102MA 1X9FD 3ZJNA 1YZIA 3WCVA 1MOAA 3HRWA 1OBMA 1NXFA 1IRDA 1A9WE 3BJ2B 1ABYB 1X9FA 1DKEB 104MA 1YMBA 2GKNA 3WFXA 2AA1A 3KMFC 1J3FA 1MYJA 1RPSB 4IROA 2SPLA 2QSSB 2V1KA 3WFTA 3QQQA 4X0LA 4YU3A 3E55A 1HRMA 1GBUA 3WI8A 1XY0A 1Y5FB 3IC0A 1O1NA 1Y4PA 4O35A 3LR9A 4FH7A 3UHXA 1GDIA 1VWTB 2HCOA 1S5XB 5CMVA 1RQ4B
chains in the Genus database with same CATH superfamily
4F6JA 1SPEA 4HHBA 5EV5A 5ILEA 1J7WB 1Y4BB 1SDLA 1XZ5A 1Y8WB 2DN3A 1Y7ZA 1HV4B 4LMSB 2QSPB 1HABB 1IDRA 1CMYB 2D60A 3A5BA 4MQJB 1JY7B 1MBNA 1J7SB 2DN1B 1NQPB 1NEJA 2NSRA 1HLBA 2MGEA 1LFQA 1UX9A 1N9XA 1G08A 4NK2A 4H0MA 2G3HA 4ERVA 1SWMA 5E83A 1ABYA 1MTJA 1XZVB 1MBIA 2HBFA 1Y4GA 2BKMA 1DLWA 1X3KA 5EOHA 1FN3A 1Y0AB 1JP9A 1MWDA 3IC2A 1NPFA 2QMBB 1HGBB 3A59B 2O58X 4AVEA 2OH9A 3PI8B 4HH1A 2LH3A 4WJG1 3ONZB 2XKIA 4O1TA 5AQDA 2RAOB 4A8MP 1V75B 1OR6A 3D1KA 3ZJHA 3UHVA 3O2CB 3U3EA 112MA 2ZS0B 4FWXA 1G9VB 1EBCA 3D1KB 2JLGA 3QM7A 5CN8A 4PO5B 1F5OA 3E5IA 3DHTA 5KDQA 1UMOA 1BJEA 3UHSA 4DC7A 3RJNB 1U7SA 1GBVB 3VRFB 3ZJJA 1O1KB 4H0BA 1DUOA 3ORDA 2HBFB 1NWIA 1YENA 2ZLVA 4TYXA 3UHQA 5JDOC 5C6EA 4IT8A 2D5ZA 5HBIA 1F5PA 3G52A 2C0KA 4C0NA 3GKTA 1B0BA 1KD2B 2W72B 2ZLTA 1HJTA 3UHWA 2WTGA 1C7CA 2OHBA 3MJUB 1YOGA 1KR7A 1HV4A 3BJ1B 4ROMA 2VJTA 3PI4A 4NI0B 4N7PA 1HDSA 3HYUB 4B3WA 2D2MA 2LH6A 1CBMA 1Y2ZA 1HBSA 2HBCA 3WR1A 2VJRB 3PIAA 1DO7A 3ARLA 3GOUA 1A01B 4NI1A 1HHSA 3LR7A 1UVMA 4XDIA 1THBB 2DHBA 3QJBA 1LIAA 2VM0A 1BABB 2R4WA 1YMCA 2D2MC 2YRSA 4G1VA 3PELA 1YVTA 5CN5A 1ON7A 1A0UB 1GBUB 1MNJA 5HLUA 2AURA 3VREB 1UVXA 1LUEA 1WVPA 4SDHA 3MYMA 1A6NA 1X9FB 5M3SA 1EWAA 1B86A 5EUIB 3UH5A 3QM8A 3FH9B 5FVBA 3EU1A 4L7YA 2UUND 3NG6A 5KKKA 5F2AA 1A3OA 3DHRA 3WCPB 1W92A 2XYKA 1XG0C 2ZSZA 2GNWA 3S66B 3GQGA 1GLIB 1MYHA 2DHBB 3QJBB 1COHA 1Y8IB 1HDBB 3D1AA 2W72C 1HACA 4Q70A 2D6CA 1UT0A 2Z85A 1G09A 1K0YB 1CQXA 1CG5B 3LB2A 3O89A 4H07A 3V57B 1KN1A 1MZ0A 1BZPA 4N7PB 1A3NA 1Y5KB 2WCQA 2Z6NA 3BCQB 1JZLA 1YGFA 4DWUA 3K9ZA 4UURA 1YIEB 2UULA 1JBOB 1M6CA 5MBNA 3MVCA 4OF9A 3S48C 1CPCA 2MYCA 3GKVB 1FSLA 1DO3A 1YGDB 1HBGA 3AQ7A 1V4WA 2ZS1A 1XZ4A 3WCTC 1HBBB 3GQRA 3OO5B 3PMCA 1V4WB 5HU6B 1DXVA 1YG5B 2VJHA 2Z6SA 3KVSA 3ZJOA 4M4AA 1CP5A 1FSXB 2HBEA 4G51A 3A0GA 1HBRB 5EYJA 2ZLUB 1Y0CA 3MYNA 2UUMB 1DLYA 4XS0B 2Z6NB 1J40B 3BCQA 1LA6A 2WCRA 1N9FA 1C7DB 3V57A 1HBHA 4N7NA 4A8OA 1NZ2A 1O1MA 1QPWB 5HLXA 5EE4D 1OUTA 3AQ5A 3OO4B 2HBSB 1QXDA 1YHEA 1XZUA 1Y4QB 3S66A 1NZ5A 2D2NC 4TWVA 2BLJM 4NZIA 1YEQB 3PI8A 1DXUA 2QU0B 4BS9A 1XYEA 4BJUA 3QJEB 1DDTA 3QJDB 3OK5A 4ZIZA 2MYDA 2ZFOA 1DTIA 3AT5B 1YE2A 4XS0A 1Y0CB 1YFFB 1HHTP 1M6MA 5FVBM 1SHRA 4MQIB 2UULC 4FC3A 1CQ2A 2ZFOB 5B13A 1XZ7B 2UUMX 4N6SB 1YVQB 1CH4A 2DC3A 1G0BA 1F99A 4N7OA 1YVTB 2ZS1C 1MKOA 1HABA 5CNCA 5HY8A 1NWNA 4ETUA 1FDHG 2DN3B 1RSEA 2FRJX 2OHAA 1AZIA 1CBLA 1YHEB 1THBA 1GZXB 1LH5A 3HENA 3UHIA 4ERTA 1B33B 1A01A 2LH2A 2HBCB 3WR1B 2GRFA 1D8UA 1RQ4A 1YGFB 3G4WA 1HBAA 1MLSA 5CHQA 2NSSA 2VJTB 5JOMA 5CN7A 1MLKA 5ILPA 3WTGA 2NX0A 3A0GB 3UHRA 2ZT1A 1SGKA 2HBEB 3LB1A 1HA7A 1Y01B 4MXLA 5MBAA 3QM6A 1LFLB 3WCTD 1MYGA 1C7BA 1QI8B 2O5OX 1YG5A 3ZJPA 1BZ0B 4A8KA 5CN4A 2ZFOD 2ZS1B 1YVQA 1CH1A 1JEBA 2BWHA 3DUTB 1Y0TB 3UHKA 1HI8A 2O5MX 1HGAA 1IOPA 4HBIA 2ZFOC 3EOKA 6HBIA 3VRFA 3M39A 1CG8B 1YIEA 3WCWB 5E29A 3WCUC 4KMVA 1F0LA 3P5QA 1YE2B 1N9HA 3PI1A 1GVHA 3BOMB 1Y4FB 1JL7A 109MA 4PQ6A 1IWHA 1J3YA 1MYMA 3NL7A 3HHBA 4RMPB 2HBDA 1ABWA 3SDNA 2VLXA 2QLSA 2HBGA 3A2GA 3PMDA 4F69A 4JYQA 1YEQA 1CH9A 1J52A 1JDOA 5JGGA 1GLIA 1XZ2B 1BINA 1MOCA 1A00A 1M9PB 3GOUB 1Y83B 2VJRA 1UIWB 1O1MB 3UH3A 2VYYA 3HHBB 1BZ1B 3KUNA 4NI0A 1OUUB 5E29B 1EYXA 2AUPA 3ODQA 2G0SA 2GL3A 1O1JB 4OODA 4JACA 4GY3A 1UFJA 2RI4A 3S1JA 2X49A 3PI2A 3D17A 2QFNA 2UUNB 3OJ1A 2GRZA 2LH7A 1XZ4B 4A8WA 2ZSTA 3ZTAA 2D5ZB 1HI1A 1Y45B 2UULH 1L2KA 1QI8A 3PI3A 2ZLXA 2D2NA 1GBVA 4MBNA 2GNVA 1V4XA 3MBAA 1HDSB 5EQMA 5KDQB 1IRCA 5AQDM 1LA6B 1MLLA 3A5AA 1QXEB 1V4UA 2ZLUA 1V4XB 4G51B 1Y4RB 3V58B 3UHZA 2HHBA 4F4OB 4YU3B 1HDBA 3D1AB 3AT6B 4HRRB 1Y8HB 1URYA 3AQ8A 1RH1A 1EBTA 5EE4C 3SZKB 4AE0A 3OZUA 3G4QA 1RQ3B 2MGFA 1G0BB 1EYXB 4H2LA 2MGMA 1OUUA 3NG6B 3UBVA 3IC2B 4Z8KB 2DKDA 1G0AB 1XZ7A 5EYSA 3GQPB 1YH9A 3D17B 4YU4A 1IRDB 3L0FA 1OR4A 3WCWC 1H1XA 101MA 3UH6A 2GKMA 3ED9A 1MBSA 1YFFA 6HBWB 1AJGA 1Y5KA 5C6YA 2W6XA 1VXCA 1UC3A 1DWSA 1BZ1A 1COLA 1NQPA 1MBOA 1J7SA 1YMAA 2FRIX 3GYSA 1DO4A 5EU2A 1HHOA 1NZ4A 3LB4A 4F6BA 1TU9A 1CH5A 3R5IA 1YIHB 3K8BA 4HRTA 1Y7CA 6HBWA 1ECNA 3MKBB 3VRGA 1FLPA 3HYUA 1GCVA 1XXTB 1Y4FA 1O1LB 1G0AA 1U7RA 1LH6A 3DR9A 3HF4B 1UVLA 1LFTB 1CLSB 1HBRA 1I3DA 1HLMA 1BZ0A 2ZT2A 4F68A 2G0RA 3ARJA 2WY4A 2G11A 3AT6A 2DN1A 1MDNA 4HRRA 1B8DB 1JF3A 1A87A 5CNGA 5HU6A 4LPIA 1HI0P 1JF4A 1MLUA 2HZ1A 5SW7A 1LFZA 1VXGA 2VEEA 2YRSB 1V4UB 1DM1A 3BJ2A 2ZT3A 4YJJA 1S69A 1VRFA 2ZSRA 3WTGB 106MA 1MNIA 2D2MB 1BBBA 1VXDA 1HBAB 4ROMB 1V07A 3UI0A 1SI4B 1AJHA 3D4XB 4N7OB 3PI9B 108MA 1C7CB 1B33A 1F99B 3LB3A 3OGBA 4MQHA 2VMLB 4N6SA 103MA 4UZVA 7HBIA 1MLMA 2OLPA 1FAWB 4FC3B 3M38A 1J41B 3ODQB 3A59A 1CLSA 1DXTB 2D5XA 2V8AA 1XF6C 4MPMA 1DWTA 3WCTB 1YEOB 2Z8AA 4B02A 3WCVC 3V2ZA 1Y4GB 1YEOA 4Z8KA 1XZVA 3QMAA 3UHTA 1DXUB 4ROLA 1GH0B 3NMMB 4H0MB 1Y7CB 3H58A 3SZKA 4ETVA 2R1HA 4MXKA 1FAWA 2FRFA 4QAUA 4ZIZB 1Y4QA 5JGGB 1YEVA 1ECAA 3G4RA 3V58A 4LM6B 3O2CA 3D4XA 3UHBA 3UGZA 3PELB 2QSPA 4F6GA 1CIOA 3B75B 1XZUB 2R1HB 4A8SA 3G53A 1QXDB 1MODA 5AZQA 2OIFA 1Y8KA 3OO4A 5B85A 1CG8A 2O5LX 1RVWB 3GLNA 3GIOA 1LFVB 1Y31A 1YEUB 3LQDA 1HDAA 1YH9B 4YU4B 1MYIA 1ECDA 3ZJSA 2ZSQA 3MN0A 2R4XA 1OJ6A 2R4YA 2M6ZA 2BW9M 3ZHWA 1O1PB 3UH7A 5CHRA 2JL9A 2AUQA 4U8UD 1HGCB 1FSXA 1IBEA 2UUNA 1PBXB 4KN3A 3WFWA 2D2MD 1ECOA 2QSSA 2VJHB 1UVYA 4O2GA 4MQHB 3OZWA 1PHNB 1Y7DA 2DKCA 3UHEA 3GQRB 3OO5A 1O1OA 4MQKA 1MBAA 1LFTA 1O16A 1ABSA 1UVNA 1S61A 1LH2A 1A6MA 2ZLWA 1O1KA 1JW8A 1RVWA 3WCVB 1S6AA 4F0TB 2D2NB 1LH1A 1VXHA 2MBWA 3S1IA 3HC9A 1A4FB 4KMWA 2MHBA 3PT7B 2QFKA 1URVA 1Y46B 2NRLA 1S5XA 4NXCA 3TM3A 1J3ZB 1HSYA 3VAUA 107MA 1EMYA 1YE0B 2C7JB 1RTEA 1I7YB 3ECZA 1MCYA 4Q70B 3ZH0A 1DWRA 4M4BB 3AG0A 3NL7B 3P5QB 3PT8B 5E6EB 4FWYA 1O1JA 2O5QX 2ZT4A 2ZS0D 3D7OA 2G0ZA 4LMXB 1FHJB 3AT5A 1Y5JA 5F0BA 2XKGA 1FN3B 1Y0AA 1XXTA 105MA 4ESAA 3VREA 5EUIA 1FHJA 2QU0A 1YHRA 3D7OB 1GCWA 1NPGA 3ASEA 1UVKA 3ECLA 1RQ3A 3PT8A 5CN9A 2XKHA 4WCHD 1YIHA 1OFJA 4MU5A 2KSCA 2HHBB 4F4OA 4TWUA 2ZSNA 2EB9A 4C44A 1CH7A 2V1JA 2G10A 2DN2A 2H35A 2HBDB 1NAZA 1CH3A 1IWHB 1J3YB 2GTLD 1ITHA 1CP0A 1LIAB 1QGWC 3G4VA 1MGNA 1BBBB 2FALA 1J40A 3V2VA 1A4FA 4HHBB 2AUOA 3WCWA 1MTIA 4F0TA 4YJJB 1Y0WA 2PEGB 1HGAB 1TESA 2GTLC 1FCSA 3HEPA 2HZ3A 2C7KA 1VHBA 1J7YA 3HXNA 3MJUA 3TM9A 1MLJA 1DO1A 3RQRA 2BNLA 1B8DA 1Y8HA 1Y09A 2ZLTB 1PBXA 2W6WA 1C7BB 5IKSA 1JL6A 1LFLA 1IBEB 3OZVA 1RPSA 1IT2A 1R1XA 2RI4B 2HHEA 1Y4RA 4ZVBA 2AA1B 1MNKA 2W6VB 3IA3B 1MLQA 1YENB 3BA2A 2G12A 5CNBA 4L1EB 1GCVB 1WMUB 1C40A 3QJCB 1CG5A 1Y35A 3QJEA 5CN6A 2ZS0C 1XYEB 1LHTA 3S65B 1VXBA 1HACB 2OH8A 4F0UA 3K8BB 2EVKA 4HRTB 1COHB 2QRWA 3R5IB 3WCWD 4NS2A 4ESUA 3BJ3B 4F0UB 2ZSXA 1Y4VA 2ZS0A 3DHRB 3TLDA 2MGGA 3WCPA 1OUTB 3WHMB 2QLSB 1Y85B 2R4ZA 2VYZA 1C7DA 2V1GA 2V1EA 1WACA 2W6VA 4HSWA 4A8YA 2MGHA 4WJGA 2QMBA 3ZJQA 1R1XB 4MQCA 1X46A 4M4AB 1BZZB 1QSHB 3GQPA 3KVSB 1ASHA 1X9FC 5AZRA 4VHBA 2ZSPA 1JY7A 1JP8A 2D60B 4MQJA 1Y0DA 5CNDA 1S0HB 4AVDA 4U8UB 2VLZA 1UVJA 4HH0A 2ZSOA 2B7HB 4N8TA 1MOBA 3AQ9A 3NFEB 1LFQB 4PNJA 2MGDA 5KERB 3VNCA 1YHUC 1HA7B 3ECXA 3MOUA 3PIAB 1KTPB 1QPWA 1ABWB 3NUHB 4N7NB 1MBDA 1GDJA 3NMLA 4GXEA 3BOMA 1KN1B 2R50A 3E4NA 1DXDA 1MYFA 1MYZA 1YHUA 4FH6A 2ZLXB 1DTMA 2ZT0A 2VEBA 4B4YA 1Y8IA 1SDKA 2HHDA 3DUTA 3GQGB 4FWZA 1JEBB 3BRPA 1HBBA 1Q1FA 1LFZB 1F65A 4U8UC 1YHUD 1A3OB 111MA 1Y0DB 3ARKA 1GCWB 1A6KA 2W31A 2V1HA 3GDJB 1JWNA 1XDTT 1A6GA 3GKVA 2EB8A 2IN4A 3MJPA 3FS4B 1K1KB 1SHRB 2E2YA 1A0ZB 1QSIB 2V1IA 3FS4A 3HF4A 3HEOA 3QZXA 2R80B 2SPOA 3ZJIA 2MGAA 3MKBA 3VRGB 1YCBA 3HRWB 1G9VA 2MYBA 3QM9A 4F6DA 1VXFA 1A0UA 1NGKA 1CH2A 1JZMA 1A00B 1M9PA 1V9QA 3UHCA 4MQGA 1T1NB 1BZ6A 2LH1A 1LTWA 2BV8B 2GRHA 3G46A 3UHUA 1XQ5B 3WCUB 3G4UA 5CNEA 3DBJB 4MQGB 1MKOB 4A8QA 3UHDA 3S65A 3GYSB 1YHUB 5JDOF 1TOXA 1WMUA 2EKTA 1S5YA 1V5HA 1YCAA 4NK1A 2PGHA 5E83B 2UUMA 1MWCA 4MQIA 1MTKA 4MQKB 2H8DA 5EETA 