1NY9A

Antibiotic binding domain of a tipa-class multidrug resistance transcriptional regulator
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
WQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGYEMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for antibiotic recognition by the TipA-class of multidrug-resistance transcriptional regulators
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Transcription
molecule keywords Transcriptional activator tipA-S
total genus 30
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07739 TipAS TipAS antibiotic-recognition domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.50 Mainly Alpha Orthogonal Bundle Globin-like Antibiotic binding domain of TipA-like multidrug resistance regulators 1ny9A00
1NY9A
chains in the Genus database with same CATH superfamily
3MBAA 1LFVB 3QJCB 1AZIA 1F5OA 4JYQA 3HRWB 1LIAA 1DWRA 1M6CA 1B8DA 1C7CA 3VRFA 5JDOD 1HCOB 2HZ2A 1Z8UB 2C7KA 5CN9A 1YE0B 1VWTA 3EDAA 1GH0B 1GCWA 3BRPA 1ALLB 4MAXA 1Y4FB 4Q70A 3NMMB 4FH6A 5HU6A 104MA 1GJNA 1O1KB 2DKCA 3A59B 2B7HA 2VLZA 4FWZA 1CPCA 4WCHD 1X3KA 1DXUA 2HZ3A 4H2LA 1ON7B 3QM6A 2MGKA 1QSIA 3IC0A 1CLSB 1DTMA 2OH8A 2EB8A 3LR9A 3P5QB 1I7YB 4N8TA 4LPIA 3ED9A 3DUTA 3SDNA 1V4WB 1URYA 5EQMA 1IT3A 1YDZB 3CY5B 1MYZA 1YHRA 1IRDB 1LFYA 3WI8A 106MA 3WCTA 1MOHA 3PT7B 5D5RA 2ZS1B 1HHTP 1OUUA 1UVYA 4MQHA 3AT6B 3KVSA 1BUWA 5HBIA 3IC2B 1V9QA 3O18B 1FSXA 5EU2A 3RQRA 1LFQB 1J7WB 2HHDB 3NFEB 4YU4B 1CH9A 1VXCA 1F99A 2RI4A 1LH2A 1A0ZA 4A8YA 1RVWB 1Q1FA 2R80B 5JOMA 1B8DB 1C7CB 1DKEB 1JP8A 2G0XA 2HBCB 1SI4B 2MB5A 3NL7A 1CMYA 3GDJA 1A3OB 2ZLUB 3ZJJA 4MXLA 4F6BA 3KMFA 4F69A 3IC2A 1MKOA 1LH7A 2ZLVB 2I88A 1G0AB 1YHEA 1DLYA 2W72C 1S5XB 1YEOA 4F6JA 3LB1A 1A0ZB 1FCSA 1GCVB 1LJWB 2BMMA 1Y5KA 3D1KA 3A5AA 4MPMA 2HBEA 4XXIA 1UVIA 1MDTA 1QXDB 1IDRA 1YCAA 3E55A 1CP5A 3PI2A 1EWAA 2G0ZA 3GQPB 