3QM9A

Blackfin tuna azido-myoglobin, atomic resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
145
structure length
139
Chain Sequence
ADFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAVSAHGATVLKKLGELLKHAILPLANSHATKHKIPINNFKLISEVLVKVMQEKAGLDAGGQTALRNVMGIIIADLEANYKELGFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structures of Blackfin Tuna Myoglobin
rcsb
molecule tags Transport protein
molecule keywords Myoglobin
total genus 59
structure length 139
sequence length 145
ec nomenclature
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 3qm9A00
1HDSB 3G4UA 1SI4B 1RSEA 2R80A 3DHTB 5KDQB 4YU3B 2W6VB 1CG5B 1NIHA 2DC3A 1LFTA 1UX8A 1DLWA 1DO1A 3PT8B 1NS6A 7HBIA 3D17A 4MQHA 1RPSA 2GTLB 3A5GA 2MGLA 3NL7A 1OUUA 3QM9A 3PI4A 1Y45A 1GZXA 3ZJNA 3WCVB 2H8DB 4WJGA 3D4XA 1DUOA 3ZJOA 4U8UD 4L7YA 2BLHA 3K8BA 3IC2B 1VXCA 3WCTD 2D5XB 1G0AA 3WFUA 1HLMA 5F0BA 1NZ3A 3UHZA 2XKIA 3HRWA 1MOBA 1UVXA 4G51B 3OO5A 2HHEA 2O58X 1YMCA 1LFZB 1KFRA 3BJ2B 3AT5B 2ZLUB 1DKEA 1X46A 1YIEA 4HRTA 2DN3B 1U7SA 2FRFA 1MDNA 1JP6A 1HGBB 1XXTA 3OO4B 1WVPA 1Y35B 2EVKA 3UHNA 3LQDB 3ODQA 2MHBA 1JZKA 1Y85B 1XZUB 3FS4A 2H35A 1XZ4B 5EV5A 3OZVA 1A9WA 1CH9A 1O1PA 3LB4A 3ECXA 1YE0B 1LH6A 3ZJHA 1Y8IA 1CQXA 1YFFB 1F5OA 3UHQA 2ZS1A 2VEBA 2GRFA 1RTEA 1HDBB 1KD2A 4PQCA 3HF4A 1J3YB 3AQ9A 1UIWA 1MYMA 2D6CA 3MN0A 4ESAA 2EB8A 4F6IA 1LTWA 2D2MB 1MTIA 1NZ2A 1J41B 5SW7A 4FWXA 2ZS0B 1A6KA 3HEPA 3GLNA 1Y31A 2MGJA 3LR7A 1PBXA 1Y8HB 1AJ9A 2ZSYA 1GLIA 1NAZA 1VXAA 3BOMA 1Y09B 3UHIA 4HSXA 1LHSA 5CMVA 3UH7A 3PI9B 1V75A 1N9XA 2SPNA 1MLQA 4N7PB 6HBWB 2XKGA 3HEOA 1X3KA 3V2ZA 1Y8KB 2GLNA 3NMLA 1EBTA 3EDAA 5KERA 111MA 1C7DA 3UHEA 1IWHB 3K3UA 1YCBA 2GDMA 2V1JA 4ROLA 1HACB 2G12A 1NQPB 3G4QA 1JZMA 1YHEB 2GKNA 3IC0B 3QJCB 1S5XA 2O5LX 4YU3A 2ZS0C 1NS9B 1XZ5A 2ZS1B 1HSYA 3M3AA 1YZIB 5CHRA 1DXUA 3HENA 1YGFB 1Y4FB 4O35A 1J3FA 1DM1A 5EU2A 1GVHA 4PQ6A 1ECDA 1MTJA 2W6XA 1MLLA 1DO7A 3B75B 2HBFA 1MNKA 2ZSZA 3R5IA 1O1KA 1SDLB 5D1VA 4F6JA 1R1YA 4KJTA 3BJ1B 2PEGB 1MLRA 2D2NB 2H8FB 1DTMA 3UHDA 2FALA 3ONZB 3VREA 3IC2A 1I3EA 1VXHA 2XYKA 2GTLC 3WTGB 4YU4B 6HBIA 1YHUD 1BIJA 3ARLA 3GDJB 1S5XB 3S1IA 2HZ1A 3UHKA 1HGCA 1HBSB 5EETA 3RJ6A 5HBIA 3VAUA 4NS2A 3MJUB 1Y7ZA 1DXDA 1GCWB 3TM3A 1HHOA 1XYEB 1COHA 4L2MA 4M4BA 1HBBA 3D1AB 3OO5B 1YIEB 1O1LA 3ARJA 3EOKB 1H97A 4MBNA 1BBBA 3PI3A 4MQKA 3AT5A 1DXTA 3R5IB 3OK5A 1UX9A 2LH6A 3FS4B 4HRRB 1LA6A 103MA 3NG6B 1BZ0B 1Q1FA 2R50A 3AQ6A 3PIAB 1UVYA 2G11A 2QRWA 4MQJA 3W4UA 1MCYA 3ONZA 1LFQB 4N7NA 5CN6A 4LPIA 2QU0B 3UGYA 2MYDA 2WTGA 5CN5A 1GDIA 2ZT0A 2MB5A 1CH1A 1K0YA 1MYHA 1HBRB 1FDHG 1IBEB 3UHBA 4HSWA 3K9ZA 2MGFA 3S66B 3PI1A 2QSPB 4F4OA 3LR9A 1JY7B 1HGCB 1HDSA 1OFJA 3A0GA 2G0SA 3WCPB 1JWNA 4WJG1 2CMMA 1QPWB 1SWMA 5HY8B 4NI1B 1Y01B 2BWHA 1DTIA 1J7YA 3KMFC 2ZS1C 3CY5A 1Y09A 3EOKA 1QSHB 2GRZA 1J7WB 1J7SB 1Y31B 2OLPA 2WY4A 1AJ9B 3UHTA 3WCWB 2B7HB 5AB8A 3WFXA 1RVWB 3MJUA 4FWYA 3AQ5A 1Y45B 4FH6A 2SPOA 1CLSB 1SHRB 2AA1B 1LH3A 2ZFOD 2DXMB 1Y7DB 3LB3A 1NZ5A 2OHAA 1Y7CB 2MGGA 1Y46A 1VXGA 2Z85A 4MQJB 3W4UB 1NQPA 1Y0DA 2QU0A 1GBVB 3E5IA 1G0BB 5E29A 1YEQB 5ILPA 1NEJB 1Y8KA 1Y8WB 3WCVA 4F4OB 1THBB 1LA6B 2R4WA 5JDOF 1CH3A 1ABYA 2GTLD 2MGBA 1LFYA 4O2GA 3GOUB 5AZQA 108MA 1ECNA 1OBMA 1PBXB 2ZT1A 2QLSA 4ZVBA 2ZFBA 3IC0A 3MBAA 2HBEB 2HBSB 3ZJQA 1OFKA 2R4YA 3ZOMA 6HBWA 4HBIA 1QSIB 2ZSRA 1CG8A 3QZZA 4SDHA 1OR4A 1CBMA 2D2NC 3HHBB 1J52A 4L7YB 3E5OA 3NMMA 3WR1A 1IT3A 2O5BX 5EUIA 5JGGA 1A01B 3HF4B 5C6EA 3SDHA 3UI0A 3GQGA 3ZJRA 3A5BA 3BCQA 3ZHWA 2NSRA 3A2GA 2HBCA 1ECAA 1RQ3B 1JL6A 4MAXA 5CNCA 1ABYB 3QM5A 4MQCA 2D60A 4AVEA 1MYTA 1Y5FB 2V1EA 2MGAA 4BJAA 1YGFA 1Y22A 1MOAA 3DUTA 3GDJA 1Y8HA 1MLGA 3G52A 3QJEA 1UIWB 1MYJA 5EOHA 2E2YA 2XKHA 1C40A 1Y5JB 4IT8A 1BVCA 1A6GA 3OZWA 1FSXA 5SW7B 1BZRA 4NXAA 2DHBB 1M9PB 1HBBB 3UHWA 1RQAB 3DR9A 2IG3A 3VHBA 2QLSB 3WI8A 3WCVC 2QFNA 1YENA 1C7CA 3ASEA 3PIAA 1Y5KB 4NXCA 3VREB 2GRHA 4MQIA 1LFQA 1JZLA 3WTGA 3GQGB 3WCUC 2QSSA 2MGIA 2Z6NA 2Z8AA 5CN7A 4B3WA 2LH1A 2O5SX 2FRJX 3WCPA 3ZJJA 2D5ZA 1Y0TA 1G08B 1CH2A 1XZ5B 1LH1A 3WCUA 1MBNA 4WCHD 3HXNA 3CY5B 2ZLXB 1GDKA 1Y4RB 3S65B 1HBAA 2B7HA 1IT2A 1SPGB 1QI8A 3VRFA 1VXEA 2D2MD 1IRDA 5HLQA 2ZFOA 1YIHA 4MQCB 4NI1A 3A0GB 1S61A 1F63A 2HHDB 2ZWJA 2ZFOC 1TU9A 1YEUB 3UBVA 5CNFA 1LJWA 3GKTA 1BZ1B 1DLYA 4TWVA 3HYUB 1GBVA 4DC7A 2HZ3A 1Y7GB 2MGMA 4XS0A 3SZKB 2ZSPA 1CO8A 1YVQB 2R1HB 1YH9A 1GDJA 1X9FB 3S1JA 2O5TX 3AG0A 1Y8WA 2D5ZB 3WCVD 1Y0CA 4X0LA 2BKMA 4OF9A 1NZ4A 4NI0B 1DWRA 3M3BA 2VLXA 1X9FD 5CNGA 1IOPA 1XZ2B 1LH7A 3H57A 109MA 1N9FA 1MYIA 4HHBA 4OODA 3UBCA 1J7WA 3R0GA 1GCVB 2ZLTB 4MXKA 1CP5A 1V4XB 1YHUC 3GQPA 1HBSA 1MWDA 1S0HA 1O1JA 3WCWC 1GJNA 2V1IA 2EKTA 3GKVA 5HU6A 1YDZA 1SDKA 1V4WB 3IXFA 4XDIA 5EUIB 1MBSA 4G1VA 4KN3A 4ESAB 1MNOA 1XZ7A 1HCOB 2ZLWA 3AQ7A 1MTKA 5KKKA 1LH5A 2BMMA 3G53A 1A0ZA 5JDOE 4TYXA 1IRCA 1UC3A 1URYA 1O1IA 4MU5A 1ABSA 3CIUB 3A5AA 1AJGA 3RJNB 3ZJLA 1LH2A 3D1KB 4F6GA 3PI9A 1CO9A 2BLJM 1J7SA 2ZS0D 5EE4D 1YHUB 1YH9B 2LH3A 4FC3A 5MBAA 1Y0AA 4KMVA 2AUQA 4NK2A 1VREA 3D4XB 2D60B 4X0LB 1D8UA 2DN3A 1EWAA 1LHTA 1UMOA 1YOHA 3FH9A 1MKOA 1BZZB 2GNWA 2HBDB 4N8TA 3D17B 4MQHB 3ZJSA 3KMFA 2ZLTA 1YENB 2HHEB 5JGGB 1O1OA 1S0HB 4U8UB 2RAOB 1GDLA 4HRTB 1CMYB 4MQIB 4M4AA 2W6VA 1MBCA 1A4FA 3AQ8A 1Y0TB 2VM0A 1HBGA 5HAVA 3WCWD 4ROMA 2DN1A 1XXTB 110MA 3OO4A 2HCOA 1HBAB 1LFLB 3QMAA 3LQDA 4F69A 3BA2A 1JF4A 1O1KB 2Z6NB 2W72B 3TLDA 4UIQA 3GYSB 102MA 4FC3B 1O1MA 1VXDA 2W31A 1RTXA 1LFVB 3QJDB 1OR6A 1DXVB 1HGAB 1JPBA 4C44A 2QMBA 2AUOA 1V07A 1YCAA 1Y4VB 1YGDB 1RQAA 1MLKA 1CG5A 1CG8B 1OUTA 1CLSA 1SHRA 2AA1A 4ILZA 1GBUA 4ODCB 1MNIA 1XY0A 1GLIB 1BIJB 3G4RA 1YMAA 1RPSB 4N7OB 3VRGB 2ZT4A 2V1GA 4C0NA 1SPGA 1ABWB 1MLNA 3PI8B 3G4YA 1S5YB 2VYWA 4H07A 1V4UA 2FAMA 3D1AA 1ASHA 1X9FA 1G08A 2HHDA 2ZSNA 4H0BA 1XZ2A 4JYQA 1HBIA 2G14A 3PT8A 1UFPA 3UHYA 3MJPA 1U7RA 3V2VA 4FH7A 4XS0B 2D2ND 1VWTB 3BOMB 1A00B 4N7PA 3A59B 4U8UC 1FN3A 1O1MB 1BABA 1G9VA 2VLYA 3WFTA 5KDQA 2H8DA 2ZFBB 1C7DB 1JP8A 1MNJA 5C6YA 3OGBA 3ZJMA 3BJ2A 1XQ5B 1Y8IB 1YFFA 1YGDA 3DHTA 1SDKB 4ROMB 1T1NA 2DN1B 1QXEB 1DUKA 4NI0A 3ARKA 1ITHA 1Y4PA 3GKVB 2VYZA 1Y2ZA 1XY0B 1XZVA 1Y35A 3GYSA 2W72C 1HBHB 5JDOD 1CPWA 1C40B 1Y5JA 1NS6B 3SZKA 1CP0A 2AUPA 1HCOA 2ZLWB 3EU1B 2R80B 3TM9A 1Y0WA 2ZS0A 2AV0A 3OVUC 1MLMA 3K8BB 3P5QA 5F2AA 5B85A 3UHVA 1Y83A 2OH9A 3RGKA 4F6FA 3GQRA 1W92A 4G51A 2GTLA 3H58A 3ZJIA 2GL3A 1R1YB 3WCTA 1Y0AB 1BABB 3ECZA 1DWTA 1G9VB 3UH5A 3LB2A 3QJEB 3U3EA 1B86B 3GQPB 1K1KA 5IKSA 1H1XA 5EYSA 2ZLUA 3BJ1A 1HABA 1FAWB 2HHBA 1YZIA 2NRLA 1YDZB 3UGZA 1Y4PB 4G1BA 2HZ2A 2VLZA 3PI2A 1G0BA 5CNDA 3LB1A 3HRWB 4YU4A 3A9MA 4U8UA 1THBA 2ZSTA 3S48C 2G0XA 5HLXA 1C7CB 3QZXA 2ZT2A 1MLJA 3EU1A 1YHRA 1MZ0A 2H35B 2HBDA 2PEGA 1Y4GA 3CIUA 2OIFA 3WHMB 1VHBA 2JHOA 1BZZA 1YEVA 3B75A 1HRMA 2RAOA 3QJBA 1JEBB 4F68A 3ODQB 2MHBB 1J3YA 1YG5B 1NWNA 2VRYA 1SPEA 1DXCA 1Y0CB 1WMUA 4N7NB 5CN4A 1R1XA 1CBLA 3O89A 3E55A 1GBUB 4ODCA 1NIHB 3FH9B 2MGKA 2MBWA 1JW8A 4O1TA 104MA 1YVTA 2R4ZA 1IDRA 3DHRB 2MGCA 3WFWA 1MOHA 1DXVA 3UHGA 1HGAA 1MYFA 3KUNA 3WCUD 1Y7GA 3OZUA 1L2KA 3PI8A 3PT7B 1V9QA 1O1NA 1A4FB 1MOCA 1HHOB 1XYEA 3ZOLA 4MPMA 1YOGA 1Y4QA 1Y4BA 1QSHA 3MYMA 2NX0A 3AT6A 1OJ6A 3DUTB 2ZSXA 1WLAA 112MA 3WHMA 1VWTA 2SPMA 1YEOA 1S69A 2HBFB 3QJCA 3WCWA 3ZH0A 1A9WE 5HLUA 3ZJPA 1CIKA 4PQBA 3SDNA 2VEEA 1CH7A 1LFVA 3QJDA 1QXDA 1TESA 1MBAA 3MJPB 1GCWA 4MXLA 4NZIA 1NS9A 1S56A 4H2LB 4IROA 1AJHA 2MGHA 2MYAA 4ZVAA 1QXEA 2D2MC 3D7OB 2HBSA 1RQ4A 1YG5A 3QQQA 4PNJA 5JOMA 1YEQA 1ABWA 4MQGB 3PELB 2Z6SA 5CN9A 1V4UB 1FHJB 3QM7A 4HRRA 1Y7DA 1COHB 4M4BB 3UHSA 1A6NA 3WCTC 2NRMA 4DWUA 2H8FA 5E83A 1MKOB 2FRIX 1KR7A 1Y46B 105MA 2BW9M 1X9FC 1O1IB 3GQRB 1KD2B 3LHBA 1DXTB 1O1OB 2HBEA 1QSIA 2V1HA 1K0YB 1O1NB 5ILEA 1MODA 1YHUA 1Y4BB 1Y7ZB 1J40A 1J41A 1BJEA 3UH6A 1T1NB 2EB9A 2VHBA 1A0UA 1Y2ZB 1CH5A 2RI4A 4MQKB 5EE4C 1RQ3A 1B86A 5B84A 2ZSSA 1O1LB 2AURA 1YOIA 3BCQB 1A3OA 2G0RA 2MYBA 3MKBA 1RVWA 1S5YA 3M39A 1HDAB 2PGHB 2YRSA 1N9HA 1UT0A 1Y22B 5HY8A 1VRFA 106MA 2V1FA 1Y5FA 107MA 4UZVA 1VXFA 1Y83B 2R4XA 3UHRA 3D7OA 1RQ4B 1LFZA 1Y4GB 2NSSA 3BJ3B 5E6EA 1A3NB 1A01A 1XCHA 3HC9A 5D5RA 1YHRB 3A59A 1FCSA 2HBGA 1MLFA 3ORDA 1FSXB 1N9IA 1IBEA 1HGBA 2EF2A 5CNEA 2ZT3A 1BUWA 2V1KA 4B4YA 2ZLVB 3HXNB 3NG6A 3QJBB 3NMMB 1JEBA 4F6BA 1R1XB 3MYNA 5EQMA 4VHBA 2GKMA 2RI4B 2GNVA 1BZPA 1G09A 2G10A 3M38A 1O1PB 101MA 2BLIA 1BZ6A 3IA3B 1HBRA 1CIOA 1WMUB 3KUOA 3QM8A 1Y4QB 1Y0WB 1M6CA 1G0AB 1Y4RA 3PT7A 2DN2A 1QPWA 2LH5A 1F5PA 2Z6TA 2D2NA 3AT6B 1NPFA 2D2MA 1BVDA 1HBHA 2M6ZA 3DHRA 1QI8B 2G3HA 1MLUA 4DWTA 2QSSB 3ECLA 3NFEA 1QXDB 2MGDA 1NEJA 1FN3B 1LJWB 1NXFA 5CHQA 1VXBA 1MWCA 1BINA 1Y7CA 3WR1B 4GZGA 5E6EB 3QM6A 1J3ZB 1MLOA 3UHUA 3UHXA 1Y85A 2LH7A 2VYYA 1YE2A 1CMYA 2O5MX 4JACA 1UFJA 1NPGA 5E29B 1C7BA 1IRDB 1FDHA 1MLHA 1FHJA 1F65A 2MGEA 1MNHA 2QFKA 2DN2B 3GOUA 2MYEA 3HHBA 5ILRA 1BZ0A 1MYZA 1EMYA 3P5QB 1MBIA 1JF3A 1MBOA 2M6ZB 1CH4A 1HV4A 4DC8A 4F6DA 2ZFOB 4O4ZA 2DHBA 4MQGA 3NFEB 3S66A 1DKEB 2G0ZA 5CNBA 5JDOC 3UHHA 1AZIA 3E4NA 1DWSA 5CN8A 2KSCA 1XZ7B 1BZ1A 1FLPA 1NWIA 1Y5KA 5M3SA 1YEVB 1JP9A 1FAWA 2HHBB 2ZLXA 1YVTB 1S6AA 1YMBA 2IN4A 3MVCA 5C6EB 1Z8UB 3UHCA 1GCVA 1J40B 1HJTA 3GK9A 1GZXB 1M9PA 2HBCB 2SPLA 1YE0A 1YIHB 2D5XA 3G4VA 3O7NA 3D1KA 2OHBA 1A00A 3S65A 1A6MA 1JL7A 1URVA 1A3OB 4TWUA 2BNLA 1B0BA 1V4XA 4QAUA 2PGHA 2YRSB 4NK1A 2WTHA 1FSLA 1EBCA 1XQ5A 3MKBB 1YVQA 1A0ZB 1HDAA 1V4WA 1BBBB 2LHBA 1XZVB 1LFYB 3BJ3A 3ED9A 1HDBA 2C0KA 2MYCA 1XZUA 4H2LA 2AV3A 4IROB 3WCUB 3MOUA 1HV4B 1XZ4A 1MYGA 1A3NA 3G4WA 3QQRA 1HLBA 2QMBB 2ZLVA 1Y4VA 3VRFB 5ILMA 1O1JB 4AVDA 5AZRA 4FWZA 1LFTB 2LH2A 1PMBA 3WCTB 3UH3A 1EW6A 4N8TB 1V5HA 1YEUA 1LFLA 4UURA 3NL7B 2OH8A 1K1KB 1SI4A 1OUUB 1YEOB 3PELA 1DO4A 1V75B 1HABB 2W6WA 1OUTB 5EYJA 1J7YB 1NGKA 3EDBA 1ECOA 1JDOA 1Y4FA 2BK9A 3OJ1A 1MWBA 1HACA 1BUWB 2G0VA 2EVPA 5MBNA 2ZSOA 4MBAA 1IWHA 1A0UB 3HYUA 1O16A 1G09B 4N7OA 3VRGA 2DXMA 1SDLA 2ZS1D 4M4AB 1YHEA 2QSPA 1JY7A 2EKUA 2R1HA 1MGNA 4ROLB 5HU6B 1Y0DB 1MLSA 1C7BB 1I3DA 2FRKX 1DXUB 2O5QX 1M6MA 5KERB 2ZSQA 1LUEA 4O4TA 1YE2B 2HCOB 3G46A 4KMWA 1J3ZA 2W72A 1CQ2A 2W6YA 5E83B 1MBDA 4HHBB 1DO3A 2O5OX