2ZSYA 3MJPB 2HHEB 3EOKB 3SDHA 3L0FB 3GK9A 2FAMA 3QJDA 2MGCA 3GDJA 1A9WA 2J96A 1KD2A 4H2LB 4N8TB 1NIHB 3ZJMA 3E5OA 4U8UA 3FEWX 1JZKA 3LQ9A 3K3UA 1BABA 1HBIA 3QM5A 1O1IA 2H8FA 3A5GA 2MGIA 1CIIA 1Y4BA 1J7WA 1NZ3A 2G0VA 1LFVA 2MYAA 1CPCB 1LJWB 1Y22A 1HBSB 2O5BX 2MGJA 1NS9B 4GXEB 1LFYA 1N9IA 1VWTA 4PQBA 1SPGB 1RTXA 5ILMA 3BJ1A 1NY9A 3WFUA 1K0YA 3UHNA 1HCOB 1KTPA 1Y5FA 2VHBA 3GUQA 3IC0B 1MLHA 1JP6A 3VHBA 2HZ2A 2MGLA 3DBJA 1YEVB 1ALLA 3CY5A 1YOIA 3AQ6A 2W72A 2RAOA 4IROB 3QZZA 2MGKA 5HY8B 3EDAA 2C7LB 2V1FA 3M3BA 4DC8A 2ZFBB 3UHHA 3EU1B 4L7YB 5B13G 1YGDA 3UHGA 3QJCA 5ILRA 4L1EA 4MBAA 2R80A 3LHBA 1KFRA 2UULB 1DXTA 2DXMB 1K1KA 1MLNA 1FDHA 2AV0A 1H97A 4HSXA 2GLNA 3O18A 5CNFA 3OVUC 3KMFA 2G14A 2VMLA 1NS6B 3IXFA 1Y83A 3WHMA 2IG3A 1CMYA 2I88A 1Y4VB 1VREA 2Z6TA 3BRPB 3W4UA 2C7JA 1J7YB 2O5SX 1MNHA 1XZ2A 3CY5B 1SDKB 1Y46A 4O4ZA 2HBSA 3ONZA 1LH3A 2MHBB 3PT7A 1Z8UB 1Y0WB 2CMMA 1AJ9B 3EDBA 1HCOA 2JHOA 1HBHB 3RJ6A 1YOHA 4PQCA 1LFYB 4XXIA 3ZJRA 2AV3A 1G08B 2VLYA 4G1BA 2LH5A 2DKAA 1Y7DB 4AE1A 1YDZA 1Y09B 3ZOMA 1Y0TA 4XXKA 2MGBA 1O1IB 2H8FB 1YDZB 1F63A 2FRKX 1DKEA 1O1PA 1S0HA 4F6IA 2BK9A 5HLQA 1O1LA 1BZRA 2EF2A 1BZZA 1QSHA 3LQDB 5B84A 2PEGA 2O5TX 3UHYA 2W6YA 4L2MA 1UFPA 1A3NB 4BJAA 3MWNA 1BVDA 4ODCA 1MLGA 4UIQA 4KJTA 1XCHA 3H57A 1Y85A 1Y4PB 1G09B 2BLIA 1HHOB 1XY0B 4NXAA 1I7YA 3BJ3A 4X0LB 1GZXA 1YE0A 2LHBA 1DXCA 1CIKA 1UVIA 3NFEA 1XQ5A 3WCUA 1J3ZA 2BV8A 5D5RA 5D1VA 1BIJB 1CO9A 2B7HA 3W4UB 1LHSA 3CIUB 1T1NA 5C6EB 1GH0A 3NMMA 1CPWA 2ZLVB 4MAXA 1MOHA 3O18B 2EKUA 1Y35B 3R0GA 3FH9A 3G4YA 5AB8A 2VYWA 1UX8A 1CO8A 1Y5JB 3WCUD 3WCTA 1B86B 1VXEA 1A0ZA 1QSIA 1YZIB 2DXMA 3ZJLA 2C7LA 4GZGA 3CIUA 2G0XA 4DWTA 1PHNA 3WCVD 1BIJA 1JPBA 4PO5A 1NEJB 2MB5A 4M4BA 2ZFBA 1GDLA 1PMBA 5HAVA 1ON7B 2ZSSA 3PI9A 3HXNB 1RQAB 4ZVAA 1QXEA 1Y7ZB 1DUKA 1V75A 2BLHA 2HHDB 1Y7GB 1NS9A 1YEUA 1MDTA 4NI1B 1BUWB 2GTLB 1WLAA 1HGBA 1Y2ZB 1MLRA 3ZOLA 2ZLWB 2EVPA 3RGKA 1C40B 1Y7GA 1MYTA 1SPGA 1VXAA 2VRYA 1IT3A 1Y45A 2DN2B 2H35B 1Y22B 1O1NB 1O1OB 110MA 5SW7B 1GDKA 1LJWA 1NIHA 3UBCA 3UGYA 1OFKA 5JDOD 3KUOA 5KERA 2MYEA 3O7NA 5JDOE 1HGCA 1DXVB 2ZS1D 4GY3B 4F6FA 3M3AA 3A9MA 1MWBA 2H8DB 4ROLB 2M6ZB 2SPMA 1YHRB 2C7KB 1Y8WA 2NRMA 2SPNA 2WTHA 1SDLB 1XZ5B 1S5YB 3QQRA 4ESAB 1HDAB 2GDMA 1Y31B 2UULD 4MQCB 1EW6A 2ZWJA 1UIWA 2BMMA 1JBOA 2D5XB 2V8AB 1AJ9A 1J41A 1BUWA 2GTLA 5E6EA 1Y8KB 4A8FA 2PGHB 1MBCA 1R1YB 2HCOB 3DHTB 1MLOA 3B75A 4ETTA 1I3EA 1RQAA 1MLFA 2JLFA 1MNOA 1LH7A 1SI4A 4ILZA 1NS6A 1GJNA 2D2ND 1BVCA 4RMPA 4ODCB 4O4TA 1R1YA 1S56A 102MA 1X9FD 3ZJNA 1YZIA 3WCVA 2X4AA 1MOAA 3HRWA 1OBMA 1NXFA 1IRDA 1A9WE 3BJ2B 1ABYB 1X9FA 1DKEB 104MA 1YMBA 2GKNA 3WFXA 2AA1A 3KMFC 4TMAB 1J3FA 1MYJA 1RPSB 4IROA 2SPLA 2QSSB 2V1KA 3WFTA 1ALLB 3QQQA 2YSKA 4X0LA 4YU3A 3E55A 1HRMA 1GBUA 3WI8A 1XY0A 1Y5FB 3IC0A 1O1NA 1Y4PA 4O35A 3LR9A 4FH7A 3UHXA 1GDIA 1VWTB 2HCOA 1S5XB 5CMVA 1RQ4B
chains in the Genus database with same CATH topology
4F6JA 1SPEA 4HHBA 5EV5A 5ILEA 1J7WB 1Y4BB 1SDLA 1XZ5A 1Y8WB 2DN3A 1Y7ZA 1HV4B 2QSPB 1HABB 1IDRA 1CMYB 2D60A 3A5BA 4MQJB 1JY7B 1MBNA 1J7SB 2DN1B 1NQPB 1NEJA 2NSRA 1HLBA 2MGEA 1LFQA 1UX9A 1N9XA 1G08A 4NK2A 2G3HA 1SWMA 5E83A 1ABYA 1MTJA 1XZVB 1MBIA 2HBFA 1Y4GA 2BKMA 1DLWA 1X3KA 5EOHA 1FN3A 1Y0AB 1JP9A 1MWDA 3IC2A 1NPFA 2QMBB 1HGBB 3A59B 2O58X 4AVEA 2OH9A 3PI8B 2LH3A 4WJG1 3ONZB 2XKIA 4O1TA 2RAOB 1V75B 1OR6A 3D1KA 3ZJHA 3UHVA 3U3EA 112MA 2ZS0B 4FWXA 1G9VB 1EBCA 3D1KB 3QM7A 5CN8A 1F5OA 3E5IA 3DHTA 5KDQA 1UMOA 1BJEA 3UHSA 4DC7A 3RJNB 1U7SA 1GBVB 3VRFB 3ZJJA 1O1KB 4H0BA 1DUOA 3ORDA 2HBFB 1NWIA 1YENA 2ZLVA 4TYXA 3UHQA 5JDOC 5C6EA 4IT8A 2D5ZA 5HBIA 1F5PA 3G52A 2C0KA 4C0NA 3GKTA 1B0BA 1KD2B 2W72B 2ZLTA 1HJTA 3UHWA 2WTGA 1C7CA 2OHBA 3MJUB 1YOGA 1KR7A 1HV4A 3BJ1B 4ROMA 3PI4A 4NI0B 4N7PA 1HDSA 3HYUB 4B3WA 2D2MA 2LH6A 1CBMA 1Y2ZA 1HBSA 2HBCA 3WR1A 3PIAA 1DO7A 3ARLA 3GOUA 1A01B 4NI1A 3LR7A 4XDIA 1THBB 2DHBA 3QJBA 2VM0A 1BABB 2R4WA 1YMCA 2D2MC 2YRSA 4G1VA 3PELA 1YVTA 5CN5A 1A0UB 1GBUB 1MNJA 5HLUA 2AURA 3VREB 1UVXA 1LUEA 1WVPA 4SDHA 3MYMA 1A6NA 1X9FB 5M3SA 1EWAA 1B86A 5EUIB 3UH5A 3QM8A 3FH9B 3EU1A 4L7YA 3NG6A 5KKKA 5F2AA 1A3OA 3DHRA 3WCPB 1W92A 2XYKA 2ZSZA 2GNWA 3S66B 3GQGA 1GLIB 1MYHA 2DHBB 3QJBB 1COHA 1Y8IB 1HDBB 3D1AA 2W72C 1HACA 2D6CA 1UT0A 2Z85A 1G09A 1K0YB 1CQXA 1CG5B 3LB2A 3O89A 4H07A 1MZ0A 1BZPA 4N7PB 1A3NA 1Y5KB 2Z6NA 3BCQB 4DWUA 1JZLA 1YGFA 3K9ZA 4UURA 1YIEB 1M6CA 5MBNA 3MVCA 4OF9A 3S48C 2MYCA 3GKVB 1FSLA 1DO3A 1YGDB 1HBGA 3AQ7A 1V4WA 2ZS1A 1XZ4A 3WCTC 1HBBB 3GQRA 3OO5B 1V4WB 5HU6B 1DXVA 1YG5B 2Z6SA 3ZJOA 4M4AA 1CP5A 1FSXB 2HBEA 4G51A 3A0GA 1HBRB 5EYJA 2ZLUB 1Y0CA 3MYNA 1DLYA 4XS0B 2Z6NB 1J40B 3BCQA 1LA6A 1N9FA 1C7DB 1HBHA 4N7NA 1NZ2A 1O1MA 1QPWB 5HLXA 5EE4D 1OUTA 3AQ5A 3OO4B 2HBSB 1QXDA 1YHEA 1XZUA 1Y4QB 3S66A 1NZ5A 2D2NC 4TWVA 2BLJM 4NZIA 1YEQB 3PI8A 1DXUA 2QU0B 1XYEA 3QJEB 3QJDB 3OK5A 2MYDA 2ZFOA 1DTIA 3AT5B 1YE2A 4XS0A 1Y0CB 1YFFB 1M6MA 1SHRA 4MQIB 4FC3A 1CQ2A 2ZFOB 1XZ7B 1YVQB 1CH4A 2DC3A 1G0BA 4N7OA 1YVTB 2ZS1C 1MKOA 1HABA 5CNCA 5HY8A 1NWNA 1FDHG 2DN3B 1RSEA 2FRJX 2OHAA 1AZIA 1CBLA 1YHEB 1THBA 1GZXB 1LH5A 3HENA 3UHIA 1A01A 2LH2A 2HBCB 3WR1B 2GRFA 1D8UA 1RQ4A 1YGFB 3G4WA 1HBAA 1MLSA 5CHQA 2NSSA 5JOMA 5CN7A 1MLKA 5ILPA 3WTGA 2NX0A 3A0GB 3UHRA 2ZT1A 2HBEB 3LB1A 1Y01B 4MXLA 5MBAA 3QM6A 1LFLB 3WCTD 1MYGA 1C7BA 1QI8B 2O5OX 1YG5A 3ZJPA 1BZ0B 5CN4A 2ZFOD 2ZS1B 1YVQA 1CH1A 1JEBA 2BWHA 3DUTB 1Y0TB 3UHKA 2O5MX 1HGAA 1IOPA 4HBIA 2ZFOC 3EOKA 6HBIA 3VRFA 3M39A 1CG8B 1YIEA 3WCWB 5E29A 3WCUC 4KMVA 3P5QA 1YE2B 1N9HA 3PI1A 1GVHA 3BOMB 1Y4FB 1JL7A 109MA 4PQ6A 1IWHA 1J3YA 1MYMA 3NL7A 3HHBA 2HBDA 1ABWA 3SDNA 2VLXA 2QLSA 2HBGA 3A2GA 4F69A 4JYQA 1YEQA 1CH9A 1J52A 1JDOA 5JGGA 1GLIA 1XZ2B 1BINA 1MOCA 1A00A 1M9PB 3GOUB 1Y83B 1UIWB 1O1MB 3UH3A 2VYYA 3HHBB 1BZ1B 3KUNA 4NI0A 1OUUB 5E29B 2AUPA 3ODQA 2G0SA 2GL3A 1O1JB 4OODA 4JACA 1UFJA 2RI4A 3S1JA 3PI2A 3D17A 2QFNA 3OJ1A 2GRZA 2LH7A 1XZ4B 2ZSTA 2D5ZB 1Y45B 1L2KA 1QI8A 3PI3A 2ZLXA 2D2NA 1GBVA 4MBNA 2GNVA 1V4XA 3MBAA 1HDSB 5EQMA 5KDQB 1IRCA 1LA6B 1MLLA 3A5AA 1QXEB 1V4UA 2ZLUA 1V4XB 4G51B 1Y4RB 3UHZA 2HHBA 4F4OB 4YU3B 1HDBA 3D1AB 3AT6B 4HRRB 1Y8HB 1URYA 3AQ8A 1EBTA 5EE4C 3SZKB 3OZUA 3G4QA 1RQ3B 2MGFA 1G0BB 4H2LA 2MGMA 1OUUA 3NG6B 3UBVA 3IC2B 1G0AB 1XZ7A 5EYSA 3GQPB 1YH9A 3D17B 4YU4A 1IRDB 1OR4A 3WCWC 1H1XA 101MA 3UH6A 2GKMA 3ED9A 1MBSA 1YFFA 6HBWB 1AJGA 1Y5KA 5C6YA 2W6XA 1VXCA 1UC3A 1DWSA 1BZ1A 1NQPA 1MBOA 1J7SA 1YMAA 2FRIX 3GYSA 1DO4A 5EU2A 1HHOA 1NZ4A 3LB4A 4F6BA 1TU9A 1CH5A 3R5IA 1YIHB 3K8BA 4HRTA 1Y7CA 6HBWA 1ECNA 3MKBB 3VRGA 1FLPA 3HYUA 1GCVA 1XXTB 1Y4FA 1O1LB 1G0AA 1U7RA 1LH6A 3DR9A 3HF4B 1LFTB 1CLSB 1HBRA 1I3DA 1HLMA 1BZ0A 2ZT2A 4F68A 2G0RA 3ARJA 2WY4A 2G11A 3AT6A 2DN1A 1MDNA 4HRRA 1JF3A 5CNGA 5HU6A 4LPIA 1JF4A 1MLUA 2HZ1A 5SW7A 1LFZA 1VXGA 2VEEA 2YRSB 1V4UB 1DM1A 3BJ2A 2ZT3A 1S69A 1VRFA 2ZSRA 3WTGB 106MA 1MNIA 2D2MB 1BBBA 1VXDA 1HBAB 4ROMB 1V07A 3UI0A 1SI4B 1AJHA 3D4XB 4N7OB 3PI9B 108MA 1C7CB 3LB3A 3OGBA 4MQHA 103MA 4UZVA 7HBIA 1MLMA 2OLPA 1FAWB 4FC3B 3M38A 1J41B 3ODQB 3A59A 1CLSA 1DXTB 2D5XA 4MPMA 1DWTA 3WCTB 1YEOB 2Z8AA 3WCVC 3V2ZA 1Y4GB 1YEOA 1XZVA 3QMAA 3UHTA 1DXUB 4ROLA 3NMMB 1Y7CB 3H58A 3SZKA 2R1HA 4MXKA 1FAWA 2FRFA 4QAUA 1Y4QA 5JGGB 1YEVA 1ECAA 3G4RA 3D4XA 3UHBA 3UGZA 3PELB 2QSPA 4F6GA 1CIOA 3B75B 1XZUB 2R1HB 3G53A 1QXDB 1MODA 5AZQA 2OIFA 1Y8KA 3OO4A 5B85A 1CG8A 2O5LX 1RVWB 3GLNA 1LFVB 1Y31A 1YEUB 3LQDA 1HDAA 1YH9B 4YU4B 1MYIA 1ECDA 3ZJSA 2ZSQA 3MN0A 2R4XA 1OJ6A 2R4YA 2M6ZA 2BW9M 3ZHWA 1O1PB 3UH7A 5CHRA 2AUQA 4U8UD 1HGCB 1FSXA 1IBEA 1PBXB 4KN3A 3WFWA 2D2MD 1ECOA 2QSSA 1UVYA 4O2GA 4MQHB 3OZWA 1Y7DA 3UHEA 3GQRB 3OO5A 1O1OA 4MQKA 1MBAA 1LFTA 1O16A 1ABSA 1S61A 1LH2A 1A6MA 2ZLWA 1O1KA 1JW8A 1RVWA 3WCVB 1S6AA 2D2NB 1LH1A 1VXHA 2MBWA 3S1IA 3HC9A 1A4FB 4KMWA 2MHBA 3PT7B 2QFKA 1URVA 1Y46B 2NRLA 1S5XA 4NXCA 3TM3A 1J3ZB 1HSYA 3VAUA 107MA 1EMYA 1YE0B 1RTEA 3ECZA 1MCYA 3ZH0A 1DWRA 4M4BB 3AG0A 3NL7B 3P5QB 3PT8B 5E6EB 4FWYA 1O1JA 2O5QX 2ZT4A 2ZS0D 3D7OA 2G0ZA 1FHJB 3AT5A 1Y5JA 5F0BA 2XKGA 1FN3B 1Y0AA 1XXTA 105MA 4ESAA 3VREA 5EUIA 1FHJA 2QU0A 1YHRA 3D7OB 1GCWA 1NPGA 3ASEA 3ECLA 1RQ3A 3PT8A 5CN9A 2XKHA 4WCHD 1YIHA 1OFJA 4MU5A 