5EYJA

Crystal structure of murine neuroglobin mutant v101f at 240 mpa pressure
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
148
structure length
148
Chain Sequence
RPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGFRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of neuroglobin plasticity highlighted by joint coarse-grained simulations and high pressure crystallography.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Neuroglobin
total genus 58
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 5eyjA00
1LTWA 1YHUB 1HDBA 1HDSB 3AT5A 3D4XA 2MBWA 1O1NB 3NMLA 2ZS0A 5EETA 4B3WA 3SDHA 2ZFOA 1RTEA 1FSXA 3D7OA 3M39A 1IWHA 3KMFA 3NL7B 2EKTA 3A5GA 1GZXA 1PBXA 1Y0TA 5CMVA 2GRFA 1G0BA 4TYXA 2OH9A 2W72B 4KMWA 2BLHA 3RGKA 3WCTD 1JEBA 1HRMA 1QPWA 2WY4A 3D17B 1CO9A 3GYSB 1Y5JB 1MTKA 3IC2A 3WCTB 1CH1A 5HU6A 2ZFOC 1HCOA 3HYUB 1HDAA 1SI4A 2MYBA 2SPLA 2EVKA 3KUOA 3VHBA 1LHTA 1LFVA 1DXVB 3MYNA 3PIAA 1LFLB 1UFPA 1B86A 1JY7B 1XZ4B 2W6VA 1O1LA 1XZ2B 1JP9A 1X9FB 1OUUB 1QXDB 1XZ7A 3M38A 1YEVB 2DN3A 1KD2B 1CH3A 3CY5B 3V2VA 1NS6B 4N7PB 3D1KA 1CLSB 3HRWB 4HRTB 1OFKA 4HRRA 1CH9A 1WVPA 4MXLA 1GDIA 1S61A 2PEGB 3LB2A 1YGDA 5EQMA 3BCQB 2GDMA 2HBGA 3WCWC 3PELA 2MHBB 4O2GA 1DKEA 2ZT0A 3MJUA 3EOKB 1Y4VA 3TM9A 5JGGB 1HGCA 1XCHA 5AB8A 1YEQB 1UT0A 1H97A 1A01A 3UHGA 2NSRA 1WMUA 3G53A 1YCAA 1SDKB 1A4FB 3LB3A 3K8BB 1Y22A 4YU3A 1A0UA 3QJCA 2XKIA 4ODCA 2DHBB 4G1VA 2QLSB 1F5OA 2EF2A 3VRGB 3ECZA 1BZ1B 1SPEA 107MA 3A9MA 1UIWB 1RQAB 1DO3A 110MA 1V4UA 2G0VA 3HXNB 1GLIA 3UHVA 3WTGB 2W6XA 3IC2B 2HBFB 6HBWB 1Y4QA 2R1HB 3AQ6A 1Y7GA 2AUOA 1O1KB 1CQ2A 1J3FA 1Y8KA 3UHKA 4PNJA 3QMAA 1FCSA 2G0RA 5CNBA 3ZJPA 4M4AA 1YE2B 1EBCA 3BJ3B 2MGAA 1V75B 1FN3B 5AZQA 1Y7DA 3WCWD 1NWIA 1A9WA 3LB1A 2O58X 4HRTA 1QI8B 2HHBA 1HBIA 3HHBB 1Y0DB 2YRSA 1NAZA 3UHQA 4IT8A 5KKKA 3ORDA 2WTGA 2OH8A 3DHRA 2LH2A 3MN0A 1YG5A 3WFXA 1Y4BA 3WCPB 1NXFA 1MBOA 2HHDA 1J3ZA 1URVA 1MWCA 1YGFB 3GDJB 112MA 2VLXA 1LH6A 1HBGA 1Y22B 2ZLTB 4YU3B 1GZXB 4VHBA 1YZIB 3ZJHA 2ZFOD 1S0HB 2VM0A 1Y83A 1MYHA 4UZVA 2DC3A 1M6MA 3HENA 3PI9A 2QSSA 1BABB 2ZSSA 1MYZA 2XYKA 1MLOA 1XY0A 4HSWA 4MQJA 1Y5KB 3WCTA 1MLJA 1VRFA 1PBXB 5E6EA 1NEJB 1HBHA 1Y7GB 3OZVA 1LFVB 2QSPB 1MBCA 2OIFA 4MQGB 3ODQA 1DO4A 2OLPA 4XS0A 1CH5A 4H07A 1OUUA 3AQ5A 4FC3B 2LH5A 1CMYB 1IRDA 3D1KB 1BINA 1DXTA 4M4BB 2O5BX 2H35B 2FRIX 3B75B 3QQQA 3GYSA 3BCQA 3UGZA 1A3OA 4L7YB 3PELB 3WCVC 2G12A 3RJ6A 1XQ5A 4L2MA 4DC7A 2WTHA 1Y4BB 1CLSA 2VEEA 1UMOA 2HCOA 1O1PB 1C7BA 3NG6A 2QFNA 2GTLC 1HSYA 3LR9A 1T1NA 1MGNA 2HBDB 1DXUA 5EOHA 3WCVD 3WHMB 1BZ1A 1MCYA 1S56A 1YIEA 5EE4D 5C6EB 3H58A 1M9PA 1MLHA 5E83A 1AJ9B 3A0GA 2LH3A 3WCVB 1BJEA 1A4FA 4ROMB 5EYJA 5IKSA 4ODCB 1Y8KB 1V5HA 2ZSOA 1NEJA 1HBHB 5CN9A 2EKUA 2R80B 3ZJNA 1R1YB 4O4ZA 3G46A 1YE0B 4KN3A 3EDBA 1J7YA 1BZZA 1CG8B 1QSIB 3HF4B 1A6MA 1CBLA 2QSPA 4MBNA 4NI0A 1X3KA 1JZKA 3UI0A 1N9FA 4XS0B 1DWTA 1JP6A 3LB4A 1MKOA 1YVTB 1MTJA 3UHSA 1IRDB 2G3HA 1GCVB 2QU0A 1K1KB 3D1AA 2GKMA 1Y46A 3LQDA 1MLRA 1V4UB 1J7WA 3AQ9A 3MOUA 1OUTA 2D60B 3OK5A 2ZT3A 5B84A 2ZSTA 1VXFA 1MZ0A 1O1KA 1MOAA 1LFZA 1DO1A 5SW7A 1VXAA 5CN4A 1HACB 1O1OB 2LH6A 2C0KA 1S69A 2ZSZA 1AZIA 2SPMA 3OGBA 3S1JA 1VXHA 1CP0A 1HHOB 3QJBA 1KFRA 1Y4RB 2R50A 2H8FB 2ZSNA 1YOHA 1C40B 1TU9A 3GDJA 1F5PA 3VRFA 1B0BA 2H8DA 1YHEA 1S5XB 1HGBB 1FHJB 1LH1A 3E5IA 4O1TA 2ZSQA 1ABSA 3G4WA 4F6BA 2ZS1C 2DN1A 1MOCA 1ECAA 3QJDB 2JHOA 3H57A 1N9HA 1Y0CA 4G51B 3ONZA 2RI4B 4PQ6A 3SZKA 4OODA 3PT7B 3GOUB 1HBRB 1MYFA 4MQGA 5EYSA 2ZLVB 3HF4A 2V1GA 5JOMA 4AVDA 1XZ5A 2HZ1A 1CMYA 1QSHA 3QM8A 1S0HA 1Y83B 1HGAA 3PI9B 1YFFB 3IA3B 3IC0A 2HBEB 1S5YB 1Y35A 3AQ7A 3PI8B 3UHYA 2QU0B 3OVUC 2DN2B 1MYJA 1YMAA 4MQJB 3MJPB 1ABWB 1MNIA 4F6IA 1GBVA 2D2MB 1JZLA 2G14A 1CQXA 2AUPA 3DR9A 4MQKA 3UHBA 1R1XB 2V1JA 1MYIA 1IBEB 4HHBB 5JDOF 2HHEA 3QM7A 1YMCA 3NG6B 4MQHA 2V1IA 1VXCA 3ODQB 2VHBA 2H35A 3S65B 1Y4FB 2ZSXA 1YH9B 1RSEA 1C7DB 4PQBA 4IROB 3LHBA 5F2AA 3EU1A 2EB9A 1M9PB 1SHRA 2ZFBA 1Y5FB 3D7OB 5HY8A 5CNGA 3ZJQA 1FSLA 4AVEA 1YHEB 1HDSA 2ZLXA 1HBSB 1HJTA 2GRHA 1ABYA 5CNDA 1DM1A 1Y0CB 4G51A 1QXEA 3SZKB 1CH2A 4N7OB 5HLXA 3P5QA 1AJ9A 2ZT4A 1LA6B 2GNVA 2MYEA 1HV4A 1NZ2A 1J3YB 1DXUB 1U7SA 5HU6B 3WCUB 1X9FC 5CN8A 1OR4A 1HDBB 2Z6NA 1HDAB 1A6KA 1XYEB 1XZVA 1YENB 4HBIA 2R80A 1K1KA 1YIEB 1MBIA 4ESAA 4H2LB 1CG8A 1FSXB 2ZWJA 2HBSB 1IWHB 3MJPA 2D6CA 1N9IA 3UHRA 4U8UD 1NQPB 2VYYA 4YU4B 3UBVA 1MLUA 2PEGA 3PIAB 1XXTB 3UHEA 2EVPA 1Y4FA 1RPSA 1G09B 1KD2A 4LPIA 3HRWA 1A01B 2MGLA 2ZS1D 3GK9A 3ZJJA 1HACA 4X0LB 1LFQA 1DXVA 1RQ3B 3QZZA 4C0NA 2ZS1B 1J41A 2GRZA 4O4TA 2LH1A 1X9FA 1Y4PA 1XZ7B 2O5SX 2VLZA 4N8TB 3ASEA 1VHBA 3S48C 5SW7B 3GOUA 2GTLD 2BK9A 1Y8WB 1HHOA 3QM6A 1CG5A 1Y2ZA 1VXBA 2R4YA 1Y4VB 1YFFA 6HBIA 2HZ2A 1Y7ZA 2MGGA 1S5YA 1C40A 1LFTA 5KERA 1XZVB 3WI8A 2Z6TA 4XDIA 1CO8A 2RI4A 1G9VB 3GQRA 1NPFA 5HAVA 1SPGA 4MU5A 109MA 1Y0AB 1Y4GB 4MQIB 1VXEA 1UFJA 1S5XA 1VWTA 3UH7A 2HBFA 3UH6A 1V07A 1Y01B 3WR1B 3G4UA 1R1XA 1MOHA 1F63A 2NRMA 3A59A 1YOIA 108MA 2HHBB 3D17A 1YCBA 1YVQA 3G4QA 1THBA 1EWAA 3OJ1A 3UBCA 4MXKA 1Y8HB 1Y8IA 1XZ5B 3HEOA 1V4WA 4F6DA 2HBCA 1GVHA 5EUIB 6HBWA 4KJTA 1IT2A 1MOBA 1Y35B 1JW8A 1J3ZB 2W72C 1LFLA 3ZJMA 1MLLA 1NS9B 1ABWA 1G08A 2MGEA 2ZLTA 1BUWB 1JF3A 1YEVA 1PMBA 4GZGA 4MQKB 1JPBA 1Y4PB 4KMVA 4F6GA 2AA1A 1YEUA 1QXEB 1GDLA 2MGCA 1YHUD 2GTLB 1HV4B 3G52A 1JDOA 1O16A 1UVYA 3AG0A 4DC8A 1CIOA 5JGGA 1MDNA 3OO4A 5E29B 1Y85B 1XZUA 1XYEA 4B4YA 4IROA 1URYA 3MYMA 3KUNA 5AZRA 5HY8B 1Y5KA 1Y45A 3K9ZA 1Y09B 1A0UB 5ILEA 1JWNA 5EU2A 1HBBB 2ZLXB 1GJNA 3WR1A 1DLWA 3AQ8A 4M4BA 3UHUA 1ECNA 3PI4A 1O1IB 1GBUB 2MYCA 4NXCA 1A3OB 2HBSA 4TWUA 2G10A 2ZS0C 1YHRB 4MAXA 3IXFA 1CH7A 2Z6NB 104MA 1BVDA 1G0AA 1DXTB 4TWVA 3UHHA 1J52A 2CMMA 1CH4A 1BZ6A 5C6YA 1AJGA 1MBNA 1OBMA 2D5ZB 2W31A 2HBDA 1O1MA 1BUWA 1NWNA 4N8TA 2BNLA 106MA 3EDAA 4F4OA 3AT6A 1I3EA 3E5OA 3KMFC 1X9FD 1Y0DA 1IOPA 2O5OX 1IRCA 3SDNA 3B75A 2ZLUB 4U8UC 4L7YA 1MODA 1NIHA 1XQ5B 1J40A 103MA 1MYTA 3OO4B 2R4ZA 5KDQA 2ZT2A 3S66A 2MYDA 2ZLWA 4JYQA 1YIHB 2EB8A 1SPGB 7HBIA 1Y0AA 4ROLA 1FDHG 4OF9A 3V2ZA 3PT8A 1T1NB 2AV3A 3UHXA 5EV5A 1CG5B 1DXDA 2R4XA 2MGMA 2VEBA 2QSSB 1UVXA 3DHTA 3A59B 2W72A 4MPMA 4NS2A 3BJ2A 1XY0B 1MWDA 1RTXA 1MLFA 2MGKA 3O7NA 1BIJA 5EUIA 1Y2ZB 1GCVA 1IT3A 1YVQB 1CBMA 5CNEA 1BZPA 4FC3A 1S6AA 3O89A 1VWTB 2D5ZA 4DWUA 2VLYA 3PI3A 3TM3A 3GQGB 1I3DA 5D5RA 1YOGA 2H8FA 1LFZB 3AT6B 4FWYA 4HRRB 5HLUA 4UIQA 2NRLA 4ILZA 4MQCA 3FS4A 2AURA 2ZLUA 4WJG1 1O1JB 5F0BA 5E29A 2HBCB 2FALA 2BWHA 1SDLA 1HBAB 3BOMA 2OHAA 1BBBB 2HCOB 1LH7A 1MNKA 3S66B 1YIHA 1LH3A 2ZFOB 3VRFB 2ZLVA 1BZ0A 5ILRA 2Z85A 3NL7A 2R4WA 3PT8B 3BJ1B 1A00B 3WHMA 1MBSA 1WLAA 1O1NA 5JDOD 5HBIA 3QM9A 3DUTA 4MBAA 4NXAA 3WCVA 2SPNA 1BVCA 1RQAA 2H8DB 2BLJM 1Y09A 1GLIB 3LR7A 3WTGA 1JL6A 2V1FA 1JF4A 1FDHA 2FRFA 1COHA 1SI4B 2DN1B 3AT5B 1DO7A 1G0BB 3FH9B 3ZHWA 2ZS0B 1Z8UB 4H0BA 2OHBA 3PT7A 2DN2A 3ARKA 1F65A 3QJEA 4MQHB 1IDRA 4NI1B 3S65A 2MB5A 1XZ2A 1Y5JA 1EW6A 4F6FA 1QXDA 1GBVB 1QSHB 1VXDA 1DXCA 1A9WE 3ARJA 1JP8A 5MBNA 1DTIA 4U8UB 1J7WB 3A5BA 2ZT1A 1Y5FA 1NIHB 3UHCA 2LHBA 3ZJOA 3MKBA 3GKVA 2D2MA 1MTIA 3CY5A 3BOMB 4ZVAA 1MWBA 4N7NA 2AV0A 5M3SA 1C7CB 3TLDA 4FH6A 2Z6SA 3K8BA 3UHTA 1O1LB 2W6VB 3ZOLA 1LFYA 1MLNA 1Y4RA 5EE4C 3R0GA 1YH9A 1FAWA 1YEQA 1VREA 4F4OB 1DUOA 3VRGA 1NZ5A 3G4YA 3UHWA 1MLMA 3EU1B 4ESAB 3BA2A 1UX8A 3WFUA 4ROLB 1MBDA 2NSSA 5JDOC 5E6EB 2G0XA 1GDJA 1WMUB 2ZLWB 3DHTB 5CNCA 2SPOA 3ZJIA 4M4AB 1YE2A 2FRKX 4NI1A 5MBAA 3HXNA 3HC9A 1J3YA 1RPSB 3NMMB 1HGAB 4DWTA 2D2NC 1H1XA 2D5XA 3GQPA 2QRWA 2YRSB 3K3UA 1UIWA 1A6GA 2D2NA 1YMBA 2XKGA 5D1VA 5ILMA 3FS4B 2MGDA 1Y31A 1VXGA 3G4VA 1U7RA 1HBAA 1Y4QB 1J7SB 3MKBB 5CHRA 3OZUA 2AUQA 1MLSA 1RVWA 3CIUB 4X0LA 1C7CA 2VYWA 1K0YA 5B85A 1J41B 1DWRA 1Y0WB 1Y7CB 1A00A 2O5QX 3W4UB 3A2GA 1LFYB 1C7DA 2IN4A 1Y7DB 3WCPA 1Y7ZB 1A3NA 3VREA 4FWZA 2G0ZA 1DTMA 1SHRB 2ZFBB 1GCWB 1G9VA 1BABA 3GQRB 5CN7A 1RQ4B 1SWMA 5E83B 1Y4GA 4UURA 1BZ0B 1Y8WA 1RQ3A 3NFEB 4WJGA 1SDLB 3OZWA 3FH9A 3OO5B 5CNFA 1LJWB 1YEOA 4N7OA 1R1YA 2FRJX 3P5QB 3WFTA 1BZZB 1J7YB 1QSIA 2D2MC 2IG3A 4NI0B 2G0SA 1Y8HA 3WFWA 101MA 3WCUD 1YDZA 2RAOA 3BJ1A 1TESA 1HABA 5KERB 4O35A 2D5XB 4H2LA 4QAUA 3DUTB 3QJEB 2FAMA 1Y8IB 105MA 4MQIA 3WCWB 1Y31B 4SDHA 1G08B 1DUKA 1OUTB 2O5MX 1X46A 2D60A 1COHB 111MA 3HEPA 4YU4A 3WCUC 1O1PA 4PQCA 5HLQA 1ECOA 2KSCA 2BMMA 1HLMA 1V9QA 1DWSA 2D2MD 1RVWB 3CIUA 1KR7A 4NK2A 4U8UA 4ZVBA 4F69A 1O1OA 1THBB 1V4XB 3R5IA 1A6NA 1MNOA 4NZIA 3QJBB 3W4UA 2AA1B 3A5AA 1HLBA 2PGHA 1A0ZB 3D4XB 1LH2A 3ECXA 3G4RA 3ECLA 3A0GB 2W6WA 1RQ4A 2DXMB 2ZS1A 2O5LX 1NS9A 2GLNA 3GKVB 3E55A 1Y0TB 2ZSRA 2M6ZB 2B7HB 1M6CA 1CIKA 3UHNA 1C7BB 1Q1FA 4N7NB 2BLIA 1MLKA 5C6EA 1O1IA 3M3AA 1NZ4A 2GTLA 1NGKA 4JACA 2V1KA 2VRYA 3ARLA 4ROMA 3NMMA 2MGBA 3RJNB 1AJHA 1FAWB 2ZS0D 5CHQA 1LFTB 1CP5A 1XZUB 1G0AB 2LH7A 1Y46B 1YE0A 2Z8AA 2D2NB 3ZH0A 1JZMA 2O5TX 1XZ4A 3UGYA 2GNWA 1Y45B 1YVTA 2D2ND 1J7SA 1OJ6A 2NX0A 3UHZA 2DN3B 2BW9M 1NS6A 102MA 2E2YA 2QMBA 1MNJA 5JDOE 3GQPB 1MLQA 3MBAA 3LQDB 1EBTA 1JEBB 1B86B 1JY7A 3QZXA 1MLGA 1V4WB 1Y7CA 1MKOB 3ZOMA 1DKEB 4HSXA 1MYGA 1HCOB 4N7PA 5CN5A 1A3NB 3VREB 1NPGA 3UH5A 1GCWA 1A0ZA 3VAUA 3D1AB 1YHUC 2V1HA 4FH7A 1K0YB 1FHJA 3S1IA 1HGCB 2GKNA 1O1MB 1L2KA 5KDQB 1D8UA 1YEUB 1LH5A 1HBSA 3ED9A 4F68A 1MNHA 2GL3A 1HBRA 1ASHA 2W6YA 1SDKA 3WCTC 3GKTA 3BJ2B 2RAOB 1MBAA 1Y0WA 3UH3A 4F6JA 1HGBA 1YHUA 3E4NA 4C44A 1Y85A 3MJUB 2BKMA 3UHIA 5CN6A 2R1HA 2QLSA 3MVCA 3WCUA 3QJDA 2HBEA 1W92A 1LJWA 1YEOB 3ONZB 1YENA 2G11A 1UC3A 2MGHA 3QQRA 1OFJA 3PI1A 2QFKA 1YDZB 3NFEA 3ZJRA 1BIJB 2ZSYA 1HBBA 4WCHD 3GQGA 2V1EA 3QJCB 3OO5A 2DHBA 3U3EA 3M3BA 1NQPA 2MGJA 2XKHA 2ZSPA 3IC0B 1ITHA 2QMBB 1FLPA 2VYZA 3ZJLA 1QPWB 1CPWA 1BZRA 3HHBA 1GBUA 1XXTA 3GLNA 1LUEA 2MYAA 4MQCB 1N9XA 1YHRA 1V75A 3HYUA 1GDKA 1G09A 1MYMA 2PGHB 1EMYA 1LHSA 1BBBA 1HABB 5ILPA 1IBEA 4HHBA 3PI8A 2MGIA 1ECDA 1YGFA 1NZ3A 2MGFA 1OR6A 2DXMA 1LFQB 1V4XA 3R5IB 2HZ3A 3WCWA 4NK1A 4FWXA 1O1JA 3DHRB 4BJAA 4G1BA 3PI2A 2M6ZA 3BJ3A 1YG5B 1UX9A 1FN3A 2B7HA 3QM5A 3UHDA 1ABYB 2HHEB 2HHDB 1QI8A 1JL7A 1YGDB 1LA6A 3ZJSA 1DLYA 2MHBA 1YZIA 3EOKA 1J40B