chains in the Genus database with same CATH superfamily
1HDSB 3G4UA 1SI4B 1RSEA 2R80A 3DHTB 5KDQB 4YU3B 2W6VB 1CG5B 1NIHA 2DC3A 1LFTA 1UX8A 4ERTA 1DLWA 1DO1A 3PT8B 1NS6A 7HBIA 1LIAA 3D17A 4MQHA 1RPSA 2GTLB 3A5GA 2MGLA 3NL7A 1OUUA 2VJRB 3QM9A 3PI4A 1Y45A 1GZXA 3ZJNA 3WCVB 2H8DB 4WJGA 3D4XA 1DUOA 3ZJOA 4U8UD 4L7YA 2BLHA 3K8BA 2JL9A 3IC2B 1NY9A 1VXCA 3WCTD 2D5XB 1G0AA 3WFUA 1HLMA 5F0BA 1NZ3A 3UHZA 1HA7B 2XKIA 3HRWA 1MOBA 1UVXA 4G51B 1XF6C 3OO5A 2HHEA 4HH0A 2O58X 1YMCA 1LFZB 1KFRA 4ZIZA 3BJ2B 3AT5B 2ZLUB 1DKEA 1X46A 1YIEA 4HRTA 2DN3B 1U7SA 2FRFA 1MDNA 1JP6A 1HGBB 1XXTA 3OO4B 1WVPA 1Y35B 2EVKA 3UHNA 3LQDB 3ODQA 2MHBA 1DDTA 1JZKA 1Y85B 1XZUB 3FS4A 2H35A 3O2CB 1XZ4B 5EV5A 3OZVA 1A9WA 1CH9A 1O1PA 3FEWX 3LB4A 3ECXA 1YE0B 1LH6A 3ZJHA 1Y8IA 1CQXA 1YFFB 3GUQA 1F5OA 3UHQA 2ZS1A 4N6SA 2VEBA 4F0TB 2GRFA 1RTEA 1HDBB 1KD2A 4PQCA 3HF4A 1J3YB 3AQ9A 1UIWA 1MYMA 2D6CA 3MN0A 4ESAA 2EB8A 4F6IA 1LTWA 2D2MB 1MTIA 1NZ2A 1J41B 4ERVA 5SW7A 4FWXA 3GIOA 3V58B 2BV8A 2ZS0B 1A6KA 3HEPA 3GLNA 1Y31A 2MGJA 3LR7A 1PBXA 1Y8HB 1AJ9A 2ZSYA 1GLIA 1NAZA 1VXAA 3BOMA 1Y09B 3UHIA 4HSXA 1LHSA 5CMVA 3UH7A 3PI9B 1V75A 1N9XA 2SPNA 1MLQA 3O2CA 4N7PB 6HBWB 1UVLA 2XKGA 3HEOA 1X3KA 2UUMX 3V2ZA 1Y8KB 2GLNA 1QGWC 3NMLA 1EBTA 3EDAA 5KERA 111MA 1C7DA 1JBOB 3UHEA 1IWHB 1B8DA 3K3UA 1YCBA 2GDMA 2V1JA 4ROLA 1HACB 2G12A 1NQPB 3G4QA 1JZMA 1YHEB 2GKNA 3IC0B 3QJCB 1S5XA 2O5LX 4YU3A 2ZS0C 1NS9B 3VNCA 1XZ5A 2ZS1B 1HSYA 3M3AA 1YZIB 5CHRA 1DXUA 3HENA 1YGFB 1Y4FB 4O35A 1J3FA 1DM1A 5EU2A 1GVHA 4PQ6A 1ECDA 1MTJA 2W6XA 1MLLA 1DO7A 3B75B 2HBFA 1MNKA 2ZSZA 3R5IA 1O1KA 1SDLB 5D1VA 4F6JA 1R1YA 4KJTA 2VJRA 3BJ1B 2PEGB 3KVSA 1MLRA 2D2NB 2H8FB 1DTMA 4A8KA 3UHDA 2FALA 3ONZB 3VREA 3IC2A 1I3EA 1VXHA 2XYKA 2GTLC 3WTGB 3BRPA 4YU4B 6HBIA 1YHUD 1BIJA 3ARLA 3GDJB 1S5XB 2JLFA 3S1IA 2HZ1A 3UHKA 1HGCA 1HBSB 5EETA 3RJ6A 5HBIA 3VAUA 4NS2A 3MJUB 2C7LB 1Y7ZA 1DXDA 1GCWB 4Q70B 3TM3A 1HHOA 1XYEB 1COHA 4L2MA 2VJHA 4M4BA 1HBBA 3D1AB 3OO5B 1YIEB 1O1LA 3ARJA 3EOKB 1H97A 4MBNA 1BBBA 3PI3A 4MQKA 3AT5A 1DXTA 3R5IB 2C7KA 3OK5A 1UX9A 2LH6A 3FS4B 4HRRB 1LA6A 103MA 3NG6B 1BZ0B 1Q1FA 2R50A 3AQ6A 3PIAB 1UVYA 2G11A 2QRWA 4MQJA 3W4UA 1MCYA 3ONZA 1LFQB 4N7NA 5CN6A 4LPIA 2QU0B 3UGYA 2MYDA 2WTGA 5CN5A 1GDIA 2ZT0A 2MB5A 1CH1A 1K0YA 1MYHA 1HBRB 1FDHG 1IBEB 3UHBA 4HSWA 3K9ZA 2MGFA 3S66B 3PI1A 2QSPB 4F4OA 4A8QA 3LR9A 1JY7B 1HGCB 1HDSA 1OFJA 3A0GA 4LMSB 4BS9A 2G0SA 3WCPB 1JWNA 4F0TA 4WJG1 2CMMA 1QPWB 1SWMA 5HY8B 4NI1B 2UUND 1Y01B 2BWHA 1DTIA 1J7YA 3KMFC 2ZS1C 3CY5A 1Y09A 3EOKA 1QSHB 2GRZA 1J7WB 1J7SB 1Y31B 2OLPA 1LIAB 2WY4A 1AJ9B 3UHTA 3WCWB 2B7HB 2DKCA 5AB8A 4LM6B 1UVMA 3WFXA 1RVWB 3MJUA 4FWYA 3AQ5A 1Y45B 4FH6A 2SPOA 2V8AA 1CLSB 1SHRB 2AA1B 1LH3A 2ZFOD 2DXMB 1Y7DB 1KTPA 3LB3A 1NZ5A 2OHAA 1Y7CB 2MGGA 1Y46A 1VXGA 2Z85A 4MQJB 3W4UB 1NQPA 1Y0DA 2QU0A 1GBVB 2J96A 3E5IA 1G0BB 5E29A 1YEQB 5ILPA 1NEJB 1Y8KA 1Y8WB 3WCVA 4F4OB 1THBB 1LA6B 2R4WA 5JDOF 1CH3A 1ABYA 2GTLD 2MGBA 1LFYA 4O2GA 3GOUB 4LMXB 4A8FA 5AZQA 108MA 1ECNA 1OBMA 1PBXB 2ZT1A 2QLSA 4ZVBA 2ZFBA 3IC0A 3MBAA 2HBEB 2HBSB 1F0LA 3ZJQA 1OFKA 2R4YA 3ZOMA 6HBWA 4HBIA 1QSIB 2ZSRA 1HHSA 1CG8A 3QZZA 4SDHA 1OR4A 1CBMA 2D2NC 3HHBB 4A8WA 1J52A 4L7YB 3E5OA 3NMMA 3WR1A 1IT3A 2O5BX 5EUIA 5JGGA 1A01B 3HF4B 5C6EA 3SDHA 3UI0A 3GQGA 3ZJRA 3A5BA 2UUMA 3BCQA 3ZHWA 2NSRA 3A2GA 2HBCA 1ECAA 1RQ3B 1JL6A 1KN1B 4MAXA 5CNCA 1ABYB 3QM5A 4MQCA 2D60A 4AVEA 1MYTA 1Y5FB 2V1EA 2MGAA 4BJAA 1YGFA 1Y22A 1MOAA 3DUTA 3GDJA 1Y8HA 1MLGA 1ON7A 3G52A 3QJEA 1UIWB 1MYJA 5EOHA 2E2YA 2XKHA 1C40A 1Y5JB 4IT8A 1BVCA 1A6GA 3OZWA 1FSXA 5SW7B 1BZRA 4NXAA 2DHBB 1M9PB 1HBBB 3UHWA 1RQAB 3DR9A 2IG3A 4Q70A 4H0MA 3VHBA 2QLSB 3WI8A 3WCVC 2QFNA 1YENA 1B8DB 1C7CA 3ASEA 3PIAA 1Y5KB 4NXCA 2JLGA 3VREB 1GH0A 2I88A 2GRHA 4MQIA 1LFQA 2UUNA 1JZLA 3WTGA 3GQGB 3WCUC 2QSSA 2MGIA 2Z6NA 2Z8AA 5CN7A 4B3WA 2LH1A 2O5SX 2FRJX 3WCPA 3ZJJA 1HI1A 2D5ZA 1Y0TA 1G08B 1CH2A 1XZ5B 1LH1A 3WCUA 1MBNA 4ETUA 4WCHD 2C7JB 3HXNA 3CY5B 2ZLXB 1GDKA 1Y4RB 3S65B 1HBAA 2B7HA 1IT2A 1SPGB 1QI8A 3VRFA 1VXEA 2D2MD 1IRDA 5HLQA 2ZFOA 1YIHA 4MQCB 4NI1A 3A0GB 1S61A 1F63A 2HHDB 2ZWJA 2ZFOC 1TU9A 1YEUB 3UBVA 3V57A 5CNFA 1EYXA 1LJWA 3GKTA 1BZ1B 1DLYA 4TWVA 3HYUB 1GBVA 4DC7A 2HZ3A 1Y7GB 2MGMA 4XS0A 3SZKB 1ALLA 2ZSPA 4TMAB 1CO8A 1YVQB 2R1HB 1YH9A 1GDJA 1X9FB 3S1JA 2O5TX 3AG0A 1Y8WA 2D5ZB 3WCVD 1Y0CA 4X0LA 2BKMA 4OF9A 1NZ4A 4NI0B 1DWRA 3M3BA 2VLXA 1X9FD 5CNGA 1IOPA 1CPCA 1LH7A 1XZ2B 3H57A 109MA 1N9FA 1F99A 1MYIA 4HHBA 4OODA 3UBCA 1J7WA 1RH1A 3R0GA 1GCVB 2YSKA 2ZLTB 4MXKA 1CP5A 1V4XB 1YHUC 3GQPA 1SGKA 1HBSA 1MWDA 1S0HA 1O1JA 2C7LA 3WCWC 1GJNA 2V1IA 2EKTA 3GKVA 5HU6A 1YDZA 1SDKA 1V4WB 3IXFA 4XDIA 5EUIB 1MBSA 4G1VA 4KN3A 4ESAB 1MNOA 1XZ7A 1HCOB 2ZLWA 4GY3A 3AQ7A 1MTKA 4A8SA 5KKKA 1LH5A 2BMMA 3G53A 1A0ZA 5JDOE 4TYXA 1IRCA 1UC3A 2DKAA 1URYA 1O1IA 4MU5A 1ABSA 3CIUB 3A5AA 1AJGA 3RJNB 3ZJLA 1LH2A 3D1KB 4F6GA 3PI9A 5B13G 1CO9A 2BLJM 1J7SA 2ZS0D 5EE4D 1YHUB 1YH9B 2LH3A 4FC3A 5MBAA 4L1EB 2UUMB 1Y0AA 4KMVA 2AUQA 4NK2A 1VREA 3D4XB 2D60B 4X0LB 1JBOA 1D8UA 2DN3A 1EWAA 1LHTA 1UMOA 1YOHA 4GXEB 3FH9A 1MKOA 1BZZB 2GNWA 2HBDB 4N8TA 3D17B 4MQHB 1HA7A 3ZJSA 3PMDA 3KMFA 2ZLTA 1YENB 2HHEB 5JGGB 1O1OA 1S0HB 4U8UB 2RAOB 1GDLA 4HRTB 1CMYB 4MQIB 4M4AA 2W6VA 1MBCA 1A4FA 3AQ8A 1Y0TB 1KN1A 2VM0A 1HBGA 3RQRA 5HAVA 1CIIA 3WCWD 4ROMA 2DN1A 1XXTB 110MA 3OO4A 2HCOA 1HBAB 1LFLB 3QMAA 3LQDA 4F69A 3BA2A 1JF4A 1O1KB 2Z6NB 1GH0B 2W72B 3TLDA 4UIQA 3GYSB 102MA 4FC3B 1O1MA 1VXDA 2W31A 1RTXA 1LFVB 3QJDB 1OR6A 1DXVB 1HGAB 1JPBA 4C44A 2QMBA 2AUOA 1V07A 1YCAA 1Y4VB 1UVNA 1YGDB 1RQAA 1MLKA 1CG5A 1CG8B 1OUTA 1CLSA 1SHRA 2AA1A 4ILZA 1GBUA 3LQ9A 1MNIA 1XY0A 4ODCB 1GLIB 4ETTA 1BIJB 3G4RA 1YMAA 1RPSB 4N7OB 3VRGB 2ZT4A 1ALLB 2V1GA 4C0NA 1SPGA 1ABWB 1MLNA 3PI8B 3G4YA 1S5YB 2VYWA 4H07A 1V4UA 2FAMA 4A8YA 3D1AA 1ASHA 1X9FA 1G08A 2HHDA 2ZSNA 4H0BA 1XZ2A 4JYQA 1HBIA 2G14A 3PT8A 1UFPA 3UHYA 3MJPA 1U7RA 3V2VA 4FH7A 4XS0B 3O18B 2D2ND 1VWTB 4AE1A 3BOMB 1A00B 4N7PA 3A59B 4U8UC 1FN3A 1O1MB 1BABA 1G9VA 2VLYA 3WFTA 5KDQA 2H8DA 2ZFBB 1C7DB 1JP8A 1MNJA 5C6YA 3OGBA 3ZJMA 3BJ2A 1XQ5B 1Y8IB 1YFFA 1YGDA 3DHTA 1SDKB 4ROMB 1T1NA 2DN1B 1QXEB 1DUKA 4NI0A 3ARKA 1ITHA 1Y4PA 3GKVB 2VYZA 1Y2ZA 1XY0B 1XZVA 1Y35A 3GYSA 2W72C 1HBHB 5JDOD 1CPWA 1C40B 1Y5JA 1NS6B 3SZKA 1CP0A 2AUPA 1HCOA 2ZLWB 4F0UA 4GY3B 3EU1B 2R80B 3TM9A 1Y0WA 2ZS0A 2AV0A 3ZTAA 3OVUC 1MLMA 3K8BB 3P5QA 5F2AA 2X4AA 5B85A 3UHVA 1Y83A 2OH9A 3RGKA 4F6FA 3GQRA 1W92A 1WACA 1UVJA 4G51A 1XDTT 2GTLA 3H58A 3ZJIA 2GL3A 1R1YB 3WCTA 1Y0AB 1COLA 1BABB 3ECZA 1DWTA 1G9VB 3UH5A 3LB2A 3QJEB 3U3EA 1B86B 3GQPB 1K1KA 5IKSA 1H1XA 4YJJB 5EYSA 2ZLUA 3BJ1A 1HABA 1FAWB 2HHBA 1HI8A 1YZIA 2NRLA 1YDZB 3UGZA 1Y4PB 4G1BA 2HZ2A 2VLZA 3PI2A 1G0BA 5CNDA 3LB1A 3HRWB 4YU4A 3A9MA 4U8UA 1THBA 2ZSTA 3S48C 2G0XA 5HLXA 1C7CB 3QZXA 2ZT2A 4F0UB 1MLJA 3EU1A 1YHRA 1MZ0A 2H35B 2HBDA 2PEGA 3KVSB 4GXEA 1Y4GA 1UVKA 2VMLA 3CIUA 2OIFA 3WHMB 1VHBA 2JHOA 1BZZA 1YEVA 2C7KB 3B75A 1HRMA 2RAOA 3QJBA 1JEBB 4N6SB 4F68A 3ODQB 3BRPB 2MHBB 1J3YA 5AQDA 1YG5B 1NWNA 2VRYA 1SPEA 1DXCA 1Y0CB 1WMUA 4N7NB 5CN4A 1R1XA 1CBLA 3O89A 3E55A 1GBUB 4ODCA 1NIHB 2X49A 3FH9B 2MGKA 2MBWA 1JW8A 4O1TA 104MA 1YVTA 2R4ZA 1IDRA 4PO5A 2UULD 3DHRB 3NUHB 2MGCA 3WFWA 1MOHA 1DXVA 3UHGA 1HGAA 5FVBA 1MYFA 3KUNA 1HI0P 3WCUD 1Y7GA 3OZUA 1L2KA 3PI8A 3PT7B 1V9QA 1O1NA 1A4FB 1MOCA 1HHOB 1XYEA 3ZOLA 4MPMA 1YOGA 1Y4QA 2BV8B 1Y4BA 1QSHA 3MYMA 2NX0A 3AT6A 1OJ6A 3DUTB 2ZSXA 4RMPA 1WLAA 112MA 3WHMA 1VWTA 4HH1A 1I7YB 2SPMA 1YEOA 1S69A 2VJTA 2HBFB 3QJCA 3WCWA 3ZH0A 1A9WE 5HLUA 3ZJPA 1CIKA 4PQBA 3SDNA 2VEEA 1CH7A 1LFVA 3QJDA 1QXDA 1TESA 1MBAA 4ZIZB 3MJPB 1GCWA 4MXLA 4A8MP 4NZIA 1NS9A 1S56A 4H2LB 4IROA 1AJHA 1PHNB 2MGHA 2MYAA 4ZVAA 1QXEA 2D2MC 3D7OB 2HBSA 1RQ4A 1YG5A 3QQQA 4PNJA 5JOMA 1YEQA 1ABWA 4MQGB 3PELB 2Z6SA 5CN9A 1V4UB 1FHJB 3QM7A 4HRRA 4AE0A 1Y7DA 4M4BB 1COHB 3UHSA 1A6NA 3WCTC 2NRMA 4DWUA 2H8FA 5E83A 1MKOB 2FRIX 1KR7A 1Y46B 105MA 2BW9M 1X9FC 1O1IB 3GQRB 5AQDM 1KD2B 1HHTP 2VJTB 3LHBA 1DXTB 1O1OB 2HBEA 1QSIA 2V1HA 1K0YB 1O1NB 5ILEA 1MODA 1YHUA 1Y4BB 1Y7ZB 1J40A 4L1EA 1J41A 1BJEA 2VJHB 3UH6A 1T1NB 3MWNA 2EB9A 2VHBA 1A0UA 1Y2ZB 1CH5A 2RI4A 4MQKB 3DBJB 5EE4C 1RQ3A 1B86A 5B84A 2ZSSA 1O1LB 2AURA 1YOIA 3BCQB 1A3OA 2G0RA 2MYBA 3MKBA 1RVWA 4ETVA 1S5YA 3M39A 1HDAB 2PGHB 2YRSA 2UULA 4Z8KA 1N9HA 1UT0A 1Y22B 5HY8A 1VRFA 106MA 1ON7B 2V1FA 1Y5FA 107MA 4UZVA 1VXFA 1Y83B 2R4XA 3UHRA 3D7OA 4BJUA 4XXIA 1RQ4B 1LFZA 1Y4GB 2NSSA 3BJ3B 5E6EA 1A3NB 1A01A 1XCHA 3HC9A 5D5RA 1YHRB 3A59A 1FCSA 2HBGA 2V8AB 1MLFA 3ORDA 1FSXB 1N9IA 1IBEA 1HGBA 2EF2A 4YJJA 5CNEA 2ZT3A 3L0FB 1BUWA 2V1KA 4B4YA 2ZLVB 2C7JA 3HXNB 3NG6A 3QJBB 3NMMB 1JEBA 4F6BA 3O18A 4PO5B 1R1XB 3MYNA 