2GRHA 1Y4PB 4ERTA 3A5GA 4ODCA 1A6KA 1WACA 3UI0A 1NQPA 3HC9A 1LH3A 3QJBA 1LTWA 1IBEB 1YEUA 4TMAB 2JL9A 2ZLWB 1BJEA 2UUND 1V75B 1MBAA 3MJPB 2D2NA 1CG5B 1CG8A 5JGGA 1X9FC 1BZZB 3R5IB 4MBNA 3NUHB 3ORDA 1MKOB 1HCOA 1HGBA 1JZKA 1XZVA 3DHTB 1Y4GB 1XZ4A 3CIUB 2M6ZB 4OF9A 4NXCA 1BZPA 3ZJRA 1YIEB 2DKAA 3RGKA 3QJEA 4HRRA 1LH1A 1FN3B 3L0FA 1Y4VA 1XYEA 1YZIA 1O1JB 1ABYA 2ZFOA 1IOPA 5MBNA 2VEEA 3A59A 1MYFA 3AQ6A 1F99B 2JLGA 4TYXA 4C44A 1DWTA 3OO5A 4UIQA 3IC0B 3UHVA 1HABB 2O5QX 2PGHB 2M6ZA 2NRLA 1XZ2B 2GTLB 3M38A 2EKTA 1QSHA 4B4YA 4NI1B 2ZSXA 1MBNA 1Y7GB 5B84A 2W72A 4L2MA 4LMXB 1XZ7A 1MBDA 3UBCA 1UX8A 1HJTA 2GL3A 2MGFA 4F6GA 2VJRB 1FDHG 3UH6A 4ETUA 1DUOA 1YHUD 1LFLA 1YEOB 1MTKA 2HBFB 2V8AA 3G4RA 2D2MA 1XXTB 2HBSB 2BV8B 1JP6A 1KTPB 1CBMA 1Y4PA 1HACA 1LHSA 2R4XA 1MOCA 3QZZA 3UHXA 1YEQB 2EVKA 1HBHB 2GTLD 2ZFOC 3MVCA 2MBWA 1YEVB 3OZVA 1X9FA 3D7OB 1Y4FA 2H8FB 4M4BB 1Y8WA 3M3BA 1MBSA 2GLNA 2LH1A 2W6VA 2MHBA 2JLFA 1NEJB 2EB9A 3ECLA 3AQ7A 1NZ5A 1Y31A 1Y01B 2H8DB 1Y7CB 1XY0A 1NY9A 1CLSA 3LB4A 3UHKA 1BABB 1HDAA 1H97A 3LQDA 103MA 1Y35B 3FH9A 4MXKA 5C6YA 1CPCB 1Y0AB 3ZJPA 1A87A 2D2MC 1YZIB 2DXMB 2OLPA 1LFZA 4MQGB 2WTHA 5EV5A 1Y46A 1FN3A 5EUIA 2ZSOA 1B86A 2GRFA 3G52A 1N9FA 1HV4B 3FS4B 3NG6A 1Y0DB 2G3HA 2V1EA 4MU5A 1WLAA 1Y8KA 3LB3A 2ZS1A 3D4XA 1R1YA 1BZ1B 1QPWA 3LHBA 5CMVA 2W6XA 4ROLB 2LH3A 5E83A 1C7BA 3D1AB 5HY8A 1Y0TB 3LB2A 3V58A 1CH4A 4U8UB 3OJ1A 2WY4A 1DUKA 2MGMA 2QSSA 3O2CB 5FVBM 1A6MA 3ZJQA 6HBWB 1YE0A 4F4OA 3PI1A 1S61A 3ECXA 3S65B 2MYBA 4HSXA 2LH7A 5CNCA 2XKHA 3PMDA 1VXEA 2HBDB 4DC7A 5F2AA 3QJEB 1BVCA 1MLJA 1Y8WB 1BIJB 111MA 110MA 2PEGA 1SDKA 3GUQA 1A4FB 4XS0B 5AZRA 1Y2ZB 1Y8IA 2Z6TA 5EYSA 2KSCA 3PIAB 4FH7A 1EBCA 2ZS1C 1Y5KB 2G10A 2WCRA 3WCUD 1LH5A 4N6SB 1GZXB 2Z85A 4A8QA 1HSYA 4B3WA 2VYZA 4M4BA 1G9VA 1VXGA 1JWNA 1Y85A 1NIHA 2J96A 2ZLVA 1YE2A 3QZXA 2GKNA 1O1PA 2VJTB 2DN1A 4MQCA 1MLUA 3GOUA 