chains in the Genus database with same CATH superfamily
4PO5B 1LTWA 1YHUB 1HDBA 5AQDM 1HDSB 3AT5A 3D4XA 2MBWA 1O1NB 3NMLA 2ZS0A 5EETA 4B3WA 3SDHA 2ZFOA 1RTEA 1FSXA 3D7OA 3DBJA 3M39A 1IWHA 3KMFA 3NL7B 2EKTA 3A5GA 1GZXA 1PBXA 1Y0TA 5CMVA 2GRFA 1G0BA 4TYXA 2OH9A 2W72B 4KMWA 2BLHA 3RGKA 3WCTD 1JEBA 1HRMA 1QPWA 3V58B 2WY4A 3D17B 1CO9A 3GYSB 4ZIZA 1Y5JB 1MTKA 3IC2A 3WCTB 1CH1A 5HU6A 2ZFOC 1HCOA 3KVSA 3HYUB 1HDAA 1SI4A 2MYBA 1UVMA 2SPLA 2EVKA 3KUOA 3VHBA 1LHTA 1LFVA 1DXVB 3MYNA 3PIAA 1LFLB 1UFPA 4AE1A 1B86A 1JY7B 1XZ4B 2W6VA 1O1LA 1XZ2B 1JP9A 1X9FB 1OUUB 1QXDB 1XZ7A 3M38A 1YEVB 2DN3A 1KD2B 1CH3A 3CY5B 3V2VA 1NS6B 4N7PB 3D1KA 1CLSB 3HRWB 4HRTB 1OFKA 4HRRA 1CH9A 1WVPA 4MXLA 1GDIA 1S61A 2PEGB 3LB2A 2UUMB 1YGDA 1KTPB 5EQMA 3BCQB 2GDMA 2HBGA 3WCWC 3PELA 2MHBB 4O2GA 1DKEA 2ZT0A 3MJUA 3EOKB 1Y4VA 3TM9A 5JGGB 1HGCA 1XCHA 5AB8A 1YEQB 1UT0A 1H97A 1A01A 3UHGA 2NSRA 1WMUA 3G53A 4GY3B 1YCAA 1SDKB 1NY9A 1A4FB 3LB3A 3K8BB 1Y22A 4YU3A 3FEWX 1QGWC 1A0UA 1MDTA 3QJCA 2XKIA 4ODCA 2DHBB 4G1VA 1SGKA 2QLSB 1F5OA 2EF2A 3VRGB 3ECZA 1BZ1B 2UUMX 1SPEA 107MA 3A9MA 1UIWB 1RQAB 1DO3A 110MA 1V4UA 2G0VA 4N6SB 3L0FB 3HXNB 1GLIA 3UHVA 3WTGB 2W6XA 3IC2B 2HBFB 6HBWB 1Y4QA 2R1HB 3AQ6A 1Y7GA 2AUOA 1O1KB 1CQ2A 1J3FA 1Y8KA 5B13G 3UHKA 4PNJA 2VJTB 3QMAA 1FCSA 2G0RA 5CNBA 3ZJPA 4M4AA 1YE2B 1EBCA 3BJ3B 2MGAA 1V75B 1FN3B 5AZQA 1Y7DA 3WCWD 1NWIA 1A9WA 3LB1A 2O58X 4HRTA 1QI8B 2HHBA 1HBIA 3HHBB 1Y0DB 2YRSA 1NAZA 3UHQA 4IT8A 5KKKA 3ORDA 2WTGA 2OH8A 3DHRA 2LH2A 3MN0A 1YG5A 3O18B 3WFXA 1Y4BA 3WCPB 1NXFA 4ETTA 1MBOA 2VJHB 2HHDA 1J3ZA 1URVA 1MWCA 1YGFB 2VJRB 3GDJB 112MA 4A8FA 2VLXA 1LH6A 1HBGA 1Y22B 2ZLTB 4YU3B 1GZXB 4VHBA 1YZIB 3ZJHA 2ZFOD 1S0HB 2VM0A 1Y83A 1MYHA 4UZVA 2DC3A 1M6MA 3HENA 3PI9A 3V57B 2QSSA 1BABB 2ZSSA 1MYZA 2XYKA 1MLOA 1XY0A 4HSWA 4MQJA 1Y5KB 3WCTA 1MLJA 1VRFA 1PBXB 5E6EA 1NEJB 1HBHA 1Y7GB 3OZVA 1LFVB 4ERTA 2QSPB 1MBCA 2OIFA 4MQGB 3ODQA 1DO4A 2OLPA 4XS0A 1CH5A 4H07A 1OUUA 3AQ5A 4FC3B 2LH5A 1CMYB 3BRPB 1IRDA 3D1KB 1BINA 1DXTA 4A8SA 4M4BB 2O5BX 1I7YA 2H35B 2FRIX 3B75B 3QQQA 3GYSA 4ETVA 3BCQA 3UGZA 1A3OA 4L7YB 3PELB 2UULC 3WCVC 2G12A 3RJ6A 1XQ5A 4L2MA 4DC7A 2WTHA 1F0LA 1Y4BB 1CLSA 1XF6C 2VEEA 1UMOA 2HCOA 1O1PB 1C7BA 3NG6A 2UULA 2QFNA 2BV8B 2GTLC 1HSYA 3LR9A 1T1NA 1MGNA 2HBDB 1DXUA 1EYXB 5EOHA 1HHTP 3WCVD 3WHMB 1BZ1A 1MCYA 1S56A 1YIEA 5EE4D 5C6EB 3H58A 1M9PA 1MLHA 5E83A 4F0UB 1AJ9B 3A0GA 2LH3A 3WCVB 1BJEA 1A4FA 4ROMB 5EYJA 3PMDA 5IKSA 4ODCB 1Y8KB 1V5HA 2ZSOA 4Z8KA 1NEJA 1HBHB 5CN9A 2EKUA 2R80B 3ZJNA 1R1YB 4O4ZA 2VMLA 3G46A 1YE0B 4KN3A 3EDBA 1J7YA 1BZZA 1CG8B 1QSIB 3HF4B 1A6MA 1CBLA 2QSPA 4MBNA 4NI0A 1X3KA 1JZKA 3UI0A 2DKCA 1N9FA 4XS0B 1DWTA 1JP6A 4N6SA 3LB4A 1MKOA 1YVTB 1MTJA 3UHSA 1IRDB 2G3HA 1B8DA 1GCVB 2QU0A 1K1KB 3D1AA 2GKMA 1Y46A 3LQDA 1MLRA 1V4UB 1J7WA 3AQ9A 3MOUA 1OUTA 2D60B 3OK5A 2ZT3A 5B84A 2ZSTA 1VXFA 1MZ0A 1O1KA 1MOAA 2VJHA 1LFZA 1DO1A 5SW7A 1VXAA 5CN4A 1HACB 1O1OB 2LH6A 2C0KA 1S69A 2UULB 2ZSZA 1AZIA 2SPMA 2BV8A 3OGBA 3S1JA 1VXHA 2V8AA 1CP0A 1HHOB 3QJBA 1KFRA 1Y4RB 2R50A 2H8FB 2ZSNA 2UULH 4L1EB 1YOHA 1C40B 1TU9A 3GDJA 1F5PA 3VRFA 1B0BA 2H8DA 1YHEA 4A8YA 1S5XB 1HGBB 1FHJB 1LIAA 1LH1A 3E5IA 4O1TA 3O18A 2ZSQA 1ABSA 3G4WA 4F6BA 2ZS1C 2DN1A 1MOCA 1ECAA 3QJDB 2JHOA 3H57A 1N9HA 1Y0CA 4G51B 3ONZA 2RI4B 4PQ6A 3SZKA 4OODA 3PT7B 3GOUB 1HBRB 1MYFA 1COLA 4MQGA 5EYSA 4BS9A 2ZLVB 3HF4A 2V1GA 5JOMA 4AVDA 1CIIA 1XZ5A 2HZ1A 1CMYA 1QSHA 3QM8A 1S0HA 1Y83B 1HGAA 3PI9B 1YFFB 3IA3B 3IC0A 2HBEB 1S5YB 1Y35A 3AQ7A 3PI8B 3UHYA 2QU0B 3OVUC 2DN2B 1MYJA 1YMAA 4MQJB 4ETUA 3MJPB 1ABWB 1MNIA 4F6IA 1GBVA 2D2MB 1JZLA 2G14A 1CQXA 2AUPA 3DR9A 4MQKA 3UHBA 1R1XB 2V1JA 1MYIA 1IBEB 4HHBB 5JDOF 2HHEA 3QM7A 1YMCA 3NG6B 4MQHA 2V1IA 1VXCA 3ODQB 2VHBA 2H35A 3S65B 1Y4FB 2ZSXA 1YH9B 4A8WA 1RSEA 1C7DB 4PQBA 4IROB 3LHBA 5F2AA 3EU1A 2EB9A 1M9PB 1SHRA 2ZFBA 2C7KA 1Y5FB 3D7OB 3DBJB 5HY8A 5CNGA 3ZJQA 1FSLA 4AVEA 1YHEB 1LIAB 1HDSA 2ZLXA 1HBSB 1HJTA 2GRHA 1ABYA 5CNDA 1DM1A 1Y0CB 4G51A 1QXEA 3SZKB 1CH2A 4N7OB 5HLXA 3P5QA 1UVKA 4XXKA 1AJ9A 2ZT4A 1LA6B 2GNVA 2MYEA 1HV4A 4ZIZB 1NZ2A 1J3YB 1DXUB 1U7SA 5HU6B 3WCUB 1X9FC 5CN8A 1OR4A 1HDBB 2Z6NA 1HDAB 4GXEB 1A6KA 1XYEB 1XZVA 1YENB 4H0MA 4HBIA 2R80A 1K1KA 1YIEB 1MBIA 4ESAA 4H2LB 1CG8A 4A8MP 1FSXB 3PMCA 2ZWJA 2HBSB 1IWHB 1GH0A 3MJPA 2D6CA 4ERVA 1N9IA 3UHRA 4U8UD 1NQPB 2VYYA 4YU4B 3UBVA 1MLUA 2PEGA 3PIAB 1XXTB 3UHEA 1KTPA 2EVPA 1Y4FA 1RPSA 2X49A 1G09B 1KD2A 4LPIA 4L1EA 3HRWA 1A01B 2MGLA 2ZS1D 3GK9A 3ZJJA 1HACA 4X0LB 1LFQA 2X4AA 1DXVA 5AQDA 1RQ3B 1ON7A 3QZZA 4C0NA 2ZS1B 1J41A 2GRZA 2LH1A 4O4TA 1X9FA 1Y4PA 1HI1A 1F99A 1XZ7B 2O5SX 2VLZA 1PHNB 4BJUA 4N8TB 3ASEA 1VHBA 3S48C 5SW7B 3GOUA 2GTLD 2BK9A 2UUMA 3VNCA 2J96A 1Y8WB 1HHOA 3QM6A 1CG5A 1Y2ZA 1VXBA 2R4YA 1Y4VB 1YFFA 4YJJB 6HBIA 2HZ2A 1Y7ZA 2MGGA 1S5YA 1C40A 1LFTA 5KERA 1XZVB 3WI8A 2Z6TA 4XDIA 1CO8A 2RI4A 1G9VB 3GQRA 1NPFA 5HAVA 1SPGA 4MU5A 4GY3A 109MA 1Y0AB 1Y4GB 4MQIB 1VXEA 1UFJA 1S5XA 1VWTA 3UH7A 2DKDA 2HBFA 3UH6A 1V07A 1Y01B 3WR1B 3G4UA 1R1XA 1MOHA 1F63A 2NRMA 3A59A 1YOIA 108MA 2HHBB 3D17A 1YCBA 1YVQA 3G4QA 1THBA 1EWAA 3OJ1A 1HA7B 3UBCA 4MXKA 1Y8HB 1Y8IA 1XZ5B 1B33A 3HEOA 1V4WA 4F6DA 2HBCA 1GVHA 5EUIB 6HBWA 4KJTA 1IT2A 1MOBA 1Y35B 1JW8A 1J3ZB 2VJRA 2W72C 1LFLA 3ZJMA 1CPCB 1MLLA 1NS9B 1ABWA 1G08A 2MGEA 2ZLTA 1BUWB 1JF3A 1UVLA 1YEVA 1PMBA 4GZGA 4MQKB 1JPBA 1Y4PB 4KMVA 4F6GA 2AA1A 1PHNA 1YEUA 1QXEB 1GDLA 2MGCA 1YHUD 2GTLB 1HV4B 3G52A 1JDOA 1O16A 1UVYA 3AG0A 4DC8A 1CIOA 5JGGA 1MDNA 1ALLB 3OO4A 5E29B 1Y85B 1XZUA 1XYEA 4B4YA 4IROA 1URYA 4YJJA 3MYMA 3KUNA 5AZRA 2JLGA 5HY8B 1Y5KA 1Y45A 3K9ZA 1Y09B 1A0UB 5ILEA 1JWNA 5EU2A 1HBBB 2C7JA 3O2CA 2ZLXB 1GJNA 3WR1A 1DLWA 3AQ8A 4M4BA 3V57A 3LQ9A 3UHUA 1ECNA 3PI4A 5FVBM 1O1IB 1GBUB 2MYCA 4NXCA 1A3OB 2HBSA 4TWUA 2G10A 2ZS0C 1YHRB 4MAXA 3IXFA 1CH7A 2Z6NB 104MA 1BVDA 1G0AA 1DXTB 4TWVA 3UHHA 1J52A 2CMMA 1CH4A 1BZ6A 5C6YA 1AJGA 1MBNA 1OBMA 2D5ZB 4HH0A 4HH1A 2W31A 2HBDA 1O1MA 1BUWA 1NWNA 4N8TA 2BNLA 106MA 3EDAA 4F4OA 3AT6A 1I3EA 3E5OA 3KMFC 1X9FD 1Y0DA 1HI8A 1IOPA 2O5OX 1IRCA 3SDNA 3B75A 2ZLUB 4U8UC 4L7YA 1MODA 1NIHA 4Q70B 1XQ5B 4LMXB 1J40A 103MA 1MYTA 3OO4B 2R4ZA 5KDQA 2ZT2A 3S66A 2MYDA 2ZLWA 4JYQA 1YIHB 2EB8A 1SPGB 7HBIA 1Y0AA 4XXIA 4ROLA 1FDHG 4OF9A 3V2ZA 3PT8A 1T1NB 2AV3A 3UHXA 5EV5A 1CG5B 1DXDA 1F99B 2C7JB 2R4XA 2MGMA 2VEBA 2QSSB 1UVXA 3DHTA 3A59B 2VMLB 2W72A 4MPMA 4NS2A 1HA7A 4A8KA 3BJ2A 1XY0B 2WCQA 1MWDA 1RTXA 1MLFA 2MGKA 3O7NA 1BIJA 5EUIA 1Y2ZB 2JLFA 1B8DB 1GCVA 1IT3A 1KN1A 1YVQB 1CBMA 5CNEA 1BZPA 4FC3A 1S6AA 3O89A 1VWTB 2D5ZA 4DWUA 2VLYA 3PI3A 3TM3A 3GQGB 1I3DA 5D5RA 1YOGA 2H8FA 1LFZB 4TMAB 3AT6B 4FWYA 4HRRB 5HLUA 4UIQA 2NRLA 4ILZA 3NUHB 4MQCA 3FS4A 1ALLA 2AURA 2ZLUA 4PO5A 1O1JB 4WJG1 5F0BA 5E29A 2HBCB 2FALA 2BWHA 1SDLA 1HBAB 3BOMA 2OHAA 1BBBB 2HCOB 1LH7A 1MNKA 3S66B 1YIHA 1LH3A 2ZFOB 3VRFB 2ZLVA 4LM6B 1BZ0A 5ILRA 2Z85A 3NL7A 2R4WA 3PT8B 3BJ1B 1A00B 3WHMA 1MBSA 1WLAA 1O1NA 5JDOD 5HBIA 3QM9A 3DUTA 4MBAA 4NXAA 3WCVA 2SPNA 1BVCA 1RQAA 2H8DB 2BLJM 1Y09A 1GLIB 3LR7A 3WTGA 1JL6A 2V1FA 1JF4A 1FDHA 2FRFA 4Z8KB 1COHA 1SI4B 2DN1B 3AT5B 1DO7A 1G0BB 3FH9B 3ZHWA 2ZS0B 1KN1B 1Z8UB 4H0BA 2OHBA 3PT7A 2DN2A 3ARKA 1F65A 3QJEA 4MQHB 1IDRA 4NI1B 3S65A 2MB5A 1XZ2A 1Y5JA 1EW6A 4F6FA 1QXDA 1GBVB 1UVNA 1QSHB 1VXDA 1DXCA 1A9WE 3ARJA 2DKAA 1JP8A 5MBNA 1DTIA 4U8UB 1J7WB 3A5BA 2ZT1A 1Y5FA 1HHSA 1NIHB 3UHCA 2LHBA 3ZJOA 3MKBA 3GKVA 2D2MA 4F0TB 1MTIA 3CY5A 3BOMB 4ZVAA 1XG0C 1UVIA 1MWBA 4N7NA 2AV0A 5M3SA 1C7CB 3TLDA 2C7KB 1DDTA 4FH6A 2Z6SA 3K8BA 3UHTA 1O1LB 2W6VB 3ZOLA 1LFYA 1MLNA 1Y4RA 5EE4C 3R0GA 1YH9A 1FAWA 1YEQA 1VREA 4F4OB 1DUOA 3VRGA 1NZ5A 3G4YA 3UHWA 1MLMA 3EU1B 4ESAB 3BA2A 1UX8A 3WFUA 4ROLB 1MBDA 1GH0B 2NSSA 5JDOC 5E6EB 2G0XA 2YSKA 1GDJA 1WMUB 4RMPA 2ZLWB 3DHTB 5CNCA 2SPOA 3ZJIA 4M4AB 3ZTAA 1YE2A 2FRKX 4NI1A 5MBAA 3HXNA 2I88A 3HC9A 1J3YA 1RPSB 3NMMB 1HGAB 4DWTA 3BRPA 2D2NC 1H1XA 2JL9A 2D5XA 4H0MB 3GQPA 2QRWA 2YRSB 3K3UA 1UIWA 1A6GA 2D2NA 1YMBA 2XKGA 5D1VA 5ILMA 3FS4B 3L0FA 2MGDA 1Y31A 1VXGA 3G4VA 1U7RA 1HBAA 1Y4QB 1J7SB 3MKBB 2UULD 5CHRA 3OZUA 3MWNA 5B13A 2AUQA 1MLSA 1RVWA 3CIUB 4B02A 4X0LA 1C7CA 2VYWA 1K0YA 5B85A 1J41B 1DWRA 1Y0WB 1Y7CB 1A00A 2O5QX 3W4UB 3A2GA 1LFYB 1C7DA 2IN4A 1Y7DB 1EYXA 3GIOA 3WCPA 1Y7ZB 1A3NA 3VREA 4FWZA 2G0ZA 1DTMA 1SHRB 2UUND 2ZFBB 1GCWB 1G9VA 1BABA 3GQRB 5CN7A 1RQ4B 1SWMA 5E83B 4F0UA 1RH1A 1Y4GA 4UURA 1BZ0B 1Y8WA 1RQ3A 2UUNB 3NFEB 4LMSB 4WJGA 1SDLB 3OZWA 3FH9A 3OO5B 5CNFA 1LJWB 1YEOA 4N7OA 1R1YA 2FRJX 3P5QB 3WFTA 1BZZB 1J7YB 1QSIA 2D2MC 2IG3A 4NI0B 2G0SA 1Y8HA 3WFWA 101MA 3WCUD 1YDZA 2RAOA 3BJ1A 3RQRA 1TESA 3GUQA 1JBOA 1HABA 5KERB 4O35A 2D5XB 4H2LA 4QAUA 3DUTB 1I7YB 3QJEB 2FAMA 1Y8IB 105MA 4MQIA 3WCWB 1Y31B 4SDHA 1G08B 1DUKA 