5EQMA 4VHBA 2GKMA 4A8OA 2RI4B 2GNVA 1BZPA 1G09A 2G10A 1B33B 3M38A 1O1PB 101MA 2BLIA 1BZ6A 3IA3B 1HBRA 1CIOA 1WMUB 3KUOA 3QM8A 1Y4QB 1A87A 1Y0WB 1M6CA 1G0AB 1Y4RA 3PT7A 2DN2A 1QPWA 2LH5A 1F5PA 2Z6TA 2WCRA 1KTPB 2D2NA 3AT6B 1NPFA 2D2MA 1BVDA 1HBHA 2M6ZA 3DHRA 3V58A 1QI8B 2G3HA 1MLUA 4DWTA 2QSSB 3ECLA 1TOXA 4B02A 3NFEA 1QXDB 2MGDA 1NEJA 1FN3B 1LJWB 1NXFA 4H0MB 5CHQA 1VXBA 1MWCA 1BINA 1Y7CA 1EYXB 3WR1B 4GZGA 5E6EB 3QM6A 1J3ZB 1MLOA 3UHUA 3UHXA 1Y85A 2LH7A 2VYYA 1YE2A 1CMYA 2O5MX 4JACA 1UFJA 5FVBM 1NPGA 5E29B 1C7BA 1IRDB 1FDHA 1MLHA 1FHJA 1F65A 2MGEA 1MNHA 2QFKA 2DN2B 3GOUA 2MYEA 3HHBA 5ILRA 1BZ0A 1CPCB 1MYZA 2VMLB 1EMYA 3P5QB 1MBIA 1JF3A 1MBOA 1I7YA 2M6ZB 1CH4A 1HV4A 4DC8A 4F6DA 2UUNB 2ZFOB 4O4ZA 2DHBA 4MQGA 3NFEB 3S66A 1DKEB 2G0ZA 5CNBA 5JDOC 3UHHA 1AZIA 3E4NA 1DWSA 5CN8A 2KSCA 1XZ7B 1BZ1A 1FLPA 1NWIA 1Y5KA 5M3SA 1YEVB 1JP9A 1FAWA 2HHBB 2ZLXA 1YVTB 1S6AA 1YMBA 2IN4A 3MVCA 5C6EB 1Z8UB 3UHCA 1GCVA 3DBJA 1J40B 2WCQA 1HJTA 3GK9A 1GZXB 1M9PA 2HBCB 2SPLA 1YE0A 1YIHB 2D5XA 3G4VA 3O7NA 3D1KA 2OHBA 1F99B 1A00A 3V57B 3S65A 1A6MA 1JL7A 1URVA 1A3OB 2BNLA 4TWUA 1B0BA 1V4XA 4XXKA 4QAUA 2PGHA 2YRSB 4NK1A 2WTHA 1FSLA 1EBCA 1XQ5A 3MKBB 1YVQA 1A0ZB 1HDAA 2UULB 4Z8KB 1V4WA 1BBBB 2LHBA 1XZVB 1LFYB 3BJ3A 3ED9A 1HDBA 2C0KA 1XG0C 2MYCA 1XZUA 4IROB 2AV3A 4H2LA 3WCUB 3MOUA 1HV4B 1XZ4A 1MYGA 1A3NA 2UULH 3G4WA 5B13A 3QQRA 1HLBA 2QMBB 2ZLVA 1Y4VA 3VRFB 5ILMA 1O1JB 4ESUA 2DKDA 4AVDA 5AZRA 3L0FA 4FWZA 1LFTB 2LH2A 1PMBA 3WCTB 3UH3A 1EW6A 4N8TB 1V5HA 1YEUA 1LFLA 1UVIA 4RMPB 4UURA 3NL7B 2OH8A 1K1KB 1SI4A 1OUUB 1YEOB 3PELA 1DO4A 1V75B 1HABB 2W6WA 1OUTB 2UULC 5EYJA 1J7YB 1NGKA 3EDBA 1ECOA 1JDOA 1Y4FA 2BK9A 3OJ1A 1MWBA 1HACA 1BUWB 2G0VA 2EVPA 5MBNA 2ZSOA 4MBAA 1IWHA 3PMCA 1A0UB 3HYUA 1O16A 1G09B 4N7OA 3VRGA 1B33A 2DXMA 1PHNA 1SDLA 2ZS1D 4M4AB 1YHEA 2QSPA 1JY7A 2EKUA 2R1HA 1MGNA 4ROLB 5HU6B 1Y0DB 1MLSA 1C7BB 1I3DA 2FRKX 1DXUB 2O5QX 1M6MA 5KERB 2ZSQA 1LUEA 4O4TA 1YE2B 2HCOB 3G46A 4KMWA 1J3ZA 2W72A 1MDTA 1CQ2A 2W6YA 5E83B 1MBDA 4HHBB 1DO3A 2O5OX
chains in the Genus database with same CATH topology
1HDSB 3G4UA 1SI4B 1RSEA 2R80A 3DHTB 5KDQB 4YU3B 2W6VB 1CG5B 1NIHA 2DC3A 1LFTA 1UX8A 1DLWA 1DO1A 3PT8B 1NS6A 7HBIA 3D17A 4MQHA 1RPSA 2GTLB 3A5GA 2MGLA 3NL7A 1OUUA 3QM9A 3PI4A 1Y45A 1GZXA 3ZJNA 3WCVB 2H8DB 4WJGA 3D4XA 1DUOA 3ZJOA 4U8UD 4L7YA 2BLHA 3K8BA 3IC2B 1VXCA 3WCTD 2D5XB 1G0AA 3WFUA 1HLMA 5F0BA 1NZ3A 3UHZA 2XKIA 3HRWA 1MOBA 1UVXA 4G51B 3OO5A 2HHEA 2O58X 1YMCA 1LFZB 1KFRA 3BJ2B 3AT5B 2ZLUB 1DKEA 1X46A 1YIEA 4HRTA 2DN3B 1U7SA 2FRFA 1MDNA 1JP6A 1HGBB 1XXTA 3OO4B 1WVPA 1Y35B 2EVKA 3UHNA 3LQDB 3ODQA 2MHBA 1JZKA 1Y85B 1XZUB 3FS4A 2H35A 1XZ4B 5EV5A 3OZVA 1A9WA 1CH9A 1O1PA 3LB4A 3ECXA 1YE0B 1LH6A 3ZJHA 1Y8IA 1CQXA 1YFFB 1F5OA 3UHQA 2ZS1A 2VEBA 2GRFA 1RTEA 1HDBB 1KD2A 4PQCA 3HF4A 1J3YB 3AQ9A 1UIWA 1MYMA 2D6CA 3MN0A 4ESAA 2EB8A 4F6IA 1LTWA 2D2MB 1MTIA 1NZ2A 1J41B 5SW7A 4FWXA 2ZS0B 1A6KA 3HEPA 3GLNA 1Y31A 2MGJA 3LR7A 1PBXA 1Y8HB 1AJ9A 2ZSYA 1GLIA 1NAZA 1VXAA 3BOMA 1Y09B 3UHIA 4HSXA 1LHSA 5CMVA 3UH7A 3PI9B 1V75A 1N9XA 2SPNA 1MLQA 4N7PB 6HBWB 2XKGA 3HEOA 1X3KA 3V2ZA 1Y8KB 2GLNA 3NMLA 1EBTA 3EDAA 5KERA 111MA 1C7DA 3UHEA 1IWHB 3K3UA 1YCBA 2GDMA 2V1JA 4ROLA 1HACB 2G12A 1NQPB 3G4QA 1JZMA 1YHEB 2GKNA 3IC0B 3QJCB 1S5XA 2O5LX 4YU3A 2ZS0C 1NS9B 1XZ5A 2ZS1B 1HSYA 3M3AA 1YZIB 5CHRA 1DXUA 3HENA 1YGFB 1Y4FB 4O35A 1J3FA 1DM1A 5EU2A 1GVHA 4PQ6A 1ECDA 1MTJA 2W6XA 1MLLA 1DO7A 3B75B 2HBFA 1MNKA 2ZSZA 3R5IA 1O1KA 1SDLB 5D1VA 4F6JA 1R1YA 4KJTA 3BJ1B 2PEGB 1MLRA 2D2NB 2H8FB 1DTMA 3UHDA 2FALA 3ONZB 3VREA 3IC2A 1I3EA 1VXHA 2XYKA 2GTLC 3WTGB 4YU4B 6HBIA 1YHUD 1BIJA 3ARLA 3GDJB 1S5XB 3S1IA 2HZ1A 3UHKA 1HGCA 1HBSB 5EETA 3RJ6A 5HBIA 3VAUA 4NS2A 3MJUB 1Y7ZA 1DXDA 1GCWB 3TM3A 1HHOA 1XYEB 1COHA 4L2MA 4M4BA 1HBBA 3D1AB 3OO5B 1YIEB 1O1LA 3ARJA 3EOKB 1H97A 4MBNA 1BBBA 3PI3A 4MQKA 3AT5A 1DXTA 3R5IB 3OK5A 1UX9A 2LH6A 3FS4B 4HRRB 1LA6A 103MA 3NG6B 1BZ0B 1Q1FA 2R50A 3AQ6A 3PIAB 1UVYA 2G11A 2QRWA 4MQJA 3W4UA 1MCYA 3ONZA 1LFQB 4N7NA 5CN6A 4LPIA 2QU0B 3UGYA 2MYDA 2WTGA 5CN5A 1GDIA 2ZT0A 2MB5A 1CH1A 1K0YA 1MYHA 1HBRB 1FDHG 1IBEB 3UHBA 4HSWA 3K9ZA 2MGFA 3S66B 3PI1A 2QSPB 4F4OA 3LR9A 1JY7B 1HGCB 1HDSA 1OFJA 3A0GA 2G0SA 3WCPB 1JWNA 4WJG1 2CMMA 1QPWB 1SWMA 5HY8B 4NI1B 1Y01B 2BWHA 1DTIA 1J7YA 3KMFC 2ZS1C 3CY5A 1Y09A 3EOKA 1QSHB 2GRZA 1J7WB 1J7SB 1Y31B 2OLPA 2WY4A 1AJ9B 3UHTA 3WCWB 2B7HB 5AB8A 3WFXA 1RVWB 3MJUA 4FWYA 3AQ5A 1Y45B 4FH6A 2SPOA 1CLSB 1SHRB 2AA1B 1LH3A 2ZFOD 2DXMB 1Y7DB 3LB3A 1NZ5A 2OHAA 1Y7CB 2MGGA 1Y46A 1VXGA 2Z85A 4MQJB 3W4UB 1NQPA 1Y0DA 2QU0A 1GBVB 3E5IA 1G0BB 5E29A 1YEQB 5ILPA 1NEJB 1Y8KA 1Y8WB 3WCVA 4F4OB 1THBB 1LA6B 2R4WA 5JDOF 1CH3A 1ABYA 2GTLD 2MGBA 1LFYA 4O2GA 3GOUB 5AZQA 108MA 1ECNA 1OBMA 1PBXB 2ZT1A 2QLSA 4ZVBA 2ZFBA 3IC0A 3MBAA 2HBEB 2HBSB 3ZJQA 1OFKA 2R4YA 3ZOMA 6HBWA 4HBIA 1QSIB 2ZSRA 1CG8A 3QZZA 4SDHA 1OR4A 1CBMA 2D2NC 3HHBB 1J52A 4L7YB 3E5OA 3NMMA 3WR1A 1IT3A 2O5BX 5EUIA 5JGGA 1A01B 3HF4B 5C6EA 3SDHA 3UI0A 3GQGA 3ZJRA 3A5BA 3BCQA 3ZHWA 2NSRA 3A2GA 2HBCA 1ECAA 1RQ3B 1JL6A 4MAXA 5CNCA 1ABYB 3QM5A 4MQCA 2D60A 4AVEA 1MYTA 1Y5FB 2V1EA 2MGAA 4BJAA 1YGFA 1Y22A 1MOAA 3DUTA 3GDJA 1Y8HA 1MLGA 3G52A 3QJEA 1UIWB 1MYJA 5EOHA 2E2YA 2XKHA 1C40A 1Y5JB 4IT8A 1BVCA 1A6GA 3OZWA 1FSXA 5SW7B 1BZRA 4NXAA 2DHBB 1M9PB 1HBBB 3UHWA 1RQAB 3DR9A 2IG3A 3VHBA 2QLSB 3WI8A 3WCVC 2QFNA 1YENA 1C7CA 3ASEA 3PIAA 1Y5KB 4NXCA 3VREB 2GRHA 4MQIA 1LFQA 1JZLA 3WTGA 3GQGB 3WCUC 2QSSA 2MGIA 2Z6NA 2Z8AA 5CN7A 4B3WA 2LH1A 2O5SX 2FRJX 3WCPA 3ZJJA 2D5ZA 1Y0TA 1G08B 1CH2A 1XZ5B 1LH1A 3WCUA 1MBNA 4WCHD 3HXNA 3CY5B 2ZLXB 1GDKA 1Y4RB 3S65B 1HBAA 2B7HA 1IT2A 1SPGB 1QI8A 3VRFA 1VXEA 2D2MD 1IRDA 5HLQA 2ZFOA 1YIHA 4MQCB 4NI1A 3A0GB 1S61A 1F63A 2HHDB 2ZWJA 2ZFOC 1TU9A 1YEUB 3UBVA 5CNFA 1LJWA 3GKTA 1BZ1B 1DLYA 4TWVA 3HYUB 1GBVA 4DC7A 2HZ3A 1Y7GB 2MGMA 4XS0A 3SZKB 2ZSPA 1CO8A 1YVQB 2R1HB 1YH9A 1GDJA 1X9FB 3S1JA 2O5TX 3AG0A 1Y8WA 2D5ZB 3WCVD 1Y0CA 4X0LA 2BKMA 4OF9A 1NZ4A 4NI0B 1DWRA 3M3BA 2VLXA 1X9FD 5CNGA 1IOPA 1XZ2B 1LH7A 3H57A 109MA 1N9FA 1MYIA 4HHBA 4OODA 3UBCA 1J7WA 3R0GA 1GCVB 2ZLTB 4MXKA 1CP5A 1V4XB 1YHUC 3GQPA 1HBSA 1MWDA 1S0HA 1O1JA 3WCWC 1GJNA 2V1IA 2EKTA 3GKVA 5HU6A 1YDZA 1SDKA 1V4WB 3IXFA 4XDIA 5EUIB 1MBSA 4G1VA 4KN3A 4ESAB 1MNOA 1XZ7A 1HCOB 2ZLWA 3AQ7A 1MTKA 5KKKA 1LH5A 2BMMA 3G53A 1A0ZA 5JDOE 4TYXA 1IRCA 1UC3A 1URYA 1O1IA 4MU5A 1ABSA 3CIUB 3A5AA 1AJGA 3RJNB 3ZJLA 1LH2A 3D1KB 4F6GA 3PI9A 1CO9A 2BLJM 1J7SA 2ZS0D 5EE4D 1YHUB 1YH9B 2LH3A 4FC3A 5MBAA 1Y0AA 4KMVA 2AUQA 4NK2A 1VREA 3D4XB 2D60B 4X0LB 1D8UA 2DN3A 1EWAA 1LHTA 1UMOA 1YOHA 3FH9A 1MKOA 1BZZB 2GNWA 2HBDB 4N8TA 3D17B 4MQHB 3ZJSA 3KMFA 2ZLTA 1YENB 2HHEB 5JGGB 1O1OA 1S0HB 4U8UB 2RAOB 1GDLA 4HRTB 1CMYB 4MQIB 4M4AA 2W6VA 1MBCA 1A4FA 3AQ8A 1Y0TB 2VM0A 1HBGA 5HAVA 3WCWD 4ROMA 2DN1A 1XXTB 110MA 3OO4A 2HCOA 1HBAB 1LFLB 3QMAA 3LQDA 4F69A 3BA2A 1JF4A 1O1KB 2Z6NB 2W72B 3TLDA 4UIQA 3GYSB 102MA 4FC3B 1O1MA 1VXDA 2W31A 1RTXA 1LFVB 3QJDB 1OR6A 1DXVB 1HGAB 1JPBA 4C44A 2QMBA 2AUOA 1V07A 1YCAA 1Y4VB 1YGDB 1RQAA 1MLKA 1CG5A 1CG8B 1OUTA 1CLSA 1SHRA 2AA1A 4ILZA 1GBUA 4ODCB 1MNIA 1XY0A 1GLIB 1BIJB 3G4RA 1YMAA 1RPSB 4N7OB 3VRGB 2ZT4A 2V1GA 4C0NA 1SPGA 1ABWB 1MLNA 3PI8B 3G4YA 1S5YB 2VYWA 4H07A 1V4UA 2FAMA 3D1AA 1ASHA 1X9FA 1G08A 2HHDA 2ZSNA 4H0BA 1XZ2A 4JYQA 1HBIA 2G14A 3PT8A 1UFPA 3UHYA 3MJPA 1U7RA 3V2VA 4FH7A 4XS0B 2D2ND 1VWTB 3BOMB 1A00B 4N7PA 3A59B 4U8UC 1FN3A 1O1MB 1BABA 1G9VA 2VLYA 3WFTA 5KDQA 2H8DA 2ZFBB 1C7DB 1JP8A 1MNJA 5C6YA 3OGBA 3ZJMA 3BJ2A 1XQ5B 1Y8IB 1YFFA 1YGDA 3DHTA 1SDKB 4ROMB 1T1NA 2DN1B 1QXEB 1DUKA 4NI0A 3ARKA 1ITHA 1Y4PA 3GKVB 2VYZA 1Y2ZA 1XY0B 1XZVA 1Y35A 3GYSA 2W72C 1HBHB 5JDOD 1CPWA 1C40B 1Y5JA 1NS6B 3SZKA 1CP0A 2AUPA 1HCOA 2ZLWB 3EU1B 2R80B 3TM9A 1Y0WA 2ZS0A 2AV0A 3OVUC 1MLMA 3K8BB 3P5QA 5F2AA 5B85A 3UHVA 1Y83A 2OH9A 3RGKA 4F6FA 3GQRA 1W92A 4G51A 2GTLA 3H58A 3ZJIA 2GL3A 1R1YB 3WCTA 1Y0AB 1BABB 3ECZA 1DWTA 1G9VB 3UH5A 3LB2A 3QJEB 3U3EA 1B86B 3GQPB 1K1KA 5IKSA 1H1XA 5EYSA 2ZLUA 3BJ1A 1HABA 1FAWB 2HHBA 1YZIA 2NRLA 1YDZB 3UGZA 1Y4PB 4G1BA 2HZ2A 2VLZA 3PI2A 1G0BA 5CNDA 3LB1A 3HRWB 4YU4A 3A9MA 4U8UA 1THBA 2ZSTA 3S48C 2G0XA 5HLXA 1C7CB 3QZXA 2ZT2A 1MLJA 3EU1A 1YHRA 1MZ0A 2H35B 2HBDA 2PEGA 1Y4GA 3CIUA 2OIFA 3WHMB 1VHBA 2JHOA 1BZZA 1YEVA 3B75A 1HRMA 2RAOA 3QJBA 1JEBB 4F68A 3ODQB 2MHBB 1J3YA 1YG5B 1NWNA 2VRYA 1SPEA 1DXCA 1Y0CB 1WMUA 4N7NB 5CN4A 1R1XA 1CBLA 3O89A 3E55A 1GBUB 4ODCA 1NIHB 3FH9B 2MGKA 2MBWA 1JW8A 4O1TA 104MA 1YVTA 2R4ZA 1IDRA 3DHRB 2MGCA 3WFWA 1MOHA 1DXVA 3UHGA 1HGAA 1MYFA 3KUNA 3WCUD 1Y7GA 3OZUA 1L2KA 3PI8A 3PT7B 1V9QA 1O1NA 1A4FB 1MOCA 1HHOB 1XYEA 3ZOLA 4MPMA 1YOGA 1Y4QA 1Y4BA 1QSHA 3MYMA 2NX0A 3AT6A 1OJ6A 3DUTB 2ZSXA 1WLAA 112MA 3WHMA 1VWTA 2SPMA 1YEOA 1S69A 2HBFB 3QJCA 3WCWA 3ZH0A 1A9WE 5HLUA 3ZJPA 1CIKA 4PQBA 3SDNA 2VEEA 1CH7A 1LFVA 3QJDA 1QXDA 1TESA 1MBAA 3MJPB 1GCWA 4MXLA 4NZIA 1NS9A 1S56A 4H2LB 4IROA 1AJHA 2MGHA 2MYAA 4ZVAA 1QXEA 2D2MC 3D7OB 2HBSA 1RQ4A 1YG5A 3QQQA 4PNJA 5JOMA 1YEQA 1ABWA 4MQGB 3PELB 2Z6SA 5CN9A 1V4UB 1FHJB 3QM7A 4HRRA 1Y7DA 1COHB 4M4BB 3UHSA 1A6NA 3WCTC 2NRMA 4DWUA 2H8FA 5E83A 1MKOB 2FRIX 1KR7A 1Y46B 105MA 2BW9M 1X9FC 1O1IB 3GQRB 1KD2B 3LHBA 1DXTB 1O1OB 2HBEA 1QSIA 2V1HA 1K0YB 1O1NB 5ILEA 1MODA 1YHUA 1Y4BB 1Y7ZB 1J40A 1J41A 1BJEA 3UH6A 1T1NB 2EB9A 2VHBA 1A0UA 1Y2ZB 1CH5A 2RI4A 4MQKB 5EE4C 1RQ3A 1B86A 5B84A 2ZSSA 1O1LB 2AURA 1YOIA 3BCQB 