2KSCA 2HHBB 4F4OA 4TWUA 2ZSNA 2EB9A 4C44A 1CH7A 2V1JA 2G10A 2DN2A 2H35A 2HBDB 1NAZA 1CH3A 1IWHB 1J3YB 2GTLD 1ITHA 1CP0A 3G4VA 1MGNA 1BBBB 2FALA 1J40A 3V2VA 1A4FA 4HHBB 2AUOA 3WCWA 1MTIA 1Y0WA 2PEGB 1HGAB 1TESA 2GTLC 1FCSA 3HEPA 2HZ3A 1VHBA 1J7YA 3HXNA 3MJUA 3TM9A 1MLJA 1DO1A 2BNLA 1Y8HA 1Y09A 2ZLTB 1PBXA 2W6WA 1C7BB 5IKSA 1JL6A 1LFLA 1IBEB 3OZVA 1RPSA 1IT2A 1R1XA 2RI4B 2HHEA 1Y4RA 4ZVBA 2AA1B 1MNKA 2W6VB 3IA3B 1MLQA 1YENB 3BA2A 2G12A 5CNBA 1GCVB 1WMUB 1C40A 3QJCB 1CG5A 1Y35A 3QJEA 5CN6A 2ZS0C 1XYEB 1LHTA 3S65B 1VXBA 1HACB 2OH8A 3K8BB 2EVKA 4HRTB 1COHB 2QRWA 3R5IB 3WCWD 4NS2A 3BJ3B 2ZSXA 1Y4VA 2ZS0A 3DHRB 3TLDA 2MGGA 3WCPA 1OUTB 3WHMB 2QLSB 1Y85B 2R4ZA 2VYZA 1C7DA 2V1GA 2V1EA 2W6VA 4HSWA 2MGHA 4WJGA 2QMBA 3ZJQA 1R1XB 4MQCA 1X46A 4M4AB 1BZZB 1QSHB 3GQPA 1ASHA 1X9FC 5AZRA 4VHBA 2ZSPA 1JY7A 1JP8A 2D60B 4MQJA 1Y0DA 5CNDA 1S0HB 4AVDA 4U8UB 2VLZA 2ZSOA 2B7HB 4N8TA 1MOBA 3AQ9A 3NFEB 1LFQB 4PNJA 2MGDA 5KERB 1YHUC 3ECXA 3MOUA 3PIAB 1QPWA 1ABWB 4N7NB 1MBDA 1GDJA 3NMLA 3BOMA 2R50A 3E4NA 1DXDA 1MYFA 1MYZA 1YHUA 4FH6A 2ZLXB 1DTMA 2ZT0A 2VEBA 4B4YA 1Y8IA 1SDKA 2HHDA 3DUTA 3GQGB 4FWZA 1JEBB 1HBBA 1Q1FA 1LFZB 1F65A 4U8UC 1YHUD 1A3OB 111MA 1Y0DB 3ARKA 1GCWB 1A6KA 2W31A 2V1HA 3GDJB 1JWNA 1A6GA 3GKVA 2EB8A 2IN4A 3MJPA 3FS4B 1K1KB 1SHRB 2E2YA 1A0ZB 1QSIB 2V1IA 3FS4A 3HF4A 3HEOA 3QZXA 2R80B 2SPOA 3ZJIA 2MGAA 3MKBA 3VRGB 1YCBA 3HRWB 1G9VA 2MYBA 3QM9A 4F6DA 1VXFA 1A0UA 1NGKA 1CH2A 1JZMA 1A00B 1M9PA 1V9QA 3UHCA 4MQGA 1T1NB 1BZ6A 2LH1A 1LTWA 2GRHA 3G46A 3UHUA 1XQ5B 3WCUB 3G4UA 5CNEA 4MQGB 1MKOB 3UHDA 3S65A 3GYSB 1YHUB 5JDOF 1WMUA 2EKTA 1S5YA 1V5HA 1YCAA 4NK1A 2PGHA 5E83B 1MWCA 4MQIA 1MTKA 4MQKB 2H8DA 5EETA 2ZSYA 3MJPB 2HHEB 3EOKB 3SDHA 3GK9A 2FAMA 3QJDA 2MGCA 3GDJA 1A9WA 1KD2A 4H2LB 4N8TB 1NIHB 3ZJMA 3E5OA 4U8UA 1JZKA 3K3UA 1BABA 1HBIA 3QM5A 1O1IA 2H8FA 3A5GA 2MGIA 1Y4BA 1J7WA 1NZ3A 2G0VA 1LFVA 2MYAA 1LJWB 1Y22A 1HBSB 2O5BX 2MGJA 1NS9B 1LFYA 1N9IA 1VWTA 4PQBA 1SPGB 1RTXA 5ILMA 3BJ1A 3WFUA 1K0YA 3UHNA 1HCOB 1Y5FA 2VHBA 3IC0B 1MLHA 1JP6A 3VHBA 2HZ2A 2MGLA 1YEVB 3CY5A 1YOIA 3AQ6A 2W72A 2RAOA 4IROB 3QZZA 2MGKA 5HY8B 3EDAA 2V1FA 3M3BA 4DC8A 2ZFBB 3UHHA 3EU1B 4L7YB 1YGDA 3UHGA 3QJCA 5ILRA 4MBAA 2R80A 3LHBA 1KFRA 1DXTA 2DXMB 1K1KA 1MLNA 1FDHA 2AV0A 1H97A 4HSXA 2GLNA 5CNFA 3OVUC 3KMFA 2G14A 1NS6B 3IXFA 1Y83A 3WHMA 2IG3A 1CMYA 1Y4VB 1VREA 2Z6TA 3W4UA 1J7YB 2O5SX 1MNHA 1XZ2A 3CY5B 1SDKB 1Y46A 4O4ZA 2HBSA 3ONZA 1LH3A 2MHBB 3PT7A 1Z8UB 1Y0WB 2CMMA 1AJ9B 3EDBA 1HCOA 2JHOA 1HBHB 3RJ6A 1YOHA 4PQCA 1LFYB 3ZJRA 2AV3A 1G08B 2VLYA 4G1BA 2LH5A 1Y7DB 1YDZA 1Y09B 3ZOMA 1Y0TA 2MGBA 1O1IB 2H8FB 1YDZB 1F63A 2FRKX 1DKEA 1O1PA 1S0HA 4F6IA 2BK9A 5HLQA 1O1LA 1BZRA 2EF2A 1BZZA 1QSHA 3LQDB 5B84A 2PEGA 2O5TX 3UHYA 2W6YA 4L2MA 1UFPA 1A3NB 4BJAA 1BVDA 4ODCA 1MLGA 4UIQA 4KJTA 1XCHA 3H57A 1Y85A 1Y4PB 1G09B 2BLIA 1HHOB 1XY0B 4NXAA 3BJ3A 4X0LB 1GZXA 1YE0A 2LHBA 1DXCA 1CIKA 3NFEA 1XQ5A 3WCUA 1J3ZA 5D5RA 5D1VA 1BIJB 1CO9A 2B7HA 3W4UB 1LHSA 3CIUB 1T1NA 5C6EB 3NMMA 1CPWA 2ZLVB 4MAXA 1MOHA 2EKUA 1Y35B 3R0GA 3FH9A 3G4YA 5AB8A 2VYWA 1UX8A 1CO8A 1Y5JB 3WCUD 3WCTA 1B86B 1VXEA 1A0ZA 1QSIA 1YZIB 2DXMA 3ZJLA 4GZGA 3CIUA 2G0XA 4DWTA 3WCVD 1BIJA 1JPBA 1NEJB 2MB5A 4M4BA 2ZFBA 1GDLA 1PMBA 5HAVA 2ZSSA 3PI9A 3HXNB 1RQAB 4ZVAA 1QXEA 1Y7ZB 1DUKA 1V75A 2BLHA 2HHDB 1Y7GB 1NS9A 1YEUA 4NI1B 1BUWB 2GTLB 1WLAA 1HGBA 1Y2ZB 1MLRA 3ZOLA 2ZLWB 2EVPA 3RGKA 1C40B 1Y7GA 1MYTA 1SPGA 1VXAA 2VRYA 1IT3A 1Y45A 2DN2B 2H35B 1Y22B 1O1NB 1O1OB 110MA 5SW7B 1GDKA 1LJWA 1NIHA 3UBCA 3UGYA 1OFKA 5JDOD 3KUOA 5KERA 2MYEA 3O7NA 5JDOE 1HGCA 1DXVB 2ZS1D 4F6FA 3M3AA 3A9MA 1MWBA 2H8DB 4ROLB 2M6ZB 2SPMA 1YHRB 1Y8WA 2NRMA 2SPNA 2WTHA 1SDLB 1XZ5B 1S5YB 3QQRA 4ESAB 1HDAB 2GDMA 1Y31B 4MQCB 1EW6A 2ZWJA 1UIWA 2BMMA 2D5XB 1AJ9A 1J41A 1BUWA 2GTLA 5E6EA 1Y8KB 2PGHB 1MBCA 1R1YB 2HCOB 3DHTB 1MLOA 3B75A 1I3EA 1RQAA 1MLFA 1MNOA 1LH7A 1SI4A 4ILZA 1NS6A 1GJNA 2D2ND 1BVCA 4ODCB 4O4TA 1R1YA 1S56A 102MA 1X9FD 3ZJNA 1YZIA 3WCVA 1MOAA 3HRWA 1OBMA 1NXFA 1IRDA 1A9WE 3BJ2B 1ABYB 1X9FA 1DKEB 104MA 1YMBA 2GKNA 3WFXA 2AA1A 3KMFC 1J3FA 1MYJA 1RPSB 4IROA 2SPLA 2QSSB 2V1KA 3WFTA 3QQQA 4X0LA 4YU3A 3E55A 1HRMA 1GBUA 3WI8A 1XY0A 1Y5FB 3IC0A 1O1NA 1Y4PA 4O35A 3LR9A 4FH7A 3UHXA 1GDIA 1VWTB 2HCOA 1S5XB 5CMVA 1RQ4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6J A;  1SPE A;  4HHB A;  5EV5 A;  5ILE A;  1J7W B;  1Y4B B;  1SDL A;  1XZ5 A;  1Y8W B;  2DN3 A;  1Y7Z A;  1HV4 B;  2QSP B;  1HAB B;  1IDR A;  1CMY B;  2D60 A;  3A5B A;  4MQJ B;  1JY7 B;  1MBN A;  1J7S B;  2DN1 B;  1NQP B;  1NEJ A;  2NSR A;  1HLB A;  2MGE A;  1LFQ A;  1UX9 A;  1N9X A;  1G08 A;  4NK2 A;  2G3H A;  1SWM A;  5E83 A;  1ABY A;  1MTJ A;  1XZV B;  1MBI A;  2HBF A;  1Y4G A;  2BKM A;  1DLW A;  1X3K A;  5EOH A;  1FN3 A;  1Y0A B;  1JP9 A;  1MWD A;  3IC2 A;  1NPF A;  2QMB B;  1HGB B;  3A59 B;  2O58 X;  4AVE A;  2OH9 A;  3PI8 B;  2LH3 A;  4WJG 1;  3ONZ B;  2XKI A;  4O1T A;  2RAO B;  1V75 B;  1OR6 A;  3D1K A;  3ZJH A;  3UHV A;  3U3E A;  112M A;  2ZS0 B;  4FWX A;  1G9V B;  1EBC A;  3D1K B;  3QM7 A;  5CN8 A;  1F5O A;  3E5I A;  3DHT A;  5KDQ A;  1UMO A;  1BJE A;  3UHS A;  4DC7 A;  3RJN B;  1U7S A;  1GBV B;  3VRF B;  3ZJJ A;  1O1K B;  4H0B A;  1DUO A;  3ORD A;  2HBF B;  1NWI A;  1YEN A;  2ZLV A;  4TYX A;  3UHQ A;  5JDO C;  5C6E A;  4IT8 A;  2D5Z A;  5HBI A;  1F5P A;  3G52 A;  2C0K A;  4C0N A;  3GKT A;  1B0B A;  1KD2 B;  2W72 B;  2ZLT A;  1HJT A;  3UHW A;  2WTG A;  1C7C A;  2OHB A;  3MJU B;  1YOG A;  1KR7 A;  1HV4 A;  3BJ1 B;  4ROM A;  3PI4 A;  4NI0 B;  4N7P A;  1HDS A;  3HYU B;  4B3W A;  2D2M A;  2LH6 A;  1CBM A;  1Y2Z A;  1HBS A;  2HBC A;  3WR1 A;  3PIA A;  1DO7 A;  3ARL A;  3GOU A;  1A01 B;  4NI1 A;  3LR7 A;  4XDI A;  1THB B;  2DHB A;  3QJB A;  2VM0 A;  1BAB B;  2R4W A;  1YMC A;  2D2M C;  2YRS A;  4G1V A;  3PEL A;  1YVT A;  5CN5 A;  1A0U B;  1GBU B;  1MNJ A;  5HLU A;  2AUR A;  3VRE B;  1UVX A;  1LUE A;  1WVP A;  4SDH A;  3MYM A;  1A6N A;  1X9F B;  5M3S A;  1EWA A;  1B86 A;  5EUI B;  3UH5 A;  3QM8 A;  3FH9 B;  3EU1 A;  4L7Y A;  3NG6 A;  5KKK A;  5F2A A;  1A3O A;  3DHR A;  3WCP B;  1W92 A;  2XYK A;  2ZSZ A;  2GNW A;  3S66 B;  3GQG A;  1GLI B;  1MYH A;  2DHB B;  3QJB B;  1COH A;  1Y8I B;  1HDB B;  3D1A A;  2W72 C;  1HAC A;  2D6C A;  1UT0 A;  2Z85 A;  1G09 A;  1K0Y B;  1CQX A;  1CG5 B;  3LB2 A;  3O89 A;  4H07 A;  1MZ0 A;  1BZP A;  4N7P B;  1A3N A;  1Y5K B;  2Z6N A;  3BCQ B;  4DWU A;  1JZL A;  1YGF A;  3K9Z A;  4UUR A;  1YIE B;  1M6C A;  5MBN A;  3MVC A;  4OF9 A;  3S48 C;  2MYC A;  3GKV B;  1FSL A;  1DO3 A;  1YGD B;  1HBG A;  3AQ7 A;  1V4W A;  2ZS1 A;  1XZ4 A;  3WCT C;  1HBB B;  3GQR A;  3OO5 B;  1V4W B;  5HU6 B;  1DXV A;  1YG5 B;  2Z6S A;  3ZJO A;  4M4A A;  1CP5 A;  1FSX B;  2HBE A;  4G51 A;  3A0G A;  1HBR B;  5EYJ A;  2ZLU B;  1Y0C A;  3MYN A;  1DLY A;  4XS0 B;  2Z6N B;  1J40 B;  3BCQ A;  1LA6 A;  1N9F A;  1C7D B;  1HBH A;  4N7N A;  1NZ2 A;  1O1M A;  1QPW B;  5HLX A;  5EE4 D;  1OUT A;  3AQ5 A;  3OO4 B;  2HBS B;  1QXD A;  1YHE A;  1XZU A;  1Y4Q B;  3S66 A;  1NZ5 A;  2D2N C;  4TWV A;  2BLJ M;  4NZI A;  1YEQ B;  3PI8 A;  1DXU A;  2QU0 B;  1XYE A;  3QJE B;  3QJD B;  3OK5 A;  2MYD A;  2ZFO A;  1DTI A;  3AT5 B;  1YE2 A;  4XS0 A;  1Y0C B;  1YFF B;  1M6M A;  1SHR A;  4MQI B;  4FC3 A;  1CQ2 A;  2ZFO B;  1XZ7 B;  1YVQ B;  1CH4 A;  2DC3 A;  1G0B A;  4N7O A;  1YVT B;  2ZS1 C;  1MKO A;  1HAB A;  5CNC A;  5HY8 A;  1NWN A;  1FDH G;  2DN3 B;  1RSE A;  2FRJ X;  2OHA A;  1AZI A;  1CBL A;  1YHE B;  1THB A;  1GZX B;  1LH5 A;  3HEN A;  3UHI A;  1A01 A;  2LH2 A;  2HBC B;  3WR1 B;  2GRF A;  1D8U A;  1RQ4 A;  1YGF B;  3G4W A;  1HBA A;  1MLS A;  5CHQ A;  2NSS A;  5JOM A;  5CN7 A;  1MLK A;  5ILP A;  3WTG A;  2NX0 A;  3A0G B;  3UHR A;  2ZT1 A;  2HBE B;  3LB1 A;  1Y01 B;  4MXL A;  5MBA A;  3QM6 A;  1LFL B;  3WCT D;  1MYG A;  1C7B A;  1QI8 B;  2O5O X;  1YG5 A;  3ZJP A;  1BZ0 B;  5CN4 A;  2ZFO D;  2ZS1 B;  1YVQ A;  1CH1 A;  1JEB A;  2BWH A;  3DUT B;  1Y0T B;  3UHK A;  2O5M X;  1HGA A;  1IOP A;  4HBI A;  2ZFO C;  3EOK A;  6HBI A;  3VRF A;  3M39 A;  1CG8 B;  1YIE A;  3WCW B;  5E29 A;  3WCU C;  