1OUTB 2O5MX 1X46A 4F0TA 2D60A 1COHB 111MA 3HEPA 2C7LA 4YU4A 3WCUC 1O1PA 4PQCA 5HLQA 1ECOA 2KSCA 2BMMA 1HLMA 1V9QA 1DWSA 2D2MD 1RVWB 3CIUA 1KR7A 4NK2A 4U8UA 4ZVBA 4F69A 1O1OA 1THBB 1V4XB 3R5IA 1A6NA 1TOXA 1MNOA 1B33B 4NZIA 3QJBB 3W4UA 2AA1B 3A5AA 1HLBA 2PGHA 1A0ZB 3D4XB 1LH2A 3ECXA 3G4RA 3ECLA 3A0GB 2W6WA 1RQ4A 2DXMB 2ZS1A 1CPCA 2O5LX 1NS9A 2GLNA 3GKVB 3E55A 1Y0TB 2ZSRA 2M6ZB 2WCRA 2B7HB 1M6CA 1CIKA 3UHNA 1C7BB 1Q1FA 4N7NB 2BLIA 1MLKA 5C6EA 1O1IA 3M3AA 1NZ4A 2GTLA 1NGKA 4JACA 2V1KA 2VRYA 3ARLA 4ROMA 3NMMA 2MGBA 3RJNB 1AJHA 1FAWB 2ZS0D 3KVSB 5CHQA 1LFTB 1CP5A 1XZUB 1G0AB 2LH7A 4RMPB 1Y46B 1YE0A 2Z8AA 2D2NB 3ZH0A 1JZMA 2O5TX 1XZ4A 3UGYA 2GNWA 1Y45B 1YVTA 2D2ND 1J7SA 1OJ6A 2NX0A 3UHZA 1A87A 2DN3B 2BW9M 1NS6A 102MA 2E2YA 2QMBA 1MNJA 5JDOE 3GQPB 1MLQA 3MBAA 3LQDB 1EBTA 1JEBB 3V58A 1B86B 1JY7A 2V8AB 3QZXA 1MLGA 1V4WB 1Y7CA 1MKOB 3ZOMA 1DKEB 1WACA 4HSXA 1MYGA 1HCOB 4N7PA 5CN5A 1A3NB 3VREB 1NPGA 3UH5A 1GCWA 1A0ZA 3VAUA 3D1AB 1YHUC 2V1HA 4FH7A 1K0YB 2UUNA 1FHJA 3S1IA 1HGCB 2GKNA 1O1MB 1L2KA 5KDQB 1D8UA 1YEUB 1LH5A 1HBSA 3ED9A 4F68A 1MNHA 2GL3A 1HBRA 1ASHA 2W6YA 1SDKA 3WCTC 3GKTA 3BJ2B 2RAOB 1MBAA 1Y0WA 3UH3A 4F6JA 1HI0P 1HGBA 1YHUA 3E4NA 4C44A 1Y85A 3MJUB 2BKMA 3UHIA 5CN6A 2R1HA 2QLSA 3MVCA 3WCUA 3QJDA 2HBEA 1W92A 4GXEA 1LJWA 1YEOB 3ONZB 1YENA 2G11A 1UC3A 4ESUA 2MGHA 3QQRA 1OFJA 3PI1A 2QFKA 1YDZB 3NFEA 3ZJRA 4A8QA 1BIJB 2ZSYA 1HBBA 4WCHD 1UVJA 3GQGA 3O2CB 2V1EA 3QJCB 3OO5A 2C7LB 2DHBA 3U3EA 3M3BA 1NQPA 2MGJA 2XKHA 2ZSPA 3IC0B 1ITHA 2QMBB 1FLPA 2VYZA 2VJTA 3ZJLA 1QPWB 1CPWA 1BZRA 3HHBA 1GBUA 1XXTA 3GLNA 1LUEA 2MYAA 4MQCB 1N9XA 1YHRA 1V75A 3HYUA 1GDKA 1G09A 1MYMA 2PGHB 1JBOB 1EMYA 1LHSA 1BBBA 1HABB 5ILPA 1IBEA 4HHBA 3PI8A 2MGIA 1ECDA 1YGFA 1NZ3A 2MGFA 1OR6A 2DXMA 1LFQB 1V4XA 3R5IB 2HZ3A 3WCWA 4NK1A 1ON7B 4FWXA 1O1JA 4A8OA 3DHRB 4BJAA 4G1BA 3PI2A 2M6ZA 3BJ3A 1YG5B 1UX9A 1FN3A 2B7HA 3QM5A 3UHDA 1ABYB 2HHEB 2HHDB 5FVBA 1QI8A 1JL7A 1YGDB 1LA6A 4AE0A 3ZJSA 1XDTT 1DLYA 2MHBA 4Q70A 1YZIA 3EOKA 1J40B
chains in the Genus database with same CATH topology
1LTWA 1YHUB 1HDBA 1HDSB 3AT5A 3D4XA 2MBWA 1O1NB 3NMLA 2ZS0A 5EETA 4B3WA 3SDHA 2ZFOA 1RTEA 1FSXA 3D7OA 3M39A 1IWHA 3KMFA 3NL7B 2EKTA 3A5GA 1GZXA 1PBXA 1Y0TA 5CMVA 2GRFA 1G0BA 4TYXA 2OH9A 2W72B 4KMWA 2BLHA 3RGKA 3WCTD 1JEBA 1HRMA 1QPWA 2WY4A 3D17B 1CO9A 3GYSB 1Y5JB 1MTKA 3IC2A 3WCTB 1CH1A 5HU6A 2ZFOC 1HCOA 3HYUB 1HDAA 1SI4A 2MYBA 2SPLA 2EVKA 3KUOA 3VHBA 1LHTA 1LFVA 1DXVB 3MYNA 3PIAA 1LFLB 1UFPA 1B86A 1JY7B 1XZ4B 2W6VA 1O1LA 1XZ2B 1JP9A 1X9FB 1OUUB 1QXDB 1XZ7A 3M38A 1YEVB 2DN3A 1KD2B 1CH3A 3CY5B 3V2VA 1NS6B 4N7PB 3D1KA 1CLSB 3HRWB 4HRTB 1OFKA 4HRRA 1CH9A 1WVPA 4MXLA 1GDIA 1S61A 2PEGB 3LB2A 1YGDA 5EQMA 3BCQB 2GDMA 2HBGA 3WCWC 3PELA 2MHBB 4O2GA 1DKEA 2ZT0A 3MJUA 3EOKB 1Y4VA 3TM9A 5JGGB 1HGCA 1XCHA 5AB8A 1YEQB 1UT0A 1H97A 1A01A 3UHGA 2NSRA 1WMUA 3G53A 1YCAA 1SDKB 1A4FB 3LB3A 3K8BB 1Y22A 4YU3A 1A0UA 3QJCA 2XKIA 4ODCA 2DHBB 4G1VA 2QLSB 1F5OA 2EF2A 3VRGB 3ECZA 1BZ1B 1SPEA 107MA 3A9MA 1UIWB 1RQAB 1DO3A 110MA 1V4UA 2G0VA 3HXNB 1GLIA 3UHVA 3WTGB 2W6XA 3IC2B 2HBFB 6HBWB 1Y4QA 2R1HB 3AQ6A 1Y7GA 2AUOA 1O1KB 1CQ2A 1J3FA 1Y8KA 3UHKA 4PNJA 3QMAA 1FCSA 2G0RA 5CNBA 3ZJPA 4M4AA 1YE2B 1EBCA 3BJ3B 2MGAA 1V75B 1FN3B 5AZQA 1Y7DA 3WCWD 1NWIA 1A9WA 3LB1A 2O58X 4HRTA 1QI8B 2HHBA 1HBIA 3HHBB 1Y0DB 2YRSA 1NAZA 3UHQA 4IT8A 5KKKA 3ORDA 2WTGA 2OH8A 3DHRA 2LH2A 3MN0A 1YG5A 3WFXA 1Y4BA 3WCPB 1NXFA 1MBOA 2HHDA 1J3ZA 1URVA 1MWCA 1YGFB 3GDJB 112MA 2VLXA 1LH6A 1HBGA 1Y22B 2ZLTB 4YU3B 1GZXB 4VHBA 1YZIB 3ZJHA 2ZFOD 1S0HB 2VM0A 1Y83A 1MYHA 4UZVA 2DC3A 1M6MA 3HENA 3PI9A 2QSSA 1BABB 2ZSSA 1MYZA 2XYKA 1MLOA 1XY0A 4HSWA 4MQJA 1Y5KB 3WCTA 1MLJA 1VRFA 1PBXB 5E6EA 1NEJB 1HBHA 1Y7GB 3OZVA 1LFVB 2QSPB 1MBCA 2OIFA 4MQGB 3ODQA 1DO4A 2OLPA 4XS0A 1CH5A 4H07A 1OUUA 3AQ5A 4FC3B 2LH5A 1CMYB 1IRDA 3D1KB 1BINA 1DXTA 4M4BB 2O5BX 2H35B 2FRIX 3B75B 3QQQA 3GYSA 3BCQA 3UGZA 1A3OA 4L7YB 3PELB 3WCVC 2G12A 3RJ6A 1XQ5A 4L2MA 4DC7A 2WTHA 1Y4BB 1CLSA 2VEEA 1UMOA 2HCOA 1O1PB 1C7BA 3NG6A 2QFNA 2GTLC 1HSYA 3LR9A 1T1NA 1MGNA 2HBDB 1DXUA 5EOHA 3WCVD 3WHMB 1BZ1A 1MCYA 1S56A 1YIEA 5EE4D 5C6EB 3H58A 1M9PA 1MLHA 5E83A 1AJ9B 3A0GA 2LH3A 3WCVB 1BJEA 1A4FA 4ROMB 5EYJA 5IKSA 4ODCB 1Y8KB 1V5HA 2ZSOA 1NEJA 1HBHB 5CN9A 2EKUA 2R80B 3ZJNA 1R1YB 4O4ZA 3G46A 1YE0B 4KN3A 3EDBA 1J7YA 1BZZA 1CG8B 1QSIB 3HF4B 1A6MA 1CBLA 2QSPA 4MBNA 4NI0A 1X3KA 1JZKA 3UI0A 1N9FA 4XS0B 1DWTA 1JP6A 3LB4A 1MKOA 1YVTB 1MTJA 3UHSA 1IRDB 2G3HA 1GCVB 2QU0A 1K1KB 3D1AA 2GKMA 1Y46A 3LQDA 1MLRA 1V4UB 1J7WA 3AQ9A 3MOUA 1OUTA 2D60B 3OK5A 2ZT3A 5B84A 2ZSTA 1VXFA 1MZ0A 1O1KA 1MOAA 1LFZA 1DO1A 5SW7A 1VXAA 5CN4A 1HACB 1O1OB 2LH6A 2C0KA 1S69A 2ZSZA 1AZIA 2SPMA 3OGBA 3S1JA 1VXHA 1CP0A 1HHOB 3QJBA 1KFRA 1Y4RB 2R50A 2H8FB 2ZSNA 1YOHA 1C40B 1TU9A 3GDJA 1F5PA 3VRFA 1B0BA 2H8DA 1YHEA 1S5XB 1HGBB 1FHJB 1LH1A 3E5IA 4O1TA 2ZSQA 1ABSA 3G4WA 4F6BA 2ZS1C 2DN1A 1MOCA 1ECAA 3QJDB 2JHOA 3H57A 1N9HA 1Y0CA 4G51B 3ONZA 2RI4B 4PQ6A 3SZKA 4OODA 3PT7B 3GOUB 1HBRB 1MYFA 4MQGA 5EYSA 2ZLVB 3HF4A 2V1GA 5JOMA 4AVDA 1XZ5A 2HZ1A 1CMYA 1QSHA 3QM8A 1S0HA 1Y83B 1HGAA 3PI9B 1YFFB 3IA3B 3IC0A 2HBEB 1S5YB 1Y35A 3AQ7A 3PI8B 3UHYA 2QU0B 3OVUC 2DN2B 1MYJA 1YMAA 4MQJB 3MJPB 1ABWB 1MNIA 4F6IA 1GBVA 2D2MB 1JZLA 2G14A 1CQXA 2AUPA 3DR9A 4MQKA 3UHBA 1R1XB 2V1JA 1MYIA 1IBEB 4HHBB 5JDOF 2HHEA 3QM7A 1YMCA 3NG6B 4MQHA 2V1IA 1VXCA 3ODQB 2VHBA 2H35A 3S65B 1Y4FB 2ZSXA 1YH9B 1RSEA 1C7DB 4PQBA 4IROB 3LHBA 5F2AA 3EU1A 2EB9A 1M9PB 1SHRA 2ZFBA 1Y5FB 3D7OB 5HY8A 5CNGA 3ZJQA 1FSLA 4AVEA 1YHEB 1HDSA 2ZLXA 1HBSB 1HJTA 2GRHA 1ABYA 5CNDA 1DM1A 1Y0CB 4G51A 1QXEA 3SZKB 1CH2A 4N7OB 5HLXA 3P5QA 1AJ9A 2ZT4A 1LA6B 2GNVA 2MYEA 1HV4A 1NZ2A 1J3YB 1DXUB 1U7SA 5HU6B 3WCUB 1X9FC 5CN8A 1OR4A 1HDBB 2Z6NA 1HDAB 1A6KA 1XYEB 1XZVA 1YENB 4HBIA 2R80A 1K1KA 1YIEB 1MBIA 4ESAA 4H2LB 1CG8A 1FSXB 2ZWJA 2HBSB 1IWHB 3MJPA 2D6CA 1N9IA 3UHRA 4U8UD 1NQPB 2VYYA 4YU4B 3UBVA 1MLUA 2PEGA 3PIAB 1XXTB 3UHEA 2EVPA 1Y4FA 1RPSA 1G09B 1KD2A 4LPIA 3HRWA 1A01B 2MGLA 2ZS1D 3GK9A 3ZJJA 1HACA 4X0LB 1LFQA 1DXVA 1RQ3B 3QZZA 4C0NA 2ZS1B 1J41A 2GRZA 4O4TA 2LH1A 1X9FA 1Y4PA 1XZ7B 2O5SX 2VLZA 4N8TB 3ASEA 1VHBA 3S48C 5SW7B 3GOUA 2GTLD 2BK9A 1Y8WB 1HHOA 3QM6A 1CG5A 1Y2ZA 1VXBA 2R4YA 1Y4VB 1YFFA 6HBIA 2HZ2A 1Y7ZA 2MGGA 1S5YA 1C40A 1LFTA 5KERA 1XZVB 3WI8A 2Z6TA 4XDIA 1CO8A 2RI4A 1G9VB 3GQRA 1NPFA 5HAVA 1SPGA 4MU5A 109MA 1Y0AB 1Y4GB 4MQIB 1VXEA 1UFJA 1S5XA 1VWTA 3UH7A 2HBFA 3UH6A 1V07A 1Y01B 3WR1B 3G4UA 1R1XA 1MOHA 1F63A 2NRMA 3A59A 1YOIA 108MA 2HHBB 3D17A 1YCBA 1YVQA 3G4QA 1THBA 1EWAA 3OJ1A 3UBCA 4MXKA 1Y8HB 1Y8IA 1XZ5B 3HEOA 1V4WA 4F6DA 2HBCA 1GVHA 5EUIB 6HBWA 4KJTA 1IT2A 1MOBA 1Y35B 1JW8A 1J3ZB 2W72C 1LFLA 3ZJMA 1MLLA 1NS9B 1ABWA 1G08A 2MGEA 2ZLTA 1BUWB 1JF3A 1YEVA 1PMBA 4GZGA 4MQKB 1JPBA 1Y4PB 4KMVA 4F6GA 2AA1A 1YEUA 1QXEB 1GDLA 2MGCA 1YHUD 2GTLB 1HV4B 3G52A 1JDOA 1O16A 1UVYA 3AG0A 4DC8A 1CIOA 5JGGA 1MDNA 3OO4A 5E29B 1Y85B 1XZUA 1XYEA 4B4YA 4IROA 1URYA 3MYMA 3KUNA 5AZRA 5HY8B 1Y5KA 1Y45A 3K9ZA 1Y09B 1A0UB 5ILEA 1JWNA 5EU2A 1HBBB 2ZLXB 1GJNA 3WR1A 1DLWA 3AQ8A 4M4BA 3UHUA 1ECNA 3PI4A 1O1IB 1GBUB 2MYCA 4NXCA 1A3OB 2HBSA 4TWUA 2G10A 2ZS0C 1YHRB 4MAXA 3IXFA 1CH7A 2Z6NB 104MA 1BVDA 1G0AA 1DXTB 4TWVA 3UHHA 1J52A 2CMMA 1CH4A 1BZ6A 5C6YA 1AJGA 1MBNA 1OBMA 2D5ZB 2W31A 2HBDA 1O1MA 1BUWA 1NWNA 4N8TA 2BNLA 106MA 3EDAA 4F4OA 3AT6A 1I3EA 3E5OA 3KMFC 1X9FD 1Y0DA 1IOPA 2O5OX 1IRCA 3SDNA 3B75A 2ZLUB 4U8UC 4L7YA 1MODA 1NIHA 1XQ5B 1J40A 103MA 1MYTA 3OO4B 2R4ZA 5KDQA 2ZT2A 3S66A 2MYDA 2ZLWA 4JYQA 1YIHB 2EB8A 1SPGB 7HBIA 1Y0AA 4ROLA 1FDHG 4OF9A 3V2ZA 3PT8A 1T1NB 2AV3A 3UHXA 5EV5A 1CG5B 1DXDA 2R4XA 2MGMA 2VEBA 2QSSB 1UVXA 3DHTA 3A59B 2W72A 4MPMA 4NS2A 3BJ2A 1XY0B 1MWDA 1RTXA 1MLFA 2MGKA 3O7NA 1BIJA 5EUIA 1Y2ZB 1GCVA 1IT3A 1YVQB 1CBMA 5CNEA 1BZPA 4FC3A 1S6AA 3O89A 1VWTB 2D5ZA 4DWUA 2VLYA 3PI3A 3TM3A 3GQGB 1I3DA 5D5RA 1YOGA 2H8FA 1LFZB 3AT6B 4FWYA 4HRRB 5HLUA 4UIQA 2NRLA 4ILZA 4MQCA 3FS4A 2AURA 2ZLUA 4WJG1 1O1JB 5F0BA 5E29A 2HBCB 2FALA 2BWHA 1SDLA 1HBAB 3BOMA 2OHAA 1BBBB 2HCOB 1LH7A 1MNKA 3S66B 1YIHA 1LH3A 2ZFOB 3VRFB 2ZLVA 1BZ0A 5ILRA 2Z85A 3NL7A 2R4WA 3PT8B 3BJ1B 1A00B 3WHMA 1MBSA 1WLAA 1O1NA 5JDOD 5HBIA 3QM9A 3DUTA 4MBAA 4NXAA 3WCVA 2SPNA 1BVCA 1RQAA 2H8DB 2BLJM 1Y09A 1GLIB 3LR7A 3WTGA 1JL6A 2V1FA 1JF4A 1FDHA 2FRFA 1COHA 1SI4B 2DN1B 3AT5B 1DO7A 1G0BB 3FH9B 3ZHWA 2ZS0B 1Z8UB 4H0BA 2OHBA 3PT7A 2DN2A 3ARKA 1F65A 3QJEA 4MQHB 1IDRA 4NI1B 3S65A 2MB5A 1XZ2A 1Y5JA 1EW6A 4F6FA 1QXDA 1GBVB 1QSHB 1VXDA 1DXCA 1A9WE 3ARJA 1JP8A 5MBNA 1DTIA 4U8UB 1J7WB 3A5BA 2ZT1A 1Y5FA 1NIHB 3UHCA 2LHBA 3ZJOA 3MKBA 3GKVA 2D2MA 1MTIA 3CY5A 3BOMB 4ZVAA 1MWBA 4N7NA 2AV0A 5M3SA 1C7CB 3TLDA 4FH6A 2Z6SA 3K8BA 3UHTA 1O1LB 2W6VB 3ZOLA 1LFYA 1MLNA 1Y4RA 5EE4C 3R0GA 1YH9A 1FAWA 1YEQA 1VREA 4F4OB 1DUOA 3VRGA 1NZ5A 3G4YA 3UHWA 1MLMA 3EU1B 4ESAB 3BA2A 1UX8A 3WFUA 4ROLB 1MBDA 2NSSA 5JDOC 5E6EB 2G0XA 1GDJA 1WMUB 2ZLWB 3DHTB 5CNCA 2SPOA 3ZJIA 4M4AB 1YE2A 2FRKX 4NI1A 5MBAA 3HXNA 3HC9A 1J3YA 1RPSB 3NMMB 1HGAB 4DWTA 2D2NC 1H1XA 2D5XA 3GQPA 2QRWA 2YRSB 3K3UA 1UIWA 1A6GA 2D2NA 1YMBA 2XKGA 5D1VA 5ILMA 3FS4B 2MGDA 1Y31A 1VXGA 3G4VA 1U7RA 1HBAA 1Y4QB 1J7SB 3MKBB 5CHRA 3OZUA 2AUQA 1MLSA 1RVWA 3CIUB 4X0LA 1C7CA 2VYWA 1K0YA 5B85A 1J41B 1DWRA 1Y0WB 1Y7CB 1A00A 2O5QX 3W4UB 3A2GA 1LFYB 1C7DA 2IN4A 1Y7DB 3WCPA 1Y7ZB 1A3NA 3VREA 4FWZA 2G0ZA 1DTMA 1SHRB 2ZFBB 1GCWB 1G9VA 1BABA 3GQRB 