1KFRA 1FAWA 1V5HA 3VREA 1Y45A 3W4UB 7HBIA 1HBIA 3QM7A 1BZ0B 5E6EB 1URVA 3HHBA 1RSEA 3BJ2A 4N7NB 1LFLB 1ECDA 2HBSA 2R4ZA 101MA 1YHUC 2BKMA 2BW9M 2O5BX 3ONZA 2GNVA 1DXDA 3GLNA 1Y5FA 3PI8A 3WCUA 2G12A 3MJPA 1ECOA 1GLIA 1B86B 3G4YA 2FALA 2VJRA 1M9PB 1NWNA 2YRSB 1JY7A 1N9XA 1NS6B 2ZFOD 2FRKX 3WCTD 1HBGA 1HGCB 1MLLA 3MYNA 1KTPA 2MGHA 4F6IA 3ECZA 1YH9B 1QGWC 1DXCA 5ILRA 4A8FA 2DN2A 5JDOE 3WR1A 107MA 4Z8KB 1UVNA 5AZQA 1O16A 1DXUB 1ABYB 3VHBA 3PI9A 1N9HA 3ZTAA 5CHRA 1C40B 1Y09B 3V57A 1HBSA 3S1IA 3UH7A 1XQ5A 2SPMA 1MCYA 1MNIA 1B0BA 2BLHA 2C7JB 1MNHA 2AA1B 3UHIA 2ZSZA 3VAUA 1CIOA 1OUUB 1BBBB 2OIFA 3SDHA 1YOGA 1V4XA 2MYCA 2ZS0C 4NXAA 1XXTA 1PHNB 3UHDA 5HU6B 2W31A 4MQGA 4NS2A 4ROLA 3AT5B 1HA7A 2G0VA 3ODQB 1GBVA 4UURA 1YENA 2DN2B 5E83B 2LHBA 2SPOA 2MYEA 1NS9B 3GKVA 1UMOA 1GBUA 5HAVA 2QU0A 3UH5A 3TLDA 3MJUB 4LM6B 2ZS0B 1THBB 1W92A 1MYIA 2ZT2A 3AQ5A 4DC8A 1YIEA 1YG5A 4F0TA 1MNOA 1YDZA 1J7SB 3OK5A 1AJ9B 2UUMB 3FEWX 3G46A 3OVUC 1NEJA 1YFFA 3A5BA 3LQ9A 1J41B 2HHBB 1PMBA 1O1IB 1O1NA 2O5OX 3WCVB 1MYMA 2QSPA 4YU3A 5AQDM 2ZLTB 4PNJA 3D17B 4A8WA 1ECAA 1S5XA 3UHQA 1CH1A 5B13G 3K3UA 4Z8KA 3HRWA 1KR7A 1Y4BB 2ZSYA 3WFXA 2FRJX 4F0UA 4WJGA 1A9WA 1HBHA 2D2ND 1UT0A 4OODA 5CHQA 1C7DB 1YMBA 3WCPA 2ZT3A 3ZJMA 5E6EA 108MA 3HYUB 4B02A 2QSPB 4YU3B 3MWNA 1MBCA 1I7YA 4AVDA 1CG5A 2ZLTA 2QRWA 1YGDB 2DN1B 1K0YA 1YVTB 1DDTA 4GZGA 1SPEA 3ZH0A 4KMWA 1Y4BA 4ROMB 1PHNA 1KD2A 1PBXA 2OHAA 4HSWA 2AUQA 1Y4RB 1Y4VB 3HHBB 4BJUA 1QXEA 1LFTA 1I3DA 3DHRB 1MNKA 1Y7ZA 4MBAA 4NK2A 3QQQA 2Z6SA 5HLXA 3B75B 3MJUA 5D1VA 4L1EA 2DN3B 1G08A 1NXFA 4MQHB 1BUWB 3E4NA 3KVSB 1C7DA 3WCWC 5C6EB 1SWMA 1T1NA 1YG5B 3E5IA 4Q70B 1Y8KB 4ETVA 1YGFA 1MODA 1B33A 1GDIA 2HHDA 2ZT1A 1SDKB 5JGGB 1JEBA 3FS4A 5FVBA 1LHTA 1S6AA 2AV0A 5EOHA 3ZJNA 2SPLA 1Y7ZB 3PT8B 3KUOA 3UHTA 2UULC 3RJ6A 1FLPA 1PBXB 3EOKA 1OUTA 2R1HA 3V2VA 4ESUA 4HHBB 4XDIA 1Y5JB 1CG8B 2Z6NA 3H58A 