1A3OA 2G0RA 2MYBA 3MKBA 1RVWA 1S5YA 3M39A 1HDAB 2PGHB 2YRSA 1N9HA 1UT0A 1Y22B 5HY8A 1VRFA 106MA 2V1FA 1Y5FA 107MA 4UZVA 1VXFA 1Y83B 2R4XA 3UHRA 3D7OA 1RQ4B 1LFZA 1Y4GB 2NSSA 3BJ3B 5E6EA 1A3NB 1A01A 1XCHA 3HC9A 5D5RA 1YHRB 3A59A 1FCSA 2HBGA 1MLFA 3ORDA 1FSXB 1N9IA 1IBEA 1HGBA 2EF2A 5CNEA 2ZT3A 1BUWA 2V1KA 4B4YA 2ZLVB 3HXNB 3NG6A 3QJBB 3NMMB 1JEBA 4F6BA 1R1XB 3MYNA 5EQMA 4VHBA 2GKMA 2RI4B 2GNVA 1BZPA 1G09A 2G10A 3M38A 1O1PB 101MA 2BLIA 1BZ6A 3IA3B 1HBRA 1CIOA 1WMUB 3KUOA 3QM8A 1Y4QB 1Y0WB 1M6CA 1G0AB 1Y4RA 3PT7A 2DN2A 1QPWA 2LH5A 1F5PA 2Z6TA 2D2NA 3AT6B 1NPFA 2D2MA 1BVDA 1HBHA 2M6ZA 3DHRA 1QI8B 2G3HA 1MLUA 4DWTA 2QSSB 3ECLA 3NFEA 1QXDB 2MGDA 1NEJA 1FN3B 1LJWB 1NXFA 5CHQA 1VXBA 1MWCA 1BINA 1Y7CA 3WR1B 4GZGA 5E6EB 3QM6A 1J3ZB 1MLOA 3UHUA 3UHXA 1Y85A 2LH7A 2VYYA 1YE2A 1CMYA 2O5MX 4JACA 1UFJA 1NPGA 5E29B 1C7BA 1IRDB 1FDHA 1MLHA 1FHJA 1F65A 2MGEA 1MNHA 2QFKA 2DN2B 3GOUA 2MYEA 3HHBA 5ILRA 1BZ0A 1MYZA 1EMYA 3P5QB 1MBIA 1JF3A 1MBOA 2M6ZB 1CH4A 1HV4A 4DC8A 4F6DA 2ZFOB 4O4ZA 2DHBA 4MQGA 3NFEB 3S66A 1DKEB 2G0ZA 5CNBA 5JDOC 3UHHA 1AZIA 3E4NA 1DWSA 5CN8A 2KSCA 1XZ7B 1BZ1A 1FLPA 1NWIA 1Y5KA 5M3SA 1YEVB 1JP9A 1FAWA 2HHBB 2ZLXA 1YVTB 1S6AA 1YMBA 2IN4A 3MVCA 5C6EB 1Z8UB 3UHCA 1GCVA 1J40B 1HJTA 3GK9A 1GZXB 1M9PA 2HBCB 2SPLA 1YE0A 1YIHB 2D5XA 3G4VA 3O7NA 3D1KA 2OHBA 1A00A 3S65A 1A6MA 1JL7A 1URVA 1A3OB 4TWUA 2BNLA 1B0BA 1V4XA 4QAUA 2PGHA 2YRSB 4NK1A 2WTHA 1FSLA 1EBCA 1XQ5A 3MKBB 1YVQA 1A0ZB 1HDAA 1V4WA 1BBBB 2LHBA 1XZVB 1LFYB 3BJ3A 3ED9A 1HDBA 2C0KA 2MYCA 1XZUA 4H2LA 2AV3A 4IROB 3WCUB 3MOUA 1HV4B 1XZ4A 1MYGA 1A3NA 3G4WA 3QQRA 1HLBA 2QMBB 2ZLVA 1Y4VA 3VRFB 5ILMA 1O1JB 4AVDA 5AZRA 4FWZA 1LFTB 2LH2A 1PMBA 3WCTB 3UH3A 1EW6A 4N8TB 1V5HA 1YEUA 1LFLA 4UURA 3NL7B 2OH8A 1K1KB 1SI4A 1OUUB 1YEOB 3PELA 1DO4A 1V75B 1HABB 2W6WA 1OUTB 5EYJA 1J7YB 1NGKA 3EDBA 1ECOA 1JDOA 1Y4FA 2BK9A 3OJ1A 1MWBA 1HACA 1BUWB 2G0VA 2EVPA 5MBNA 2ZSOA 4MBAA 1IWHA 1A0UB 3HYUA 1O16A 1G09B 4N7OA 3VRGA 2DXMA 1SDLA 2ZS1D 4M4AB 1YHEA 2QSPA 1JY7A 2EKUA 2R1HA 1MGNA 4ROLB 5HU6B 1Y0DB 1MLSA 1C7BB 1I3DA 2FRKX 1DXUB 2O5QX 1M6MA 5KERB 2ZSQA 1LUEA 4O4TA 1YE2B 2HCOB 3G46A 4KMWA 1J3ZA 2W72A 1CQ2A 2W6YA 5E83B 1MBDA 4HHBB 1DO3A 2O5OX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDS B;  3G4U A;  1SI4 B;  1RSE A;  2R80 A;  3DHT B;  5KDQ B;  4YU3 B;  2W6V B;  1CG5 B;  1NIH A;  2DC3 A;  1LFT A;  1UX8 A;  1DLW A;  1DO1 A;  3PT8 B;  1NS6 A;  7HBI A;  3D17 A;  4MQH A;  1RPS A;  2GTL B;  3A5G A;  2MGL A;  3NL7 A;  1OUU A;  3QM9 A;  3PI4 A;  1Y45 A;  1GZX A;  3ZJN A;  3WCV B;  2H8D B;  4WJG A;  3D4X A;  1DUO A;  3ZJO A;  4U8U D;  4L7Y A;  2BLH A;  3K8B A;  3IC2 B;  1VXC A;  3WCT D;  2D5X B;  1G0A A;  3WFU A;  1HLM A;  5F0B A;  1NZ3 A;  3UHZ A;  2XKI A;  3HRW A;  1MOB A;  1UVX A;  4G51 B;  3OO5 A;  2HHE A;  2O58 X;  1YMC A;  1LFZ B;  1KFR A;  3BJ2 B;  3AT5 B;  2ZLU B;  1DKE A;  1X46 A;  1YIE A;  4HRT A;  2DN3 B;  1U7S A;  2FRF A;  1MDN A;  1JP6 A;  1HGB B;  1XXT A;  3OO4 B;  1WVP A;  1Y35 B;  2EVK A;  3UHN A;  3LQD B;  3ODQ A;  2MHB A;  1JZK A;  1Y85 B;  1XZU B;  3FS4 A;  2H35 A;  1XZ4 B;  5EV5 A;  3OZV A;  1A9W A;  1CH9 A;  1O1P A;  3LB4 A;  3ECX A;  1YE0 B;  1LH6 A;  3ZJH A;  1Y8I A;  1CQX A;  1YFF B;  1F5O A;  3UHQ A;  2ZS1 A;  2VEB A;  2GRF A;  1RTE A;  1HDB B;  1KD2 A;  4PQC A;  3HF4 A;  1J3Y B;  3AQ9 A;  1UIW A;  1MYM A;  2D6C A;  3MN0 A;  4ESA A;  2EB8 A;  4F6I A;  1LTW A;  2D2M B;  1MTI A;  1NZ2 A;  1J41 B;  5SW7 A;  4FWX A;  2ZS0 B;  1A6K A;  3HEP A;  3GLN A;  1Y31 A;  2MGJ A;  3LR7 A;  1PBX A;  1Y8H B;  1AJ9 A;  2ZSY A;  1GLI A;  1NAZ A;  1VXA A;  3BOM A;  1Y09 B;  3UHI A;  4HSX A;  1LHS A;  5CMV A;  3UH7 A;  3PI9 B;  1V75 A;  1N9X A;  2SPN A;  1MLQ A;  4N7P B;  6HBW B;  2XKG A;  3HEO A;  1X3K A;  3V2Z A;  1Y8K B;  2GLN A;  3NML A;  1EBT A;  3EDA A;  5KER A;  111M A;  1C7D A;  3UHE A;  1IWH B;  3K3U A;  1YCB A;  2GDM A;  2V1J A;  4ROL A;  1HAC B;  2G12 A;  1NQP B;  3G4Q A;  1JZM A;  1YHE B;  2GKN A;  3IC0 B;  3QJC B;  1S5X A;  2O5L X;  4YU3 A;  2ZS0 C;  1NS9 B;  1XZ5 A;  2ZS1 B;  1HSY A;  3M3A A;  1YZI B;  5CHR A;  1DXU A;  3HEN A;  1YGF B;  1Y4F B;  4O35 A;  1J3F A;  1DM1 A;  5EU2 A;  1GVH A;  4PQ6 A;  1ECD A;  1MTJ A;  2W6X A;  1MLL A;  1DO7 A;  3B75 B;  2HBF A;  1MNK A;  2ZSZ A;  3R5I A;  1O1K A;  1SDL B;  5D1V A;  4F6J A;  1R1Y A;  4KJT A;  3BJ1 B;  2PEG B;  1MLR A;  2D2N B;  2H8F B;  1DTM A;  3UHD A;  2FAL A;  3ONZ B;  3VRE A;  3IC2 A;  1I3E A;  1VXH A;  2XYK A;  2GTL C;  3WTG B;  4YU4 B;  6HBI A;  1YHU D;  1BIJ A;  3ARL A;  3GDJ B;  1S5X B;  3S1I A;  2HZ1 A;  3UHK A;  1HGC A;  1HBS B;  5EET A;  3RJ6 A;  5HBI A;  3VAU A;  4NS2 A;  3MJU B;  1Y7Z A;  1DXD A;  1GCW B;  3TM3 A;  1HHO A;  1XYE B;  1COH A;  4L2M A;  4M4B A;  1HBB A;  3D1A B;  3OO5 B;  1YIE B;  1O1L A;  3ARJ A;  3EOK B;  1H97 A;  4MBN A;  1BBB A;  3PI3 A;  4MQK A;  3AT5 A;  1DXT A;  3R5I B;  3OK5 A;  1UX9 A;  2LH6 A;  3FS4 B;  4HRR B;  1LA6 A;  103M A;  3NG6 B;  1BZ0 B;  1Q1F A;  2R50 A;  3AQ6 A;  3PIA B;  1UVY A;  2G11 A;  2QRW A;  4MQJ A;  3W4U A;  1MCY A;  3ONZ A;  1LFQ B;  4N7N A;  5CN6 A;  4LPI A;  2QU0 B;  3UGY A;  2MYD A;  2WTG A;  5CN5 A;  1GDI A;  2ZT0 A;  2MB5 A;  1CH1 A;  1K0Y A;  1MYH A;  1HBR B;  1FDH G;  1IBE B;  3UHB A;  4HSW A;  3K9Z A;  2MGF A;  3S66 B;  3PI1 A;  2QSP B;  4F4O A;  3LR9 A;  1JY7 B;  1HGC B;  1HDS A;  1OFJ A;  3A0G A;  2G0S A;  3WCP B;  1JWN A;  4WJG 1;  2CMM A;  1QPW B;  1SWM A;  5HY8 B;  4NI1 B;  1Y01 B;  2BWH A;  1DTI A;  1J7Y A;  3KMF C;  2ZS1 C;  3CY5 A;  1Y09 A;  3EOK A;  1QSH B;  2GRZ A;  1J7W B;  1J7S B;  1Y31 B;  2OLP A;  2WY4 A;  1AJ9 B;  3UHT A;  3WCW B;  2B7H B;  5AB8 A;  3WFX A;  1RVW B;  3MJU A;  4FWY A;  3AQ5 A;  1Y45 B;  4FH6 A;  2SPO A;  1CLS B;  1SHR B;  2AA1 B;  1LH3 A;  2ZFO D;  2DXM B;  1Y7D B;  3LB3 A;  1NZ5 A;  2OHA A;  1Y7C B;  2MGG A;  1Y46 A;  1VXG A;  2Z85 A;  4MQJ B;  3W4U B;  1NQP A;  1Y0D A;  2QU0 A;  1GBV B;  3E5I A;  1G0B B;  5E29 A;  1YEQ B;  5ILP A;  1NEJ B;  1Y8K A;  1Y8W B;  3WCV A;  4F4O B;  1THB B;  1LA6 B;  2R4W A;  5JDO F;  1CH3 A;  1ABY A;  2GTL D;  2MGB A;  1LFY A;  4O2G A;  3GOU B;  5AZQ A;  108M A;  1ECN A;  1OBM A;  1PBX B;  2ZT1 A;  2QLS A;  4ZVB A;  2ZFB A;  3IC0 A;  3MBA A;  2HBE B;  2HBS B;  3ZJQ A;  1OFK A;  2R4Y A;  3ZOM A;  6HBW A;  4HBI A;  1QSI B;  2ZSR A;  1CG8 A;  3QZZ A;  4SDH A;  1OR4 A;  1CBM A;  2D2N C;  3HHB B;  1J52 A;  4L7Y B;  3E5O A;  3NMM A;  3WR1 A;  1IT3 A;  2O5B X;  5EUI A;  5JGG A;  1A01 B;  3HF4 B;  5C6E A;  3SDH A;  3UI0 A;  3GQG A;  3ZJR A;  3A5B A;  3BCQ A;  3ZHW A;  2NSR A;  3A2G A;  2HBC A;  1ECA A;  1RQ3 B;  1JL6 A;  4MAX A;  5CNC A;  1ABY B;  3QM5 A;  4MQC A;  2D60 A;  4AVE A;  1MYT A;  1Y5F B;  2V1E A;  2MGA A;  4BJA A;  1YGF A;  1Y22 A;  1MOA A;  3DUT A;  3GDJ A;  1Y8H A;  1MLG A;  3G52 A;  3QJE A;  1UIW B;  1MYJ A;  5EOH A;  2E2Y A;  2XKH A;  1C40 A;  1Y5J B;  4IT8 A;  1BVC A;  1A6G A;  3OZW A;  1FSX A;  5SW7 B;  1BZR A;  4NXA A;  2DHB B;  1M9P B;  1HBB B;  3UHW A;  1RQA B;  3DR9 A;  2IG3 A;  3VHB A;  2QLS B;  3WI8 A;  3WCV C;  2QFN A;  1YEN A;  1C7C A;  3ASE A;  3PIA A;  1Y5K B;  4NXC A;  3VRE B;  2GRH A;  4MQI A;  1LFQ A;  1JZL A;  3WTG A;  3GQG B;  3WCU C;  2QSS A;  2MGI A;  2Z6N A;  2Z8A A;  5CN7 A;  4B3W A;  2LH1 A;  2O5S X;  2FRJ X;  3WCP A;  3ZJJ A;  2D5Z A;  1Y0T A;  1G08 B;  1CH2 A;  1XZ5 B;  1LH1 A;  3WCU A;  1MBN A;  4WCH D;  3HXN A;  3CY5 B;  2ZLX B;  1GDK A;  1Y4R B;  3S65 B;  1HBA A;  2B7H A;  1IT2 A;  1SPG B;  1QI8 A;  3VRF A;  1VXE A;  2D2M D;  1IRD A;  5HLQ A;  2ZFO A;  1YIH A;  4MQC B;  4NI1 A;  3A0G B;  1S61 A;  1F63 A;  2HHD B;  2ZWJ A;  2ZFO C;  1TU9 A;  1YEU B;  3UBV A;  5CNF A;  1LJW A;  3GKT A;  1BZ1 B;  1DLY A;  4TWV A;  3HYU B;  1GBV A;  4DC7 A;  2HZ3 A;  1Y7G B;  2MGM A;  4XS0 A;  3SZK B;  2ZSP A;  1CO8 A;  1YVQ B;  2R1H B;  1YH9 A;  1GDJ A;  1X9F B;  3S1J A;  2O5T X;  3AG0 A;  1Y8W A;  2D5Z B;  3WCV D;  1Y0C A;  4X0L A;  2BKM A;  4OF9 A;  1NZ4 A;  4NI0 B;  1DWR A;  3M3B A;  2VLX A;  1X9F D;  5CNG A;  1IOP A;  1XZ2 B;  1LH7 A;  3H57 A;  109M A;  1N9F A;  1MYI A;  4HHB A;  4OOD A;  3UBC A;  1J7W A;  3R0G A;  1GCV B;  2ZLT B;  4MXK A;  1CP5 A;  1V4X B;  1YHU C;  3GQP A;  1HBS A;  1MWD A;  1S0H A;  1O1J A;  3WCW C;  1GJN A;  2V1I A;  2EKT A;  3GKV A;  5HU6 A;  1YDZ A;  1SDK A;  1V4W B;  3IXF A;  4XDI A;  5EUI B;  1MBS A;  4G1V A;  4KN3 A;  4ESA B;  1MNO A;  1XZ7 A;  1HCO B;  2ZLW A;  3AQ7 A;  1MTK A;  5KKK A;  1LH5 A;  2BMM A;  3G53 A;  1A0Z A;  5JDO E;  4TYX A;  1IRC A;  1UC3 A;  1URY A;  1O1I A;  4MU5 A;  1ABS A;  3CIU B;  3A5A A;  1AJG A;  3RJN B;  3ZJL A;  1LH2 A;  3D1K B;  4F6G A;  3PI9 A;  1CO9 A;  2BLJ M;  1J7S A;  2ZS0 D;  5EE4 D;  1YHU B;  1YH9 B;  2LH3 A;  4FC3 A;  5MBA A;  1Y0A A;  4KMV A;  2AUQ A;  4NK2 A;  1VRE A;  3D4X B;  2D60 B;  4X0L B;  1D8U A;  2DN3 A;  1EWA A;  1LHT A;  1UMO A;  1YOH A;  3FH9 A;  1MKO A;  1BZZ B;  2GNW A;  2HBD B;  4N8T A;  3D17 B;  4MQH B;  3ZJS A;  3KMF A;  2ZLT A;  1YEN B;  2HHE B;  5JGG B;  1O1O A;  1S0H B;  4U8U B;  2RAO B;  1GDL A;  4HRT B;  1CMY B;  4MQI B;  4M4A A;  2W6V A;  1MBC A;  1A4F A;  3AQ8 A;  1Y0T B;  2VM0 A;  1HBG A;  5HAV A;  3WCW D;  4ROM A;  2DN1 A;  1XXT B;  110M A;  3OO4 A;  2HCO A;  1HBA B;  1LFL B;  3QMA