5CN7A 1RQ4B 1SWMA 5E83B 1Y4GA 4UURA 1BZ0B 1Y8WA 1RQ3A 3NFEB 4WJGA 1SDLB 3OZWA 3FH9A 3OO5B 5CNFA 1LJWB 1YEOA 4N7OA 1R1YA 2FRJX 3P5QB 3WFTA 1BZZB 1J7YB 1QSIA 2D2MC 2IG3A 4NI0B 2G0SA 1Y8HA 3WFWA 101MA 3WCUD 1YDZA 2RAOA 3BJ1A 1TESA 1HABA 5KERB 4O35A 2D5XB 4H2LA 4QAUA 3DUTB 3QJEB 2FAMA 1Y8IB 105MA 4MQIA 3WCWB 1Y31B 4SDHA 1G08B 1DUKA 1OUTB 2O5MX 1X46A 2D60A 1COHB 111MA 3HEPA 4YU4A 3WCUC 1O1PA 4PQCA 5HLQA 1ECOA 2KSCA 2BMMA 1HLMA 1V9QA 1DWSA 2D2MD 1RVWB 3CIUA 1KR7A 4NK2A 4U8UA 4ZVBA 4F69A 1O1OA 1THBB 1V4XB 3R5IA 1A6NA 1MNOA 4NZIA 3QJBB 3W4UA 2AA1B 3A5AA 1HLBA 2PGHA 1A0ZB 3D4XB 1LH2A 3ECXA 3G4RA 3ECLA 3A0GB 2W6WA 1RQ4A 2DXMB 2ZS1A 2O5LX 1NS9A 2GLNA 3GKVB 3E55A 1Y0TB 2ZSRA 2M6ZB 2B7HB 1M6CA 1CIKA 3UHNA 1C7BB 1Q1FA 4N7NB 2BLIA 1MLKA 5C6EA 1O1IA 3M3AA 1NZ4A 2GTLA 1NGKA 4JACA 2V1KA 2VRYA 3ARLA 4ROMA 3NMMA 2MGBA 3RJNB 1AJHA 1FAWB 2ZS0D 5CHQA 1LFTB 1CP5A 1XZUB 1G0AB 2LH7A 1Y46B 1YE0A 2Z8AA 2D2NB 3ZH0A 1JZMA 2O5TX 1XZ4A 3UGYA 2GNWA 1Y45B 1YVTA 2D2ND 1J7SA 1OJ6A 2NX0A 3UHZA 2DN3B 2BW9M 1NS6A 102MA 2E2YA 2QMBA 1MNJA 5JDOE 3GQPB 1MLQA 3MBAA 3LQDB 1EBTA 1JEBB 1B86B 1JY7A 3QZXA 1MLGA 1V4WB 1Y7CA 1MKOB 3ZOMA 1DKEB 4HSXA 1MYGA 1HCOB 4N7PA 5CN5A 1A3NB 3VREB 1NPGA 3UH5A 1GCWA 1A0ZA 3VAUA 3D1AB 1YHUC 2V1HA 4FH7A 1K0YB 1FHJA 3S1IA 1HGCB 2GKNA 1O1MB 1L2KA 5KDQB 1D8UA 1YEUB 1LH5A 1HBSA 3ED9A 4F68A 1MNHA 2GL3A 1HBRA 1ASHA 2W6YA 1SDKA 3WCTC 3GKTA 3BJ2B 2RAOB 1MBAA 1Y0WA 3UH3A 4F6JA 1HGBA 1YHUA 3E4NA 4C44A 1Y85A 3MJUB 2BKMA 3UHIA 5CN6A 2R1HA 2QLSA 3MVCA 3WCUA 3QJDA 2HBEA 1W92A 1LJWA 1YEOB 3ONZB 1YENA 2G11A 1UC3A 2MGHA 3QQRA 1OFJA 3PI1A 2QFKA 1YDZB 3NFEA 3ZJRA 1BIJB 2ZSYA 1HBBA 4WCHD 3GQGA 2V1EA 3QJCB 3OO5A 2DHBA 3U3EA 3M3BA 1NQPA 2MGJA 2XKHA 2ZSPA 3IC0B 1ITHA 2QMBB 1FLPA 2VYZA 3ZJLA 1QPWB 1CPWA 1BZRA 3HHBA 1GBUA 1XXTA 3GLNA 1LUEA 2MYAA 4MQCB 1N9XA 1YHRA 1V75A 3HYUA 1GDKA 1G09A 1MYMA 2PGHB 1EMYA 1LHSA 1BBBA 1HABB 5ILPA 1IBEA 4HHBA 3PI8A 2MGIA 1ECDA 1YGFA 1NZ3A 2MGFA 1OR6A 2DXMA 1LFQB 1V4XA 3R5IB 2HZ3A 3WCWA 4NK1A 4FWXA 1O1JA 3DHRB 4BJAA 4G1BA 3PI2A 2M6ZA 3BJ3A 1YG5B 1UX9A 1FN3A 2B7HA 3QM5A 3UHDA 1ABYB 2HHEB 2HHDB 1QI8A 1JL7A 1YGDB 1LA6A 3ZJSA 1DLYA 2MHBA 1YZIA 3EOKA 1J40B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTW A;  1YHU B;  1HDB A;  1HDS B;  3AT5 A;  3D4X A;  2MBW A;  1O1N B;  3NML A;  2ZS0 A;  5EET A;  4B3W A;  3SDH A;  2ZFO A;  1RTE A;  1FSX A;  3D7O A;  3M39 A;  1IWH A;  3KMF A;  3NL7 B;  2EKT A;  3A5G A;  1GZX A;  1PBX A;  1Y0T A;  5CMV A;  2GRF A;  1G0B A;  4TYX A;  2OH9 A;  2W72 B;  4KMW A;  2BLH A;  3RGK A;  3WCT D;  1JEB A;  1HRM A;  1QPW A;  2WY4 A;  3D17 B;  1CO9 A;  3GYS B;  1Y5J B;  1MTK A;  3IC2 A;  3WCT B;  1CH1 A;  5HU6 A;  2ZFO C;  1HCO A;  3HYU B;  1HDA A;  1SI4 A;  2MYB A;  2SPL A;  2EVK A;  3KUO A;  3VHB A;  1LHT A;  1LFV A;  1DXV B;  3MYN A;  3PIA A;  1LFL B;  1UFP A;  1B86 A;  1JY7 B;  1XZ4 B;  2W6V A;  1O1L A;  1XZ2 B;  1JP9 A;  1X9F B;  1OUU B;  1QXD B;  1XZ7 A;  3M38 A;  1YEV B;  2DN3 A;  1KD2 B;  1CH3 A;  3CY5 B;  3V2V A;  1NS6 B;  4N7P B;  3D1K A;  1CLS B;  3HRW B;  4HRT B;  1OFK A;  4HRR A;  1CH9 A;  1WVP A;  4MXL A;  1GDI A;  1S61 A;  2PEG B;  3LB2 A;  1YGD A;  5EQM A;  3BCQ B;  2GDM A;  2HBG A;  3WCW C;  3PEL A;  2MHB B;  4O2G A;  1DKE A;  2ZT0 A;  3MJU A;  3EOK B;  1Y4V A;  3TM9 A;  5JGG B;  1HGC A;  1XCH A;  5AB8 A;  1YEQ B;  1UT0 A;  1H97 A;  1A01 A;  3UHG A;  2NSR A;  1WMU A;  3G53 A;  1YCA A;  1SDK B;  1A4F B;  3LB3 A;  3K8B B;  1Y22 A;  4YU3 A;  1A0U A;  3QJC A;  2XKI A;  4ODC A;  2DHB B;  4G1V A;  2QLS B;  1F5O A;  2EF2 A;  3VRG B;  3ECZ A;  1BZ1 B;  1SPE A;  107M A;  3A9M A;  1UIW B;  1RQA B;  1DO3 A;  110M A;  1V4U A;  2G0V A;  3HXN B;  1GLI A;  3UHV A;  3WTG B;  2W6X A;  3IC2 B;  2HBF B;  6HBW B;  1Y4Q A;  2R1H B;  3AQ6 A;  1Y7G A;  2AUO A;  1O1K B;  1CQ2 A;  1J3F A;  1Y8K A;  3UHK A;  4PNJ A;  3QMA A;  1FCS A;  2G0R A;  5CNB A;  3ZJP A;  4M4A A;  1YE2 B;  1EBC A;  3BJ3 B;  2MGA A;  1V75 B;  1FN3 B;  5AZQ A;  1Y7D A;  3WCW D;  1NWI A;  1A9W A;  3LB1 A;  2O58 X;  4HRT A;  1QI8 B;  2HHB A;  1HBI A;  3HHB B;  1Y0D B;  2YRS A;  1NAZ A;  3UHQ A;  4IT8 A;  5KKK A;  3ORD A;  2WTG A;  2OH8 A;  3DHR A;  2LH2 A;  3MN0 A;  1YG5 A;  3WFX A;  1Y4B A;  3WCP B;  1NXF A;  1MBO A;  2HHD A;  1J3Z A;  1URV A;  1MWC A;  1YGF B;  3GDJ B;  112M A;  2VLX A;  1LH6 A;  1HBG A;  1Y22 B;  2ZLT B;  4YU3 B;  1GZX B;  4VHB A;  1YZI B;  3ZJH A;  2ZFO D;  1S0H B;  2VM0 A;  1Y83 A;  1MYH A;  4UZV A;  2DC3 A;  1M6M A;  3HEN A;  3PI9 A;  2QSS A;  1BAB B;  2ZSS A;  1MYZ A;  2XYK A;  1MLO A;  1XY0 A;  4HSW A;  4MQJ A;  1Y5K B;  3WCT A;  1MLJ A;  1VRF A;  1PBX B;  5E6E A;  1NEJ B;  1HBH A;  1Y7G B;  3OZV A;  1LFV B;  2QSP B;  1MBC A;  2OIF A;  4MQG B;  3ODQ A;  1DO4 A;  2OLP A;  4XS0 A;  1CH5 A;  4H07 A;  1OUU A;  3AQ5 A;  4FC3 B;  2LH5 A;  1CMY B;  1IRD A;  3D1K B;  1BIN A;  1DXT A;  4M4B B;  2O5B X;  2H35 B;  2FRI X;  3B75 B;  3QQQ A;  3GYS A;  3BCQ A;  3UGZ A;  1A3O A;  4L7Y B;  3PEL B;  3WCV C;  2G12 A;  3RJ6 A;  1XQ5 A;  4L2M A;  4DC7 A;  2WTH A;  1Y4B B;  1CLS A;  2VEE A;  1UMO A;  2HCO A;  1O1P B;  1C7B A;  3NG6 A;  2QFN A;  2GTL C;  1HSY A;  3LR9 A;  1T1N A;  1MGN A;  2HBD B;  1DXU A;  5EOH A;  3WCV D;  3WHM B;  1BZ1 A;  1MCY A;  1S56 A;  1YIE A;  5EE4 D;  5C6E B;  3H58 A;  1M9P A;  1MLH A;  5E83 A;  1AJ9 B;  3A0G A;  2LH3 A;  3WCV B;  1BJE A;  1A4F A;  4ROM B;  5EYJ A;  5IKS A;  4ODC B;  1Y8K B;  1V5H A;  2ZSO A;  1NEJ A;  1HBH B;  5CN9 A;  2EKU A;  2R80 B;  3ZJN A;  1R1Y B;  4O4Z A;  3G46 A;  1YE0 B;  4KN3 A;  3EDB A;  1J7Y A;  1BZZ A;  1CG8 B;  1QSI B;  3HF4 B;  1A6M A;  1CBL A;  2QSP A;  4MBN A;  4NI0 A;  1X3K A;  1JZK A;  3UI0 A;  1N9F A;  4XS0 B;  1DWT A;  1JP6 A;  3LB4 A;  1MKO A;  1YVT B;  1MTJ A;  3UHS A;  1IRD B;  2G3H A;  1GCV B;  2QU0 A;  1K1K B;  3D1A A;  2GKM A;  1Y46 A;  3LQD A;  1MLR A;  1V4U B;  1J7W A;  3AQ9 A;  3MOU A;  1OUT A;  2D60 B;  3OK5 A;  2ZT3 A;  5B84 A;  2ZST A;  1VXF A;  1MZ0 A;  1O1K A;  1MOA A;  1LFZ A;  1DO1 A;  5SW7 A;  1VXA A;  5CN4 A;  1HAC B;  1O1O B;  2LH6 A;  2C0K A;  1S69 A;  2ZSZ A;  1AZI A;  2SPM A;  3OGB A;  3S1J A;  1VXH A;  1CP0 A;  1HHO B;  3QJB A;  1KFR A;  1Y4R B;  2R50 A;  2H8F B;  2ZSN A;  1YOH A;  1C40 B;  1TU9 A;  3GDJ A;  1F5P A;  3VRF A;  1B0B A;  2H8D A;  1YHE A;  1S5X B;  1HGB B;  1FHJ B;  1LH1 A;  3E5I A;  4O1T A;  2ZSQ A;  1ABS A;  3G4W A;  4F6B A;  2ZS1 C;  2DN1 A;  1MOC A;  1ECA A;  3QJD B;  2JHO A;  3H57 A;  1N9H A;  1Y0C A;  4G51 B;  3ONZ A;  2RI4 B;  4PQ6 A;  3SZK A;  4OOD A;  3PT7 B;  3GOU B;  1HBR B;  1MYF A;  4MQG A;  5EYS A;  2ZLV B;  3HF4 A;  2V1G A;  5JOM A;  4AVD A;  1XZ5 A;  2HZ1 A;  1CMY A;  1QSH A;  3QM8 A;  1S0H A;  1Y83 B;  1HGA A;  3PI9 B;  1YFF B;  3IA3 B;  3IC0 A;  2HBE B;  1S5Y B;  1Y35 A;  3AQ7 A;  3PI8 B;  3UHY A;  2QU0 B;  3OVU C;  2DN2 B;  1MYJ A;  1YMA A;  4MQJ B;  3MJP B;  1ABW B;  1MNI A;  4F6I A;  1GBV A;  2D2M B;  1JZL A;  2G14 A;  1CQX A;  2AUP A;  3DR9 A;  4MQK A;  3UHB A;  1R1X B;  2V1J A;  1MYI A;  1IBE B;  4HHB B;  5JDO F;  2HHE A;  3QM7 A;  1YMC A;  3NG6 B;  4MQH A;  2V1I A;  1VXC A;  3ODQ B;  2VHB A;  2H35 A;  3S65 B;  1Y4F B;  2ZSX A;  1YH9 B;  1RSE A;  1C7D B;  4PQB A;  4IRO B;  3LHB A;  5F2A A;  3EU1 A;  2EB9 A;  1M9P B;  1SHR A;  2ZFB A;  1Y5F B;  3D7O B;  5HY8 A;  5CNG A;  3ZJQ A;  1FSL A;  4AVE A;  1YHE B;  1HDS A;  2ZLX A;  1HBS B;  1HJT A;  2GRH A;  1ABY A;  5CND A;  1DM1 A;  1Y0C B;  4G51 A;  1QXE A;  3SZK B;  1CH2 A;  4N7O B;  5HLX A;  3P5Q A;  1AJ9 A;  2ZT4 A;  1LA6 B;  2GNV A;  2MYE A;  1HV4 A;  1NZ2 A;  1J3Y B;  1DXU B;  1U7S A;  5HU6 B;  3WCU B;  1X9F C;  5CN8 A;  1OR4 A;  1HDB B;  2Z6N A;  1HDA B;  1A6K A;  1XYE B;  1XZV A;  1YEN B;  4HBI A;  2R80 A;  1K1K A;  1YIE B;  1MBI A;  4ESA A;  4H2L B;  1CG8 A;  1FSX B;  2ZWJ A;  2HBS B;  1IWH B;  3MJP A;  2D6C A;  1N9I A;  3UHR A;  4U8U D;  1NQP B;  2VYY A;  4YU4 B;  3UBV A;  1MLU A;  2PEG A;  3PIA B;  1XXT B;  3UHE A;  2EVP A;  1Y4F A;  1RPS A;  1G09 B;  1KD2 A;  4LPI A;  3HRW A;  1A01 B;  2MGL A;  2ZS1 D;  3GK9 A;  3ZJJ A;  1HAC A;  4X0L B;  1LFQ A;  1DXV A;  1RQ3 B;  3QZZ A;  4C0N A;  2ZS1 B;  1J41 A;  2GRZ A;  4O4T A;  2LH1 A;  1X9F A;  1Y4P A;  1XZ7 B;  2O5S X;  2VLZ A;  4N8T B;  3ASE A;  1VHB A;  3S48 C;  5SW7 B;  3GOU A;  2GTL D;  2BK9 A;  1Y8W B;  1HHO A;  3QM6 A;  1CG5 A;  1Y2Z A;  1VXB A;  2R4Y A;  1Y4V B;  1YFF A;  6HBI A;  2HZ2 A;  1Y7Z A;  2MGG A;  1S5Y A;  1C40 A;  1LFT A;  5KER A;  1XZV B;  3WI8 A;  2Z6T A;  4XDI A;  1CO8 A;  2RI4 A;  1G9V B;  3GQR A;  1NPF A;  5HAV A;  1SPG A;  4MU5 A;  109M A;  1Y0A B;  1Y4G B;  4MQI B;  1VXE A;  1UFJ A;  1S5X A;  1VWT A;  3UH7 A;  2HBF A;  3UH6 A;  1V07 A;  1Y01 B;  3WR1 B;  3G4U A;  1R1X A;  1MOH A;  1F63 A;  2NRM A;  3A59 A;  1YOI A;  108M A;  2HHB B;  3D17 A;  1YCB A;  1YVQ A;  3G4Q A;  1THB A;  1EWA A;  3OJ1 A;  3UBC A;  4MXK A;  1Y8H B;  1Y8I A;  1XZ5 B;  3HEO A;  1V4W A;  4F6D A;  2HBC A;  1GVH A;  5EUI B;  6HBW A;  4KJT A;  1IT2 A;  1MOB A;  1Y35 B;  1JW8 A;  1J3Z B;  2W72 C;  1LFL A;  3ZJM A;  1MLL A;  1NS9 B;  1ABW A;  1G08 A;  2MGE A;  2ZLT A;  1BUW B;  1JF3 A;  1YEV A;  1PMB A;  4GZG A;  4MQK B;  1JPB A;  1Y4P B;  4KMV A;  4F6G A;  2AA1 A;  1YEU A;  1QXE B;  1GDL A;  2MGC A;  1YHU D;  2GTL