1MLFA 2B7HB 3V57B 3MKBB 2GDMA 1C40A 3PI8B 1S56A 1DO7A 2QFKA 3TM3A 3VRGB 3HF4B 1S0HA 1HGBB 1HACB 109MA 2MGEA 1XZ5A 2VRYA 3D17A 1JY7B 4PQ6A 1O1MA 1LFYB 4MQKB 1UVLA 1ABWA 2AV3A 1CBLA 1CO8A 1MLOA 3UHSA 1RQAA 2ZFBA 2VEBA 1NPFA 4F0UB 3CY5A 1HI0P 1RTEA 1JW8A 1IBEA 1K0YB 2LH5A 3WCPB 1YVQA 1YENB 1HLMA 1A00B 1Y4RA 3UHCA 1S0HB 1FHJA 2C7KB 2VMLB 1CH7A 1VXBA 1A0UB 4LMSB 2ZSTA 4L7YA 1Y0WA 3WCVD 1XDTT 4GXEA 2D5XB 4O2GA 3V2ZA 2HHEB 3K8BB 1R1XB 3QM5A 4PO5B 1MOAA 1D8UA 2GRZA 3UHBA 1J40A 2ZSPA 3ARKA 1SHRB 1LFQA 2ZSQA 3UHHA 5HLUA 1L2KA 5ILEA 3UHWA 2G0RA 4MQKA 1Y45B 1V4WA 1ON7A 2HBCA 1MLKA 1DKEA 5JDOC 2AA1A 5E29A 4HH0A 2QSSB 3O2CA 2V1KA 4KJTA 3DR9A 4NI0A 1OJ6A 1YHUA 1X46A 3BOMB 1O1OB 4G51A 4KN3A 3IXFA 5KERB 1ECNA 3E5OA 2AURA 1YGDA 1HA7B 1J3YA 1MLQA 4HHBA 2ZS0A 2O5LX 3AT6A 1A6GA 1NS6A 3QQRA 2RAOB 4ZIZB 1GBUB 1SPGA 3PELB 1YH9A 2XKGA 5EETA 2HCOB 3GYSB 3PIAA 1NGKA 1XG0C 4RMPB 2QFNA 1EYXA 2WCQA 1VWTB 2NRMA 3WCUC 5SW7A 3WFWA 3DBJA 1UVMA 5KDQB 1YE2B 1JBOA 1J3YB 1S5YB 1G08B 2EKUA 1V4XB 3MYMA 3A2GA 112MA 3ZOLA 1EMYA 1YHUB 3UHNA 2LH2A 5M3SA 1GCWB 1J41A 1MWCA 2QMBA 1HI8A 3ZJHA 5MBAA 1J52A 4YJJB 1QPWB 1CH2A 4X0LB 1BBBA 4MQIB 1U7RA 1UFPA 3MN0A 3GOUB 3QMAA 1LH6A 2MYAA 5EE4C 1BABA 1YEVA 1K1KA 3ZOMA 1FHJB 1I3EA 3GQGB 1MWDA 1NQPB 1HBBB 1TESA 3BJ2B 4N7NA 1UC3A 2DXMA 4IROB 4DWUA 2VM0A 1QXDA 1HGCA 2R50A 5CNGA 2D5ZA 3WR1B 4MQIA 2LH6A 1M9PA 5KERA 1YEUB 2GNWA 2VYYA 4O4TA 1BZ1A 4AE0A 3QM8A 3WFUA 1HBBA 2BLJM 3GQGA 2ZLXA 4N7OA 1MLHA 3NG6B 1HHOB 2D60B 4WJG1 3EU1B 2HHBA 105MA 3S66B 1BZ0A 1H1XA 1N9IA 2HCOA 1NIHB 3U3EA 1JP9A 4F4OB 1YEQA 3PI9B 1MLNA 2HHEA 1UVXA 1JPBA 2D5XA 2CMMA 1JF4A 1U7SA 2H8FA 4VHBA 1XZ2A 2GTLA 4ILZA 2C7LA 3OO4B 1B33B 1HDSA 1QI8B 1SI4A 1MBIA 4F68A 2ZLXB 2V1GA 3WCWA 3ZJLA 1J3ZA 1YMCA 5CNBA 1A4FA 1NS9A 3GKVB 2IG3A 1BIJA 2OH9A 1GDKA 4N7PB 2SPNA 1JBOB 4ESAA 1XY0B 1GLIB 2ZT0A 1O1OA 1QSHB 1NZ2A 4UZVA 2W6YA 1Y83A 