A;  3LQD A;  4F69 A;  3BA2 A;  1JF4 A;  1O1K B;  2Z6N B;  2W72 B;  3TLD A;  4UIQ A;  3GYS B;  102M A;  4FC3 B;  1O1M A;  1VXD A;  2W31 A;  1RTX A;  1LFV B;  3QJD B;  1OR6 A;  1DXV B;  1HGA B;  1JPB A;  4C44 A;  2QMB A;  2AUO A;  1V07 A;  1YCA A;  1Y4V B;  1YGD B;  1RQA A;  1MLK A;  1CG5 A;  1CG8 B;  1OUT A;  1CLS A;  1SHR A;  2AA1 A;  4ILZ A;  1GBU A;  4ODC B;  1MNI A;  1XY0 A;  1GLI B;  1BIJ B;  3G4R A;  1YMA A;  1RPS B;  4N7O B;  3VRG B;  2ZT4 A;  2V1G A;  4C0N A;  1SPG A;  1ABW B;  1MLN A;  3PI8 B;  3G4Y A;  1S5Y B;  2VYW A;  4H07 A;  1V4U A;  2FAM A;  3D1A A;  1ASH A;  1X9F A;  1G08 A;  2HHD A;  2ZSN A;  4H0B A;  1XZ2 A;  4JYQ A;  1HBI A;  2G14 A;  3PT8 A;  1UFP A;  3UHY A;  3MJP A;  1U7R A;  3V2V A;  4FH7 A;  4XS0 B;  2D2N D;  1VWT B;  3BOM B;  1A00 B;  4N7P A;  3A59 B;  4U8U C;  1FN3 A;  1O1M B;  1BAB A;  1G9V A;  2VLY A;  3WFT A;  5KDQ A;  2H8D A;  2ZFB B;  1C7D B;  1JP8 A;  1MNJ A;  5C6Y A;  3OGB A;  3ZJM A;  3BJ2 A;  1XQ5 B;  1Y8I B;  1YFF A;  1YGD A;  3DHT A;  1SDK B;  4ROM B;  1T1N A;  2DN1 B;  1QXE B;  1DUK A;  4NI0 A;  3ARK A;  1ITH A;  1Y4P A;  3GKV B;  2VYZ A;  1Y2Z A;  1XY0 B;  1XZV A;  1Y35 A;  3GYS A;  2W72 C;  1HBH B;  5JDO D;  1CPW A;  1C40 B;  1Y5J A;  1NS6 B;  3SZK A;  1CP0 A;  2AUP A;  1HCO A;  2ZLW B;  3EU1 B;  2R80 B;  3TM9 A;  1Y0W A;  2ZS0 A;  2AV0 A;  3OVU C;  1MLM A;  3K8B B;  3P5Q A;  5F2A A;  5B85 A;  3UHV A;  1Y83 A;  2OH9 A;  3RGK A;  4F6F A;  3GQR A;  1W92 A;  4G51 A;  2GTL A;  3H58 A;  3ZJI A;  2GL3 A;  1R1Y B;  3WCT A;  1Y0A B;  1BAB B;  3ECZ A;  1DWT A;  1G9V B;  3UH5 A;  3LB2 A;  3QJE B;  3U3E A;  1B86 B;  3GQP B;  1K1K A;  5IKS A;  1H1X A;  5EYS A;  2ZLU A;  3BJ1 A;  1HAB A;  1FAW B;  2HHB A;  1YZI A;  2NRL A;  1YDZ B;  3UGZ A;  1Y4P B;  4G1B A;  2HZ2 A;  2VLZ A;  3PI2 A;  1G0B A;  5CND A;  3LB1 A;  3HRW B;  4YU4 A;  3A9M A;  4U8U A;  1THB A;  2ZST A;  3S48 C;  2G0X A;  5HLX A;  1C7C B;  3QZX A;  2ZT2 A;  1MLJ A;  3EU1 A;  1YHR A;  1MZ0 A;  2H35 B;  2HBD A;  2PEG A;  1Y4G A;  3CIU A;  2OIF A;  3WHM B;  1VHB A;  2JHO A;  1BZZ A;  1YEV A;  3B75 A;  1HRM A;  2RAO A;  3QJB A;  1JEB B;  4F68 A;  3ODQ B;  2MHB B;  1J3Y A;  1YG5 B;  1NWN A;  2VRY A;  1SPE A;  1DXC A;  1Y0C B;  1WMU A;  4N7N B;  5CN4 A;  1R1X A;  1CBL A;  3O89 A;  3E55 A;  1GBU B;  4ODC A;  1NIH B;  3FH9 B;  2MGK A;  2MBW A;  1JW8 A;  4O1T A;  104M A;  1YVT A;  2R4Z A;  1IDR A;  3DHR B;  2MGC A;  3WFW A;  1MOH A;  1DXV A;  3UHG A;  1HGA A;  1MYF A;  3KUN A;  3WCU D;  1Y7G A;  3OZU A;  1L2K A;  3PI8 A;  3PT7 B;  1V9Q A;  1O1N A;  1A4F B;  1MOC A;  1HHO B;  1XYE A;  3ZOL A;  4MPM A;  1YOG A;  1Y4Q A;  1Y4B A;  1QSH A;  3MYM A;  2NX0 A;  3AT6 A;  1OJ6 A;  3DUT B;  2ZSX A;  1WLA A;  112M A;  3WHM A;  1VWT A;  2SPM A;  1YEO A;  1S69 A;  2HBF B;  3QJC A;  3WCW A;  3ZH0 A;  1A9W E;  5HLU A;  3ZJP A;  1CIK A;  4PQB A;  3SDN A;  2VEE A;  1CH7 A;  1LFV A;  3QJD A;  1QXD A;  1TES A;  1MBA A;  3MJP B;  1GCW A;  4MXL A;  4NZI A;  1NS9 A;  1S56 A;  4H2L B;  4IRO A;  1AJH A;  2MGH A;  2MYA A;  4ZVA A;  1QXE A;  2D2M C;  3D7O B;  2HBS A;  1RQ4 A;  1YG5 A;  3QQQ A;  4PNJ A;  5JOM A;  1YEQ A;  1ABW A;  4MQG B;  3PEL B;  2Z6S A;  5CN9 A;  1V4U B;  1FHJ B;  3QM7 A;  4HRR A;  1Y7D A;  1COH B;  4M4B B;  3UHS A;  1A6N A;  3WCT C;  2NRM A;  4DWU A;  2H8F A;  5E83 A;  1MKO B;  2FRI X;  1KR7 A;  1Y46 B;  105M A;  2BW9 M;  1X9F C;  1O1I B;  3GQR B;  1KD2 B;  3LHB A;  1DXT B;  1O1O B;  2HBE A;  1QSI A;  2V1H A;  1K0Y B;  1O1N B;  5ILE A;  1MOD A;  1YHU A;  1Y4B B;  1Y7Z B;  1J40 A;  1J41 A;  1BJE A;  3UH6 A;  1T1N B;  2EB9 A;  2VHB A;  1A0U A;  1Y2Z B;  1CH5 A;  2RI4 A;  4MQK B;  5EE4 C;  1RQ3 A;  1B86 A;  5B84 A;  2ZSS A;  1O1L B;  2AUR A;  1YOI A;  3BCQ B;  1A3O A;  2G0R A;  2MYB A;  3MKB A;  1RVW A;  1S5Y A;  3M39 A;  1HDA B;  2PGH B;  2YRS A;  1N9H A;  1UT0 A;  1Y22 B;  5HY8 A;  1VRF A;  106M A;  2V1F A;  1Y5F A;  107M A;  4UZV A;  1VXF A;  1Y83 B;  2R4X A;  3UHR A;  3D7O A;  1RQ4 B;  1LFZ A;  1Y4G B;  2NSS A;  3BJ3 B;  5E6E A;  1A3N B;  1A01 A;  1XCH A;  3HC9 A;  5D5R A;  1YHR B;  3A59 A;  1FCS A;  2HBG A;  1MLF A;  3ORD A;  1FSX B;  1N9I A;  1IBE A;  1HGB A;  2EF2 A;  5CNE A;  2ZT3 A;  1BUW A;  2V1K A;  4B4Y A;  2ZLV B;  3HXN B;  3NG6 A;  3QJB B;  3NMM B;  1JEB A;  4F6B A;  1R1X B;  3MYN A;  5EQM A;  4VHB A;  2GKM A;  2RI4 B;  2GNV A;  1BZP A;  1G09 A;  2G10 A;  3M38 A;  1O1P B;  101M A;  2BLI A;  1BZ6 A;  3IA3 B;  1HBR A;  1CIO A;  1WMU B;  3KUO A;  3QM8 A;  1Y4Q B;  1Y0W B;  1M6C A;  1G0A B;  1Y4R A;  3PT7 A;  2DN2 A;  1QPW A;  2LH5 A;  1F5P A;  2Z6T A;  2D2N A;  3AT6 B;  1NPF A;  2D2M A;  1BVD A;  1HBH A;  2M6Z A;  3DHR A;  1QI8 B;  2G3H A;  1MLU A;  4DWT A;  2QSS B;  3ECL A;  3NFE A;  1QXD B;  2MGD A;  1NEJ A;  1FN3 B;  1LJW B;  1NXF A;  5CHQ A;  1VXB A;  1MWC A;  1BIN A;  1Y7C A;  3WR1 B;  4GZG A;  5E6E B;  3QM6 A;  1J3Z B;  1MLO A;  3UHU A;  3UHX A;  1Y85 A;  2LH7 A;  2VYY A;  1YE2 A;  1CMY A;  2O5M X;  4JAC A;  1UFJ A;  1NPG A;  5E29 B;  1C7B A;  1IRD B;  1FDH A;  1MLH A;  1FHJ A;  1F65 A;  2MGE A;  1MNH A;  2QFK A;  2DN2 B;  3GOU A;  2MYE A;  3HHB A;  5ILR A;  1BZ0 A;  1MYZ A;  1EMY A;  3P5Q B;  1MBI A;  1JF3 A;  1MBO A;  2M6Z B;  1CH4 A;  1HV4 A;  4DC8 A;  4F6D A;  2ZFO B;  4O4Z A;  2DHB A;  4MQG A;  3NFE B;  3S66 A;  1DKE B;  2G0Z A;  5CNB A;  5JDO C;  3UHH A;  1AZI A;  3E4N A;  1DWS A;  5CN8 A;  2KSC A;  1XZ7 B;  1BZ1 A;  1FLP A;  1NWI A;  1Y5K A;  5M3S A;  1YEV B;  1JP9 A;  1FAW A;  2HHB B;  2ZLX A;  1YVT B;  1S6A A;  1YMB A;  2IN4 A;  3MVC A;  5C6E B;  1Z8U B;  3UHC A;  1GCV A;  1J40 B;  1HJT A;  3GK9 A;  1GZX B;  1M9P A;  2HBC B;  2SPL A;  1YE0 A;  1YIH B;  2D5X A;  3G4V A;  3O7N A;  3D1K A;  2OHB A;  1A00 A;  3S65 A;  1A6M A;  1JL7 A;  1URV A;  1A3O B;  4TWU A;  2BNL A;  1B0B A;  1V4X A;  4QAU A;  2PGH A;  2YRS B;  4NK1 A;  2WTH A;  1FSL A;  1EBC A;  1XQ5 A;  3MKB B;  1YVQ A;  1A0Z B;  1HDA A;  1V4W A;  1BBB B;  2LHB A;  1XZV B;  1LFY B;  3BJ3 A;  3ED9 A;  1HDB A;  2C0K A;  2MYC A;  1XZU A;  4H2L A;  2AV3 A;  4IRO B;  3WCU B;  3MOU A;  1HV4 B;  1XZ4 A;  1MYG A;  1A3N A;  3G4W A;  3QQR A;  1HLB A;  2QMB B;  2ZLV A;  1Y4V A;  3VRF B;  5ILM A;  1O1J B;  4AVD A;  5AZR A;  4FWZ A;  1LFT B;  2LH2 A;  1PMB A;  3WCT B;  3UH3 A;  1EW6 A;  4N8T B;  1V5H A;  1YEU A;  1LFL A;  4UUR A;  3NL7 B;  2OH8 A;  1K1K B;  1SI4 A;  1OUU B;  1YEO B;  3PEL A;  1DO4 A;  1V75 B;  1HAB B;  2W6W A;  1OUT B;  5EYJ A;  1J7Y B;  1NGK A;  3EDB A;  1ECO A;  1JDO A;  1Y4F A;  2BK9 A;  3OJ1 A;  1MWB A;  1HAC A;  1BUW B;  2G0V A;  2EVP A;  5MBN A;  2ZSO A;  4MBA A;  1IWH A;  1A0U B;  3HYU A;  1O16 A;  1G09 B;  4N7O A;  3VRG A;  2DXM A;  1SDL A;  2ZS1 D;  4M4A B;  1YHE A;  2QSP A;  1JY7 A;  2EKU A;  2R1H A;  1MGN A;  4ROL B;  5HU6 B;  1Y0D B;  1MLS A;  1C7B B;  1I3D A;  2FRK X;  1DXU B;  2O5Q X;  1M6M A;  5KER B;  2ZSQ A;  1LUE A;  4O4T A;  1YE2 B;  2HCO B;  3G46 A;  4KMW A;  1J3Z A;  2W72 A;  1CQ2 A;  2W6Y A;  5E83 B;  1MBD A;  4HHB B;  1DO3 A;  2O5O X; 
#chains in the Genus database with same CATH topology
 1HDS B;  3G4U A;  1SI4 B;  1RSE A;  2R80 A;  3DHT B;  5KDQ B;  4YU3 B;  2W6V B;  1CG5 B;  1NIH A;  2DC3 A;  1LFT A;  1UX8 A;  4ERT A;  1DLW A;  1DO1 A;  3PT8 B;  1NS6 A;  7HBI A;  1LIA A;  3D17 A;  4MQH A;  1RPS A;  2GTL B;  3A5G A;  2MGL A;  3NL7 A;  1OUU A;  2VJR B;  3QM9 A;  3PI4 A;  1Y45 A;  1GZX A;  3ZJN A;  3WCV B;  2H8D B;  4WJG A;  3D4X A;  1DUO A;  3ZJO A;  4U8U D;  4L7Y A;  2BLH A;  3K8B A;  2JL9 A;  3IC2 B;  1NY9 A;  1VXC A;  3WCT D;  2D5X B;  1G0A A;  3WFU A;  1HLM A;  5F0B A;  1NZ3 A;  3UHZ A;  1HA7 B;  2XKI A;  3HRW A;  1MOB A;  1UVX A;  4G51 B;  1XF6 C;  3OO5 A;  2HHE A;  4HH0 A;  2O58 X;  1YMC A;  1LFZ B;  1KFR A;  4ZIZ A;  3BJ2 B;  3AT5 B;  2ZLU B;  1DKE A;  1X46 A;  1YIE A;  4HRT A;  2DN3 B;  1U7S A;  2FRF A;  1MDN A;  1JP6 A;  1HGB B;  1XXT A;  3OO4 B;  1WVP A;  1Y35 B;  2EVK A;  3UHN A;  3LQD B;  3ODQ A;  2MHB A;  1DDT A;  1JZK A;  1Y85 B;  1XZU B;  3FS4 A;  2H35 A;  3O2C B;  1XZ4 B;  5EV5 A;  3OZV A;  1A9W A;  1CH9 A;  1O1P A;  3FEW X;  3LB4 A;  3ECX A;  1YE0 B;  1LH6 A;  3ZJH A;  1Y8I A;  1CQX A;  1YFF B;  3GUQ A;  1F5O A;  3UHQ A;  2ZS1 A;  4N6S A;  2VEB A;  4F0T B;  2GRF A;  1RTE A;  1HDB B;  1KD2 A;  4PQC A;  3HF4 A;  1J3Y B;  3AQ9 A;  1UIW A;  1MYM A;  2D6C A;  3MN0 A;  4ESA A;  2EB8 A;  4F6I A;  1LTW A;  2D2M B;  1MTI A;  1NZ2 A;  1J41 B;  4ERV A;  5SW7 A;  4FWX A;  3GIO A;  3V58 B;  2BV8 A;  2ZS0 B;  1A6K A;  3HEP A;  3GLN A;  1Y31 A;  2MGJ A;  3LR7 A;  1PBX A;  1Y8H B;  1AJ9 A;  2ZSY A;  1GLI A;  1NAZ A;  1VXA A;  3BOM A;  1Y09 B;  3UHI A;  4HSX A;  1LHS A;  5CMV A;  3UH7 A;  3PI9 B;  1V75 A;  1N9X A;  2SPN A;  1MLQ A;  3O2C A;  4N7P B;  6HBW B;  1UVL A;  2XKG A;  3HEO A;  1X3K A;  2UUM X;  3V2Z A;  1Y8K B;  2GLN A;  1QGW C;  3NML A;  1EBT A;  3EDA A;  5KER A;  111M A;  1C7D A;  1JBO B;  3UHE A;  1IWH B;  1B8D A;  3K3U A;  1YCB A;  2GDM A;  2V1J A;  4ROL A;  1HAC B;  2G12 A;  1NQP B;  3G4Q A;  1JZM A;  1YHE B;  2GKN A;  3IC0 B;  3QJC B;  1S5X A;  2O5L X;  4YU3 A;  2ZS0 C;  1NS9 B;  3VNC A;  1XZ5 A;  2ZS1 B;  1HSY A;  3M3A A;  1YZI B;  5CHR A;  1DXU A;  3HEN A;  1YGF B;  1Y4F B;  4O35 A;  1J3F A;  1DM1 A;  5EU2 