B;  1HV4 B;  3G52 A;  1JDO A;  1O16 A;  1UVY A;  3AG0 A;  4DC8 A;  1CIO A;  5JGG A;  1MDN A;  3OO4 A;  5E29 B;  1Y85 B;  1XZU A;  1XYE A;  4B4Y A;  4IRO A;  1URY A;  3MYM A;  3KUN A;  5AZR A;  5HY8 B;  1Y5K A;  1Y45 A;  3K9Z A;  1Y09 B;  1A0U B;  5ILE A;  1JWN A;  5EU2 A;  1HBB B;  2ZLX B;  1GJN A;  3WR1 A;  1DLW A;  3AQ8 A;  4M4B A;  3UHU A;  1ECN A;  3PI4 A;  1O1I B;  1GBU B;  2MYC A;  4NXC A;  1A3O B;  2HBS A;  4TWU A;  2G10 A;  2ZS0 C;  1YHR B;  4MAX A;  3IXF A;  1CH7 A;  2Z6N B;  104M A;  1BVD A;  1G0A A;  1DXT B;  4TWV A;  3UHH A;  1J52 A;  2CMM A;  1CH4 A;  1BZ6 A;  5C6Y A;  1AJG A;  1MBN A;  1OBM A;  2D5Z B;  2W31 A;  2HBD A;  1O1M A;  1BUW A;  1NWN A;  4N8T A;  2BNL A;  106M A;  3EDA A;  4F4O A;  3AT6 A;  1I3E A;  3E5O A;  3KMF C;  1X9F D;  1Y0D A;  1IOP A;  2O5O X;  1IRC A;  3SDN A;  3B75 A;  2ZLU B;  4U8U C;  4L7Y A;  1MOD A;  1NIH A;  1XQ5 B;  1J40 A;  103M A;  1MYT A;  3OO4 B;  2R4Z A;  5KDQ A;  2ZT2 A;  3S66 A;  2MYD A;  2ZLW A;  4JYQ A;  1YIH B;  2EB8 A;  1SPG B;  7HBI A;  1Y0A A;  4ROL A;  1FDH G;  4OF9 A;  3V2Z A;  3PT8 A;  1T1N B;  2AV3 A;  3UHX A;  5EV5 A;  1CG5 B;  1DXD A;  2R4X A;  2MGM A;  2VEB A;  2QSS B;  1UVX A;  3DHT A;  3A59 B;  2W72 A;  4MPM A;  4NS2 A;  3BJ2 A;  1XY0 B;  1MWD A;  1RTX A;  1MLF A;  2MGK A;  3O7N A;  1BIJ A;  5EUI A;  1Y2Z B;  1GCV A;  1IT3 A;  1YVQ B;  1CBM A;  5CNE A;  1BZP A;  4FC3 A;  1S6A A;  3O89 A;  1VWT B;  2D5Z A;  4DWU A;  2VLY A;  3PI3 A;  3TM3 A;  3GQG B;  1I3D A;  5D5R A;  1YOG A;  2H8F A;  1LFZ B;  3AT6 B;  4FWY A;  4HRR B;  5HLU A;  4UIQ A;  2NRL A;  4ILZ A;  4MQC A;  3FS4 A;  2AUR A;  2ZLU A;  4WJG 1;  1O1J B;  5F0B A;  5E29 A;  2HBC B;  2FAL A;  2BWH A;  1SDL A;  1HBA B;  3BOM A;  2OHA A;  1BBB B;  2HCO B;  1LH7 A;  1MNK A;  3S66 B;  1YIH A;  1LH3 A;  2ZFO B;  3VRF B;  2ZLV A;  1BZ0 A;  5ILR A;  2Z85 A;  3NL7 A;  2R4W A;  3PT8 B;  3BJ1 B;  1A00 B;  3WHM A;  1MBS A;  1WLA A;  1O1N A;  5JDO D;  5HBI A;  3QM9 A;  3DUT A;  4MBA A;  4NXA A;  3WCV A;  2SPN A;  1BVC A;  1RQA A;  2H8D B;  2BLJ M;  1Y09 A;  1GLI B;  3LR7 A;  3WTG A;  1JL6 A;  2V1F A;  1JF4 A;  1FDH A;  2FRF A;  1COH A;  1SI4 B;  2DN1 B;  3AT5 B;  1DO7 A;  1G0B B;  3FH9 B;  3ZHW A;  2ZS0 B;  1Z8U B;  4H0B A;  2OHB A;  3PT7 A;  2DN2 A;  3ARK A;  1F65 A;  3QJE A;  4MQH B;  1IDR A;  4NI1 B;  3S65 A;  2MB5 A;  1XZ2 A;  1Y5J A;  1EW6 A;  4F6F A;  1QXD A;  1GBV B;  1QSH B;  1VXD A;  1DXC A;  1A9W E;  3ARJ A;  1JP8 A;  5MBN A;  1DTI A;  4U8U B;  1J7W B;  3A5B A;  2ZT1 A;  1Y5F A;  1NIH B;  3UHC A;  2LHB A;  3ZJO A;  3MKB A;  3GKV A;  2D2M A;  1MTI A;  3CY5 A;  3BOM B;  4ZVA A;  1MWB A;  4N7N A;  2AV0 A;  5M3S A;  1C7C B;  3TLD A;  4FH6 A;  2Z6S A;  3K8B A;  3UHT A;  1O1L B;  2W6V B;  3ZOL A;  1LFY A;  1MLN A;  1Y4R A;  5EE4 C;  3R0G A;  1YH9 A;  1FAW A;  1YEQ A;  1VRE A;  4F4O B;  1DUO A;  3VRG A;  1NZ5 A;  3G4Y A;  3UHW A;  1MLM A;  3EU1 B;  4ESA B;  3BA2 A;  1UX8 A;  3WFU A;  4ROL B;  1MBD A;  2NSS A;  5JDO C;  5E6E B;  2G0X A;  1GDJ A;  1WMU B;  2ZLW B;  3DHT B;  5CNC A;  2SPO A;  3ZJI A;  4M4A B;  1YE2 A;  2FRK X;  4NI1 A;  5MBA A;  3HXN A;  3HC9 A;  1J3Y A;  1RPS B;  3NMM B;  1HGA B;  4DWT A;  2D2N C;  1H1X A;  2D5X A;  3GQP A;  2QRW A;  2YRS B;  3K3U A;  1UIW A;  1A6G A;  2D2N A;  1YMB A;  2XKG A;  5D1V A;  5ILM A;  3FS4 B;  2MGD A;  1Y31 A;  1VXG A;  3G4V A;  1U7R A;  1HBA A;  1Y4Q B;  1J7S B;  3MKB B;  5CHR A;  3OZU A;  2AUQ A;  1MLS A;  1RVW A;  3CIU B;  4X0L A;  1C7C A;  2VYW A;  1K0Y A;  5B85 A;  1J41 B;  1DWR A;  1Y0W B;  1Y7C B;  1A00 A;  2O5Q X;  3W4U B;  3A2G A;  1LFY B;  1C7D A;  2IN4 A;  1Y7D B;  3WCP A;  1Y7Z B;  1A3N A;  3VRE A;  4FWZ A;  2G0Z A;  1DTM A;  1SHR B;  2ZFB B;  1GCW B;  1G9V A;  1BAB A;  3GQR B;  5CN7 A;  1RQ4 B;  1SWM A;  5E83 B;  1Y4G A;  4UUR A;  1BZ0 B;  1Y8W A;  1RQ3 A;  3NFE B;  4WJG A;  1SDL B;  3OZW A;  3FH9 A;  3OO5 B;  5CNF A;  1LJW B;  1YEO A;  4N7O A;  1R1Y A;  2FRJ X;  3P5Q B;  3WFT A;  1BZZ B;  1J7Y B;  1QSI A;  2D2M C;  2IG3 A;  4NI0 B;  2G0S A;  1Y8H A;  3WFW A;  101M A;  3WCU D;  1YDZ A;  2RAO A;  3BJ1 A;  1TES A;  1HAB A;  5KER B;  4O35 A;  2D5X B;  4H2L A;  4QAU A;  3DUT B;  3QJE B;  2FAM A;  1Y8I B;  105M A;  4MQI A;  3WCW B;  1Y31 B;  4SDH A;  1G08 B;  1DUK A;  1OUT B;  2O5M X;  1X46 A;  2D60 A;  1COH B;  111M A;  3HEP A;  4YU4 A;  3WCU C;  1O1P A;  4PQC A;  5HLQ A;  1ECO A;  2KSC A;  2BMM A;  1HLM A;  1V9Q A;  1DWS A;  2D2M D;  1RVW B;  3CIU A;  1KR7 A;  4NK2 A;  4U8U A;  4ZVB A;  4F69 A;  1O1O A;  1THB B;  1V4X B;  3R5I A;  1A6N A;  1MNO A;  4NZI A;  3QJB B;  3W4U A;  2AA1 B;  3A5A A;  1HLB A;  2PGH A;  1A0Z B;  3D4X B;  1LH2 A;  3ECX A;  3G4R A;  3ECL A;  3A0G B;  2W6W A;  1RQ4 A;  2DXM B;  2ZS1 A;  2O5L X;  1NS9 A;  2GLN A;  3GKV B;  3E55 A;  1Y0T B;  2ZSR A;  2M6Z B;  2B7H B;  1M6C A;  1CIK A;  3UHN A;  1C7B B;  1Q1F A;  4N7N B;  2BLI A;  1MLK A;  5C6E A;  1O1I A;  3M3A A;  1NZ4 A;  2GTL A;  1NGK A;  4JAC A;  2V1K A;  2VRY A;  3ARL A;  4ROM A;  3NMM A;  2MGB A;  3RJN B;  1AJH A;  1FAW B;  2ZS0 D;  5CHQ A;  1LFT B;  1CP5 A;  1XZU B;  1G0A B;  2LH7 A;  1Y46 B;  1YE0 A;  2Z8A A;  2D2N B;  3ZH0 A;  1JZM A;  2O5T X;  1XZ4 A;  3UGY A;  2GNW A;  1Y45 B;  1YVT A;  2D2N D;  1J7S A;  1OJ6 A;  2NX0 A;  3UHZ A;  2DN3 B;  2BW9 M;  1NS6 A;  102M A;  2E2Y A;  2QMB A;  1MNJ A;  5JDO E;  3GQP B;  1MLQ A;  3MBA A;  3LQD B;  1EBT A;  1JEB B;  1B86 B;  1JY7 A;  3QZX A;  1MLG A;  1V4W B;  1Y7C A;  1MKO B;  3ZOM A;  1DKE B;  4HSX A;  1MYG A;  1HCO B;  4N7P A;  5CN5 A;  1A3N B;  3VRE B;  1NPG A;  3UH5 A;  1GCW A;  1A0Z A;  3VAU A;  3D1A B;  1YHU C;  2V1H A;  4FH7 A;  1K0Y B;  1FHJ A;  3S1I A;  1HGC B;  2GKN A;  1O1M B;  1L2K A;  5KDQ B;  1D8U A;  1YEU B;  1LH5 A;  1HBS A;  3ED9 A;  4F68 A;  1MNH A;  2GL3 A;  1HBR A;  1ASH A;  2W6Y A;  1SDK A;  3WCT C;  3GKT A;  3BJ2 B;  2RAO B;  1MBA A;  1Y0W A;  3UH3 A;  4F6J A;  1HGB A;  1YHU A;  3E4N A;  4C44 A;  1Y85 A;  3MJU B;  2BKM A;  3UHI A;  5CN6 A;  2R1H A;  2QLS A;  3MVC A;  3WCU A;  3QJD A;  2HBE A;  1W92 A;  1LJW A;  1YEO B;  3ONZ B;  1YEN A;  2G11 A;  1UC3 A;  2MGH A;  3QQR A;  1OFJ A;  3PI1 A;  2QFK A;  1YDZ B;  3NFE A;  3ZJR A;  1BIJ B;  2ZSY A;  1HBB A;  4WCH D;  3GQG A;  2V1E A;  3QJC B;  3OO5 A;  2DHB A;  3U3E A;  3M3B A;  1NQP A;  2MGJ A;  2XKH A;  2ZSP A;  3IC0 B;  1ITH A;  2QMB B;  1FLP A;  2VYZ A;  3ZJL A;  1QPW B;  1CPW A;  1BZR A;  3HHB A;  1GBU A;  1XXT A;  3GLN A;  1LUE A;  2MYA A;  4MQC B;  1N9X A;  1YHR A;  1V75 A;  3HYU A;  1GDK A;  1G09 A;  1MYM A;  2PGH B;  1EMY A;  1LHS A;  1BBB A;  1HAB B;  5ILP A;  1IBE A;  4HHB A;  3PI8 A;  2MGI A;  1ECD A;  1YGF A;  1NZ3 A;  2MGF A;  1OR6 A;  2DXM A;  1LFQ B;  1V4X A;  3R5I B;  2HZ3 A;  3WCW A;  4NK1 A;  4FWX A;  1O1J A;  3DHR B;  4BJA A;  4G1B A;  3PI2 A;  2M6Z A;  3BJ3 A;  1YG5 B;  1UX9 A;  1FN3 A;  2B7H A;  3QM5 A;  3UHD A;  1ABY B;  2HHE B;  2HHD B;  1QI8 A;  1JL7 A;  1YGD B;  1LA6 A;  3ZJS A;  1DLY A;  2MHB A;  1YZI A;  3EOK A;  1J40 B; 
#chains in the Genus database with same CATH topology
 4PO5 B;  1LTW A;  1YHU B;  1HDB A;  5AQD M;  1HDS B;  3AT5 A;  3D4X A;  2MBW A;  1O1N B;  3NML A;  2ZS0 A;  5EET A;  4B3W A;  3SDH A;  2ZFO A;  1RTE A;  1FSX A;  3D7O A;  3DBJ A;  3M39 A;  1IWH A;  3KMF A;  3NL7 B;  2EKT A;  3A5G A;  1GZX A;  1PBX A;  1Y0T A;  5CMV A;  2GRF A;  1G0B A;  4TYX A;  2OH9 A;  2W72 B;  4KMW A;  2BLH A;  3RGK A;  3WCT D;  1JEB A;  1HRM A;  1QPW A;  3V58 B;  2WY4 A;  3D17 B;  1CO9 A;  3GYS B;  4ZIZ A;  1Y5J B;  1MTK A;  3IC2 A;  3WCT B;  1CH1 A;  5HU6 A;  2ZFO C;  1HCO A;  3KVS A;  3HYU B;  1HDA A;  1SI4 A;  2MYB A;  1UVM A;  2SPL A;  2EVK A;  3KUO A;  3VHB A;  1LHT A;  1LFV A;  1DXV B;  3MYN A;  3PIA A;  1LFL B;  1UFP A;  4AE1 A;  1B86 A;  1JY7 B;  1XZ4 B;  2W6V A;  1O1L A;  1XZ2 B;  1JP9 A;  1X9F B;  1OUU B;  1QXD B;  1XZ7 A;  3M38 A;  1YEV B;  2DN3 A;  1KD2 B;  1CH3 A;  3CY5 B;  3V2V A;  1NS6 B;  4N7P B;  3D1K A;  1CLS B;  3HRW B;  4HRT B;  1OFK A;  4HRR A;  1CH9 A;  1WVP A;  4MXL A;  1GDI A;  1S61 A;  2PEG B;  3LB2 A;  2UUM B;  1YGD A;  1KTP B;  5EQM A;  3BCQ B;  2GDM A;  2HBG A;  3WCW C;  3PEL A;  2MHB B;  4O2G A;  1DKE A;  2ZT0 A;  3MJU A;  3EOK B;  1Y4V A;  3TM9 A;  5JGG B;  1HGC A;  1XCH A;  5AB8 A;  1YEQ B;  1UT0 A;  1H97 A;  1A01 A;  3UHG A;  2NSR A;  1WMU A;  3G53 A;  4GY3 B;  1YCA A;  1SDK B;  1NY9 A;  1A4F B;  3LB3 A;  3K8B B;  1Y22 A;  4YU3 A;  3FEW X;  1QGW C;  1A0U A;  1MDT A;  3QJC A;  2XKI A;  4ODC A;  2DHB B;  4G1V A;  1SGK A;  2QLS B;  1F5O A;  2EF2 A;  3VRG B;  3ECZ A;  1BZ1 B;  2UUM X;  1SPE A;  107M A;  3A9M A;  1UIW B;  1RQA B;  1DO3 A;  110M A;  1V4U A;  2G0V A;  4N6S B;  3L0F B;  3HXN B;  1GLI A;  3UHV A;  3WTG B;  2W6X A;  3IC2 B;  2HBF B;  6HBW B;  1Y4Q A;  2R1H B;  3AQ6 A;  1Y7G A;  2AUO A;  1O1K B;  1CQ2 A;  1J3F A;  1Y8K A;  5B13 G;  3UHK A;  4PNJ A;  2VJT B;  3QMA A;  1FCS A;  2G0R A;  5CNB A;  3ZJP A;  4M4A A;  1YE2 B;  1EBC A;  3BJ3 B;  2MGA A;  1V75 B;  1FN3 B;  5AZQ A;  1Y7D A;  3WCW D;  1NWI A;  1A9W A;  3LB1 A;  2O58 X;  4HRT A;  1QI8 B;  2HHB A;  1HBI A;  3HHB B;  1Y0D B;  2YRS A;  1NAZ A;  3UHQ A;  4IT8 A;  5KKK A;  3ORD A;  2WTG A;  2OH8 A;  3DHR A;  2LH2 A;  3MN0 A;  1YG5 A;  3O18 B;  