1SHRA 3ARLA 2C7LB 3NMMA 3M39A 2IN4A 5CN8A 3UHYA 1G0BA 5E29B 1HV4A 2HBFA 1BVDA 2ZSNA 3QJBB 1RQAB 1Y4GA 4U8UC 3PELA 2D5ZB 1YMAA 1VHBA 3GKTA 4F6FA 4RMPA 3WHMA 4ESAB 2VJHB 1O1PB 3BA2A 6HBWA 1Y7DB 2H35A 1G09A 1OR6A 3GIOA 1X9FB 3D7OA 4C0NA 3GQRA 5SW7B 4ZIZA 1SDLA 1DO1A 1DXTB 1Y0TA 1XZUA 2BNLA 4H2LB 2XYKA 3GYSA 1J7YB 3NL7B 4PQCA 2VMLA 3BJ1B 4PQBA 4ETTA 1RPSB 1GCVA 2VLYA 4G1VA 3S66A 1HDBB 4H0MA 2BK9A 3VRFB 1RQ3B 3O7NA 4GXEB 2UULA 1J3FA 2R4WA 2GTLC 5AQDA 1CQXA 1OR4A 2GKMA 5KKKA 3MKBA 3LQDB 1M6MA 1TU9A 2Z6NB 3O18A 1F65A 1HHOA 1VXDA 2D60A 1FSLA 1LFZB 1SGKA 1UIWB 5IKSA 2V1IA 2OHBA 1CQ2A 3AQ9A 2UUMA 5CN6A 3UHRA 3PT7A 1GDLA 5ILPA 4YJJA 3R5IA 2UULH 2H35B 2V8AB 1GDJA 5ILMA 3CIUA 3HXNB 3G4VA 2VJTA 3D4XB 3WTGA 2V1JA 3G4QA 1LFTB 2D2MD 3DUTB 1DTIA 5KDQA 2Z8AA 4HRRB 2QLSB 3AT5A 1JL7A 1XZVB 2HZ1A 3DHTA 1JEBB 1MOBA 3A0GA 1V4UA 1QSIB 1DM1A 3D1KB 1A01B 4TWUA 1NPGA 3OO5B 3R0GA 1MDNA 3PT8A 1JL6A 3BCQB 1ITHA 5CN5A 2R1HB 2FRIX 3EOKB 1S5YA 5CNEA 1Y22A 2VYWA 2VLXA 4HRTA 3VRGA 2NX0A 4AE1A 1MLMA 2DKDA 2DHBB 4NK1A 1BZZA 2ZT4A 2WTGA 1IT2A 1UVKA 3GQPA 3BRPB 1JDOA 1GH0A 1IWHB 1V75A 1ABWB 1O1NB 3B75A 1A6NA 2ZLWA 5JDOF 2D2NB 1DXVB 1MGNA 1AJGA 3HENA 1BINA 1YVQB 1A01A 1HLBA 3L0FB 1T1NB 1EW6A 4FC3A 1Y8HB 4A8SA 1MWBA 1R1YB 2DN3A 3OGBA 2ZSRA 3HYUA 1COHB 2H8DA 1NAZA 3ASEA 5C6EA 3K8BA 2EVPA 1X9FD 2MYDA 1MYTA 4QAUA 3UBVA 3HEPA 2MHBB 4M4AA 3ODQA 3AG0A 1YVTA 1A3NB 1UX9A 1YIHA 2AUOA 1YHRB 2V1FA 1LJWA 1FSXB 3IA3B 4HBIA 1MTIA 1V4UB 1MZ0A 1Y0CB 3DHRA 3WCTB 3UHZA 1RPSA 3OZWA 1RQ4B 5EYJA 2R4YA 1HDAB 3BJ1A 2UUMX 4H0MB 2VJHA 4N6SA 2R80A 1DO3A 2ZFBB 1ABSA 5CNFA 4ZVBA 4F6DA 1LA6B 2ZWJA 1UFJA 1CMYB 3NFEA 1Y85B 3HEOA 4XS0A 1DXTA 1TOXA 3BJ3A 1Y09A 2NSRA 1RVWA 4SDHA 2RI4B 4A8KA 4BS9A 2D2MB 2UULB 3K9ZA 2DHBA 3WCVA 3WCTC 4O1TA 1O1IA 1VXFA 3H57A 3RJNB 1VREA 3KUNA 3P5QA 2O5TX 1A3OA 2ZLUA 1MNJA 2AUPA 1EYXB 1IWHA 3ONZB 4GY3A 1HGAA 2QU0B 