4KMV A;  3P5Q A;  1YE2 B;  1N9H A;  3PI1 A;  1GVH A;  3BOM B;  1Y4F B;  1JL7 A;  109M A;  4PQ6 A;  1IWH A;  1J3Y A;  1MYM A;  3NL7 A;  3HHB A;  2HBD A;  1ABW A;  3SDN A;  2VLX A;  2QLS A;  2HBG A;  3A2G A;  4F69 A;  4JYQ A;  1YEQ A;  1CH9 A;  1J52 A;  1JDO A;  5JGG A;  1GLI A;  1XZ2 B;  1BIN A;  1MOC A;  1A00 A;  1M9P B;  3GOU B;  1Y83 B;  1UIW B;  1O1M B;  3UH3 A;  2VYY A;  3HHB B;  1BZ1 B;  3KUN A;  4NI0 A;  1OUU B;  5E29 B;  2AUP A;  3ODQ A;  2G0S A;  2GL3 A;  1O1J B;  4OOD A;  4JAC A;  1UFJ A;  2RI4 A;  3S1J A;  3PI2 A;  3D17 A;  2QFN A;  3OJ1 A;  2GRZ A;  2LH7 A;  1XZ4 B;  2ZST A;  2D5Z B;  1Y45 B;  1L2K A;  1QI8 A;  3PI3 A;  2ZLX A;  2D2N A;  1GBV A;  4MBN A;  2GNV A;  1V4X A;  3MBA A;  1HDS B;  5EQM A;  5KDQ B;  1IRC A;  1LA6 B;  1MLL A;  3A5A A;  1QXE B;  1V4U A;  2ZLU A;  1V4X B;  4G51 B;  1Y4R B;  3UHZ A;  2HHB A;  4F4O B;  4YU3 B;  1HDB A;  3D1A B;  3AT6 B;  4HRR B;  1Y8H B;  1URY A;  3AQ8 A;  1EBT A;  5EE4 C;  3SZK B;  3OZU A;  3G4Q A;  1RQ3 B;  2MGF A;  1G0B B;  4H2L A;  2MGM A;  1OUU A;  3NG6 B;  3UBV A;  3IC2 B;  1G0A B;  1XZ7 A;  5EYS A;  3GQP B;  1YH9 A;  3D17 B;  4YU4 A;  1IRD B;  1OR4 A;  3WCW C;  1H1X A;  101M A;  3UH6 A;  2GKM A;  3ED9 A;  1MBS A;  1YFF A;  6HBW B;  1AJG A;  1Y5K A;  5C6Y A;  2W6X A;  1VXC A;  1UC3 A;  1DWS A;  1BZ1 A;  1NQP A;  1MBO A;  1J7S A;  1YMA A;  2FRI X;  3GYS A;  1DO4 A;  5EU2 A;  1HHO A;  1NZ4 A;  3LB4 A;  4F6B A;  1TU9 A;  1CH5 A;  3R5I A;  1YIH B;  3K8B A;  4HRT A;  1Y7C A;  6HBW A;  1ECN A;  3MKB B;  3VRG A;  1FLP A;  3HYU A;  1GCV A;  1XXT B;  1Y4F A;  1O1L B;  1G0A A;  1U7R A;  1LH6 A;  3DR9 A;  3HF4 B;  1LFT B;  1CLS B;  1HBR A;  1I3D A;  1HLM A;  1BZ0 A;  2ZT2 A;  4F68 A;  2G0R A;  3ARJ A;  2WY4 A;  2G11 A;  3AT6 A;  2DN1 A;  1MDN A;  4HRR A;  1JF3 A;  5CNG A;  5HU6 A;  4LPI A;  1JF4 A;  1MLU A;  2HZ1 A;  5SW7 A;  1LFZ A;  1VXG A;  2VEE A;  2YRS B;  1V4U B;  1DM1 A;  3BJ2 A;  2ZT3 A;  1S69 A;  1VRF A;  2ZSR A;  3WTG B;  106M A;  1MNI A;  2D2M B;  1BBB A;  1VXD A;  1HBA B;  4ROM B;  1V07 A;  3UI0 A;  1SI4 B;  1AJH A;  3D4X B;  4N7O B;  3PI9 B;  108M A;  1C7C B;  3LB3 A;  3OGB A;  4MQH A;  103M A;  4UZV A;  7HBI A;  1MLM A;  2OLP A;  1FAW B;  4FC3 B;  3M38 A;  1J41 B;  3ODQ B;  3A59 A;  1CLS A;  1DXT B;  2D5X A;  4MPM A;  1DWT A;  3WCT B;  1YEO B;  2Z8A A;  3WCV C;  3V2Z A;  1Y4G B;  1YEO A;  1XZV A;  3QMA A;  3UHT A;  1DXU B;  4ROL A;  3NMM B;  1Y7C B;  3H58 A;  3SZK A;  2R1H A;  4MXK A;  1FAW A;  2FRF A;  4QAU A;  1Y4Q A;  5JGG B;  1YEV A;  1ECA A;  3G4R A;  3D4X A;  3UHB A;  3UGZ A;  3PEL B;  2QSP A;  4F6G A;  1CIO A;  3B75 B;  1XZU B;  2R1H B;  3G53 A;  1QXD B;  1MOD A;  5AZQ A;  2OIF A;  1Y8K A;  3OO4 A;  5B85 A;  1CG8 A;  2O5L X;  1RVW B;  3GLN A;  1LFV B;  1Y31 A;  1YEU B;  3LQD A;  1HDA A;  1YH9 B;  4YU4 B;  1MYI A;  1ECD A;  3ZJS A;  2ZSQ A;  3MN0 A;  2R4X A;  1OJ6 A;  2R4Y A;  2M6Z A;  2BW9 M;  3ZHW A;  1O1P B;  3UH7 A;  5CHR A;  2AUQ A;  4U8U D;  1HGC B;  1FSX A;  1IBE A;  1PBX B;  4KN3 A;  3WFW A;  2D2M D;  1ECO A;  2QSS A;  1UVY A;  4O2G A;  4MQH B;  3OZW A;  1Y7D A;  3UHE A;  3GQR B;  3OO5 A;  1O1O A;  4MQK A;  1MBA A;  1LFT A;  1O16 A;  1ABS A;  1S61 A;  1LH2 A;  1A6M A;  2ZLW A;  1O1K A;  1JW8 A;  1RVW A;  3WCV B;  1S6A A;  2D2N B;  1LH1 A;  1VXH A;  2MBW A;  3S1I A;  3HC9 A;  1A4F B;  4KMW A;  2MHB A;  3PT7 B;  2QFK A;  1URV A;  1Y46 B;  2NRL A;  1S5X A;  4NXC A;  3TM3 A;  1J3Z B;  1HSY A;  3VAU A;  107M A;  1EMY A;  1YE0 B;  1RTE A;  3ECZ A;  1MCY A;  3ZH0 A;  1DWR A;  4M4B B;  3AG0 A;  3NL7 B;  3P5Q B;  3PT8 B;  5E6E B;  4FWY A;  1O1J A;  2O5Q X;  2ZT4 A;  2ZS0 D;  3D7O A;  2G0Z A;  1FHJ B;  3AT5 A;  1Y5J A;  5F0B A;  2XKG A;  1FN3 B;  1Y0A A;  1XXT A;  105M A;  4ESA A;  3VRE A;  5EUI A;  1FHJ A;  2QU0 A;  1YHR A;  3D7O B;  1GCW A;  1NPG A;  3ASE A;  3ECL A;  1RQ3 A;  3PT8 A;  5CN9 A;  2XKH A;  4WCH D;  1YIH A;  1OFJ A;  4MU5 A;  2KSC A;  2HHB B;  4F4O A;  4TWU A;  2ZSN A;  2EB9 A;  4C44 A;  1CH7 A;  2V1J A;  2G10 A;  2DN2 A;  2H35 A;  2HBD B;  1NAZ A;  1CH3 A;  1IWH B;  1J3Y B;  2GTL D;  1ITH A;  1CP0 A;  3G4V A;  1MGN A;  1BBB B;  2FAL A;  1J40 A;  3V2V A;  1A4F A;  4HHB B;  2AUO A;  3WCW A;  1MTI A;  1Y0W A;  2PEG B;  1HGA B;  1TES A;  2GTL C;  1FCS A;  3HEP A;  2HZ3 A;  1VHB A;  1J7Y A;  3HXN A;  3MJU A;  3TM9 A;  1MLJ A;  1DO1 A;  2BNL A;  1Y8H A;  1Y09 A;  2ZLT B;  1PBX A;  2W6W A;  1C7B B;  5IKS A;  1JL6 A;  1LFL A;  1IBE B;  3OZV A;  1RPS A;  1IT2 A;  1R1X A;  2RI4 B;  2HHE A;  1Y4R A;  4ZVB A;  2AA1 B;  1MNK A;  2W6V B;  3IA3 B;  1MLQ A;  1YEN B;  3BA2 A;  2G12 A;  5CNB A;  1GCV B;  1WMU B;  1C40 A;  3QJC B;  1CG5 A;  1Y35 A;  3QJE A;  5CN6 A;  2ZS0 C;  1XYE B;  1LHT A;  3S65 B;  1VXB A;  1HAC B;  2OH8 A;  3K8B B;  2EVK A;  4HRT B;  1COH B;  2QRW A;  3R5I B;  3WCW D;  4NS2 A;  3BJ3 B;  2ZSX A;  1Y4V A;  2ZS0 A;  3DHR B;  3TLD A;  2MGG A;  3WCP A;  1OUT B;  3WHM B;  2QLS B;  1Y85 B;  2R4Z A;  2VYZ A;  1C7D A;  2V1G A;  2V1E A;  2W6V A;  4HSW A;  2MGH A;  4WJG A;  2QMB A;  3ZJQ A;  1R1X B;  4MQC A;  1X46 A;  4M4A B;  1BZZ B;  1QSH B;  3GQP A;  1ASH A;  1X9F C;  5AZR A;  4VHB A;  2ZSP A;  1JY7 A;  1JP8 A;  2D60 B;  4MQJ A;  1Y0D A;  5CND A;  1S0H B;  4AVD A;  4U8U B;  2VLZ A;  2ZSO A;  2B7H B;  4N8T A;  1MOB A;  3AQ9 A;  3NFE B;  1LFQ B;  4PNJ A;  2MGD A;  5KER B;  1YHU C;  3ECX A;  3MOU A;  3PIA B;  1QPW A;  1ABW B;  4N7N B;  1MBD A;  1GDJ A;  3NML A;  3BOM A;  2R50 A;  3E4N A;  1DXD A;  1MYF A;  1MYZ A;  1YHU A;  4FH6 A;  2ZLX B;  1DTM A;  2ZT0 A;  2VEB A;  4B4Y A;  1Y8I A;  1SDK A;  2HHD A;  3DUT A;  3GQG B;  4FWZ A;  1JEB B;  1HBB A;  1Q1F A;  1LFZ B;  1F65 A;  4U8U C;  1YHU D;  1A3O B;  111M A;  1Y0D B;  3ARK A;  1GCW B;  1A6K A;  2W31 A;  2V1H A;  3GDJ B;  1JWN A;  1A6G A;  3GKV A;  2EB8 A;  2IN4 A;  3MJP A;  3FS4 B;  1K1K B;  1SHR B;  2E2Y A;  1A0Z B;  1QSI B;  2V1I A;  3FS4 A;  3HF4 A;  3HEO A;  3QZX A;  2R80 B;  2SPO A;  3ZJI A;  2MGA A;  3MKB A;  3VRG B;  1YCB A;  3HRW B;  1G9V A;  2MYB A;  3QM9 A;  4F6D A;  1VXF A;  1A0U A;  1NGK A;  1CH2 A;  1JZM A;  1A00 B;  1M9P A;  1V9Q A;  3UHC A;  4MQG A;  1T1N B;  1BZ6 A;  2LH1 A;  1LTW A;  2GRH A;  3G46 A;  3UHU A;  1XQ5 B;  3WCU B;  3G4U A;  5CNE A;  4MQG B;  1MKO B;  3UHD A;  3S65 A;  3GYS B;  1YHU B;  5JDO F;  1WMU A;  2EKT A;  1S5Y A;  1V5H A;  1YCA A;  4NK1 A;  2PGH A;  5E83 B;  1MWC A;  4MQI A;  1MTK A;  4MQK B;  2H8D A;  5EET A;  2ZSY A;  3MJP B;  2HHE B;  3EOK B;  3SDH A;  3GK9 A;  2FAM A;  3QJD A;  2MGC A;  3GDJ A;  1A9W A;  1KD2 A;  4H2L B;  4N8T B;  1NIH B;  3ZJM A;  3E5O A;  4U8U A;  1JZK A;  3K3U A;  1BAB A;  1HBI A;  3QM5 A;  1O1I A;  2H8F A;  3A5G A;  2MGI A;  1Y4B A;  1J7W A;  1NZ3 A;  2G0V A;  1LFV A;  2MYA A;  1LJW B;  1Y22 A;  1HBS B;  2O5B X;  2MGJ A;  1NS9 B;  1LFY A;  1N9I A;  1VWT A;  4PQB A;  1SPG B;  1RTX A;  5ILM A;  3BJ1 A;  3WFU A;  1K0Y A;  3UHN A;  1HCO B;  1Y5F A;  2VHB A;  3IC0 B;  1MLH A;  1JP6 A;  3VHB A;  2HZ2 A;  2MGL A;  1YEV B;  3CY5 A;  1YOI A;  3AQ6 A;  2W72 A;  2RAO A;  4IRO B;  3QZZ A;  2MGK A;  5HY8 B;  3EDA A;  2V1F A;  3M3B A;  4DC8 A;  2ZFB B;  3UHH A;  3EU1 B;  4L7Y B;  1YGD A;  3UHG A;  3QJC A;  5ILR A;  4MBA A;  2R80 A;  3LHB A;  1KFR A;  1DXT A;  2DXM B;  1K1K A;  1MLN A;  1FDH A;  2AV0 A;  1H97 A;  4HSX A;  2GLN A;  5CNF A;  3OVU C;  3KMF A;  2G14 A;  1NS6 B;  3IXF A;  1Y83 A;  3WHM A;  2IG3 A;  1CMY A;  1Y4V B;  1VRE A;  2Z6T A;  3W4U A;  1J7Y B;  2O5S X;  1MNH A;  1XZ2 A;  3CY5 B;  1SDK B;  1Y46 A;  4O4Z A;  2HBS A;  3ONZ A;  1LH3 A;  2MHB B;  3PT7 A;  1Z8U B;  1Y0W B;  2CMM A;  1AJ9 B;  3EDB A;  1HCO A;  2JHO A;  1HBH B;  3RJ6 A;  1YOH A;  4PQC A;  1LFY B;  3ZJR A;  2AV3 A;  1G08 B;  2VLY A;  4G1B A;  2LH5 A;  1Y7D B;  1YDZ A;  1Y09 B;  3ZOM A;  1Y0T A;  2MGB A;  1O1I B;  2H8F B;  1YDZ B;  1F63 A;  2FRK X;  1DKE A;  1O1P A;  1S0H A;  4F6I A;  2BK9 A;  5HLQ A;  1O1L A;  1BZR A;  2EF2 A;  1BZZ A;  1QSH A;  3LQD B;  5B84 A;  2PEG A;  2O5T X;  3UHY A;  2W6Y A;  4L2M A;  1UFP A;  1A3N