A;  1GVH A;  4PQ6 A;  1ECD A;  1MTJ A;  2W6X A;  1MLL A;  1DO7 A;  3B75 B;  2HBF A;  1MNK A;  2ZSZ A;  3R5I A;  1O1K A;  1SDL B;  5D1V A;  4F6J A;  1R1Y A;  4KJT A;  2VJR A;  3BJ1 B;  2PEG B;  3KVS A;  1MLR A;  2D2N B;  2H8F B;  1DTM A;  4A8K A;  3UHD A;  2FAL A;  3ONZ B;  3VRE A;  3IC2 A;  1I3E A;  1VXH A;  2XYK A;  2GTL C;  3WTG B;  3BRP A;  4YU4 B;  6HBI A;  1YHU D;  1BIJ A;  3ARL A;  3GDJ B;  1S5X B;  2JLF A;  3S1I A;  2HZ1 A;  3UHK A;  1HGC A;  1HBS B;  5EET A;  3RJ6 A;  5HBI A;  3VAU A;  4NS2 A;  3MJU B;  2C7L B;  1Y7Z A;  1DXD A;  1GCW B;  4Q70 B;  3TM3 A;  1HHO A;  1XYE B;  1COH A;  4L2M A;  2VJH A;  4M4B A;  1HBB A;  3D1A B;  3OO5 B;  1YIE B;  1O1L A;  3ARJ A;  3EOK B;  1H97 A;  4MBN A;  1BBB A;  3PI3 A;  4MQK A;  3AT5 A;  1DXT A;  3R5I B;  2C7K A;  3OK5 A;  1UX9 A;  2LH6 A;  3FS4 B;  4HRR B;  1LA6 A;  103M A;  3NG6 B;  1BZ0 B;  1Q1F A;  2R50 A;  3AQ6 A;  3PIA B;  1UVY A;  2G11 A;  2QRW A;  4MQJ A;  3W4U A;  1MCY A;  3ONZ A;  1LFQ B;  4N7N A;  5CN6 A;  4LPI A;  2QU0 B;  3UGY A;  2MYD A;  2WTG A;  5CN5 A;  1GDI A;  2ZT0 A;  2MB5 A;  1CH1 A;  1K0Y A;  1MYH A;  1HBR B;  1FDH G;  1IBE B;  3UHB A;  4HSW A;  3K9Z A;  2MGF A;  3S66 B;  3PI1 A;  2QSP B;  4F4O A;  4A8Q A;  3LR9 A;  1JY7 B;  1HGC B;  1HDS A;  1OFJ A;  3A0G A;  4LMS B;  4BS9 A;  2G0S A;  3WCP B;  1JWN A;  4F0T A;  4WJG 1;  2CMM A;  1QPW B;  1SWM A;  5HY8 B;  4NI1 B;  2UUN D;  1Y01 B;  2BWH A;  1DTI A;  1J7Y A;  3KMF C;  2ZS1 C;  3CY5 A;  1Y09 A;  3EOK A;  1QSH B;  2GRZ A;  1J7W B;  1J7S B;  1Y31 B;  2OLP A;  1LIA B;  2WY4 A;  1AJ9 B;  3UHT A;  3WCW B;  2B7H B;  2DKC A;  5AB8 A;  4LM6 B;  1UVM A;  3WFX A;  1RVW B;  3MJU A;  4FWY A;  3AQ5 A;  1Y45 B;  4FH6 A;  2SPO A;  2V8A A;  1CLS B;  1SHR B;  2AA1 B;  1LH3 A;  2ZFO D;  2DXM B;  1Y7D B;  1KTP A;  3LB3 A;  1NZ5 A;  2OHA A;  1Y7C B;  2MGG A;  1Y46 A;  1VXG A;  2Z85 A;  4MQJ B;  3W4U B;  1NQP A;  1Y0D A;  2QU0 A;  1GBV B;  2J96 A;  3E5I A;  1G0B B;  5E29 A;  1YEQ B;  5ILP A;  1NEJ B;  1Y8K A;  1Y8W B;  3WCV A;  4F4O B;  1THB B;  1LA6 B;  2R4W A;  5JDO F;  1CH3 A;  1ABY A;  2GTL D;  2MGB A;  1LFY A;  4O2G A;  3GOU B;  4LMX B;  4A8F A;  5AZQ A;  108M A;  1ECN A;  1OBM A;  1PBX B;  2ZT1 A;  2QLS A;  4ZVB A;  2ZFB A;  3IC0 A;  3MBA A;  2HBE B;  2HBS B;  1F0L A;  3ZJQ A;  1OFK A;  2R4Y A;  3ZOM A;  6HBW A;  4HBI A;  1QSI B;  2ZSR A;  1HHS A;  1CG8 A;  3QZZ A;  4SDH A;  1OR4 A;  1CBM A;  2D2N C;  3HHB B;  4A8W A;  1J52 A;  4L7Y B;  3E5O A;  3NMM A;  3WR1 A;  1IT3 A;  2O5B X;  5EUI A;  5JGG A;  1A01 B;  3HF4 B;  5C6E A;  3SDH A;  3UI0 A;  3GQG A;  3ZJR A;  3A5B A;  2UUM A;  3BCQ A;  3ZHW A;  2NSR A;  3A2G A;  2HBC A;  1ECA A;  1RQ3 B;  1JL6 A;  1KN1 B;  4MAX A;  5CNC A;  1ABY B;  3QM5 A;  4MQC A;  2D60 A;  4AVE A;  1MYT A;  1Y5F B;  2V1E A;  2MGA A;  4BJA A;  1YGF A;  1Y22 A;  1MOA A;  3DUT A;  3GDJ A;  1Y8H A;  1MLG A;  1ON7 A;  3G52 A;  3QJE A;  1UIW B;  1MYJ A;  5EOH A;  2E2Y A;  2XKH A;  1C40 A;  1Y5J B;  4IT8 A;  1BVC A;  1A6G A;  3OZW A;  1FSX A;  5SW7 B;  1BZR A;  4NXA A;  2DHB B;  1M9P B;  1HBB B;  3UHW A;  1RQA B;  3DR9 A;  2IG3 A;  4Q70 A;  4H0M A;  3VHB A;  2QLS B;  3WI8 A;  3WCV C;  2QFN A;  1YEN A;  1B8D B;  1C7C A;  3ASE A;  3PIA A;  1Y5K B;  4NXC A;  2JLG A;  3VRE B;  1GH0 A;  2I88 A;  2GRH A;  4MQI A;  1LFQ A;  2UUN A;  1JZL A;  3WTG A;  3GQG B;  3WCU C;  2QSS A;  2MGI A;  2Z6N A;  2Z8A A;  5CN7 A;  4B3W A;  2LH1 A;  2O5S X;  2FRJ X;  3WCP A;  3ZJJ A;  1HI1 A;  2D5Z A;  1Y0T A;  1G08 B;  1CH2 A;  1XZ5 B;  1LH1 A;  3WCU A;  1MBN A;  4ETU A;  4WCH D;  2C7J B;  3HXN A;  3CY5 B;  2ZLX B;  1GDK A;  1Y4R B;  3S65 B;  1HBA A;  2B7H A;  1IT2 A;  1SPG B;  1QI8 A;  3VRF A;  1VXE A;  2D2M D;  1IRD A;  5HLQ A;  2ZFO A;  1YIH A;  4MQC B;  4NI1 A;  3A0G B;  1S61 A;  1F63 A;  2HHD B;  2ZWJ A;  2ZFO C;  1TU9 A;  1YEU B;  3UBV A;  3V57 A;  5CNF A;  1EYX A;  1LJW A;  3GKT A;  1BZ1 B;  1DLY A;  4TWV A;  3HYU B;  1GBV A;  4DC7 A;  2HZ3 A;  1Y7G B;  2MGM A;  4XS0 A;  3SZK B;  1ALL A;  2ZSP A;  4TMA B;  1CO8 A;  1YVQ B;  2R1H B;  1YH9 A;  1GDJ A;  1X9F B;  3S1J A;  2O5T X;  3AG0 A;  1Y8W A;  2D5Z B;  3WCV D;  1Y0C A;  4X0L A;  2BKM A;  4OF9 A;  1NZ4 A;  4NI0 B;  1DWR A;  3M3B A;  2VLX A;  1X9F D;  5CNG A;  1IOP A;  1CPC A;  1LH7 A;  1XZ2 B;  3H57 A;  109M A;  1N9F A;  1F99 A;  1MYI A;  4HHB A;  4OOD A;  3UBC A;  1J7W A;  1RH1 A;  3R0G A;  1GCV B;  2YSK A;  2ZLT B;  4MXK A;  1CP5 A;  1V4X B;  1YHU C;  3GQP A;  1SGK A;  1HBS A;  1MWD A;  1S0H A;  1O1J A;  2C7L A;  3WCW C;  1GJN A;  2V1I A;  2EKT A;  3GKV A;  5HU6 A;  1YDZ A;  1SDK A;  1V4W B;  3IXF A;  4XDI A;  5EUI B;  1MBS A;  4G1V A;  4KN3 A;  4ESA B;  1MNO A;  1XZ7 A;  1HCO B;  2ZLW A;  4GY3 A;  3AQ7 A;  1MTK A;  4A8S A;  5KKK A;  1LH5 A;  2BMM A;  3G53 A;  1A0Z A;  5JDO E;  4TYX A;  1IRC A;  1UC3 A;  2DKA A;  1URY A;  1O1I A;  4MU5 A;  1ABS A;  3CIU B;  3A5A A;  1AJG A;  3RJN B;  3ZJL A;  1LH2 A;  3D1K B;  4F6G A;  3PI9 A;  5B13 G;  1CO9 A;  2BLJ M;  1J7S A;  2ZS0 D;  5EE4 D;  1YHU B;  1YH9 B;  2LH3 A;  4FC3 A;  5MBA A;  4L1E B;  2UUM B;  1Y0A A;  4KMV A;  2AUQ A;  4NK2 A;  1VRE A;  3D4X B;  2D60 B;  4X0L B;  1JBO A;  1D8U A;  2DN3 A;  1EWA A;  1LHT A;  1UMO A;  1YOH A;  4GXE B;  3FH9 A;  1MKO A;  1BZZ B;  2GNW A;  2HBD B;  4N8T A;  3D17 B;  4MQH B;  1HA7 A;  3ZJS A;  3PMD A;  3KMF A;  2ZLT A;  1YEN B;  2HHE B;  5JGG B;  1O1O A;  1S0H B;  4U8U B;  2RAO B;  1GDL A;  4HRT B;  1CMY B;  4MQI B;  4M4A A;  2W6V A;  1MBC A;  1A4F A;  3AQ8 A;  1Y0T B;  1KN1 A;  2VM0 A;  1HBG A;  3RQR A;  5HAV A;  1CII A;  3WCW D;  4ROM A;  2DN1 A;  1XXT B;  110M A;  3OO4 A;  2HCO A;  1HBA B;  1LFL B;  3QMA A;  3LQD A;  4F69 A;  3BA2 A;  1JF4 A;  1O1K B;  2Z6N B;  1GH0 B;  2W72 B;  3TLD A;  4UIQ A;  3GYS B;  102M A;  4FC3 B;  1O1M A;  1VXD A;  2W31 A;  1RTX A;  1LFV B;  3QJD B;  1OR6 A;  1DXV B;  1HGA B;  1JPB A;  4C44 A;  2QMB A;  2AUO A;  1V07 A;  1YCA A;  1Y4V B;  1UVN A;  1YGD B;  1RQA A;  1MLK A;  1CG5 A;  1CG8 B;  1OUT A;  1CLS A;  1SHR A;  2AA1 A;  4ILZ A;  1GBU A;  3LQ9 A;  1MNI A;  1XY0 A;  4ODC B;  1GLI B;  4ETT A;  1BIJ B;  3G4R A;  1YMA A;  1RPS B;  4N7O B;  3VRG B;  2ZT4 A;  1ALL B;  2V1G A;  4C0N A;  1SPG A;  1ABW B;  1MLN A;  3PI8 B;  3G4Y A;  1S5Y B;  2VYW A;  4H07 A;  1V4U A;  2FAM A;  4A8Y A;  3D1A A;  1ASH A;  1X9F A;  1G08 A;  2HHD A;  2ZSN A;  4H0B A;  1XZ2 A;  4JYQ A;  1HBI A;  2G14 A;  3PT8 A;  1UFP A;  3UHY A;  3MJP A;  1U7R A;  3V2V A;  4FH7 A;  4XS0 B;  3O18 B;  2D2N D;  1VWT B;  4AE1 A;  3BOM B;  1A00 B;  4N7P A;  3A59 B;  4U8U C;  1FN3 A;  1O1M B;  1BAB A;  1G9V A;  2VLY A;  3WFT A;  5KDQ A;  2H8D A;  2ZFB B;  1C7D B;  1JP8 A;  1MNJ A;  5C6Y A;  3OGB A;  3ZJM A;  3BJ2 A;  1XQ5 B;  1Y8I B;  1YFF A;  1YGD A;  3DHT A;  1SDK B;  4ROM B;  1T1N A;  2DN1 B;  1QXE B;  1DUK A;  4NI0 A;  3ARK A;  1ITH A;  1Y4P A;  3GKV B;  2VYZ A;  1Y2Z A;  1XY0 B;  1XZV A;  1Y35 A;  3GYS A;  2W72 C;  1HBH B;  5JDO D;  1CPW A;  1C40 B;  1Y5J A;  1NS6 B;  3SZK A;  1CP0 A;  2AUP A;  1HCO A;  2ZLW B;  4F0U A;  4GY3 B;  3EU1 B;  2R80 B;  3TM9 A;  1Y0W A;  2ZS0 A;  2AV0 A;  3ZTA A;  3OVU C;  1MLM A;  3K8B B;  3P5Q A;  5F2A A;  2X4A A;  5B85 A;  3UHV A;  1Y83 A;  2OH9 A;  3RGK A;  4F6F A;  3GQR A;  1W92 A;  1WAC A;  1UVJ A;  4G51 A;  1XDT T;  2GTL A;  3H58 A;  3ZJI A;  2GL3 A;  1R1Y B;  3WCT A;  1Y0A B;  1COL A;  1BAB B;  3ECZ A;  1DWT A;  1G9V B;  3UH5 A;  3LB2 A;  3QJE B;  3U3E A;  1B86 B;  3GQP B;  1K1K A;  5IKS A;  1H1X A;  4YJJ B;  5EYS A;  2ZLU A;  3BJ1 A;  1HAB A;  1FAW B;  2HHB A;  1HI8 A;  1YZI A;  2NRL A;  1YDZ B;  3UGZ A;  1Y4P B;  4G1B A;  2HZ2 A;  2VLZ A;  3PI2 A;  1G0B A;  5CND A;  3LB1 A;  3HRW B;  4YU4 A;  3A9M A;  4U8U A;  1THB A;  2ZST A;  3S48 C;  2G0X A;  5HLX A;  1C7C B;  3QZX A;  2ZT2 A;  4F0U B;  1MLJ A;  3EU1 A;  1YHR A;  1MZ0 A;  2H35 B;  2HBD A;  2PEG A;  3KVS B;  4GXE A;  1Y4G A;  1UVK A;  2VML A;  3CIU A;  2OIF A;  3WHM B;  1VHB A;  2JHO A;  1BZZ A;  1YEV A;  2C7K B;  3B75 A;  1HRM A;  2RAO A;  3QJB A;  1JEB B;  4N6S B;  4F68 A;  3ODQ B;  3BRP B;  2MHB B;  1J3Y A;  5AQD A;  1YG5 B;  1NWN A;  2VRY A;  1SPE A;  1DXC A;  1Y0C B;  1WMU A;  4N7N B;  5CN4 A;  1R1X A;  1CBL A;  3O89 A;  3E55 A;  1GBU B;  4ODC A;  1NIH B;  2X49 A;  3FH9 B;  2MGK A;  2MBW A;  1JW8 A;  4O1T A;  104M A;  1YVT A;  2R4Z A;  1IDR A;  4PO5 A;  2UUL D;  3DHR B;  3NUH B;  2MGC A;  3WFW A;  1MOH A;  1DXV A;  3UHG A;  1HGA A;  5FVB A;  1MYF A;  3KUN A;  1HI0 P;  3WCU D;  1Y7G A;  3OZU A;  1L2K A;  3PI8 A;  3PT7 B;  1V9Q A;  1O1N A;  1A4F B;  1MOC A;  1HHO B;  1XYE A;  3ZOL A;  4MPM A;  1YOG A;  1Y4Q A;  2BV8 B;  1Y4B A;  1QSH A;  3MYM A;  2NX0 A;  3AT6 A;  1OJ6 A;  3DUT B;  2ZSX A;  4RMP A;  1WLA A;  112M A;  3WHM A;  1VWT A;  4HH1 A;  1I7Y B;  2SPM A;  1YEO A;  1S69 A;  2VJT A;  2HBF B;  3QJC A;  3WCW A;  3ZH0 A;  1A9W E;  5HLU A;  3ZJP A;  1CIK A;  4PQB A;  3SDN A;  2VEE A;  1CH7 A;  1LFV A;  3QJD A;  1QXD A;  1TES A;  1MBA A;  4ZIZ B;  3MJP B;  1GCW A;  4MXL A;  4A8M P;  4NZI A;  1NS9 A;  1S56 A;  4H2L B;  4IRO A;  1AJH A;  1PHN B;  2MGH A;  2MYA A;  4ZVA A;  1QXE A;  2D2M C;  3D7O B;  2HBS A;  1RQ4 A;  1YG5 A;  3QQQ A;  4PNJ A;  5JOM A;  1YEQ A;  1ABW A;  4MQG B;  3PEL B;  2Z6S