1Y5JA 3WHMB 1SPGB 1GVHA 1MYJA 1AJHA 4NI1A 1HBAA 1G09B 2ZFOB 2MGAA 1GBVB 3QJCA 4O4ZA 3NMLA 1Y4QA 1IRDA 3ZHWA 1CPWA 1SDLB 1V07A 3SZKB 3ZJOA 2DC3A 2YSKA 4MQJB 2O5MX 2E2YA 1YFFB 3G4UA 1OUTB 1JF3A 1Y7DA 1CH3A 1BZ6A 4NI0B 1J3ZB 3BCQA 3WTGB 4ZVAA 1VRFA 2ZS0D 2FAMA 1JZMA 2HBGA 1KD2B 5EE4D 1XCHA 3UHUA 1HDSB 1QI8A 4L1EB 1Y22B 4A8OA 1Y2ZA 1Y8IB 3OO4A 4HRTB 1QXEB 1Y0DA 4G1BA 3M3AA 1COLA 1HDBA 1KN1B 1RQ4A 3EDBA 2C7JA 1G0BB 3S48C 4ERVA 5CNDA 1YOIA 1XZ4B 1WVPA 1HBAB 1F0LA 2FRFA 4L7YB 5AB8A 1IRCA 3KMFC 4KMVA 3TM9A 1A3NA 1YIHB 3AQ8A 4FWXA 1Y5FB 1J40B 4IROA 1CH5A 2XKIA 1UIWA 1XF6C 3WFTA 1F5PA 3V58B 1Y35A 2MGGA 1LIAB 3QJDB 4ROMA 4A8MP 1WMUA 2UUNB 2HBEB 2O5SX 1Y7CA 1YOHA 1XZUB 2MGIA 2PEGB 2QLSA 4PO5A 3HXNA 4FC3B 1F63A 3QM9A 2BLIA 1G0AA 2G14A 3BJ3B 1LFVA 4N7OB 1OFJA 4GY3B 4JACA 2MGBA 3ZJSA 1RQ3A 2MGJA 1J7SA 1MYHA 4F0TB 1JZLA 1NWIA 5HLQA 2D2NC 5B13A 1MLRA 1J7YA 2JHOA 4YU4A 1FAWB 3VREB 1WMUB 1YCBA 4O35A 1VXAA 3UGYA 3G53A 1GZXA 1HI1A 1MLSA 3VNCA 4U8UA 2O58X 1HRMA 1A9WE 2MGDA 3ZJIA 1O1KA 3GDJB 1DWSA 1VXHA 4M4AB 4N8TB 3GK9A 3A9MA 1Y31B 1HHSA 2D6CA 3UHEA 3WCUB 3W4UA 3DBJB 3PMCA 2ZS1D 1XYEB 3OZUA 2YRSA 4DWTA 2X49A 1Y0WB 4IT8A 3EU1A 3UHGA 1KN1A 2MGLA 5B85A 4U8UD 4NZIA 1XZ5B 2W6WA 1UVJA 1CIIA 1HBRB 3FH9B 1NZ4A 1DXVA 2HBDA 2ZSSA 5CN7A 2EF2A 4AVEA 2QMBB 3WCWD 1Y46B 5EUIB 1BZRA 1MLGA 1Y8HA 4MQCB 4HH1A 1Y4QB 1C7BB 4BJAA 3QJDA 2RAOA 3ARJA 1XQ5B 1ALLA 2BWHA 4MQJA 1OFKA 3SZKA 4N7PA 2UULD 1HGAB 1MYGA 1O1LB 1HBRA 1Y83B 4FWYA 3WCWB 1S69A 3S65A 1R1XA 1HBSB 1A00A 1ASHA 102MA 3D1AA 5HY8B 1CIKA 1O1JA 2W6VB 1A0UA 1DO4A 1Y0CA 1MTJA 1RH1A 3PI3A 3S1JA 2PGHA 3PI4A 1HABA 1RTXA 2V1HA 1OBMA 1CO9A 4H0BA 1YGFB 1LA6A 1CP0A 1NZ3A 4H07A 1LUEA 4ODCB 1XZ7B 1EBTA 2W72B 3LR7A 3GQRB 1YHEB 2C0KA 3HF4A 4TWVA 1G9VB 5CN4A 1Y0AA 1K1KB 4XXKA 1AJ9A 3MOUA 3A0GB 1J7WA 2G0SA 5F0BA 2VHBA 6HBIA 3O89A 1DLWA 2UUNA 1Y7GA 1THBA 2X4AA 1O1LA 4X0LA 4G51B 3UH3A 2BV8A 2NSSA 1O1MB 2G11A 3BOMA 3WCVC 1MBOA 1COHA 1FDHA 3UGZA 2MGCA 3G4WA