B;  4BJA A;  1BVD A;  4ODC A;  1MLG A;  4UIQ A;  4KJT A;  1XCH A;  3H57 A;  1Y85 A;  1Y4P B;  1G09 B;  2BLI A;  1HHO B;  1XY0 B;  4NXA A;  3BJ3 A;  4X0L B;  1GZX A;  1YE0 A;  2LHB A;  1DXC A;  1CIK A;  3NFE A;  1XQ5 A;  3WCU A;  1J3Z A;  5D5R A;  5D1V A;  1BIJ B;  1CO9 A;  2B7H A;  3W4U B;  1LHS A;  3CIU B;  1T1N A;  5C6E B;  3NMM A;  1CPW A;  2ZLV B;  4MAX A;  1MOH A;  2EKU A;  1Y35 B;  3R0G A;  3FH9 A;  3G4Y A;  5AB8 A;  2VYW A;  1UX8 A;  1CO8 A;  1Y5J B;  3WCU D;  3WCT A;  1B86 B;  1VXE A;  1A0Z A;  1QSI A;  1YZI B;  2DXM A;  3ZJL A;  4GZG A;  3CIU A;  2G0X A;  4DWT A;  3WCV D;  1BIJ A;  1JPB A;  1NEJ B;  2MB5 A;  4M4B A;  2ZFB A;  1GDL A;  1PMB A;  5HAV A;  2ZSS A;  3PI9 A;  3HXN B;  1RQA B;  4ZVA A;  1QXE A;  1Y7Z B;  1DUK A;  1V75 A;  2BLH A;  2HHD B;  1Y7G B;  1NS9 A;  1YEU A;  4NI1 B;  1BUW B;  2GTL B;  1WLA A;  1HGB A;  1Y2Z B;  1MLR A;  3ZOL A;  2ZLW B;  2EVP A;  3RGK A;  1C40 B;  1Y7G A;  1MYT A;  1SPG A;  1VXA A;  2VRY A;  1IT3 A;  1Y45 A;  2DN2 B;  2H35 B;  1Y22 B;  1O1N B;  1O1O B;  110M A;  5SW7 B;  1GDK A;  1LJW A;  1NIH A;  3UBC A;  3UGY A;  1OFK A;  5JDO D;  3KUO A;  5KER A;  2MYE A;  3O7N A;  5JDO E;  1HGC A;  1DXV B;  2ZS1 D;  4F6F A;  3M3A A;  3A9M A;  1MWB A;  2H8D B;  4ROL B;  2M6Z B;  2SPM A;  1YHR B;  1Y8W A;  2NRM A;  2SPN A;  2WTH A;  1SDL B;  1XZ5 B;  1S5Y B;  3QQR A;  4ESA B;  1HDA B;  2GDM A;  1Y31 B;  4MQC B;  1EW6 A;  2ZWJ A;  1UIW A;  2BMM A;  2D5X B;  1AJ9 A;  1J41 A;  1BUW A;  2GTL A;  5E6E A;  1Y8K B;  2PGH B;  1MBC A;  1R1Y B;  2HCO B;  3DHT B;  1MLO A;  3B75 A;  1I3E A;  1RQA A;  1MLF A;  1MNO A;  1LH7 A;  1SI4 A;  4ILZ A;  1NS6 A;  1GJN A;  2D2N D;  1BVC A;  4ODC B;  4O4T A;  1R1Y A;  1S56 A;  102M A;  1X9F D;  3ZJN A;  1YZI A;  3WCV A;  1MOA A;  3HRW A;  1OBM A;  1NXF A;  1IRD A;  1A9W E;  3BJ2 B;  1ABY B;  1X9F A;  1DKE B;  104M A;  1YMB A;  2GKN A;  3WFX A;  2AA1 A;  3KMF C;  1J3F A;  1MYJ A;  1RPS B;  4IRO A;  2SPL A;  2QSS B;  2V1K A;  3WFT A;  3QQQ A;  4X0L A;  4YU3 A;  3E55 A;  1HRM A;  1GBU A;  3WI8 A;  1XY0 A;  1Y5F B;  3IC0 A;  1O1N A;  1Y4P A;  4O35 A;  3LR9 A;  4FH7 A;  3UHX A;  1GDI A;  1VWT B;  2HCO A;  1S5X B;  5CMV A;  1RQ4 B; 
#chains in the Genus database with same CATH topology
 4F6J A;  1SPE A;  4HHB A;  5EV5 A;  5ILE A;  1J7W B;  1Y4B B;  1SDL A;  1XZ5 A;  1Y8W B;  2DN3 A;  1Y7Z A;  1HV4 B;  4LMS B;  2QSP B;  1HAB B;  1IDR A;  1CMY B;  2D60 A;  3A5B A;  4MQJ B;  1JY7 B;  1MBN A;  1J7S B;  2DN1 B;  1NQP B;  1NEJ A;  2NSR A;  1HLB A;  2MGE A;  1LFQ A;  1UX9 A;  1N9X A;  1G08 A;  4NK2 A;  4H0M A;  2G3H A;  4ERV A;  1SWM A;  5E83 A;  1ABY A;  1MTJ A;  1XZV B;  1MBI A;  2HBF A;  1Y4G A;  2BKM A;  1DLW A;  1X3K A;  5EOH A;  1FN3 A;  1Y0A B;  1JP9 A;  1MWD A;  3IC2 A;  1NPF A;  2QMB B;  1HGB B;  3A59 B;  2O58 X;  4AVE A;  2OH9 A;  3PI8 B;  4HH1 A;  2LH3 A;  4WJG 1;  3ONZ B;  2XKI A;  4O1T A;  5AQD A;  2RAO B;  4A8M P;  1V75 B;  1OR6 A;  3D1K A;  3ZJH A;  3UHV A;  3O2C B;  3U3E A;  112M A;  2ZS0 B;  4FWX A;  1G9V B;  1EBC A;  3D1K B;  2JLG A;  3QM7 A;  5CN8 A;  4PO5 B;  1F5O A;  3E5I A;  3DHT A;  5KDQ A;  1UMO A;  1BJE A;  3UHS A;  4DC7 A;  3RJN B;  1U7S A;  1GBV B;  3VRF B;  3ZJJ A;  1O1K B;  4H0B A;  1DUO A;  3ORD A;  2HBF B;  1NWI A;  1YEN A;  2ZLV A;  4TYX A;  3UHQ A;  5JDO C;  5C6E A;  4IT8 A;  2D5Z A;  5HBI A;  1F5P A;  3G52 A;  2C0K A;  4C0N A;  3GKT A;  1B0B A;  1KD2 B;  2W72 B;  2ZLT A;  1HJT A;  3UHW A;  2WTG A;  1C7C A;  2OHB A;  3MJU B;  1YOG A;  1KR7 A;  1HV4 A;  3BJ1 B;  4ROM A;  2VJT A;  3PI4 A;  4NI0 B;  4N7P A;  1HDS A;  3HYU B;  4B3W A;  2D2M A;  2LH6 A;  1CBM A;  1Y2Z A;  1HBS A;  2HBC A;  3WR1 A;  2VJR B;  3PIA A;  1DO7 A;  3ARL A;  3GOU A;  1A01 B;  4NI1 A;  1HHS A;  3LR7 A;  1UVM A;  4XDI A;  1THB B;  2DHB A;  3QJB A;  1LIA A;  2VM0 A;  1BAB B;  2R4W A;  1YMC A;  2D2M C;  2YRS A;  4G1V A;  3PEL A;  1YVT A;  5CN5 A;  1ON7 A;  1A0U B;  1GBU B;  1MNJ A;  5HLU A;  2AUR A;  3VRE B;  1UVX A;  1LUE A;  1WVP A;  4SDH A;  3MYM A;  1A6N A;  1X9F B;  5M3S A;  1EWA A;  1B86 A;  5EUI B;  3UH5 A;  3QM8 A;  3FH9 B;  5FVB A;  3EU1 A;  4L7Y A;  2UUN D;  3NG6 A;  5KKK A;  5F2A A;  1A3O A;  3DHR A;  3WCP B;  1W92 A;  2XYK A;  1XG0 C;  2ZSZ A;  2GNW A;  3S66 B;  3GQG A;  1GLI B;  1MYH A;  2DHB B;  3QJB B;  1COH A;  1Y8I B;  1HDB B;  3D1A A;  2W72 C;  1HAC A;  4Q70 A;  2D6C A;  1UT0 A;  2Z85 A;  1G09 A;  1K0Y B;  1CQX A;  1CG5 B;  3LB2 A;  3O89 A;  4H07 A;  3V57 B;  1KN1 A;  1MZ0 A;  1BZP A;  4N7P B;  1A3N A;  1Y5K B;  2WCQ A;  2Z6N A;  3BCQ B;  1JZL A;  1YGF A;  4DWU A;  3K9Z A;  4UUR A;  1YIE B;  2UUL A;  1JBO B;  1M6C A;  5MBN A;  3MVC A;  4OF9 A;  3S48 C;  1CPC A;  2MYC A;  3GKV B;  1FSL A;  1DO3 A;  1YGD B;  1HBG A;  3AQ7 A;  1V4W A;  2ZS1 A;  1XZ4 A;  3WCT C;  1HBB B;  3GQR A;  3OO5 B;  3PMC A;  1V4W B;  5HU6 B;  1DXV A;  1YG5 B;  2VJH A;  2Z6S A;  3KVS A;  3ZJO A;  4M4A A;  1CP5 A;  1FSX B;  2HBE A;  4G51 A;  3A0G A;  1HBR B;  5EYJ A;  2ZLU B;  1Y0C A;  3MYN A;  2UUM B;  1DLY A;  4XS0 B;  2Z6N B;  1J40 B;  3BCQ A;  1LA6 A;  2WCR A;  1N9F A;  1C7D B;  3V57 A;  1HBH A;  4N7N A;  4A8O A;  1NZ2 A;  1O1M A;  1QPW B;  5HLX A;  5EE4 D;  1OUT A;  3AQ5 A;  3OO4 B;  2HBS B;  1QXD A;  1YHE A;  1XZU A;  1Y4Q B;  3S66 A;  1NZ5 A;  2D2N C;  4TWV A;  2BLJ M;  4NZI A;  1YEQ B;  3PI8 A;  1DXU A;  2QU0 B;  4BS9 A;  1XYE A;  4BJU A;  3QJE B;  1DDT A;  3QJD B;  3OK5 A;  4ZIZ A;  2MYD A;  2ZFO A;  1DTI A;  3AT5 B;  1YE2 A;  4XS0 A;  1Y0C B;  1YFF B;  1HHT P;  1M6M A;  5FVB M;  1SHR A;  4MQI B;  2UUL C;  4FC3 A;  1CQ2 A;  2ZFO B;  5B13 A;  1XZ7 B;  2UUM X;  4N6S B;  1YVQ B;  1CH4 A;  2DC3 A;  1G0B A;  1F99 A;  4N7O A;  1YVT B;  2ZS1 C;  1MKO A;  1HAB A;  5CNC A;  5HY8 A;  1NWN A;  4ETU A;  1FDH G;  2DN3 B;  1RSE A;  2FRJ X;  2OHA A;  1AZI A;  1CBL A;  1YHE B;  1THB A;  1GZX B;  1LH5 A;  3HEN A;  3UHI A;  4ERT A;  1B33 B;  1A01 A;  2LH2 A;  2HBC B;  3WR1 B;  2GRF A;  1D8U A;  1RQ4 A;  1YGF B;  3G4W A;  1HBA A;  1MLS A;  5CHQ A;  2NSS A;  2VJT B;  5JOM A;  5CN7 A;  1MLK A;  5ILP A;  3WTG A;  2NX0 A;  3A0G B;  3UHR A;  2ZT1 A;  1SGK A;  2HBE B;  3LB1 A;  1HA7 A;  1Y01 B;  4MXL A;  5MBA A;  3QM6 A;  1LFL B;  3WCT D;  1MYG A;  1C7B A;  1QI8 B;  2O5O X;  1YG5 A;  3ZJP A;  1BZ0 B;  4A8K A;  5CN4 A;  2ZFO D;  2ZS1 B;  1YVQ A;  1CH1 A;  1JEB A;  2BWH A;  3DUT B;  1Y0T B;  3UHK A;  1HI8 A;  2O5M X;  1HGA A;  1IOP A;  4HBI A;  2ZFO C;  3EOK A;  6HBI A;  3VRF A;  3M39 A;  1CG8 B;  1YIE A;  3WCW B;  5E29 A;  3WCU C;  4KMV A;  1F0L A;  3P5Q A;  1YE2 B;  1N9H A;  3PI1 A;  1GVH A;  3BOM B;  1Y4F B;  1JL7 A;  109M A;  4PQ6 A;  1IWH A;  1J3Y A;  1MYM A;  3NL7 A;  3HHB A;  4RMP B;  2HBD A;  1ABW A;  3SDN A;  2VLX A;  2QLS A;  2HBG A;  3A2G A;  3PMD A;  4F69 A;  4JYQ A;  1YEQ A;  1CH9 A;  1J52 A;  1JDO A;  5JGG A;  1GLI A;  1XZ2 B;  1BIN A;  1MOC A;  1A00 A;  1M9P B;  3GOU B;  1Y83 B;  2VJR A;  1UIW B;  1O1M B;  3UH3 A;  2VYY A;  3HHB B;  1BZ1 B;  3KUN A;  4NI0 A;  1OUU B;  5E29 B;  1EYX A;  2AUP A;  3ODQ A;  2G0S A;  2GL3 A;  1O1J B;  4OOD A;  4JAC A;  4GY3 A;  1UFJ A;  2RI4 A;  3S1J A;  2X49 A;  3PI2 A;  3D17 A;  2QFN A;  2UUN B;  3OJ1 A;  2GRZ A;  2LH7 A;  1XZ4 B;  4A8W A;  2ZST A;  3ZTA A;  2D5Z B;  1HI1 A;  1Y45 B;  2UUL H;  1L2K A;  1QI8 A;  3PI3 A;  2ZLX A;  2D2N A;  1GBV A;  4MBN A;  2GNV A;  1V4X A;  3MBA A;  1HDS B;  5EQM A;  5KDQ B;  1IRC A;  5AQD M;  1LA6 B;  1MLL A;  3A5A A;  1QXE B;  1V4U A;  2ZLU A;  1V4X B;  4G51 B;  1Y4R B;  3V58 B;  3UHZ A;  2HHB A;  4F4O B;  4YU3 B;  1HDB A;  3D1A B;  3AT6 B;  4HRR B;  1Y8H B;  1URY A;  3AQ8 A;  1RH1 A;  1EBT A;  5EE4 C;  3SZK B;  4AE0 A;  3OZU A;  3G4Q A;  1RQ3 B;  2MGF A;  1G0B B;  1EYX B;  4H2L A;  2MGM A;  1OUU A;  3NG6 B;  3UBV A;  3IC2 B;  4Z8K B;  2DKD A;  1G0A B;  1XZ7 A;  5EYS A;  3GQP B;  1YH9 A;  3D17 B;  4YU4 A;  1IRD B;  3L0F A;  1OR4 A;  3WCW C;  1H1X A;  101M A;  3UH6 A;  2GKM A;  3ED9 A;  1MBS A;  1YFF A;  6HBW B;  1AJG A;  1Y5K A;  5C6Y A;  2W6X A;  1VXC A;  1UC3 A;  1DWS A;  1BZ1 