3WFX A;  1Y4B A;  3WCP B;  1NXF A;  4ETT A;  1MBO A;  2VJH B;  2HHD A;  1J3Z A;  1URV A;  1MWC A;  1YGF B;  2VJR B;  3GDJ B;  112M A;  4A8F A;  2VLX A;  1LH6 A;  1HBG A;  1Y22 B;  2ZLT B;  4YU3 B;  1GZX B;  4VHB A;  1YZI B;  3ZJH A;  2ZFO D;  1S0H B;  2VM0 A;  1Y83 A;  1MYH A;  4UZV A;  2DC3 A;  1M6M A;  3HEN A;  3PI9 A;  3V57 B;  2QSS A;  1BAB B;  2ZSS A;  1MYZ A;  2XYK A;  1MLO A;  1XY0 A;  4HSW A;  4MQJ A;  1Y5K B;  3WCT A;  1MLJ A;  1VRF A;  1PBX B;  5E6E A;  1NEJ B;  1HBH A;  1Y7G B;  3OZV A;  1LFV B;  4ERT A;  2QSP B;  1MBC A;  2OIF A;  4MQG B;  3ODQ A;  1DO4 A;  2OLP A;  4XS0 A;  1CH5 A;  4H07 A;  1OUU A;  3AQ5 A;  4FC3 B;  2LH5 A;  1CMY B;  3BRP B;  1IRD A;  3D1K B;  1BIN A;  1DXT A;  4A8S A;  4M4B B;  2O5B X;  1I7Y A;  2H35 B;  2FRI X;  3B75 B;  3QQQ A;  3GYS A;  4ETV A;  3BCQ A;  3UGZ A;  1A3O A;  4L7Y B;  3PEL B;  2UUL C;  3WCV C;  2G12 A;  3RJ6 A;  1XQ5 A;  4L2M A;  4DC7 A;  2WTH A;  1F0L A;  1Y4B B;  1CLS A;  1XF6 C;  2VEE A;  1UMO A;  2HCO A;  1O1P B;  1C7B A;  3NG6 A;  2UUL A;  2QFN A;  2BV8 B;  2GTL C;  1HSY A;  3LR9 A;  1T1N A;  1MGN A;  2HBD B;  1DXU A;  1EYX B;  5EOH A;  1HHT P;  3WCV D;  3WHM B;  1BZ1 A;  1MCY A;  1S56 A;  1YIE A;  5EE4 D;  5C6E B;  3H58 A;  1M9P A;  1MLH A;  5E83 A;  4F0U B;  1AJ9 B;  3A0G A;  2LH3 A;  3WCV B;  1BJE A;  1A4F A;  4ROM B;  5EYJ A;  3PMD A;  5IKS A;  4ODC B;  1Y8K B;  1V5H A;  2ZSO A;  4Z8K A;  1NEJ A;  1HBH B;  5CN9 A;  2EKU A;  2R80 B;  3ZJN A;  1R1Y B;  4O4Z A;  2VML A;  3G46 A;  1YE0 B;  4KN3 A;  3EDB A;  1J7Y A;  1BZZ A;  1CG8 B;  1QSI B;  3HF4 B;  1A6M A;  1CBL A;  2QSP A;  4MBN A;  4NI0 A;  1X3K A;  1JZK A;  3UI0 A;  2DKC A;  1N9F A;  4XS0 B;  1DWT A;  1JP6 A;  4N6S A;  3LB4 A;  1MKO A;  1YVT B;  1MTJ A;  3UHS A;  1IRD B;  2G3H A;  1B8D A;  1GCV B;  2QU0 A;  1K1K B;  3D1A A;  2GKM A;  1Y46 A;  3LQD A;  1MLR A;  1V4U B;  1J7W A;  3AQ9 A;  3MOU A;  1OUT A;  2D60 B;  3OK5 A;  2ZT3 A;  5B84 A;  2ZST A;  1VXF A;  1MZ0 A;  1O1K A;  1MOA A;  2VJH A;  1LFZ A;  1DO1 A;  5SW7 A;  1VXA A;  5CN4 A;  1HAC B;  1O1O B;  2LH6 A;  2C0K A;  1S69 A;  2UUL B;  2ZSZ A;  1AZI A;  2SPM A;  2BV8 A;  3OGB A;  3S1J A;  1VXH A;  2V8A A;  1CP0 A;  1HHO B;  3QJB A;  1KFR A;  1Y4R B;  2R50 A;  2H8F B;  2ZSN A;  2UUL H;  4L1E B;  1YOH A;  1C40 B;  1TU9 A;  3GDJ A;  1F5P A;  3VRF A;  1B0B A;  2H8D A;  1YHE A;  4A8Y A;  1S5X B;  1HGB B;  1FHJ B;  1LIA A;  1LH1 A;  3E5I A;  4O1T A;  3O18 A;  2ZSQ A;  1ABS A;  3G4W A;  4F6B A;  2ZS1 C;  2DN1 A;  1MOC A;  1ECA A;  3QJD B;  2JHO A;  3H57 A;  1N9H A;  1Y0C A;  4G51 B;  3ONZ A;  2RI4 B;  4PQ6 A;  3SZK A;  4OOD A;  3PT7 B;  3GOU B;  1HBR B;  1MYF A;  1COL A;  4MQG A;  5EYS A;  4BS9 A;  2ZLV B;  3HF4 A;  2V1G A;  5JOM A;  4AVD A;  1CII A;  1XZ5 A;  2HZ1 A;  1CMY A;  1QSH A;  3QM8 A;  1S0H A;  1Y83 B;  1HGA A;  3PI9 B;  1YFF B;  3IA3 B;  3IC0 A;  2HBE B;  1S5Y B;  1Y35 A;  3AQ7 A;  3PI8 B;  3UHY A;  2QU0 B;  3OVU C;  2DN2 B;  1MYJ A;  1YMA A;  4MQJ B;  4ETU A;  3MJP B;  1ABW B;  1MNI A;  4F6I A;  1GBV A;  2D2M B;  1JZL A;  2G14 A;  1CQX A;  2AUP A;  3DR9 A;  4MQK A;  3UHB A;  1R1X B;  2V1J A;  1MYI A;  1IBE B;  4HHB B;  5JDO F;  2HHE A;  3QM7 A;  1YMC A;  3NG6 B;  4MQH A;  2V1I A;  1VXC A;  3ODQ B;  2VHB A;  2H35 A;  3S65 B;  1Y4F B;  2ZSX A;  1YH9 B;  4A8W A;  1RSE A;  1C7D B;  4PQB A;  4IRO B;  3LHB A;  5F2A A;  3EU1 A;  2EB9 A;  1M9P B;  1SHR A;  2ZFB A;  2C7K A;  1Y5F B;  3D7O B;  3DBJ B;  5HY8 A;  5CNG A;  3ZJQ A;  1FSL A;  4AVE A;  1YHE B;  1LIA B;  1HDS A;  2ZLX A;  1HBS B;  1HJT A;  2GRH A;  1ABY A;  5CND A;  1DM1 A;  1Y0C B;  4G51 A;  1QXE A;  3SZK B;  1CH2 A;  4N7O B;  5HLX A;  3P5Q A;  1UVK A;  4XXK A;  1AJ9 A;  2ZT4 A;  1LA6 B;  2GNV A;  2MYE A;  1HV4 A;  4ZIZ B;  1NZ2 A;  1J3Y B;  1DXU B;  1U7S A;  5HU6 B;  3WCU B;  1X9F C;  5CN8 A;  1OR4 A;  1HDB B;  2Z6N A;  1HDA B;  4GXE B;  1A6K A;  1XYE B;  1XZV A;  1YEN B;  4H0M A;  4HBI A;  2R80 A;  1K1K A;  1YIE B;  1MBI A;  4ESA A;  4H2L B;  1CG8 A;  4A8M P;  1FSX B;  3PMC A;  2ZWJ A;  2HBS B;  1IWH B;  1GH0 A;  3MJP A;  2D6C A;  4ERV A;  1N9I A;  3UHR A;  4U8U D;  1NQP B;  2VYY A;  4YU4 B;  3UBV A;  1MLU A;  2PEG A;  3PIA B;  1XXT B;  3UHE A;  1KTP A;  2EVP A;  1Y4F A;  1RPS A;  2X49 A;  1G09 B;  1KD2 A;  4LPI A;  4L1E A;  3HRW A;  1A01 B;  2MGL A;  2ZS1 D;  3GK9 A;  3ZJJ A;  1HAC A;  4X0L B;  1LFQ A;  2X4A A;  1DXV A;  5AQD A;  1RQ3 B;  1ON7 A;  3QZZ A;  4C0N A;  2ZS1 B;  1J41 A;  2GRZ A;  2LH1 A;  4O4T A;  1X9F A;  1Y4P A;  1HI1 A;  1F99 A;  1XZ7 B;  2O5S X;  2VLZ A;  1PHN B;  4BJU A;  4N8T B;  3ASE A;  1VHB A;  3S48 C;  5SW7 B;  3GOU A;  2GTL D;  2BK9 A;  2UUM A;  3VNC A;  2J96 A;  1Y8W B;  1HHO A;  3QM6 A;  1CG5 A;  1Y2Z A;  1VXB A;  2R4Y A;  1Y4V B;  1YFF A;  4YJJ B;  6HBI A;  2HZ2 A;  1Y7Z A;  2MGG A;  1S5Y A;  1C40 A;  1LFT A;  5KER A;  1XZV B;  3WI8 A;  2Z6T A;  4XDI A;  1CO8 A;  2RI4 A;  1G9V B;  3GQR A;  1NPF A;  5HAV A;  1SPG A;  4MU5 A;  4GY3 A;  109M A;  1Y0A B;  1Y4G B;  4MQI B;  1VXE A;  1UFJ A;  1S5X A;  1VWT A;  3UH7 A;  2DKD A;  2HBF A;  3UH6 A;  1V07 A;  1Y01 B;  3WR1 B;  3G4U A;  1R1X A;  1MOH A;  1F63 A;  2NRM A;  3A59 A;  1YOI A;  108M A;  2HHB B;  3D17 A;  1YCB A;  1YVQ A;  3G4Q A;  1THB A;  1EWA A;  3OJ1 A;  1HA7 B;  3UBC A;  4MXK A;  1Y8H B;  1Y8I A;  1XZ5 B;  1B33 A;  3HEO A;  1V4W A;  4F6D A;  2HBC A;  1GVH A;  5EUI B;  6HBW A;  4KJT A;  1IT2 A;  1MOB A;  1Y35 B;  1JW8 A;  1J3Z B;  2VJR A;  2W72 C;  1LFL A;  3ZJM A;  1CPC B;  1MLL A;  1NS9 B;  1ABW A;  1G08 A;  2MGE A;  2ZLT A;  1BUW B;  1JF3 A;  1UVL A;  1YEV A;  1PMB A;  4GZG A;  4MQK B;  1JPB A;  1Y4P B;  4KMV A;  4F6G A;  2AA1 A;  1PHN A;  1YEU A;  1QXE B;  1GDL A;  2MGC A;  1YHU D;  2GTL B;  1HV4 B;  3G52 A;  1JDO A;  1O16 A;  1UVY A;  3AG0 A;  4DC8 A;  1CIO A;  5JGG A;  1MDN A;  1ALL B;  3OO4 A;  5E29 B;  1Y85 B;  1XZU A;  1XYE A;  4B4Y A;  4IRO A;  1URY A;  4YJJ A;  3MYM A;  3KUN A;  5AZR A;  2JLG A;  5HY8 B;  1Y5K A;  1Y45 A;  3K9Z A;  1Y09 B;  1A0U B;  5ILE A;  1JWN A;  5EU2 A;  1HBB B;  2C7J A;  3O2C A;  2ZLX B;  1GJN A;  3WR1 A;  1DLW A;  3AQ8 A;  4M4B A;  3V57 A;  3LQ9 A;  3UHU A;  1ECN A;  3PI4 A;  5FVB M;  1O1I B;  1GBU B;  2MYC A;  4NXC A;  1A3O B;  2HBS A;  4TWU A;  2G10 A;  2ZS0 C;  1YHR B;  4MAX A;  3IXF A;  1CH7 A;  2Z6N B;  104M A;  1BVD A;  1G0A A;  1DXT B;  4TWV A;  3UHH A;  1J52 A;  2CMM A;  1CH4 A;  1BZ6 A;  5C6Y A;  1AJG A;  1MBN A;  1OBM A;  2D5Z B;  4HH0 A;  4HH1 A;  2W31 A;  2HBD A;  1O1M A;  1BUW A;  1NWN A;  4N8T A;  2BNL A;  106M A;  3EDA A;  4F4O A;  3AT6 A;  1I3E A;  3E5O A;  3KMF C;  1X9F D;  1Y0D A;  1HI8 A;  1IOP A;  2O5O X;  1IRC A;  3SDN A;  3B75 A;  2ZLU B;  4U8U C;  4L7Y A;  1MOD A;  1NIH A;  4Q70 B;  1XQ5 B;  4LMX B;  1J40 A;  103M A;  1MYT A;  3OO4 B;  2R4Z A;  5KDQ A;  2ZT2 A;  3S66 A;  2MYD A;  2ZLW A;  4JYQ A;  1YIH B;  2EB8 A;  1SPG B;  7HBI A;  1Y0A A;  4XXI A;  4ROL A;  1FDH G;  4OF9 A;  3V2Z A;  3PT8 A;  1T1N B;  2AV3 A;  3UHX A;  5EV5 A;  1CG5 B;  1DXD A;  1F99 B;  2C7J B;  2R4X A;  2MGM A;  2VEB A;  2QSS B;  1UVX A;  3DHT A;  3A59 B;  2VML B;  2W72 A;  4MPM A;  4NS2 A;  1HA7 A;  4A8K A;  3BJ2 A;  1XY0 B;  2WCQ A;  1MWD A;  1RTX A;  1MLF A;  2MGK A;  3O7N A;  1BIJ A;  5EUI A;  1Y2Z B;  2JLF A;  1B8D B;  1GCV A;  1IT3 A;  1KN1 A;  1YVQ B;  1CBM A;  5CNE A;  1BZP A;  4FC3 A;  1S6A A;  3O89 A;  1VWT B;  2D5Z A;  4DWU A;  2VLY A;  3PI3 A;  3TM3 A;  3GQG B;  1I3D A;  5D5R A;  1YOG A;  2H8F A;  1LFZ B;  4TMA B;  3AT6 B;  4FWY A;  4HRR B;  5HLU A;  4UIQ A;  2NRL A;  4ILZ A;  3NUH B;  4MQC A;  3FS4 A;  1ALL A;  2AUR A;  2ZLU A;  4PO5 A;  1O1J B;  4WJG 1;  5F0B A;  5E29 A;  2HBC B;  2FAL A;  2BWH A;  1SDL A;  1HBA B;  3BOM A;  2OHA A;  1BBB B;  2HCO B;  1LH7 A;  1MNK A;  3S66 B;  1YIH A;  1LH3 A;  2ZFO B;  3VRF B;  2ZLV A;  4LM6 B;  1BZ0 A;  5ILR A;  2Z85 A;  3NL7 A;  2R4W A;  3PT8 B;  3BJ1 B;  1A00 B;  3WHM A;  1MBS A;  1WLA A;  1O1N A;  5JDO D;  5HBI A;  3QM9 A;  3DUT A;  4MBA A;  4NXA A;  3WCV A;  2SPN A;  1BVC A;  1RQA A;  2H8D B;  2BLJ M;  1Y09 A;  1GLI B;  3LR7 A;  3WTG A;  1JL6 A;  2V1F A;  1JF4 A;  1FDH A;  2FRF A;  4Z8K B;  1COH A;  1SI4 B;  2DN1 B;  3AT5 B;  1DO7 A;  1G0B B;  3FH9 B;  3ZHW A;  2ZS0 B;  1KN1 B;  1Z8U B;  4H0B A;  2OHB A;  3PT7 A;  2DN2 A;  3ARK A;  1F65 A;  3QJE A;  4MQH B;  1IDR A;  4NI1 B;  3S65 A;  2MB5 A;  1XZ2 A;  1Y5J A;  1EW6 A;  4F6F A;  1QXD A;  1GBV B;  1UVN A;  1QSH B;  1VXD A;  1DXC A;  1A9W E;  3ARJ A;  2DKA A;  1JP8 A;  5MBN A;  1DTI A;  4U8U B;  1J7W B;  3A5B A;  2ZT1 A;  1Y5F A;  1HHS A;  1NIH B;  3UHC A;  2LHB A;  3ZJO A;  3MKB A;  3GKV A;  2D2M A;  4F0T B;  1MTI A;  3CY5 A;  3BOM B;  4ZVA A;  1XG0 C;  1UVI A;  1MWB A;  4N7N A;  2AV0 A;  5M3S A;  1C7C B;  3TLD A;  2C7K B;  1DDT A;  4FH6 A;  2Z6S A;  3K8B A;  3UHT A;  1O1L B;  2W6V B;  3ZOL A;  1LFY A;  1MLN A;  1Y4R A;  5EE4 C;  3R0G A;  1YH9 A;  1FAW A;  1YEQ A;  1VRE A;  4F4O B;  1DUO A;  3VRG A;  1NZ5 A;  3G4Y A;  3UHW A;  1MLM A;  3EU1 B;  4ESA B;  3BA2 A;  1UX8 A;  3WFU A;  4ROL B;  1MBD A;  1GH0 B;  2NSS A;  5JDO C;  5E6E B;  2G0X A;  2YSK A;  1GDJ A;  1WMU B;  4RMP A;  2ZLW B;  3DHT B;  5CNC A;  2SPO A;  3ZJI A;  4M4A B;  3ZTA A;  1YE2 A;  2FRK X;  4NI1 