chains in the Genus database with same CATH topology
1NY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NY9 A; 
#chains in the Genus database with same CATH topology
 3MBA A;  1LFV B;  3QJC B;  1AZI A;  1F5O A;  4JYQ A;  3HRW B;  1LIA A;  1DWR A;  1M6C A;  1B8D A;  1C7C A;  3VRF A;  5JDO D;  1HCO B;  2HZ2 A;  1Z8U B;  2C7K A;  5CN9 A;  1YE0 B;  1VWT A;  3EDA A;  1GH0 B;  1GCW A;  3BRP A;  1ALL B;  4MAX A;  1Y4F B;  4Q70 A;  3NMM B;  4FH6 A;  5HU6 A;  104M A;  1GJN A;  1O1K B;  2DKC A;  3A59 B;  2B7H A;  2VLZ A;  4FWZ A;  1CPC A;  4WCH D;  1X3K A;  1DXU A;  2HZ3 A;  4H2L A;  1ON7 B;  3QM6 A;  2MGK A;  1QSI A;  3IC0 A;  1CLS B;  1DTM A;  2OH8 A;  2EB8 A;  3LR9 A;  3P5Q B;  1I7Y B;  4N8T A;  4LPI A;  3ED9 A;  3DUT A;  3SDN A;  1V4W B;  1URY A;  5EQM A;  1IT3 A;  1YDZ B;  3CY5 B;  1MYZ A;  1YHR A;  1IRD B;  1LFY A;  3WI8 A;  106M A;  3WCT A;  1MOH A;  3PT7 B;  5D5R A;  2ZS1 B;  1HHT P;  1OUU A;  1UVY A;  4MQH A;  3AT6 B;  3KVS A;  1BUW A;  5HBI A;  3IC2 B;  1V9Q A;  3O18 B;  1FSX A;  5EU2 A;  3RQR A;  1LFQ B;  1J7W B;  2HHD B;  3NFE B;  4YU4 B;  1CH9 A;  1VXC A;  1F99 A;  2RI4 A;  1LH2 A;  1A0Z A;  4A8Y A;  1RVW B;  1Q1F A;  2R80 B;  5JOM A;  1B8D B;  1C7C B;  1DKE B;  1JP8 A;  2G0X A;  2HBC B;  1SI4 B;  2MB5 A;  3NL7 A;  1CMY A;  3GDJ A;  1A3O B;  2ZLU B;  3ZJJ A;  4MXL A;  4F6B A;  3KMF A;  4F69 A;  3IC2 A;  1MKO A;  1LH7 A;  2ZLV B;  2I88 A;  1G0A B;  1YHE A;  1DLY A;  2W72 C;  1S5X B;  1YEO A;  4F6J A;  3LB1 A;  1A0Z B;  1FCS A;  1GCV B;  1LJW B;  2BMM A;  1Y5K A;  3D1K A;  3A5A A;  4MPM A;  2HBE A;  4XXI A;  1UVI A;  1MDT A;  1QXD B;  1IDR A;  1YCA A;  3E55 A;  1CP5 A;  3PI2 A;  1EWA A;  2G0Z A;  3GQP B;  2GRH A;  1Y4P B;  4ERT A;  3A5G A;  4ODC A;  1A6K A;  1WAC A;  3UI0 A;  1NQP A;  3HC9 