A;  1COL A;  1NQP A;  1MBO A;  1J7S A;  1YMA A;  2FRI X;  3GYS A;  1DO4 A;  5EU2 A;  1HHO A;  1NZ4 A;  3LB4 A;  4F6B A;  1TU9 A;  1CH5 A;  3R5I A;  1YIH B;  3K8B A;  4HRT A;  1Y7C A;  6HBW A;  1ECN A;  3MKB B;  3VRG A;  1FLP A;  3HYU A;  1GCV A;  1XXT B;  1Y4F A;  1O1L B;  1G0A A;  1U7R A;  1LH6 A;  3DR9 A;  3HF4 B;  1UVL A;  1LFT B;  1CLS B;  1HBR A;  1I3D A;  1HLM A;  1BZ0 A;  2ZT2 A;  4F68 A;  2G0R A;  3ARJ A;  2WY4 A;  2G11 A;  3AT6 A;  2DN1 A;  1MDN A;  4HRR A;  1B8D B;  1JF3 A;  1A87 A;  5CNG A;  5HU6 A;  4LPI A;  1HI0 P;  1JF4 A;  1MLU A;  2HZ1 A;  5SW7 A;  1LFZ A;  1VXG A;  2VEE A;  2YRS B;  1V4U B;  1DM1 A;  3BJ2 A;  2ZT3 A;  4YJJ A;  1S69 A;  1VRF A;  2ZSR A;  3WTG B;  106M A;  1MNI A;  2D2M B;  1BBB A;  1VXD A;  1HBA B;  4ROM B;  1V07 A;  3UI0 A;  1SI4 B;  1AJH A;  3D4X B;  4N7O B;  3PI9 B;  108M A;  1C7C B;  1B33 A;  1F99 B;  3LB3 A;  3OGB A;  4MQH A;  2VML B;  4N6S A;  103M A;  4UZV A;  7HBI A;  1MLM A;  2OLP A;  1FAW B;  4FC3 B;  3M38 A;  1J41 B;  3ODQ B;  3A59 A;  1CLS A;  1DXT B;  2D5X A;  2V8A A;  1XF6 C;  4MPM A;  1DWT A;  3WCT B;  1YEO B;  2Z8A A;  4B02 A;  3WCV C;  3V2Z A;  1Y4G B;  1YEO A;  4Z8K A;  1XZV A;  3QMA A;  3UHT A;  1DXU B;  4ROL A;  1GH0 B;  3NMM B;  4H0M B;  1Y7C B;  3H58 A;  3SZK A;  4ETV A;  2R1H A;  4MXK A;  1FAW A;  2FRF A;  4QAU A;  4ZIZ B;  1Y4Q A;  5JGG B;  1YEV A;  1ECA A;  3G4R A;  3V58 A;  4LM6 B;  3O2C A;  3D4X A;  3UHB A;  3UGZ A;  3PEL B;  2QSP A;  4F6G A;  1CIO A;  3B75 B;  1XZU B;  2R1H B;  4A8S A;  3G53 A;  1QXD B;  1MOD A;  5AZQ A;  2OIF A;  1Y8K A;  3OO4 A;  5B85 A;  1CG8 A;  2O5L X;  1RVW B;  3GLN A;  3GIO A;  1LFV B;  1Y31 A;  1YEU B;  3LQD A;  1HDA A;  1YH9 B;  4YU4 B;  1MYI A;  1ECD A;  3ZJS A;  2ZSQ A;  3MN0 A;  2R4X A;  1OJ6 A;  2R4Y A;  2M6Z A;  2BW9 M;  3ZHW A;  1O1P B;  3UH7 A;  5CHR A;  2JL9 A;  2AUQ A;  4U8U D;  1HGC B;  1FSX A;  1IBE A;  2UUN A;  1PBX B;  4KN3 A;  3WFW A;  2D2M D;  1ECO A;  2QSS A;  2VJH B;  1UVY A;  4O2G A;  4MQH B;  3OZW A;  1PHN B;  1Y7D A;  2DKC A;  3UHE A;  3GQR B;  3OO5 A;  1O1O A;  4MQK A;  1MBA A;  1LFT A;  1O16 A;  1ABS A;  1UVN A;  1S61 A;  1LH2 A;  1A6M A;  2ZLW A;  1O1K A;  1JW8 A;  1RVW A;  3WCV B;  1S6A A;  4F0T B;  2D2N B;  1LH1 A;  1VXH A;  2MBW A;  3S1I A;  3HC9 A;  1A4F B;  4KMW A;  2MHB A;  3PT7 B;  2QFK A;  1URV A;  1Y46 B;  2NRL A;  1S5X A;  4NXC A;  3TM3 A;  1J3Z B;  1HSY A;  3VAU A;  107M A;  1EMY A;  1YE0 B;  2C7J B;  1RTE A;  1I7Y B;  3ECZ A;  1MCY A;  4Q70 B;  3ZH0 A;  1DWR A;  4M4B B;  3AG0 A;  3NL7 B;  3P5Q B;  3PT8 B;  5E6E B;  4FWY A;  1O1J A;  2O5Q X;  2ZT4 A;  2ZS0 D;  3D7O A;  2G0Z A;  4LMX B;  1FHJ B;  3AT5 A;  1Y5J A;  5F0B A;  2XKG A;  1FN3 B;  1Y0A A;  1XXT A;  105M A;  4ESA A;  3VRE A;  5EUI A;  1FHJ A;  2QU0 A;  1YHR A;  3D7O B;  1GCW A;  1NPG A;  3ASE A;  1UVK A;  3ECL A;  1RQ3 A;  3PT8 A;  5CN9 A;  2XKH A;  4WCH D;  1YIH A;  1OFJ A;  4MU5 A;  2KSC A;  2HHB B;  4F4O A;  4TWU A;  2ZSN A;  2EB9 A;  4C44 A;  1CH7 A;  2V1J A;  2G10 A;  2DN2 A;  2H35 A;  2HBD B;  1NAZ A;  1CH3 A;  1IWH B;  1J3Y B;  2GTL D;  1ITH A;  1CP0 A;  1LIA B;  1QGW C;  3G4V A;  1MGN A;  1BBB B;  2FAL A;  1J40 A;  3V2V A;  1A4F A;  4HHB B;  2AUO A;  3WCW A;  1MTI A;  4F0T A;  4YJJ B;  1Y0W A;  2PEG B;  1HGA B;  1TES A;  2GTL C;  1FCS A;  3HEP A;  2HZ3 A;  2C7K A;  1VHB A;  1J7Y A;  3HXN A;  3MJU A;  3TM9 A;  1MLJ A;  1DO1 A;  3RQR A;  2BNL A;  1B8D A;  1Y8H A;  1Y09 A;  2ZLT B;  1PBX A;  2W6W A;  1C7B B;  5IKS A;  1JL6 A;  1LFL A;  1IBE B;  3OZV A;  1RPS A;  1IT2 A;  1R1X A;  2RI4 B;  2HHE A;  1Y4R A;  4ZVB A;  2AA1 B;  1MNK A;  2W6V B;  3IA3 B;  1MLQ A;  1YEN B;  3BA2 A;  2G12 A;  5CNB A;  4L1E B;  1GCV B;  1WMU B;  1C40 A;  3QJC B;  1CG5 A;  1Y35 A;  3QJE A;  5CN6 A;  2ZS0 C;  1XYE B;  1LHT A;  3S65 B;  1VXB A;  1HAC B;  2OH8 A;  4F0U A;  3K8B B;  2EVK A;  4HRT B;  1COH B;  2QRW A;  3R5I B;  3WCW D;  4NS2 A;  4ESU A;  3BJ3 B;  4F0U B;  2ZSX A;  1Y4V A;  2ZS0 A;  3DHR B;  3TLD A;  2MGG A;  3WCP A;  1OUT B;  3WHM B;  2QLS B;  1Y85 B;  2R4Z A;  2VYZ A;  1C7D A;  2V1G A;  2V1E A;  1WAC A;  2W6V A;  4HSW A;  4A8Y A;  2MGH A;  4WJG A;  2QMB A;  3ZJQ A;  1R1X B;  4MQC A;  1X46 A;  4M4A B;  1BZZ B;  1QSH B;  3GQP A;  3KVS B;  1ASH A;  1X9F C;  5AZR A;  4VHB A;  2ZSP A;  1JY7 A;  1JP8 A;  2D60 B;  4MQJ A;  1Y0D A;  5CND A;  1S0H B;  4AVD A;  4U8U B;  2VLZ A;  1UVJ A;  4HH0 A;  2ZSO A;  2B7H B;  4N8T A;  1MOB A;  3AQ9 A;  3NFE B;  1LFQ B;  4PNJ A;  2MGD A;  5KER B;  3VNC A;  1YHU C;  1HA7 B;  3ECX A;  3MOU A;  3PIA B;  1KTP B;  1QPW A;  1ABW B;  3NUH B;  4N7N B;  1MBD A;  1GDJ A;  3NML A;  4GXE A;  3BOM A;  1KN1 B;  2R50 A;  3E4N A;  1DXD A;  1MYF A;  1MYZ A;  1YHU A;  4FH6 A;  2ZLX B;  1DTM A;  2ZT0 A;  2VEB A;  4B4Y A;  1Y8I A;  1SDK A;  2HHD A;  3DUT A;  3GQG B;  4FWZ A;  1JEB B;  3BRP A;  1HBB A;  1Q1F A;  1LFZ B;  1F65 A;  4U8U C;  1YHU D;  1A3O B;  111M A;  1Y0D B;  3ARK A;  1GCW B;  1A6K A;  2W31 A;  2V1H A;  3GDJ B;  1JWN A;  1XDT T;  1A6G A;  3GKV A;  2EB8 A;  2IN4 A;  3MJP A;  3FS4 B;  1K1K B;  1SHR B;  2E2Y A;  1A0Z B;  1QSI B;  2V1I A;  3FS4 A;  3HF4 A;  3HEO A;  3QZX A;  2R80 B;  2SPO A;  3ZJI A;  2MGA A;  3MKB A;  3VRG B;  1YCB A;  3HRW B;  1G9V A;  2MYB A;  3QM9 A;  4F6D A;  1VXF A;  1A0U A;  1NGK A;  1CH2 A;  1JZM A;  1A00 B;  1M9P A;  1V9Q A;  3UHC A;  4MQG A;  1T1N B;  1BZ6 A;  2LH1 A;  1LTW A;  2BV8 B;  2GRH A;  3G46 A;  3UHU A;  1XQ5 B;  3WCU B;  3G4U A;  5CNE A;  3DBJ B;  4MQG B;  1MKO B;  4A8Q A;  3UHD A;  3S65 A;  3GYS B;  1YHU B;  5JDO F;  1TOX A;  1WMU A;  2EKT A;  1S5Y A;  1V5H A;  1YCA A;  4NK1 A;  2PGH A;  5E83 B;  2UUM A;  1MWC A;  4MQI A;  1MTK A;  4MQK B;  2H8D A;  5EET A;  2ZSY A;  3MJP B;  2HHE B;  3EOK B;  3SDH A;  3L0F B;  3GK9 A;  2FAM A;  3QJD A;  2MGC A;  3GDJ A;  1A9W A;  2J96 A;  1KD2 A;  4H2L B;  4N8T B;  1NIH B;  3ZJM A;  3E5O A;  4U8U A;  3FEW X;  1JZK A;  3LQ9 A;  3K3U A;  1BAB A;  1HBI A;  3QM5 A;  1O1I A;  2H8F A;  3A5G A;  2MGI A;  1CII A;  1Y4B A;  1J7W A;  1NZ3 A;  2G0V A;  1LFV A;  2MYA A;  1CPC B;  1LJW B;  1Y22 A;  1HBS B;  2O5B X;  2MGJ A;  1NS9 B;  4GXE B;  1LFY A;  1N9I A;  1VWT A;  4PQB A;  1SPG B;  1RTX A;  5ILM A;  3BJ1 A;  1NY9 A;  3WFU A;  1K0Y A;  3UHN A;  1HCO B;  1KTP A;  1Y5F A;  2VHB A;  3GUQ A;  3IC0 B;  1MLH A;  1JP6 A;  3VHB A;  2HZ2 A;  2MGL A;  3DBJ A;  1YEV B;  1ALL A;  3CY5 A;  1YOI A;  3AQ6 A;  2W72 A;  2RAO A;  4IRO B;  3QZZ A;  2MGK A;  5HY8 B;  3EDA A;  2C7L B;  2V1F A;  3M3B A;  4DC8 A;  2ZFB B;  3UHH A;  3EU1 B;  4L7Y B;  5B13 G;  1YGD A;  3UHG A;  3QJC A;  5ILR A;  4L1E A;  4MBA A;  2R80 A;  3LHB A;  1KFR A;  2UUL B;  1DXT A;  2DXM B;  1K1K A;  1MLN A;  1FDH A;  2AV0 A;  1H97 A;  4HSX A;  2GLN A;  3O18 A;  5CNF A;  3OVU C;  3KMF A;  2G14 A;  2VML A;  1NS6 B;  3IXF A;  1Y83 A;  3WHM A;  2IG3 A;  1CMY A;  2I88 A;  1Y4V B;  1VRE A;  2Z6T A;  3BRP B;  3W4U A;  2C7J A;  1J7Y B;  2O5S X;  1MNH A;  1XZ2 A;  3CY5 B;  1SDK B;  1Y46 A;  4O4Z A;  2HBS A;  3ONZ A;  1LH3 A;  2MHB B;  3PT7 A;  1Z8U B;  1Y0W B;  2CMM A;  1AJ9 B;  3EDB A;  1HCO A;  2JHO A;  1HBH B;  3RJ6 A;  1YOH A;  4PQC A;  1LFY B;  4XXI A;  3ZJR A;  2AV3 A;  1G08 B;  2VLY A;  4G1B A;  2LH5 A;  2DKA A;  1Y7D B;  4AE1 A;  1YDZ A;  1Y09 B;  3ZOM A;  1Y0T A;  4XXK A;  2MGB A;  1O1I B;  2H8F B;  1YDZ B;  1F63 A;  2FRK X;  1DKE A;  1O1P A;  1S0H A;  4F6I A;  2BK9 A;  5HLQ A;  1O1L A;  1BZR A;  2EF2 A;  1BZZ A;  1QSH A;  3LQD B;  5B84 A;  2PEG A;  2O5T X;  3UHY A;  2W6Y A;  4L2M A;  1UFP A;  1A3N B;  4BJA A;  3MWN A;  1BVD A;  4ODC A;  1MLG A;  4UIQ A;  4KJT A;  1XCH A;  3H57 A;  1Y85 A;  1Y4P B;  1G09 B;  2BLI A;  1HHO B;  1XY0 B;  4NXA A;  1I7Y A;  3BJ3 A;  4X0L B;  1GZX A;  1YE0 A;  2LHB A;  1DXC A;  1CIK A;  1UVI A;  3NFE A;  1XQ5 A;  3WCU A;  1J3Z A;  2BV8 A;  5D5R A;  5D1V A;  1BIJ B;  1CO9 A;  2B7H A;  3W4U B;  1LHS A;  3CIU B;  1T1N A;  5C6E B;  1GH0 A;  3NMM A;  1CPW A;  2ZLV B;  4MAX A;  1MOH A;  3O18 B;  2EKU A;  1Y35 B;  3R0G A;  3FH9 A;  3G4Y A;  