A;  5MBA A;  3HXN A;  2I88 A;  3HC9 A;  1J3Y A;  1RPS B;  3NMM B;  1HGA B;  4DWT A;  3BRP A;  2D2N C;  1H1X A;  2JL9 A;  2D5X A;  4H0M B;  3GQP A;  2QRW A;  2YRS B;  3K3U A;  1UIW A;  1A6G A;  2D2N A;  1YMB A;  2XKG A;  5D1V A;  5ILM A;  3FS4 B;  3L0F A;  2MGD A;  1Y31 A;  1VXG A;  3G4V A;  1U7R A;  1HBA A;  1Y4Q B;  1J7S B;  3MKB B;  2UUL D;  5CHR A;  3OZU A;  3MWN A;  5B13 A;  2AUQ A;  1MLS A;  1RVW A;  3CIU B;  4B02 A;  4X0L A;  1C7C A;  2VYW A;  1K0Y A;  5B85 A;  1J41 B;  1DWR A;  1Y0W B;  1Y7C B;  1A00 A;  2O5Q X;  3W4U B;  3A2G A;  1LFY B;  1C7D A;  2IN4 A;  1Y7D B;  1EYX A;  3GIO A;  3WCP A;  1Y7Z B;  1A3N A;  3VRE A;  4FWZ A;  2G0Z A;  1DTM A;  1SHR B;  2UUN D;  2ZFB B;  1GCW B;  1G9V A;  1BAB A;  3GQR B;  5CN7 A;  1RQ4 B;  1SWM A;  5E83 B;  4F0U A;  1RH1 A;  1Y4G A;  4UUR A;  1BZ0 B;  1Y8W A;  1RQ3 A;  2UUN B;  3NFE B;  4LMS B;  4WJG A;  1SDL B;  3OZW A;  3FH9 A;  3OO5 B;  5CNF A;  1LJW B;  1YEO A;  4N7O A;  1R1Y A;  2FRJ X;  3P5Q B;  3WFT A;  1BZZ B;  1J7Y B;  1QSI A;  2D2M C;  2IG3 A;  4NI0 B;  2G0S A;  1Y8H A;  3WFW A;  101M A;  3WCU D;  1YDZ A;  2RAO A;  3BJ1 A;  3RQR A;  1TES A;  3GUQ A;  1JBO A;  1HAB A;  5KER B;  4O35 A;  2D5X B;  4H2L A;  4QAU A;  3DUT B;  1I7Y B;  3QJE B;  2FAM A;  1Y8I B;  105M A;  4MQI A;  3WCW B;  1Y31 B;  4SDH A;  1G08 B;  1DUK A;  1OUT B;  2O5M X;  1X46 A;  4F0T A;  2D60 A;  1COH B;  111M A;  3HEP A;  2C7L A;  4YU4 A;  3WCU C;  1O1P A;  4PQC A;  5HLQ A;  1ECO A;  2KSC A;  2BMM A;  1HLM A;  1V9Q A;  1DWS A;  2D2M D;  1RVW B;  3CIU A;  1KR7 A;  4NK2 A;  4U8U A;  4ZVB A;  4F69 A;  1O1O A;  1THB B;  1V4X B;  3R5I A;  1A6N A;  1TOX A;  1MNO A;  1B33 B;  4NZI A;  3QJB B;  3W4U A;  2AA1 B;  3A5A A;  1HLB A;  2PGH A;  1A0Z B;  3D4X B;  1LH2 A;  3ECX A;  3G4R A;  3ECL A;  3A0G B;  2W6W A;  1RQ4 A;  2DXM B;  2ZS1 A;  1CPC A;  2O5L X;  1NS9 A;  2GLN A;  3GKV B;  3E55 A;  1Y0T B;  2ZSR A;  2M6Z B;  2WCR A;  2B7H B;  1M6C A;  1CIK A;  3UHN A;  1C7B B;  1Q1F A;  4N7N B;  2BLI A;  1MLK A;  5C6E A;  1O1I A;  3M3A A;  1NZ4 A;  2GTL A;  1NGK A;  4JAC A;  2V1K A;  2VRY A;  3ARL A;  4ROM A;  3NMM A;  2MGB A;  3RJN B;  1AJH A;  1FAW B;  2ZS0 D;  3KVS B;  5CHQ A;  1LFT B;  1CP5 A;  1XZU B;  1G0A B;  2LH7 A;  4RMP B;  1Y46 B;  1YE0 A;  2Z8A A;  2D2N B;  3ZH0 A;  1JZM A;  2O5T X;  1XZ4 A;  3UGY A;  2GNW A;  1Y45 B;  1YVT A;  2D2N D;  1J7S A;  1OJ6 A;  2NX0 A;  3UHZ A;  1A87 A;  2DN3 B;  2BW9 M;  1NS6 A;  102M A;  2E2Y A;  2QMB A;  1MNJ A;  5JDO E;  3GQP B;  1MLQ A;  3MBA A;  3LQD B;  1EBT A;  1JEB B;  3V58 A;  1B86 B;  1JY7 A;  2V8A B;  3QZX A;  1MLG A;  1V4W B;  1Y7C A;  1MKO B;  3ZOM A;  1DKE B;  1WAC A;  4HSX A;  1MYG A;  1HCO B;  4N7P A;  5CN5 A;  1A3N B;  3VRE B;  1NPG A;  3UH5 A;  1GCW A;  1A0Z A;  3VAU A;  3D1A B;  1YHU C;  2V1H A;  4FH7 A;  1K0Y B;  2UUN A;  1FHJ A;  3S1I A;  1HGC B;  2GKN A;  1O1M B;  1L2K A;  5KDQ B;  1D8U A;  1YEU B;  1LH5 A;  1HBS A;  3ED9 A;  4F68 A;  1MNH A;  2GL3 A;  1HBR A;  1ASH A;  2W6Y A;  1SDK A;  3WCT C;  3GKT A;  3BJ2 B;  2RAO B;  1MBA A;  1Y0W A;  3UH3 A;  4F6J A;  1HI0 P;  1HGB A;  1YHU A;  3E4N A;  4C44 A;  1Y85 A;  3MJU B;  2BKM A;  3UHI A;  5CN6 A;  2R1H A;  2QLS A;  3MVC A;  3WCU A;  3QJD A;  2HBE A;  1W92 A;  4GXE A;  1LJW A;  1YEO B;  3ONZ B;  1YEN A;  2G11 A;  1UC3 A;  4ESU A;  2MGH A;  3QQR A;  1OFJ A;  3PI1 A;  2QFK A;  1YDZ B;  3NFE A;  3ZJR A;  4A8Q A;  1BIJ B;  2ZSY A;  1HBB A;  4WCH D;  1UVJ A;  3GQG A;  3O2C B;  2V1E A;  3QJC B;  3OO5 A;  2C7L B;  2DHB A;  3U3E A;  3M3B A;  1NQP A;  2MGJ A;  2XKH A;  2ZSP A;  3IC0 B;  1ITH A;  2QMB B;  1FLP A;  2VYZ A;  2VJT A;  3ZJL A;  1QPW B;  1CPW A;  1BZR A;  3HHB A;  1GBU A;  1XXT A;  3GLN A;  1LUE A;  2MYA A;  4MQC B;  1N9X A;  1YHR A;  1V75 A;  3HYU A;  1GDK A;  1G09 A;  1MYM A;  2PGH B;  1JBO B;  1EMY A;  1LHS A;  1BBB A;  1HAB B;  5ILP A;  1IBE A;  4HHB A;  3PI8 A;  2MGI A;  1ECD A;  1YGF A;  1NZ3 A;  2MGF A;  1OR6 A;  2DXM A;  1LFQ B;  1V4X A;  3R5I B;  2HZ3 A;  3WCW A;  4NK1 A;  1ON7 B;  4FWX A;  1O1J A;  4A8O A;  3DHR B;  4BJA A;  4G1B A;  3PI2 A;  2M6Z A;  3BJ3 A;  1YG5 B;  1UX9 A;  1FN3 A;  2B7H A;  3QM5 A;  3UHD A;  1ABY B;  2HHE B;  2HHD B;  5FVB A;  1QI8 A;  1JL7 A;  1YGD B;  1LA6 A;  4AE0 A;  3ZJS A;  1XDT T;  1DLY A;  2MHB A;  4Q70 A;  1YZI A;  3EOK A;  1J40 B; 
#chains in the Genus database with same CATH homology
 1LTW A;  1YHU B;  1HDB A;  1HDS B;  3AT5 A;  3D4X A;  2MBW A;  1O1N B;  3NML A;  2ZS0 A;  5EET A;  4B3W A;  3SDH A;  2ZFO A;  1RTE A;  1FSX A;  3D7O A;  3M39 A;  1IWH A;  3KMF A;  3NL7 B;  2EKT A;  3A5G A;  1GZX A;  1PBX A;  1Y0T A;  5CMV A;  2GRF A;  1G0B A;  4TYX A;  2OH9 A;  2W72 B;  4KMW A;  2BLH A;  3RGK A;  3WCT D;  1JEB A;  1HRM A;  1QPW A;  2WY4 A;  3D17 B;  1CO9 A;  3GYS B;  1Y5J B;  1MTK A;  3IC2 A;  3WCT B;  1CH1 A;  5HU6 A;  2ZFO C;  1HCO A;  3HYU B;  1HDA A;  1SI4 A;  2MYB A;  2SPL A;  2EVK A;  3KUO A;  3VHB A;  1LHT A;  1LFV A;  1DXV B;  3MYN A;  3PIA A;  1LFL B;  1UFP A;  1B86 A;  1JY7 B;  1XZ4 B;  2W6V A;  1O1L A;  1XZ2 B;  1JP9 A;  1X9F B;  1OUU B;  1QXD B;  1XZ7 A;  3M38 A;  1YEV B;  2DN3 A;  1KD2 B;  1CH3 A;  3CY5 B;  3V2V A;  1NS6 B;  4N7P B;  3D1K A;  1CLS B;  3HRW B;  4HRT B;  1OFK A;  4HRR A;  1CH9 A;  1WVP A;  4MXL A;  1GDI A;  1S61 A;  2PEG B;  3LB2 A;  1YGD A;  5EQM A;  3BCQ B;  2GDM A;  2HBG A;  3WCW C;  3PEL A;  2MHB B;  4O2G A;  1DKE A;  2ZT0 A;  3MJU A;  3EOK B;  1Y4V A;  3TM9 A;  5JGG B;  1HGC A;  1XCH A;  5AB8 A;  1YEQ B;  1UT0 A;  1H97 A;  1A01 A;  3UHG A;  2NSR A;  1WMU A;  3G53 A;  1YCA A;  1SDK B;  1A4F B;  3LB3 A;  3K8B B;  1Y22 A;  4YU3 A;  1A0U A;  3QJC A;  2XKI A;  4ODC A;  2DHB B;  4G1V A;  2QLS B;  1F5O A;  2EF2 A;  3VRG B;  3ECZ A;  1BZ1 B;  1SPE A;  107M A;  3A9M A;  1UIW B;  1RQA B;  1DO3 A;  110M A;  1V4U A;  2G0V A;  3HXN B;  1GLI A;  3UHV A;  3WTG B;  2W6X A;  3IC2 B;  2HBF B;  6HBW B;  1Y4Q A;  2R1H B;  3AQ6 A;  1Y7G A;  2AUO A;  1O1K B;  1CQ2 A;  1J3F A;  1Y8K A;  3UHK A;  4PNJ A;  3QMA A;  1FCS A;  2G0R A;  5CNB A;  3ZJP A;  4M4A A;  1YE2 B;  1EBC A;  3BJ3 B;  2MGA A;  1V75 B;  1FN3 B;  5AZQ A;  1Y7D A;  3WCW D;  1NWI A;  1A9W A;  3LB1 A;  2O58 X;  4HRT A;  1QI8 B;  2HHB A;  1HBI A;  3HHB B;  1Y0D B;  2YRS A;  1NAZ A;  3UHQ A;  4IT8 A;  5KKK A;  3ORD A;  2WTG A;  2OH8 A;  3DHR A;  2LH2 A;  3MN0 A;  1YG5 A;  3WFX A;  1Y4B A;  3WCP B;  1NXF A;  1MBO A;  2HHD A;  1J3Z A;  1URV A;  1MWC A;  1YGF B;  3GDJ B;  112M A;  2VLX A;  1LH6 A;  1HBG A;  1Y22 B;  2ZLT B;  4YU3 B;  1GZX B;  4VHB A;  1YZI B;  3ZJH A;  2ZFO D;  1S0H B;  2VM0 A;  1Y83 A;  1MYH A;  4UZV A;  2DC3 A;  1M6M A;  3HEN A;  3PI9 A;  2QSS A;  1BAB B;  2ZSS A;  1MYZ A;  2XYK A;  1MLO A;  1XY0 A;  4HSW A;  4MQJ A;  1Y5K B;  3WCT A;  1MLJ A;  1VRF A;  1PBX B;  5E6E A;  1NEJ B;  1HBH A;  1Y7G B;  3OZV A;  1LFV B;  2QSP B;  1MBC A;  2OIF A;  4MQG B;  3ODQ A;  1DO4 A;  2OLP A;  4XS0 A;  1CH5 A;  4H07 A;  1OUU A;  3AQ5 A;  4FC3 B;  2LH5 A;  1CMY B;  1IRD A;  3D1K B;  1BIN A;  1DXT A;  4M4B B;  2O5B X;  2H35 B;  2FRI X;  3B75 B;  3QQQ A;  3GYS A;  3BCQ A;  3UGZ A;  1A3O A;  4L7Y B;  3PEL B;  3WCV C;  2G12 A;  3RJ6 A;  1XQ5 A;  4L2M A;  4DC7 A;  2WTH A;  1Y4B B;  1CLS A;  2VEE A;  1UMO A;  2HCO A;  1O1P B;  1C7B A;  3NG6 A;  2QFN A;  2GTL C;  1HSY A;  3LR9 A;  1T1N A;  1MGN A;  2HBD B;  1DXU A;  5EOH A;  3WCV D;  3WHM B;  1BZ1 A;  1MCY A;  1S56 A;  1YIE A;  5EE4 D;  5C6E B;  3H58 A;  1M9P A;  1MLH A;  5E83 A;  1AJ9 B;  3A0G A;  2LH3 A;  3WCV B;  1BJE A;  1A4F A;  4ROM B;  5EYJ A;  5IKS A;  4ODC B;  1Y8K B;  1V5H A;  2ZSO A;  1NEJ A;  1HBH B;  5CN9 A;  2EKU A;  2R80 B;  3ZJN A;  1R1Y B;  4O4Z A;  3G46 A;  1YE0 B;  4KN3 A;  3EDB A;  1J7Y A;  1BZZ A;  1CG8 B;  1QSI B;  3HF4 B;  1A6M A;  1CBL A;  2QSP A;  4MBN A;  4NI0 A;  1X3K A;  1JZK A;  3UI0 A;  1N9F A;  4XS0 B;  1DWT A;  1JP6 A;  3LB4 A;  1MKO A;  1YVT B;  1MTJ A;  3UHS A;  1IRD B;  2G3H A;  1GCV B;  2QU0 A;  1K1K B;  3D1A A;  2GKM A;  1Y46 A;  3LQD A;  1MLR A;  1V4U B;  1J7W A;  3AQ9 A;  3MOU A;  1OUT A;  2D60 B;  3OK5 A;  2ZT3 A;  5B84 A;  2ZST A;  1VXF A;  1MZ0 A;  1O1K A;  1MOA A;  1LFZ A;  1DO1 A;  5SW7 A;  1VXA A;  5CN4 A;  1HAC B;  1O1O B;  2LH6 A;  2C0K A;  1S69 A;  2ZSZ A;  1AZI A;  2SPM A;  3OGB A;  3S1J A;  1VXH A;  1CP0 A;  1HHO B;  3QJB A;  1KFR A;  1Y4R B;  2R50 A;  2H8F B;  2ZSN A;  1YOH A;  1C40 B;  1TU9 A;  3GDJ A;  1F5P A;  3VRF A;  1B0B A;  2H8D A;  1YHE A;  1S5X B;  1HGB B;  1FHJ B;  1LH1 A;  3E5I A;  4O1T A;  2ZSQ A;  1ABS A;  3G4W A;  4F6B A;  2ZS1 C;  2DN1 A;  1MOC A;  1ECA A;  3QJD B;  2JHO A;  3H57 A;  1N9H A;  1Y0C A;  4G51 B;  3ONZ A;  2RI4 B;  4PQ6 A;  3SZK A;  4OOD A;  3PT7 B;  3GOU B;  1HBR B;  1MYF A;  4MQG A;  5EYS A;  2ZLV B;  3HF4 A;  2V1G A;  5JOM A;  4AVD A;  1XZ5 A;  2HZ1 A;  1CMY A;  1QSH A;  3QM8 A;  1S0H A;  1Y83 B;  1HGA A;  3PI9 B;  1YFF B;  3IA3 B;  3IC0 A;  2HBE B;  1S5Y B;  1Y35 A;  3AQ7 A;  3PI8 B;  3UHY A;  2QU0 B;  3OVU C;  2DN2 B;  1MYJ A;  1YMA A;  4MQJ B;  3MJP B;  1ABW B;  1MNI A;  4F6I A;  1GBV A;  2D2M B;  1JZL A;  2G14 A;  1CQX A;  2AUP A;  3DR9 A;  4MQK A;  3UHB A;  1R1X B;  2V1J A;  1MYI A;  1IBE B;  4HHB B;  5JDO F;  2HHE A;  3QM7 A;  1YMC A;  3NG6 B;  