A;  5CN9 A;  1V4U B;  1FHJ B;  3QM7 A;  4HRR A;  4AE0 A;  1Y7D A;  4M4B B;  1COH B;  3UHS A;  1A6N A;  3WCT C;  2NRM A;  4DWU A;  2H8F A;  5E83 A;  1MKO B;  2FRI X;  1KR7 A;  1Y46 B;  105M A;  2BW9 M;  1X9F C;  1O1I B;  3GQR B;  5AQD M;  1KD2 B;  1HHT P;  2VJT B;  3LHB A;  1DXT B;  1O1O B;  2HBE A;  1QSI A;  2V1H A;  1K0Y B;  1O1N B;  5ILE A;  1MOD A;  1YHU A;  1Y4B B;  1Y7Z B;  1J40 A;  4L1E A;  1J41 A;  1BJE A;  2VJH B;  3UH6 A;  1T1N B;  3MWN A;  2EB9 A;  2VHB A;  1A0U A;  1Y2Z B;  1CH5 A;  2RI4 A;  4MQK B;  3DBJ B;  5EE4 C;  1RQ3 A;  1B86 A;  5B84 A;  2ZSS A;  1O1L B;  2AUR A;  1YOI A;  3BCQ B;  1A3O A;  2G0R A;  2MYB A;  3MKB A;  1RVW A;  4ETV A;  1S5Y A;  3M39 A;  1HDA B;  2PGH B;  2YRS A;  2UUL A;  4Z8K A;  1N9H A;  1UT0 A;  1Y22 B;  5HY8 A;  1VRF A;  106M A;  1ON7 B;  2V1F A;  1Y5F A;  107M A;  4UZV A;  1VXF A;  1Y83 B;  2R4X A;  3UHR A;  3D7O A;  4BJU A;  4XXI A;  1RQ4 B;  1LFZ A;  1Y4G B;  2NSS A;  3BJ3 B;  5E6E A;  1A3N B;  1A01 A;  1XCH A;  3HC9 A;  5D5R A;  1YHR B;  3A59 A;  1FCS A;  2HBG A;  2V8A B;  1MLF A;  3ORD A;  1FSX B;  1N9I A;  1IBE A;  1HGB A;  2EF2 A;  4YJJ A;  5CNE A;  2ZT3 A;  3L0F B;  1BUW A;  2V1K A;  4B4Y A;  2ZLV B;  2C7J A;  3HXN B;  3NG6 A;  3QJB B;  3NMM B;  1JEB A;  4F6B A;  3O18 A;  4PO5 B;  1R1X B;  3MYN A;  5EQM A;  4VHB A;  2GKM A;  4A8O A;  2RI4 B;  2GNV A;  1BZP A;  1G09 A;  2G10 A;  1B33 B;  3M38 A;  1O1P B;  101M A;  2BLI A;  1BZ6 A;  3IA3 B;  1HBR A;  1CIO A;  1WMU B;  3KUO A;  3QM8 A;  1Y4Q B;  1A87 A;  1Y0W B;  1M6C A;  1G0A B;  1Y4R A;  3PT7 A;  2DN2 A;  1QPW A;  2LH5 A;  1F5P A;  2Z6T A;  2WCR A;  1KTP B;  2D2N A;  3AT6 B;  1NPF A;  2D2M A;  1BVD A;  1HBH A;  2M6Z A;  3DHR A;  3V58 A;  1QI8 B;  2G3H A;  1MLU A;  4DWT A;  2QSS B;  3ECL A;  1TOX A;  4B02 A;  3NFE A;  1QXD B;  2MGD A;  1NEJ A;  1FN3 B;  1LJW B;  1NXF A;  4H0M B;  5CHQ A;  1VXB A;  1MWC A;  1BIN A;  1Y7C A;  1EYX B;  3WR1 B;  4GZG A;  5E6E B;  3QM6 A;  1J3Z B;  1MLO A;  3UHU A;  3UHX A;  1Y85 A;  2LH7 A;  2VYY A;  1YE2 A;  1CMY A;  2O5M X;  4JAC A;  1UFJ A;  5FVB M;  1NPG A;  5E29 B;  1C7B A;  1IRD B;  1FDH A;  1MLH A;  1FHJ A;  1F65 A;  2MGE A;  1MNH A;  2QFK A;  2DN2 B;  3GOU A;  2MYE A;  3HHB A;  5ILR A;  1BZ0 A;  1CPC B;  1MYZ A;  2VML B;  1EMY A;  3P5Q B;  1MBI A;  1JF3 A;  1MBO A;  1I7Y A;  2M6Z B;  1CH4 A;  1HV4 A;  4DC8 A;  4F6D A;  2UUN B;  2ZFO B;  4O4Z A;  2DHB A;  4MQG A;  3NFE B;  3S66 A;  1DKE B;  2G0Z A;  5CNB A;  5JDO C;  3UHH A;  1AZI A;  3E4N A;  1DWS A;  5CN8 A;  2KSC A;  1XZ7 B;  1BZ1 A;  1FLP A;  1NWI A;  1Y5K A;  5M3S A;  1YEV B;  1JP9 A;  1FAW A;  2HHB B;  2ZLX A;  1YVT B;  1S6A A;  1YMB A;  2IN4 A;  3MVC A;  5C6E B;  1Z8U B;  3UHC A;  1GCV A;  3DBJ A;  1J40 B;  2WCQ A;  1HJT A;  3GK9 A;  1GZX B;  1M9P A;  2HBC B;  2SPL A;  1YE0 A;  1YIH B;  2D5X A;  3G4V A;  3O7N A;  3D1K A;  2OHB A;  1F99 B;  1A00 A;  3V57 B;  3S65 A;  1A6M A;  1JL7 A;  1URV A;  1A3O B;  2BNL A;  4TWU A;  1B0B A;  1V4X A;  4XXK A;  4QAU A;  2PGH A;  2YRS B;  4NK1 A;  2WTH A;  1FSL A;  1EBC A;  1XQ5 A;  3MKB B;  1YVQ A;  1A0Z B;  1HDA A;  2UUL B;  4Z8K B;  1V4W A;  1BBB B;  2LHB A;  1XZV B;  1LFY B;  3BJ3 A;  3ED9 A;  1HDB A;  2C0K A;  1XG0 C;  2MYC A;  1XZU A;  4IRO B;  2AV3 A;  4H2L A;  3WCU B;  3MOU A;  1HV4 B;  1XZ4 A;  1MYG A;  1A3N A;  2UUL H;  3G4W A;  5B13 A;  3QQR A;  1HLB A;  2QMB B;  2ZLV A;  1Y4V A;  3VRF B;  5ILM A;  1O1J B;  4ESU A;  2DKD A;  4AVD A;  5AZR A;  3L0F A;  4FWZ A;  1LFT B;  2LH2 A;  1PMB A;  3WCT B;  3UH3 A;  1EW6 A;  4N8T B;  1V5H A;  1YEU A;  1LFL A;  1UVI A;  4RMP B;  4UUR A;  3NL7 B;  2OH8 A;  1K1K B;  1SI4 A;  1OUU B;  1YEO B;  3PEL A;  1DO4 A;  1V75 B;  1HAB B;  2W6W A;  1OUT B;  2UUL C;  5EYJ A;  1J7Y B;  1NGK A;  3EDB A;  1ECO A;  1JDO A;  1Y4F A;  2BK9 A;  3OJ1 A;  1MWB A;  1HAC A;  1BUW B;  2G0V A;  2EVP A;  5MBN A;  2ZSO A;  4MBA A;  1IWH A;  3PMC A;  1A0U B;  3HYU A;  1O16 A;  1G09 B;  4N7O A;  3VRG A;  1B33 A;  2DXM A;  1PHN A;  1SDL A;  2ZS1 D;  4M4A B;  1YHE A;  2QSP A;  1JY7 A;  2EKU A;  2R1H A;  1MGN A;  4ROL B;  5HU6 B;  1Y0D B;  1MLS A;  1C7B B;  1I3D A;  2FRK X;  1DXU B;  2O5Q X;  1M6M A;  5KER B;  2ZSQ A;  1LUE A;  4O4T A;  1YE2 B;  2HCO B;  3G46 A;  4KMW A;  1J3Z A;  2W72 A;  1MDT A;  1CQ2 A;  2W6Y A;  5E83 B;  1MBD A;  4HHB B;  1DO3 A;  2O5O X; 
#chains in the Genus database with same CATH homology
 1HDS B;  3G4U A;  1SI4 B;  1RSE A;  2R80 A;  3DHT B;  5KDQ B;  4YU3 B;  2W6V B;  1CG5 B;  1NIH A;  2DC3 A;  1LFT A;  1UX8 A;  1DLW A;  1DO1 A;  3PT8 B;  1NS6 A;  7HBI A;  3D17 A;  4MQH A;  1RPS A;  2GTL B;  3A5G A;  2MGL A;  3NL7 A;  1OUU A;  3QM9 A;  3PI4 A;  1Y45 A;  1GZX A;  3ZJN A;  3WCV B;  2H8D B;  4WJG A;  3D4X A;  1DUO A;  3ZJO A;  4U8U D;  4L7Y A;  2BLH A;  3K8B A;  3IC2 B;  1VXC A;  3WCT D;  2D5X B;  1G0A A;  3WFU A;  1HLM A;  5F0B A;  1NZ3 A;  3UHZ A;  2XKI A;  3HRW A;  1MOB A;  1UVX A;  4G51 B;  3OO5 A;  2HHE A;  2O58 X;  1YMC A;  1LFZ B;  1KFR A;  3BJ2 B;  3AT5 B;  2ZLU B;  1DKE A;  1X46 A;  1YIE A;  4HRT A;  2DN3 B;  1U7S A;  2FRF A;  1MDN A;  1JP6 A;  1HGB B;  1XXT A;  3OO4 B;  1WVP A;  1Y35 B;  2EVK A;  3UHN A;  3LQD B;  3ODQ A;  2MHB A;  1JZK A;  1Y85 B;  1XZU B;  3FS4 A;  2H35 A;  1XZ4 B;  5EV5 A;  3OZV A;  1A9W A;  1CH9 A;  1O1P A;  3LB4 A;  3ECX A;  1YE0 B;  1LH6 A;  3ZJH A;  1Y8I A;  1CQX A;  1YFF B;  1F5O A;  3UHQ A;  2ZS1 A;  2VEB A;  2GRF A;  1RTE A;  1HDB B;  1KD2 A;  4PQC A;  3HF4 A;  1J3Y B;  3AQ9 A;  1UIW A;  1MYM A;  2D6C A;  3MN0 A;  4ESA A;  2EB8 A;  4F6I A;  1LTW A;  2D2M B;  1MTI A;  1NZ2 A;  1J41 B;  5SW7 A;  4FWX A;  2ZS0 B;  1A6K A;  3HEP A;  3GLN A;  1Y31 A;  2MGJ A;  3LR7 A;  1PBX A;  1Y8H B;  1AJ9 A;  2ZSY A;  1GLI A;  1NAZ A;  1VXA A;  3BOM A;  1Y09 B;  3UHI A;  4HSX A;  1LHS A;  5CMV A;  3UH7 A;  3PI9 B;  1V75 A;  1N9X A;  2SPN A;  1MLQ A;  4N7P B;  6HBW B;  2XKG A;  3HEO A;  1X3K A;  3V2Z A;  1Y8K B;  2GLN A;  3NML A;  1EBT A;  3EDA A;  5KER A;  111M A;  1C7D A;  3UHE A;  1IWH B;  3K3U A;  1YCB A;  2GDM A;  2V1J A;  4ROL A;  1HAC B;  2G12 A;  1NQP B;  3G4Q A;  1JZM A;  1YHE B;  2GKN A;  3IC0 B;  3QJC B;  1S5X A;  2O5L X;  4YU3 A;  2ZS0 C;  1NS9 B;  1XZ5 A;  2ZS1 B;  1HSY A;  3M3A A;  1YZI B;  5CHR A;  1DXU A;  3HEN A;  1YGF B;  1Y4F B;  4O35 A;  1J3F A;  1DM1 A;  5EU2 A;  1GVH A;  4PQ6 A;  1ECD A;  1MTJ A;  2W6X A;  1MLL A;  1DO7 A;  3B75 B;  2HBF A;  1MNK A;  2ZSZ A;  3R5I A;  1O1K A;  1SDL B;  5D1V A;  4F6J A;  1R1Y A;  4KJT A;  3BJ1 B;  2PEG B;  1MLR A;  2D2N B;  2H8F B;  1DTM A;  3UHD A;  2FAL A;  3ONZ B;  3VRE A;  3IC2 A;  1I3E A;  1VXH A;  2XYK A;  2GTL C;  3WTG B;  4YU4 B;  6HBI A;  1YHU D;  1BIJ A;  3ARL A;  3GDJ B;  1S5X B;  3S1I A;  2HZ1 A;  3UHK A;  1HGC A;  1HBS B;  5EET A;  3RJ6 A;  5HBI A;  3VAU A;  4NS2 A;  3MJU B;  1Y7Z A;  1DXD A;  1GCW B;  3TM3 A;  1HHO A;  1XYE B;  1COH A;  4L2M A;  4M4B A;  1HBB A;  3D1A B;  3OO5 B;  1YIE B;  1O1L A;  3ARJ A;  3EOK B;  1H97 A;  4MBN A;  1BBB A;  3PI3 A;  4MQK A;  3AT5 A;  1DXT A;  3R5I B;  3OK5 A;  1UX9 A;  2LH6 A;  3FS4 B;  4HRR B;  1LA6 A;  103M A;  3NG6 B;  1BZ0 B;  1Q1F A;  2R50 A;  3AQ6 A;  3PIA B;  1UVY A;  2G11 A;  2QRW A;  4MQJ A;  3W4U A;  1MCY A;  3ONZ A;  1LFQ B;  4N7N A;  5CN6 A;  4LPI A;  2QU0 B;  3UGY A;  2MYD A;  2WTG A;  5CN5 A;  1GDI A;  2ZT0 A;  2MB5 A;  1CH1 A;  1K0Y A;  1MYH A;  1HBR B;  1FDH G;  1IBE B;  3UHB A;  4HSW A;  3K9Z A;  2MGF A;  3S66 B;  3PI1 A;  2QSP B;  4F4O A;  3LR9 A;  1JY7 B;  1HGC B;  1HDS A;  1OFJ A;  3A0G A;  2G0S A;  3WCP B;  1JWN A;  4WJG 1;  2CMM A;  1QPW B;  1SWM A;  5HY8 B;  4NI1 B;  1Y01 B;  2BWH A;  1DTI A;  1J7Y A;  3KMF C;  2ZS1 C;  3CY5 A;  1Y09 A;  3EOK A;  1QSH B;  2GRZ A;  1J7W B;  1J7S B;  1Y31 B;  2OLP A;  2WY4 A;  1AJ9 B;  3UHT A;  3WCW B;  2B7H B;  5AB8 A;  3WFX A;  1RVW B;  3MJU A;  4FWY A;  3AQ5 A;  1Y45 B;  4FH6 A;  2SPO A;  1CLS B;  1SHR B;  2AA1 B;  1LH3 A;  2ZFO D;  2DXM B;  1Y7D B;  3LB3 A;  1NZ5 A;  2OHA A;  1Y7C B;  2MGG A;  1Y46 A;  1VXG A;  2Z85 A;  4MQJ B;  3W4U B;  1NQP A;  1Y0D A;  2QU0 A;  1GBV B;  3E5I A;  1G0B B;  5E29 A;  1YEQ B;  5ILP A;  1NEJ B;  1Y8K A;  1Y8W B;  3WCV A;  4F4O B;  1THB B;  1LA6 B;  2R4W A;  5JDO F;  1CH3 A;  1ABY A;  2GTL D;  2MGB A;  1LFY A;  4O2G A;  3GOU B;  5AZQ A;  108M A;  1ECN A;  1OBM A;  1PBX B;  2ZT1 A;  2QLS A;  4ZVB A;  2ZFB A;  3IC0 A;  3MBA A;  2HBE B;  2HBS B;  3ZJQ A;  1OFK A;  2R4Y A;  3ZOM A;  6HBW A;  4HBI A;  1QSI B;  2ZSR A;  1CG8 A;  3QZZ A;  4SDH A;  1OR4 A;  1CBM A;  2D2N C;  3HHB B;  1J52 A;  4L7Y B;  3E5O A;  3NMM A;  3WR1 A;  1IT3 A;  2O5B X;  5EUI A;  5JGG A;  1A01 B;  3HF4 B;  5C6E A;  3SDH A;  3UI0 A;  3GQG A;  3ZJR A;  3A5B A;  3BCQ A;  3ZHW A;  2NSR A;  3A2G A;  2HBC A;  1ECA A;  1RQ3 B;  1JL6 A;  4MAX A;  5CNC A;  1ABY B;  3QM5 A;  4MQC A;  2D60 A;  4AVE A;  1MYT A;  1Y5F B;  2V1E A;  2MGA A;  4BJA A;  1YGF A;  1Y22 A;  1MOA A;  3DUT A;  3GDJ A;  1Y8H A;  1MLG A;  3G52 A;  3QJE A;  1UIW B;  1MYJ A;  5EOH A;  2E2Y A;  2XKH A;  1C40 A;  1Y5J B;  4IT8 A;  1BVC A;  1A6G A;  3OZW A;  1FSX A;  5SW7 B;  1BZR A;  4NXA A;  2DHB B;  1M9P B;  1HBB B;  3UHW A;  1RQA B;  3DR9 A;  2IG3 A;  3VHB A;  2QLS B;  3WI8 A;  3WCV C;  2QFN A;  1YEN A;  1C7C