5AB8 A;  2VYW A;  1UX8 A;  1CO8 A;  1Y5J B;  3WCU D;  3WCT A;  1B86 B;  1VXE A;  1A0Z A;  1QSI A;  1YZI B;  2DXM A;  3ZJL A;  2C7L A;  4GZG A;  3CIU A;  2G0X A;  4DWT A;  1PHN A;  3WCV D;  1BIJ A;  1JPB A;  4PO5 A;  1NEJ B;  2MB5 A;  4M4B A;  2ZFB A;  1GDL A;  1PMB A;  5HAV A;  1ON7 B;  2ZSS A;  3PI9 A;  3HXN B;  1RQA B;  4ZVA A;  1QXE A;  1Y7Z B;  1DUK A;  1V75 A;  2BLH A;  2HHD B;  1Y7G B;  1NS9 A;  1YEU A;  1MDT A;  4NI1 B;  1BUW B;  2GTL B;  1WLA A;  1HGB A;  1Y2Z B;  1MLR A;  3ZOL A;  2ZLW B;  2EVP A;  3RGK A;  1C40 B;  1Y7G A;  1MYT A;  1SPG A;  1VXA A;  2VRY A;  1IT3 A;  1Y45 A;  2DN2 B;  2H35 B;  1Y22 B;  1O1N B;  1O1O B;  110M A;  5SW7 B;  1GDK A;  1LJW A;  1NIH A;  3UBC A;  3UGY A;  1OFK A;  5JDO D;  3KUO A;  5KER A;  2MYE A;  3O7N A;  5JDO E;  1HGC A;  1DXV B;  2ZS1 D;  4GY3 B;  4F6F A;  3M3A A;  3A9M A;  1MWB A;  2H8D B;  4ROL B;  2M6Z B;  2SPM A;  1YHR B;  2C7K B;  1Y8W A;  2NRM A;  2SPN A;  2WTH A;  1SDL B;  1XZ5 B;  1S5Y B;  3QQR A;  4ESA B;  1HDA B;  2GDM A;  1Y31 B;  2UUL D;  4MQC B;  1EW6 A;  2ZWJ A;  1UIW A;  2BMM A;  1JBO A;  2D5X B;  2V8A B;  1AJ9 A;  1J41 A;  1BUW A;  2GTL A;  5E6E A;  1Y8K B;  4A8F A;  2PGH B;  1MBC A;  1R1Y B;  2HCO B;  3DHT B;  1MLO A;  3B75 A;  4ETT A;  1I3E A;  1RQA A;  1MLF A;  2JLF A;  1MNO A;  1LH7 A;  1SI4 A;  4ILZ A;  1NS6 A;  1GJN A;  2D2N D;  1BVC A;  4RMP A;  4ODC B;  4O4T A;  1R1Y A;  1S56 A;  102M A;  1X9F D;  3ZJN A;  1YZI A;  3WCV A;  2X4A A;  1MOA A;  3HRW A;  1OBM A;  1NXF A;  1IRD A;  1A9W E;  3BJ2 B;  1ABY B;  1X9F A;  1DKE B;  104M A;  1YMB A;  2GKN A;  3WFX A;  2AA1 A;  3KMF C;  4TMA B;  1J3F A;  1MYJ A;  1RPS B;  4IRO A;  2SPL A;  2QSS B;  2V1K A;  3WFT A;  1ALL B;  3QQQ A;  2YSK A;  4X0L A;  4YU3 A;  3E55 A;  1HRM A;  1GBU A;  3WI8 A;  1XY0 A;  1Y5F B;  3IC0 A;  1O1N A;  1Y4P A;  4O35 A;  3LR9 A;  4FH7 A;  3UHX A;  1GDI A;  1VWT B;  2HCO A;  1S5X B;  5CMV A;  1RQ4 B; 
#chains in the Genus database with same CATH homology
 4F6J A;  1SPE A;  4HHB A;  5EV5 A;  5ILE A;  1J7W B;  1Y4B B;  1SDL A;  1XZ5 A;  1Y8W B;  2DN3 A;  1Y7Z A;  1HV4 B;  2QSP B;  1HAB B;  1IDR A;  1CMY B;  2D60 A;  3A5B A;  4MQJ B;  1JY7 B;  1MBN A;  1J7S B;  2DN1 B;  1NQP B;  1NEJ A;  2NSR A;  1HLB A;  2MGE A;  1LFQ A;  1UX9 A;  1N9X A;  1G08 A;  4NK2 A;  2G3H A;  1SWM A;  5E83 A;  1ABY A;  1MTJ A;  1XZV B;  1MBI A;  2HBF A;  1Y4G A;  2BKM A;  1DLW A;  1X3K A;  5EOH A;  1FN3 A;  1Y0A B;  1JP9 A;  1MWD A;  3IC2 A;  1NPF A;  2QMB B;  1HGB B;  3A59 B;  2O58 X;  4AVE A;  2OH9 A;  3PI8 B;  2LH3 A;  4WJG 1;  3ONZ B;  2XKI A;  4O1T A;  2RAO B;  1V75 B;  1OR6 A;  3D1K A;  3ZJH A;  3UHV A;  3U3E A;  112M A;  2ZS0 B;  4FWX A;  1G9V B;  1EBC A;  3D1K B;  3QM7 A;  5CN8 A;  1F5O A;  3E5I A;  3DHT A;  5KDQ A;  1UMO A;  1BJE A;  3UHS A;  4DC7 A;  3RJN B;  1U7S A;  1GBV B;  3VRF B;  3ZJJ A;  1O1K B;  4H0B A;  1DUO A;  3ORD A;  2HBF B;  1NWI A;  1YEN A;  2ZLV A;  4TYX A;  3UHQ A;  5JDO C;  5C6E A;  4IT8 A;  2D5Z A;  5HBI A;  1F5P A;  3G52 A;  2C0K A;  4C0N A;  3GKT A;  1B0B A;  1KD2 B;  2W72 B;  2ZLT A;  1HJT A;  3UHW A;  2WTG A;  1C7C A;  2OHB A;  3MJU B;  1YOG A;  1KR7 A;  1HV4 A;  3BJ1 B;  4ROM A;  3PI4 A;  4NI0 B;  4N7P A;  1HDS A;  3HYU B;  4B3W A;  2D2M A;  2LH6 A;  1CBM A;  1Y2Z A;  1HBS A;  2HBC A;  3WR1 A;  3PIA A;  1DO7 A;  3ARL A;  3GOU A;  1A01 B;  4NI1 A;  3LR7 A;  4XDI A;  1THB B;  2DHB A;  3QJB A;  2VM0 A;  1BAB B;  2R4W A;  1YMC A;  2D2M C;  2YRS A;  4G1V A;  3PEL A;  1YVT A;  5CN5 A;  1A0U B;  1GBU B;  1MNJ A;  5HLU A;  2AUR A;  3VRE B;  1UVX A;  1LUE A;  1WVP A;  4SDH A;  3MYM A;  1A6N A;  1X9F B;  5M3S A;  1EWA A;  1B86 A;  5EUI B;  3UH5 A;  3QM8 A;  3FH9 B;  3EU1 A;  4L7Y A;  3NG6 A;  5KKK A;  5F2A A;  1A3O A;  3DHR A;  3WCP B;  1W92 A;  2XYK A;  2ZSZ A;  2GNW A;  3S66 B;  3GQG A;  1GLI B;  1MYH A;  2DHB B;  3QJB B;  1COH A;  1Y8I B;  1HDB B;  3D1A A;  2W72 C;  1HAC A;  2D6C A;  1UT0 A;  2Z85 A;  1G09 A;  1K0Y B;  1CQX A;  1CG5 B;  3LB2 A;  3O89 A;  4H07 A;  1MZ0 A;  1BZP A;  4N7P B;  1A3N A;  1Y5K B;  2Z6N A;  3BCQ B;  4DWU A;  1JZL A;  1YGF A;  3K9Z A;  4UUR A;  1YIE B;  1M6C A;  5MBN A;  3MVC A;  4OF9 A;  3S48 C;  2MYC A;  3GKV B;  1FSL A;  1DO3 A;  1YGD B;  1HBG A;  3AQ7 A;  1V4W A;  2ZS1 A;  1XZ4 A;  3WCT C;  1HBB B;  3GQR A;  3OO5 B;  1V4W B;  5HU6 B;  1DXV A;  1YG5 B;  2Z6S A;  3ZJO A;  4M4A A;  1CP5 A;  1FSX B;  2HBE A;  4G51 A;  3A0G A;  1HBR B;  5EYJ A;  2ZLU B;  1Y0C A;  3MYN A;  1DLY A;  4XS0 B;  2Z6N B;  1J40 B;  3BCQ A;  1LA6 A;  1N9F A;  1C7D B;  1HBH A;  4N7N A;  1NZ2 A;  1O1M A;  1QPW B;  5HLX A;  5EE4 D;  1OUT A;  3AQ5 A;  3OO4 B;  2HBS B;  1QXD A;  1YHE A;  1XZU A;  1Y4Q B;  3S66 A;  1NZ5 A;  2D2N C;  4TWV A;  2BLJ M;  4NZI A;  1YEQ B;  3PI8 A;  1DXU A;  2QU0 B;  1XYE A;  3QJE B;  3QJD B;  3OK5 A;  2MYD A;  2ZFO A;  1DTI A;  3AT5 B;  1YE2 A;  4XS0 A;  1Y0C B;  1YFF B;  1M6M A;  1SHR A;  4MQI B;  4FC3 A;  1CQ2 A;  2ZFO B;  1XZ7 B;  1YVQ B;  1CH4 A;  2DC3 A;  1G0B A;  4N7O A;  1YVT B;  2ZS1 C;  1MKO A;  1HAB A;  5CNC A;  5HY8 A;  1NWN A;  1FDH G;  2DN3 B;  1RSE A;  2FRJ X;  2OHA A;  1AZI A;  1CBL A;  1YHE B;  1THB A;  1GZX B;  1LH5 A;  3HEN A;  3UHI A;  1A01 A;  2LH2 A;  2HBC B;  3WR1 B;  2GRF A;  1D8U A;  1RQ4 A;  1YGF B;  3G4W A;  1HBA A;  1MLS A;  5CHQ A;  2NSS A;  5JOM A;  5CN7 A;  1MLK A;  5ILP A;  3WTG A;  2NX0 A;  3A0G B;  3UHR A;  2ZT1 A;  2HBE B;  3LB1 A;  1Y01 B;  4MXL A;  5MBA A;  3QM6 A;  1LFL B;  3WCT D;  1MYG A;  1C7B A;  1QI8 B;  2O5O X;  1YG5 A;  3ZJP A;  1BZ0 B;  5CN4 A;  2ZFO D;  2ZS1 B;  1YVQ A;  1CH1 A;  1JEB A;  2BWH A;  3DUT B;  1Y0T B;  3UHK A;  2O5M X;  1HGA A;  1IOP A;  4HBI A;  2ZFO C;  3EOK A;  6HBI A;  3VRF A;  3M39 A;  1CG8 B;  1YIE A;  3WCW B;  5E29 A;  3WCU C;  4KMV A;  3P5Q A;  1YE2 B;  1N9H A;  3PI1 A;  1GVH A;  3BOM B;  1Y4F B;  1JL7 A;  109M A;  4PQ6 A;  1IWH A;  1J3Y A;  1MYM A;  3NL7 A;  3HHB A;  2HBD A;  1ABW A;  3SDN A;  2VLX A;  2QLS A;  2HBG A;  3A2G A;  4F69 A;  4JYQ A;  1YEQ A;  1CH9 A;  1J52 A;  1JDO A;  5JGG A;  1GLI A;  1XZ2 B;  1BIN A;  1MOC A;  1A00 A;  1M9P B;  3GOU B;  1Y83 B;  1UIW B;  1O1M B;  3UH3 A;  2VYY A;  3HHB B;  1BZ1 B;  3KUN A;  4NI0 A;  1OUU B;  5E29 B;  2AUP A;  3ODQ A;  2G0S A;  2GL3 A;  1O1J B;  4OOD A;  4JAC A;  1UFJ A;  2RI4 A;  3S1J A;  3PI2 A;  3D17 A;  2QFN A;  3OJ1 A;  2GRZ A;  2LH7 A;  1XZ4 B;  2ZST A;  2D5Z B;  1Y45 B;  1L2K A;  1QI8 A;  3PI3 A;  2ZLX A;  2D2N A;  1GBV A;  4MBN A;  2GNV A;  1V4X A;  3MBA A;  1HDS B;  5EQM A;  5KDQ B;  1IRC A;  1LA6 B;  1MLL A;  3A5A A;  1QXE B;  1V4U A;  2ZLU A;  1V4X B;  4G51 B;  1Y4R B;  3UHZ A;  2HHB A;  4F4O B;  4YU3 B;  1HDB A;  3D1A B;  3AT6 B;  4HRR B;  1Y8H B;  1URY A;  3AQ8 A;  1EBT A;  5EE4 C;  3SZK B;  3OZU A;  3G4Q A;  1RQ3 B;  2MGF A;  1G0B B;  4H2L A;  2MGM A;  1OUU A;  3NG6 B;  3UBV A;  3IC2 B;  1G0A B;  1XZ7 A;  5EYS A;  3GQP B;  1YH9 A;  3D17 B;  4YU4 A;  1IRD B;  1OR4 A;  3WCW C;  1H1X A;  101M A;  3UH6 A;  2GKM A;  3ED9 A;  1MBS A;  1YFF A;  6HBW B;  1AJG A;  1Y5K A;  5C6Y A;  2W6X A;  1VXC A;  1UC3 A;  1DWS A;  1BZ1 A;  1NQP A;  1MBO A;  1J7S A;  1YMA A;  2FRI X;  3GYS A;  1DO4 A;  5EU2 A;  1HHO A;  1NZ4 A;  3LB4 A;  4F6B A;  1TU9 A;  1CH5 A;  3R5I A;  1YIH B;  3K8B A;  4HRT A;  1Y7C A;  6HBW A;  1ECN A;  3MKB B;  3VRG A;  1FLP A;  3HYU A;  1GCV A;  1XXT B;  1Y4F A;  1O1L B;  1G0A A;  1U7R A;  1LH6 A;  3DR9 A;  3HF4 B;  1LFT B;  1CLS B;  1HBR A;  1I3D A;  1HLM A;  1BZ0 A;  2ZT2 A;  4F68 A;  2G0R A;  3ARJ A;  2WY4 A;  2G11 A;  3AT6 A;  2DN1 A;  1MDN A;  4HRR A;  1JF3 A;  5CNG A;  5HU6 A;  4LPI A;  1JF4 A;  1MLU A;  2HZ1 A;  5SW7 A;  1LFZ A;  1VXG A;  2VEE A;  2YRS B;  1V4U B;  1DM1 A;  3BJ2 A;  2ZT3 A;  1S69 A;  1VRF A;  2ZSR A;  3WTG B;  106M A;  1MNI A;  2D2M B;  1BBB A;  1VXD A;  1HBA B;  4ROM B;  1V07 A;  3UI0 A;  1SI4 B;  1AJH A;  3D4X B;  4N7O B;  3PI9 B;  108M A;  1C7C B;  3LB3 A;  3OGB A;  4MQH A;  103M A;  4UZV A;  7HBI A;  1MLM A;  2OLP A;  1FAW B;  4FC3 B;  3M38 A;  1J41 B;  3ODQ B;  