4MQH A;  2V1I A;  1VXC A;  3ODQ B;  2VHB A;  2H35 A;  3S65 B;  1Y4F B;  2ZSX A;  1YH9 B;  1RSE A;  1C7D B;  4PQB A;  4IRO B;  3LHB A;  5F2A A;  3EU1 A;  2EB9 A;  1M9P B;  1SHR A;  2ZFB A;  1Y5F B;  3D7O B;  5HY8 A;  5CNG A;  3ZJQ A;  1FSL A;  4AVE A;  1YHE B;  1HDS A;  2ZLX A;  1HBS B;  1HJT A;  2GRH A;  1ABY A;  5CND A;  1DM1 A;  1Y0C B;  4G51 A;  1QXE A;  3SZK B;  1CH2 A;  4N7O B;  5HLX A;  3P5Q A;  1AJ9 A;  2ZT4 A;  1LA6 B;  2GNV A;  2MYE A;  1HV4 A;  1NZ2 A;  1J3Y B;  1DXU B;  1U7S A;  5HU6 B;  3WCU B;  1X9F C;  5CN8 A;  1OR4 A;  1HDB B;  2Z6N A;  1HDA B;  1A6K A;  1XYE B;  1XZV A;  1YEN B;  4HBI A;  2R80 A;  1K1K A;  1YIE B;  1MBI A;  4ESA A;  4H2L B;  1CG8 A;  1FSX B;  2ZWJ A;  2HBS B;  1IWH B;  3MJP A;  2D6C A;  1N9I A;  3UHR A;  4U8U D;  1NQP B;  2VYY A;  4YU4 B;  3UBV A;  1MLU A;  2PEG A;  3PIA B;  1XXT B;  3UHE A;  2EVP A;  1Y4F A;  1RPS A;  1G09 B;  1KD2 A;  4LPI A;  3HRW A;  1A01 B;  2MGL A;  2ZS1 D;  3GK9 A;  3ZJJ A;  1HAC A;  4X0L B;  1LFQ A;  1DXV A;  1RQ3 B;  3QZZ A;  4C0N A;  2ZS1 B;  1J41 A;  2GRZ A;  4O4T A;  2LH1 A;  1X9F A;  1Y4P A;  1XZ7 B;  2O5S X;  2VLZ A;  4N8T B;  3ASE A;  1VHB A;  3S48 C;  5SW7 B;  3GOU A;  2GTL D;  2BK9 A;  1Y8W B;  1HHO A;  3QM6 A;  1CG5 A;  1Y2Z A;  1VXB A;  2R4Y A;  1Y4V B;  1YFF A;  6HBI A;  2HZ2 A;  1Y7Z A;  2MGG A;  1S5Y A;  1C40 A;  1LFT A;  5KER A;  1XZV B;  3WI8 A;  2Z6T A;  4XDI A;  1CO8 A;  2RI4 A;  1G9V B;  3GQR A;  1NPF A;  5HAV A;  1SPG A;  4MU5 A;  109M A;  1Y0A B;  1Y4G B;  4MQI B;  1VXE A;  1UFJ A;  1S5X A;  1VWT A;  3UH7 A;  2HBF A;  3UH6 A;  1V07 A;  1Y01 B;  3WR1 B;  3G4U A;  1R1X A;  1MOH A;  1F63 A;  2NRM A;  3A59 A;  1YOI A;  108M A;  2HHB B;  3D17 A;  1YCB A;  1YVQ A;  3G4Q A;  1THB A;  1EWA A;  3OJ1 A;  3UBC A;  4MXK A;  1Y8H B;  1Y8I A;  1XZ5 B;  3HEO A;  1V4W A;  4F6D A;  2HBC A;  1GVH A;  5EUI B;  6HBW A;  4KJT A;  1IT2 A;  1MOB A;  1Y35 B;  1JW8 A;  1J3Z B;  2W72 C;  1LFL A;  3ZJM A;  1MLL A;  1NS9 B;  1ABW A;  1G08 A;  2MGE A;  2ZLT A;  1BUW B;  1JF3 A;  1YEV A;  1PMB A;  4GZG A;  4MQK B;  1JPB A;  1Y4P B;  4KMV A;  4F6G A;  2AA1 A;  1YEU A;  1QXE B;  1GDL A;  2MGC A;  1YHU D;  2GTL B;  1HV4 B;  3G52 A;  1JDO A;  1O16 A;  1UVY A;  3AG0 A;  4DC8 A;  1CIO A;  5JGG A;  1MDN A;  3OO4 A;  5E29 B;  1Y85 B;  1XZU A;  1XYE A;  4B4Y A;  4IRO A;  1URY A;  3MYM A;  3KUN A;  5AZR A;  5HY8 B;  1Y5K A;  1Y45 A;  3K9Z A;  1Y09 B;  1A0U B;  5ILE A;  1JWN A;  5EU2 A;  1HBB B;  2ZLX B;  1GJN A;  3WR1 A;  1DLW A;  3AQ8 A;  4M4B A;  3UHU A;  1ECN A;  3PI4 A;  1O1I B;  1GBU B;  2MYC A;  4NXC A;  1A3O B;  2HBS A;  4TWU A;  2G10 A;  2ZS0 C;  1YHR B;  4MAX A;  3IXF A;  1CH7 A;  2Z6N B;  104M A;  1BVD A;  1G0A A;  1DXT B;  4TWV A;  3UHH A;  1J52 A;  2CMM A;  1CH4 A;  1BZ6 A;  5C6Y A;  1AJG A;  1MBN A;  1OBM A;  2D5Z B;  2W31 A;  2HBD A;  1O1M A;  1BUW A;  1NWN A;  4N8T A;  2BNL A;  106M A;  3EDA A;  4F4O A;  3AT6 A;  1I3E A;  3E5O A;  3KMF C;  1X9F D;  1Y0D A;  1IOP A;  2O5O X;  1IRC A;  3SDN A;  3B75 A;  2ZLU B;  4U8U C;  4L7Y A;  1MOD A;  1NIH A;  1XQ5 B;  1J40 A;  103M A;  1MYT A;  3OO4 B;  2R4Z A;  5KDQ A;  2ZT2 A;  3S66 A;  2MYD A;  2ZLW A;  4JYQ A;  1YIH B;  2EB8 A;  1SPG B;  7HBI A;  1Y0A A;  4ROL A;  1FDH G;  4OF9 A;  3V2Z A;  3PT8 A;  1T1N B;  2AV3 A;  3UHX A;  5EV5 A;  1CG5 B;  1DXD A;  2R4X A;  2MGM A;  2VEB A;  2QSS B;  1UVX A;  3DHT A;  3A59 B;  2W72 A;  4MPM A;  4NS2 A;  3BJ2 A;  1XY0 B;  1MWD A;  1RTX A;  1MLF A;  2MGK A;  3O7N A;  1BIJ A;  5EUI A;  1Y2Z B;  1GCV A;  1IT3 A;  1YVQ B;  1CBM A;  5CNE A;  1BZP A;  4FC3 A;  1S6A A;  3O89 A;  1VWT B;  2D5Z A;  4DWU A;  2VLY A;  3PI3 A;  3TM3 A;  3GQG B;  1I3D A;  5D5R A;  1YOG A;  2H8F A;  1LFZ B;  3AT6 B;  4FWY A;  4HRR B;  5HLU A;  4UIQ A;  2NRL A;  4ILZ A;  4MQC A;  3FS4 A;  2AUR A;  2ZLU A;  4WJG 1;  1O1J B;  5F0B A;  5E29 A;  2HBC B;  2FAL A;  2BWH A;  1SDL A;  1HBA B;  3BOM A;  2OHA A;  1BBB B;  2HCO B;  1LH7 A;  1MNK A;  3S66 B;  1YIH A;  1LH3 A;  2ZFO B;  3VRF B;  2ZLV A;  1BZ0 A;  5ILR A;  2Z85 A;  3NL7 A;  2R4W A;  3PT8 B;  3BJ1 B;  1A00 B;  3WHM A;  1MBS A;  1WLA A;  1O1N A;  5JDO D;  5HBI A;  3QM9 A;  3DUT A;  4MBA A;  4NXA A;  3WCV A;  2SPN A;  1BVC A;  1RQA A;  2H8D B;  2BLJ M;  1Y09 A;  1GLI B;  3LR7 A;  3WTG A;  1JL6 A;  2V1F A;  1JF4 A;  1FDH A;  2FRF A;  1COH A;  1SI4 B;  2DN1 B;  3AT5 B;  1DO7 A;  1G0B B;  3FH9 B;  3ZHW A;  2ZS0 B;  1Z8U B;  4H0B A;  2OHB A;  3PT7 A;  2DN2 A;  3ARK A;  1F65 A;  3QJE A;  4MQH B;  1IDR A;  4NI1 B;  3S65 A;  2MB5 A;  1XZ2 A;  1Y5J A;  1EW6 A;  4F6F A;  1QXD A;  1GBV B;  1QSH B;  1VXD A;  1DXC A;  1A9W E;  3ARJ A;  1JP8 A;  5MBN A;  1DTI A;  4U8U B;  1J7W B;  3A5B A;  2ZT1 A;  1Y5F A;  1NIH B;  3UHC A;  2LHB A;  3ZJO A;  3MKB A;  3GKV A;  2D2M A;  1MTI A;  3CY5 A;  3BOM B;  4ZVA A;  1MWB A;  4N7N A;  2AV0 A;  5M3S A;  1C7C B;  3TLD A;  4FH6 A;  2Z6S A;  3K8B A;  3UHT A;  1O1L B;  2W6V B;  3ZOL A;  1LFY A;  1MLN A;  1Y4R A;  5EE4 C;  3R0G A;  1YH9 A;  1FAW A;  1YEQ A;  1VRE A;  4F4O B;  1DUO A;  3VRG A;  1NZ5 A;  3G4Y A;  3UHW A;  1MLM A;  3EU1 B;  4ESA B;  3BA2 A;  1UX8 A;  3WFU A;  4ROL B;  1MBD A;  2NSS A;  5JDO C;  5E6E B;  2G0X A;  1GDJ A;  1WMU B;  2ZLW B;  3DHT B;  5CNC A;  2SPO A;  3ZJI A;  4M4A B;  1YE2 A;  2FRK X;  4NI1 A;  5MBA A;  3HXN A;  3HC9 A;  1J3Y A;  1RPS B;  3NMM B;  1HGA B;  4DWT A;  2D2N C;  1H1X A;  2D5X A;  3GQP A;  2QRW A;  2YRS B;  3K3U A;  1UIW A;  1A6G A;  2D2N A;  1YMB A;  2XKG A;  5D1V A;  5ILM A;  3FS4 B;  2MGD A;  1Y31 A;  1VXG A;  3G4V A;  1U7R A;  1HBA A;  1Y4Q B;  1J7S B;  3MKB B;  5CHR A;  3OZU A;  2AUQ A;  1MLS A;  1RVW A;  3CIU B;  4X0L A;  1C7C A;  2VYW A;  1K0Y A;  5B85 A;  1J41 B;  1DWR A;  1Y0W B;  1Y7C B;  1A00 A;  2O5Q X;  3W4U B;  3A2G A;  1LFY B;  1C7D A;  2IN4 A;  1Y7D B;  3WCP A;  1Y7Z B;  1A3N A;  3VRE A;  4FWZ A;  2G0Z A;  1DTM A;  1SHR B;  2ZFB B;  1GCW B;  1G9V A;  1BAB A;  3GQR B;  5CN7 A;  1RQ4 B;  1SWM A;  5E83 B;  1Y4G A;  4UUR A;  1BZ0 B;  1Y8W A;  1RQ3 A;  3NFE B;  4WJG A;  1SDL B;  3OZW A;  3FH9 A;  3OO5 B;  5CNF A;  1LJW B;  1YEO A;  4N7O A;  1R1Y A;  2FRJ X;  3P5Q B;  3WFT A;  1BZZ B;  1J7Y B;  1QSI A;  2D2M C;  2IG3 A;  4NI0 B;  2G0S A;  1Y8H A;  3WFW A;  101M A;  3WCU D;  1YDZ A;  2RAO A;  3BJ1 A;  1TES A;  1HAB A;  5KER B;  4O35 A;  2D5X B;  4H2L A;  4QAU A;  3DUT B;  3QJE B;  2FAM A;  1Y8I B;  105M A;  4MQI A;  3WCW B;  1Y31 B;  4SDH A;  1G08 B;  1DUK A;  1OUT B;  2O5M X;  1X46 A;  2D60 A;  1COH B;  111M A;  3HEP A;  4YU4 A;  3WCU C;  1O1P A;  4PQC A;  5HLQ A;  1ECO A;  2KSC A;  2BMM A;  1HLM A;  1V9Q A;  1DWS A;  2D2M D;  1RVW B;  3CIU A;  1KR7 A;  4NK2 A;  4U8U A;  4ZVB A;  4F69 A;  1O1O A;  1THB B;  1V4X B;  3R5I A;  1A6N A;  1MNO A;  4NZI A;  3QJB B;  3W4U A;  2AA1 B;  3A5A A;  1HLB A;  2PGH A;  1A0Z B;  3D4X B;  1LH2 A;  3ECX A;  3G4R A;  3ECL A;  3A0G B;  2W6W A;  1RQ4 A;  2DXM B;  2ZS1 A;  2O5L X;  1NS9 A;  2GLN A;  3GKV B;  3E55 A;  1Y0T B;  2ZSR A;  2M6Z B;  2B7H B;  1M6C A;  1CIK A;  3UHN A;  1C7B B;  1Q1F A;  4N7N B;  2BLI A;  1MLK A;  5C6E A;  1O1I A;  3M3A A;  1NZ4 A;  2GTL A;  1NGK A;  4JAC A;  2V1K A;  2VRY A;  3ARL A;  4ROM A;  3NMM A;  2MGB A;  3RJN B;  1AJH A;  1FAW B;  2ZS0 D;  5CHQ A;  1LFT B;  1CP5 A;  1XZU B;  1G0A B;  2LH7 A;  1Y46 B;  1YE0 A;  2Z8A A;  2D2N B;  3ZH0 A;  1JZM A;  2O5T X;  1XZ4 A;  3UGY A;  2GNW A;  1Y45 B;  1YVT A;  2D2N D;  1J7S A;  1OJ6 A;  2NX0 A;  3UHZ A;  2DN3 B;  2BW9 M;  1NS6 A;  102M A;  2E2Y A;  2QMB A;  1MNJ A;  5JDO E;  3GQP B;  1MLQ A;  3MBA A;  3LQD B;  1EBT A;  1JEB B;  1B86 B;  1JY7 A;  3QZX A;  1MLG A;  1V4W B;  1Y7C A;  1MKO B;  3ZOM A;  1DKE B;  4HSX A;  1MYG A;  1HCO B;  4N7P A;  5CN5 A;  1A3N B;  3VRE B;  1NPG A;  3UH5 A;  1GCW A;  1A0Z A;  3VAU A;  3D1A B;  1YHU C;  2V1H A;  4FH7 A;  1K0Y B;  1FHJ A;  3S1I A;  1HGC B;  2GKN A;  1O1M B;  1L2K A;  5KDQ B;  1D8U A;  1YEU B;  1LH5 A;  1HBS A;  3ED9 A;  4F68 A;  1MNH A;  2GL3 A;  1HBR A;  1ASH A;  2W6Y A;  1SDK A;  3WCT C;  3GKT A;  3BJ2 B;  2RAO B;  1MBA A;  1Y0W A;  3UH3 A;  4F6J A;  1HGB A;  1YHU A;  3E4N A;  4C44 A;  1Y85 A;  3MJU B;  2BKM A;  3UHI A;  5CN6 A;  2R1H A;  2QLS A;  3MVC A;  3WCU A;  3QJD A;  2HBE A;  1W92 A;  1LJW A;  1YEO B;  3ONZ B;  1YEN A;  2G11 A;  1UC3 A;  2MGH A;  3QQR A;  1OFJ A;  3PI1 A;  2QFK A;  1YDZ B;  3NFE A;  3ZJR A;  1BIJ B;  2ZSY A;  1HBB A;  4WCH D;  3GQG A;  2V1E A;  3QJC B;  3OO5 A;  2DHB A;  3U3E A;  3M3B A;  1NQP A;  2MGJ A;  2XKH A;  2ZSP A;  3IC0 B;  1ITH A;  2QMB B;  1FLP A;  2VYZ A;  3ZJL A;  1QPW B;  1CPW A;  1BZR A;  3HHB A;  1GBU A;  1XXT A;  3GLN A;  1LUE A;  2MYA A;  4MQC B;  1N9X A;  1YHR A;  1V75 A;  3HYU A;  1GDK A;  1G09 A;  1MYM A;  2PGH B;  1EMY A;  1LHS A;  1BBB A;  1HAB B;  5ILP A;  1IBE A;  4HHB A;  3PI8 A;  2MGI A;  1ECD A;  1YGF A;  1NZ3 A;  2MGF A;  1OR6 A;  2DXM A;  1LFQ B;  1V4X A;  3R5I B;  2HZ3 A;  3WCW A;  4NK1 A;  4FWX A;  1O1J A;  3DHR B;  4BJA A;  4G1B A;  3PI2 A;  2M6Z A;  3BJ3 A;  1YG5 B;  1UX9 A;  1FN3 A;  2B7H A;  3QM5 A;  3UHD A;  1ABY B;  2HHE B;  2HHD B;  1QI8 A;  1JL7 A;  1YGD B;  1LA6 A;  3ZJS A;  1DLY A;  2MHB A;  1YZI A;  3EOK A;  1J40 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...