A;  3ASE A;  3PIA A;  1Y5K B;  4NXC A;  3VRE B;  2GRH A;  4MQI A;  1LFQ A;  1JZL A;  3WTG A;  3GQG B;  3WCU C;  2QSS A;  2MGI A;  2Z6N A;  2Z8A A;  5CN7 A;  4B3W A;  2LH1 A;  2O5S X;  2FRJ X;  3WCP A;  3ZJJ A;  2D5Z A;  1Y0T A;  1G08 B;  1CH2 A;  1XZ5 B;  1LH1 A;  3WCU A;  1MBN A;  4WCH D;  3HXN A;  3CY5 B;  2ZLX B;  1GDK A;  1Y4R B;  3S65 B;  1HBA A;  2B7H A;  1IT2 A;  1SPG B;  1QI8 A;  3VRF A;  1VXE A;  2D2M D;  1IRD A;  5HLQ A;  2ZFO A;  1YIH A;  4MQC B;  4NI1 A;  3A0G B;  1S61 A;  1F63 A;  2HHD B;  2ZWJ A;  2ZFO C;  1TU9 A;  1YEU B;  3UBV A;  5CNF A;  1LJW A;  3GKT A;  1BZ1 B;  1DLY A;  4TWV A;  3HYU B;  1GBV A;  4DC7 A;  2HZ3 A;  1Y7G B;  2MGM A;  4XS0 A;  3SZK B;  2ZSP A;  1CO8 A;  1YVQ B;  2R1H B;  1YH9 A;  1GDJ A;  1X9F B;  3S1J A;  2O5T X;  3AG0 A;  1Y8W A;  2D5Z B;  3WCV D;  1Y0C A;  4X0L A;  2BKM A;  4OF9 A;  1NZ4 A;  4NI0 B;  1DWR A;  3M3B A;  2VLX A;  1X9F D;  5CNG A;  1IOP A;  1XZ2 B;  1LH7 A;  3H57 A;  109M A;  1N9F A;  1MYI A;  4HHB A;  4OOD A;  3UBC A;  1J7W A;  3R0G A;  1GCV B;  2ZLT B;  4MXK A;  1CP5 A;  1V4X B;  1YHU C;  3GQP A;  1HBS A;  1MWD A;  1S0H A;  1O1J A;  3WCW C;  1GJN A;  2V1I A;  2EKT A;  3GKV A;  5HU6 A;  1YDZ A;  1SDK A;  1V4W B;  3IXF A;  4XDI A;  5EUI B;  1MBS A;  4G1V A;  4KN3 A;  4ESA B;  1MNO A;  1XZ7 A;  1HCO B;  2ZLW A;  3AQ7 A;  1MTK A;  5KKK A;  1LH5 A;  2BMM A;  3G53 A;  1A0Z A;  5JDO E;  4TYX A;  1IRC A;  1UC3 A;  1URY A;  1O1I A;  4MU5 A;  1ABS A;  3CIU B;  3A5A A;  1AJG A;  3RJN B;  3ZJL A;  1LH2 A;  3D1K B;  4F6G A;  3PI9 A;  1CO9 A;  2BLJ M;  1J7S A;  2ZS0 D;  5EE4 D;  1YHU B;  1YH9 B;  2LH3 A;  4FC3 A;  5MBA A;  1Y0A A;  4KMV A;  2AUQ A;  4NK2 A;  1VRE A;  3D4X B;  2D60 B;  4X0L B;  1D8U A;  2DN3 A;  1EWA A;  1LHT A;  1UMO A;  1YOH A;  3FH9 A;  1MKO A;  1BZZ B;  2GNW A;  2HBD B;  4N8T A;  3D17 B;  4MQH B;  3ZJS A;  3KMF A;  2ZLT A;  1YEN B;  2HHE B;  5JGG B;  1O1O A;  1S0H B;  4U8U B;  2RAO B;  1GDL A;  4HRT B;  1CMY B;  4MQI B;  4M4A A;  2W6V A;  1MBC A;  1A4F A;  3AQ8 A;  1Y0T B;  2VM0 A;  1HBG A;  5HAV A;  3WCW D;  4ROM A;  2DN1 A;  1XXT B;  110M A;  3OO4 A;  2HCO A;  1HBA B;  1LFL B;  3QMA A;  3LQD A;  4F69 A;  3BA2 A;  1JF4 A;  1O1K B;  2Z6N B;  2W72 B;  3TLD A;  4UIQ A;  3GYS B;  102M A;  4FC3 B;  1O1M A;  1VXD A;  2W31 A;  1RTX A;  1LFV B;  3QJD B;  1OR6 A;  1DXV B;  1HGA B;  1JPB A;  4C44 A;  2QMB A;  2AUO A;  1V07 A;  1YCA A;  1Y4V B;  1YGD B;  1RQA A;  1MLK A;  1CG5 A;  1CG8 B;  1OUT A;  1CLS A;  1SHR A;  2AA1 A;  4ILZ A;  1GBU A;  4ODC B;  1MNI A;  1XY0 A;  1GLI B;  1BIJ B;  3G4R A;  1YMA A;  1RPS B;  4N7O B;  3VRG B;  2ZT4 A;  2V1G A;  4C0N A;  1SPG A;  1ABW B;  1MLN A;  3PI8 B;  3G4Y A;  1S5Y B;  2VYW A;  4H07 A;  1V4U A;  2FAM A;  3D1A A;  1ASH A;  1X9F A;  1G08 A;  2HHD A;  2ZSN A;  4H0B A;  1XZ2 A;  4JYQ A;  1HBI A;  2G14 A;  3PT8 A;  1UFP A;  3UHY A;  3MJP A;  1U7R A;  3V2V A;  4FH7 A;  4XS0 B;  2D2N D;  1VWT B;  3BOM B;  1A00 B;  4N7P A;  3A59 B;  4U8U C;  1FN3 A;  1O1M B;  1BAB A;  1G9V A;  2VLY A;  3WFT A;  5KDQ A;  2H8D A;  2ZFB B;  1C7D B;  1JP8 A;  1MNJ A;  5C6Y A;  3OGB A;  3ZJM A;  3BJ2 A;  1XQ5 B;  1Y8I B;  1YFF A;  1YGD A;  3DHT A;  1SDK B;  4ROM B;  1T1N A;  2DN1 B;  1QXE B;  1DUK A;  4NI0 A;  3ARK A;  1ITH A;  1Y4P A;  3GKV B;  2VYZ A;  1Y2Z A;  1XY0 B;  1XZV A;  1Y35 A;  3GYS A;  2W72 C;  1HBH B;  5JDO D;  1CPW A;  1C40 B;  1Y5J A;  1NS6 B;  3SZK A;  1CP0 A;  2AUP A;  1HCO A;  2ZLW B;  3EU1 B;  2R80 B;  3TM9 A;  1Y0W A;  2ZS0 A;  2AV0 A;  3OVU C;  1MLM A;  3K8B B;  3P5Q A;  5F2A A;  5B85 A;  3UHV A;  1Y83 A;  2OH9 A;  3RGK A;  4F6F A;  3GQR A;  1W92 A;  4G51 A;  2GTL A;  3H58 A;  3ZJI A;  2GL3 A;  1R1Y B;  3WCT A;  1Y0A B;  1BAB B;  3ECZ A;  1DWT A;  1G9V B;  3UH5 A;  3LB2 A;  3QJE B;  3U3E A;  1B86 B;  3GQP B;  1K1K A;  5IKS A;  1H1X A;  5EYS A;  2ZLU A;  3BJ1 A;  1HAB A;  1FAW B;  2HHB A;  1YZI A;  2NRL A;  1YDZ B;  3UGZ A;  1Y4P B;  4G1B A;  2HZ2 A;  2VLZ A;  3PI2 A;  1G0B A;  5CND A;  3LB1 A;  3HRW B;  4YU4 A;  3A9M A;  4U8U A;  1THB A;  2ZST A;  3S48 C;  2G0X A;  5HLX A;  1C7C B;  3QZX A;  2ZT2 A;  1MLJ A;  3EU1 A;  1YHR A;  1MZ0 A;  2H35 B;  2HBD A;  2PEG A;  1Y4G A;  3CIU A;  2OIF A;  3WHM B;  1VHB A;  2JHO A;  1BZZ A;  1YEV A;  3B75 A;  1HRM A;  2RAO A;  3QJB A;  1JEB B;  4F68 A;  3ODQ B;  2MHB B;  1J3Y A;  1YG5 B;  1NWN A;  2VRY A;  1SPE A;  1DXC A;  1Y0C B;  1WMU A;  4N7N B;  5CN4 A;  1R1X A;  1CBL A;  3O89 A;  3E55 A;  1GBU B;  4ODC A;  1NIH B;  3FH9 B;  2MGK A;  2MBW A;  1JW8 A;  4O1T A;  104M A;  1YVT A;  2R4Z A;  1IDR A;  3DHR B;  2MGC A;  3WFW A;  1MOH A;  1DXV A;  3UHG A;  1HGA A;  1MYF A;  3KUN A;  3WCU D;  1Y7G A;  3OZU A;  1L2K A;  3PI8 A;  3PT7 B;  1V9Q A;  1O1N A;  1A4F B;  1MOC A;  1HHO B;  1XYE A;  3ZOL A;  4MPM A;  1YOG A;  1Y4Q A;  1Y4B A;  1QSH A;  3MYM A;  2NX0 A;  3AT6 A;  1OJ6 A;  3DUT B;  2ZSX A;  1WLA A;  112M A;  3WHM A;  1VWT A;  2SPM A;  1YEO A;  1S69 A;  2HBF B;  3QJC A;  3WCW A;  3ZH0 A;  1A9W E;  5HLU A;  3ZJP A;  1CIK A;  4PQB A;  3SDN A;  2VEE A;  1CH7 A;  1LFV A;  3QJD A;  1QXD A;  1TES A;  1MBA A;  3MJP B;  1GCW A;  4MXL A;  4NZI A;  1NS9 A;  1S56 A;  4H2L B;  4IRO A;  1AJH A;  2MGH A;  2MYA A;  4ZVA A;  1QXE A;  2D2M C;  3D7O B;  2HBS A;  1RQ4 A;  1YG5 A;  3QQQ A;  4PNJ A;  5JOM A;  1YEQ A;  1ABW A;  4MQG B;  3PEL B;  2Z6S A;  5CN9 A;  1V4U B;  1FHJ B;  3QM7 A;  4HRR A;  1Y7D A;  1COH B;  4M4B B;  3UHS A;  1A6N A;  3WCT C;  2NRM A;  4DWU A;  2H8F A;  5E83 A;  1MKO B;  2FRI X;  1KR7 A;  1Y46 B;  105M A;  2BW9 M;  1X9F C;  1O1I B;  3GQR B;  1KD2 B;  3LHB A;  1DXT B;  1O1O B;  2HBE A;  1QSI A;  2V1H A;  1K0Y B;  1O1N B;  5ILE A;  1MOD A;  1YHU A;  1Y4B B;  1Y7Z B;  1J40 A;  1J41 A;  1BJE A;  3UH6 A;  1T1N B;  2EB9 A;  2VHB A;  1A0U A;  1Y2Z B;  1CH5 A;  2RI4 A;  4MQK B;  5EE4 C;  1RQ3 A;  1B86 A;  5B84 A;  2ZSS A;  1O1L B;  2AUR A;  1YOI A;  3BCQ B;  1A3O A;  2G0R A;  2MYB A;  3MKB A;  1RVW A;  1S5Y A;  3M39 A;  1HDA B;  2PGH B;  2YRS A;  1N9H A;  1UT0 A;  1Y22 B;  5HY8 A;  1VRF A;  106M A;  2V1F A;  1Y5F A;  107M A;  4UZV A;  1VXF A;  1Y83 B;  2R4X A;  3UHR A;  3D7O A;  1RQ4 B;  1LFZ A;  1Y4G B;  2NSS A;  3BJ3 B;  5E6E A;  1A3N B;  1A01 A;  1XCH A;  3HC9 A;  5D5R A;  1YHR B;  3A59 A;  1FCS A;  2HBG A;  1MLF A;  3ORD A;  1FSX B;  1N9I A;  1IBE A;  1HGB A;  2EF2 A;  5CNE A;  2ZT3 A;  1BUW A;  2V1K A;  4B4Y A;  2ZLV B;  3HXN B;  3NG6 A;  3QJB B;  3NMM B;  1JEB A;  4F6B A;  1R1X B;  3MYN A;  5EQM A;  4VHB A;  2GKM A;  2RI4 B;  2GNV A;  1BZP A;  1G09 A;  2G10 A;  3M38 A;  1O1P B;  101M A;  2BLI A;  1BZ6 A;  3IA3 B;  1HBR A;  1CIO A;  1WMU B;  3KUO A;  3QM8 A;  1Y4Q B;  1Y0W B;  1M6C A;  1G0A B;  1Y4R A;  3PT7 A;  2DN2 A;  1QPW A;  2LH5 A;  1F5P A;  2Z6T A;  2D2N A;  3AT6 B;  1NPF A;  2D2M A;  1BVD A;  1HBH A;  2M6Z A;  3DHR A;  1QI8 B;  2G3H A;  1MLU A;  4DWT A;  2QSS B;  3ECL A;  3NFE A;  1QXD B;  2MGD A;  1NEJ A;  1FN3 B;  1LJW B;  1NXF A;  5CHQ A;  1VXB A;  1MWC A;  1BIN A;  1Y7C A;  3WR1 B;  4GZG A;  5E6E B;  3QM6 A;  1J3Z B;  1MLO A;  3UHU A;  3UHX A;  1Y85 A;  2LH7 A;  2VYY A;  1YE2 A;  1CMY A;  2O5M X;  4JAC A;  1UFJ A;  1NPG A;  5E29 B;  1C7B A;  1IRD B;  1FDH A;  1MLH A;  1FHJ A;  1F65 A;  2MGE A;  1MNH A;  2QFK A;  2DN2 B;  3GOU A;  2MYE A;  3HHB A;  5ILR A;  1BZ0 A;  1MYZ A;  1EMY A;  3P5Q B;  1MBI A;  1JF3 A;  1MBO A;  2M6Z B;  1CH4 A;  1HV4 A;  4DC8 A;  4F6D A;  2ZFO B;  4O4Z A;  2DHB A;  4MQG A;  3NFE B;  3S66 A;  1DKE B;  2G0Z A;  5CNB A;  5JDO C;  3UHH A;  1AZI A;  3E4N A;  1DWS A;  5CN8 A;  2KSC A;  1XZ7 B;  1BZ1 A;  1FLP A;  1NWI A;  1Y5K A;  5M3S A;  1YEV B;  1JP9 A;  1FAW A;  2HHB B;  2ZLX A;  1YVT B;  1S6A A;  1YMB A;  2IN4 A;  3MVC A;  5C6E B;  1Z8U B;  3UHC A;  1GCV A;  1J40 B;  1HJT A;  3GK9 A;  1GZX B;  1M9P A;  2HBC B;  2SPL A;  1YE0 A;  1YIH B;  2D5X A;  3G4V A;  3O7N A;  3D1K A;  2OHB A;  1A00 A;  3S65 A;  1A6M A;  1JL7 A;  1URV A;  1A3O B;  4TWU A;  2BNL A;  1B0B A;  1V4X A;  4QAU A;  2PGH A;  2YRS B;  4NK1 A;  2WTH A;  1FSL A;  1EBC A;  1XQ5 A;  3MKB B;  1YVQ A;  1A0Z B;  1HDA A;  1V4W A;  1BBB B;  2LHB A;  1XZV B;  1LFY B;  3BJ3 A;  3ED9 A;  1HDB A;  2C0K A;  2MYC A;  1XZU A;  4H2L A;  2AV3 A;  4IRO B;  3WCU B;  3MOU A;  1HV4 B;  1XZ4 A;  1MYG A;  1A3N A;  3G4W A;  3QQR A;  1HLB A;  2QMB B;  2ZLV A;  1Y4V A;  3VRF B;  5ILM A;  1O1J B;  4AVD A;  5AZR A;  4FWZ A;  1LFT B;  2LH2 A;  1PMB A;  3WCT B;  3UH3 A;  1EW6 A;  4N8T B;  1V5H A;  1YEU A;  1LFL A;  4UUR A;  3NL7 B;  2OH8 A;  1K1K B;  1SI4 A;  1OUU B;  1YEO B;  3PEL A;  1DO4 A;  1V75 B;  1HAB B;  2W6W A;  1OUT B;  5EYJ A;  1J7Y B;  1NGK A;  3EDB A;  1ECO A;  1JDO A;  1Y4F A;  2BK9 A;  3OJ1 A;  1MWB A;  1HAC A;  1BUW B;  2G0V A;  2EVP A;  5MBN A;  2ZSO A;  4MBA A;  1IWH A;  1A0U B;  3HYU A;  1O16 A;  1G09 B;  4N7O A;  3VRG A;  2DXM A;  1SDL A;  2ZS1 D;  4M4A B;  1YHE A;  2QSP A;  1JY7 A;  2EKU A;  2R1H A;  1MGN A;  4ROL B;  5HU6 B;  1Y0D B;  1MLS A;  1C7B B;  1I3D A;  2FRK X;  1DXU B;  2O5Q X;  1M6M A;  5KER B;  2ZSQ A;  1LUE A;  4O4T A;  1YE2 B;  2HCO B;  3G46 A;  4KMW A;  1J3Z A;  2W72 A;  1CQ2 A;  2W6Y A;  5E83 B;  1MBD A;  4HHB B;  1DO3 A;  2O5O X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...