3A59 A;  1CLS A;  1DXT B;  2D5X A;  4MPM A;  1DWT A;  3WCT B;  1YEO B;  2Z8A A;  3WCV C;  3V2Z A;  1Y4G B;  1YEO A;  1XZV A;  3QMA A;  3UHT A;  1DXU B;  4ROL A;  3NMM B;  1Y7C B;  3H58 A;  3SZK A;  2R1H A;  4MXK A;  1FAW A;  2FRF A;  4QAU A;  1Y4Q A;  5JGG B;  1YEV A;  1ECA A;  3G4R A;  3D4X A;  3UHB A;  3UGZ A;  3PEL B;  2QSP A;  4F6G A;  1CIO A;  3B75 B;  1XZU B;  2R1H B;  3G53 A;  1QXD B;  1MOD A;  5AZQ A;  2OIF A;  1Y8K A;  3OO4 A;  5B85 A;  1CG8 A;  2O5L X;  1RVW B;  3GLN A;  1LFV B;  1Y31 A;  1YEU B;  3LQD A;  1HDA A;  1YH9 B;  4YU4 B;  1MYI A;  1ECD A;  3ZJS A;  2ZSQ A;  3MN0 A;  2R4X A;  1OJ6 A;  2R4Y A;  2M6Z A;  2BW9 M;  3ZHW A;  1O1P B;  3UH7 A;  5CHR A;  2AUQ A;  4U8U D;  1HGC B;  1FSX A;  1IBE A;  1PBX B;  4KN3 A;  3WFW A;  2D2M D;  1ECO A;  2QSS A;  1UVY A;  4O2G A;  4MQH B;  3OZW A;  1Y7D A;  3UHE A;  3GQR B;  3OO5 A;  1O1O A;  4MQK A;  1MBA A;  1LFT A;  1O16 A;  1ABS A;  1S61 A;  1LH2 A;  1A6M A;  2ZLW A;  1O1K A;  1JW8 A;  1RVW A;  3WCV B;  1S6A A;  2D2N B;  1LH1 A;  1VXH A;  2MBW A;  3S1I A;  3HC9 A;  1A4F B;  4KMW A;  2MHB A;  3PT7 B;  2QFK A;  1URV A;  1Y46 B;  2NRL A;  1S5X A;  4NXC A;  3TM3 A;  1J3Z B;  1HSY A;  3VAU A;  107M A;  1EMY A;  1YE0 B;  1RTE A;  3ECZ A;  1MCY A;  3ZH0 A;  1DWR A;  4M4B B;  3AG0 A;  3NL7 B;  3P5Q B;  3PT8 B;  5E6E B;  4FWY A;  1O1J A;  2O5Q X;  2ZT4 A;  2ZS0 D;  3D7O A;  2G0Z A;  1FHJ B;  3AT5 A;  1Y5J A;  5F0B A;  2XKG A;  1FN3 B;  1Y0A A;  1XXT A;  105M A;  4ESA A;  3VRE A;  5EUI A;  1FHJ A;  2QU0 A;  1YHR A;  3D7O B;  1GCW A;  1NPG A;  3ASE A;  3ECL A;  1RQ3 A;  3PT8 A;  5CN9 A;  2XKH A;  4WCH D;  1YIH A;  1OFJ A;  4MU5 A;  2KSC A;  2HHB B;  4F4O A;  4TWU A;  2ZSN A;  2EB9 A;  4C44 A;  1CH7 A;  2V1J A;  2G10 A;  2DN2 A;  2H35 A;  2HBD B;  1NAZ A;  1CH3 A;  1IWH B;  1J3Y B;  2GTL D;  1ITH A;  1CP0 A;  3G4V A;  1MGN A;  1BBB B;  2FAL A;  1J40 A;  3V2V A;  1A4F A;  4HHB B;  2AUO A;  3WCW A;  1MTI A;  1Y0W A;  2PEG B;  1HGA B;  1TES A;  2GTL C;  1FCS A;  3HEP A;  2HZ3 A;  1VHB A;  1J7Y A;  3HXN A;  3MJU A;  3TM9 A;  1MLJ A;  1DO1 A;  2BNL A;  1Y8H A;  1Y09 A;  2ZLT B;  1PBX A;  2W6W A;  1C7B B;  5IKS A;  1JL6 A;  1LFL A;  1IBE B;  3OZV A;  1RPS A;  1IT2 A;  1R1X A;  2RI4 B;  2HHE A;  1Y4R A;  4ZVB A;  2AA1 B;  1MNK A;  2W6V B;  3IA3 B;  1MLQ A;  1YEN B;  3BA2 A;  2G12 A;  5CNB A;  1GCV B;  1WMU B;  1C40 A;  3QJC B;  1CG5 A;  1Y35 A;  3QJE A;  5CN6 A;  2ZS0 C;  1XYE B;  1LHT A;  3S65 B;  1VXB A;  1HAC B;  2OH8 A;  3K8B B;  2EVK A;  4HRT B;  1COH B;  2QRW A;  3R5I B;  3WCW D;  4NS2 A;  3BJ3 B;  2ZSX A;  1Y4V A;  2ZS0 A;  3DHR B;  3TLD A;  2MGG A;  3WCP A;  1OUT B;  3WHM B;  2QLS B;  1Y85 B;  2R4Z A;  2VYZ A;  1C7D A;  2V1G A;  2V1E A;  2W6V A;  4HSW A;  2MGH A;  4WJG A;  2QMB A;  3ZJQ A;  1R1X B;  4MQC A;  1X46 A;  4M4A B;  1BZZ B;  1QSH B;  3GQP A;  1ASH A;  1X9F C;  5AZR A;  4VHB A;  2ZSP A;  1JY7 A;  1JP8 A;  2D60 B;  4MQJ A;  1Y0D A;  5CND A;  1S0H B;  4AVD A;  4U8U B;  2VLZ A;  2ZSO A;  2B7H B;  4N8T A;  1MOB A;  3AQ9 A;  3NFE B;  1LFQ B;  4PNJ A;  2MGD A;  5KER B;  1YHU C;  3ECX A;  3MOU A;  3PIA B;  1QPW A;  1ABW B;  4N7N B;  1MBD A;  1GDJ A;  3NML A;  3BOM A;  2R50 A;  3E4N A;  1DXD A;  1MYF A;  1MYZ A;  1YHU A;  4FH6 A;  2ZLX B;  1DTM A;  2ZT0 A;  2VEB A;  4B4Y A;  1Y8I A;  1SDK A;  2HHD A;  3DUT A;  3GQG B;  4FWZ A;  1JEB B;  1HBB A;  1Q1F A;  1LFZ B;  1F65 A;  4U8U C;  1YHU D;  1A3O B;  111M A;  1Y0D B;  3ARK A;  1GCW B;  1A6K A;  2W31 A;  2V1H A;  3GDJ B;  1JWN A;  1A6G A;  3GKV A;  2EB8 A;  2IN4 A;  3MJP A;  3FS4 B;  1K1K B;  1SHR B;  2E2Y A;  1A0Z B;  1QSI B;  2V1I A;  3FS4 A;  3HF4 A;  3HEO A;  3QZX A;  2R80 B;  2SPO A;  3ZJI A;  2MGA A;  3MKB A;  3VRG B;  1YCB A;  3HRW B;  1G9V A;  2MYB A;  3QM9 A;  4F6D A;  1VXF A;  1A0U A;  1NGK A;  1CH2 A;  1JZM A;  1A00 B;  1M9P A;  1V9Q A;  3UHC A;  4MQG A;  1T1N B;  1BZ6 A;  2LH1 A;  1LTW A;  2GRH A;  3G46 A;  3UHU A;  1XQ5 B;  3WCU B;  3G4U A;  5CNE A;  4MQG B;  1MKO B;  3UHD A;  3S65 A;  3GYS B;  1YHU B;  5JDO F;  1WMU A;  2EKT A;  1S5Y A;  1V5H A;  1YCA A;  4NK1 A;  2PGH A;  5E83 B;  1MWC A;  4MQI A;  1MTK A;  4MQK B;  2H8D A;  5EET A;  2ZSY A;  3MJP B;  2HHE B;  3EOK B;  3SDH A;  3GK9 A;  2FAM A;  3QJD A;  2MGC A;  3GDJ A;  1A9W A;  1KD2 A;  4H2L B;  4N8T B;  1NIH B;  3ZJM A;  3E5O A;  4U8U A;  1JZK A;  3K3U A;  1BAB A;  1HBI A;  3QM5 A;  1O1I A;  2H8F A;  3A5G A;  2MGI A;  1Y4B A;  1J7W A;  1NZ3 A;  2G0V A;  1LFV A;  2MYA A;  1LJW B;  1Y22 A;  1HBS B;  2O5B X;  2MGJ A;  1NS9 B;  1LFY A;  1N9I A;  1VWT A;  4PQB A;  1SPG B;  1RTX A;  5ILM A;  3BJ1 A;  3WFU A;  1K0Y A;  3UHN A;  1HCO B;  1Y5F A;  2VHB A;  3IC0 B;  1MLH A;  1JP6 A;  3VHB A;  2HZ2 A;  2MGL A;  1YEV B;  3CY5 A;  1YOI A;  3AQ6 A;  2W72 A;  2RAO A;  4IRO B;  3QZZ A;  2MGK A;  5HY8 B;  3EDA A;  2V1F A;  3M3B A;  4DC8 A;  2ZFB B;  3UHH A;  3EU1 B;  4L7Y B;  1YGD A;  3UHG A;  3QJC A;  5ILR A;  4MBA A;  2R80 A;  3LHB A;  1KFR A;  1DXT A;  2DXM B;  1K1K A;  1MLN A;  1FDH A;  2AV0 A;  1H97 A;  4HSX A;  2GLN A;  5CNF A;  3OVU C;  3KMF A;  2G14 A;  1NS6 B;  3IXF A;  1Y83 A;  3WHM A;  2IG3 A;  1CMY A;  1Y4V B;  1VRE A;  2Z6T A;  3W4U A;  1J7Y B;  2O5S X;  1MNH A;  1XZ2 A;  3CY5 B;  1SDK B;  1Y46 A;  4O4Z A;  2HBS A;  3ONZ A;  1LH3 A;  2MHB B;  3PT7 A;  1Z8U B;  1Y0W B;  2CMM A;  1AJ9 B;  3EDB A;  1HCO A;  2JHO A;  1HBH B;  3RJ6 A;  1YOH A;  4PQC A;  1LFY B;  3ZJR A;  2AV3 A;  1G08 B;  2VLY A;  4G1B A;  2LH5 A;  1Y7D B;  1YDZ A;  1Y09 B;  3ZOM A;  1Y0T A;  2MGB A;  1O1I B;  2H8F B;  1YDZ B;  1F63 A;  2FRK X;  1DKE A;  1O1P A;  1S0H A;  4F6I A;  2BK9 A;  5HLQ A;  1O1L A;  1BZR A;  2EF2 A;  1BZZ A;  1QSH A;  3LQD B;  5B84 A;  2PEG A;  2O5T X;  3UHY A;  2W6Y A;  4L2M A;  1UFP A;  1A3N B;  4BJA A;  1BVD A;  4ODC A;  1MLG A;  4UIQ A;  4KJT A;  1XCH A;  3H57 A;  1Y85 A;  1Y4P B;  1G09 B;  2BLI A;  1HHO B;  1XY0 B;  4NXA A;  3BJ3 A;  4X0L B;  1GZX A;  1YE0 A;  2LHB A;  1DXC A;  1CIK A;  3NFE A;  1XQ5 A;  3WCU A;  1J3Z A;  5D5R A;  5D1V A;  1BIJ B;  1CO9 A;  2B7H A;  3W4U B;  1LHS A;  3CIU B;  1T1N A;  5C6E B;  3NMM A;  1CPW A;  2ZLV B;  4MAX A;  1MOH A;  2EKU A;  1Y35 B;  3R0G A;  3FH9 A;  3G4Y A;  5AB8 A;  2VYW A;  1UX8 A;  1CO8 A;  1Y5J B;  3WCU D;  3WCT A;  1B86 B;  1VXE A;  1A0Z A;  1QSI A;  1YZI B;  2DXM A;  3ZJL A;  4GZG A;  3CIU A;  2G0X A;  4DWT A;  3WCV D;  1BIJ A;  1JPB A;  1NEJ B;  2MB5 A;  4M4B A;  2ZFB A;  1GDL A;  1PMB A;  5HAV A;  2ZSS A;  3PI9 A;  3HXN B;  1RQA B;  4ZVA A;  1QXE A;  1Y7Z B;  1DUK A;  1V75 A;  2BLH A;  2HHD B;  1Y7G B;  1NS9 A;  1YEU A;  4NI1 B;  1BUW B;  2GTL B;  1WLA A;  1HGB A;  1Y2Z B;  1MLR A;  3ZOL A;  2ZLW B;  2EVP A;  3RGK A;  1C40 B;  1Y7G A;  1MYT A;  1SPG A;  1VXA A;  2VRY A;  1IT3 A;  1Y45 A;  2DN2 B;  2H35 B;  1Y22 B;  1O1N B;  1O1O B;  110M A;  5SW7 B;  1GDK A;  1LJW A;  1NIH A;  3UBC A;  3UGY A;  1OFK A;  5JDO D;  3KUO A;  5KER A;  2MYE A;  3O7N A;  5JDO E;  1HGC A;  1DXV B;  2ZS1 D;  4F6F A;  3M3A A;  3A9M A;  1MWB A;  2H8D B;  4ROL B;  2M6Z B;  2SPM A;  1YHR B;  1Y8W A;  2NRM A;  2SPN A;  2WTH A;  1SDL B;  1XZ5 B;  1S5Y B;  3QQR A;  4ESA B;  1HDA B;  2GDM A;  1Y31 B;  4MQC B;  1EW6 A;  2ZWJ A;  1UIW A;  2BMM A;  2D5X B;  1AJ9 A;  1J41 A;  1BUW A;  2GTL A;  5E6E A;  1Y8K B;  2PGH B;  1MBC A;  1R1Y B;  2HCO B;  3DHT B;  1MLO A;  3B75 A;  1I3E A;  1RQA A;  1MLF A;  1MNO A;  1LH7 A;  1SI4 A;  4ILZ A;  1NS6 A;  1GJN A;  2D2N D;  1BVC A;  4ODC B;  4O4T A;  1R1Y A;  1S56 A;  102M A;  1X9F D;  3ZJN A;  1YZI A;  3WCV A;  1MOA A;  3HRW A;  1OBM A;  1NXF A;  1IRD A;  1A9W E;  3BJ2 B;  1ABY B;  1X9F A;  1DKE B;  104M A;  1YMB A;  2GKN A;  3WFX A;  2AA1 A;  3KMF C;  1J3F A;  1MYJ A;  1RPS B;  4IRO A;  2SPL A;  2QSS B;  2V1K A;  3WFT A;  3QQQ A;  4X0L A;  4YU3 A;  3E55 A;  1HRM A;  1GBU A;  3WI8 A;  1XY0 A;  1Y5F B;  3IC0 A;  1O1N A;  1Y4P A;  4O35 A;  3LR9 A;  4FH7 A;  3UHX A;  1GDI A;  1VWT B;  2HCO A;  1S5X B;  5CMV A;  1RQ4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...