A;  1LH3 A;  3QJB A;  1LTW A;  1IBE B;  1YEU A;  4TMA B;  2JL9 A;  2ZLW B;  1BJE A;  2UUN D;  1V75 B;  1MBA A;  3MJP B;  2D2N A;  1CG5 B;  1CG8 A;  5JGG A;  1X9F C;  1BZZ B;  3R5I B;  4MBN A;  3NUH B;  3ORD A;  1MKO B;  1HCO A;  1HGB A;  1JZK A;  1XZV A;  3DHT B;  1Y4G B;  1XZ4 A;  3CIU B;  2M6Z B;  4OF9 A;  4NXC A;  1BZP A;  3ZJR A;  1YIE B;  2DKA A;  3RGK A;  3QJE A;  4HRR A;  1LH1 A;  1FN3 B;  3L0F A;  1Y4V A;  1XYE A;  1YZI A;  1O1J B;  1ABY A;  2ZFO A;  1IOP A;  5MBN A;  2VEE A;  3A59 A;  1MYF A;  3AQ6 A;  1F99 B;  2JLG A;  4TYX A;  4C44 A;  1DWT A;  3OO5 A;  4UIQ A;  3IC0 B;  3UHV A;  1HAB B;  2O5Q X;  2PGH B;  2M6Z A;  2NRL A;  1XZ2 B;  2GTL B;  3M38 A;  2EKT A;  1QSH A;  4B4Y A;  4NI1 B;  2ZSX A;  1MBN A;  1Y7G B;  5B84 A;  2W72 A;  4L2M A;  4LMX B;  1XZ7 A;  1MBD A;  3UBC A;  1UX8 A;  1HJT A;  2GL3 A;  2MGF A;  4F6G A;  2VJR B;  1FDH G;  3UH6 A;  4ETU A;  1DUO A;  1YHU D;  1LFL A;  1YEO B;  1MTK A;  2HBF B;  2V8A A;  3G4R A;  2D2M A;  1XXT B;  2HBS B;  2BV8 B;  1JP6 A;  1KTP B;  1CBM A;  1Y4P A;  1HAC A;  1LHS A;  2R4X A;  1MOC A;  3QZZ A;  3UHX A;  1YEQ B;  2EVK A;  1HBH B;  2GTL D;  2ZFO C;  3MVC A;  2MBW A;  1YEV B;  3OZV A;  1X9F A;  3D7O B;  1Y4F A;  2H8F B;  4M4B B;  1Y8W A;  3M3B A;  1MBS A;  2GLN A;  2LH1 A;  2W6V A;  2MHB A;  2JLF A;  1NEJ B;  2EB9 A;  3ECL A;  3AQ7 A;  1NZ5 A;  1Y31 A;  1Y01 B;  2H8D B;  1Y7C B;  1XY0 A;  1NY9 A;  1CLS A;  3LB4 A;  3UHK A;  1BAB B;  1HDA A;  1H97 A;  3LQD A;  103M A;  1Y35 B;  3FH9 A;  4MXK A;  5C6Y A;  1CPC B;  1Y0A B;  3ZJP A;  1A87 A;  2D2M C;  1YZI B;  2DXM B;  2OLP A;  1LFZ A;  4MQG B;  2WTH A;  5EV5 A;  1Y46 A;  1FN3 A;  5EUI A;  2ZSO A;  1B86 A;  2GRF A;  3G52 A;  1N9F A;  1HV4 B;  3FS4 B;  3NG6 A;  1Y0D B;  2G3H A;  2V1E A;  4MU5 A;  1WLA A;  1Y8K A;  3LB3 A;  2ZS1 A;  3D4X A;  1R1Y A;  1BZ1 B;  1QPW A;  3LHB A;  5CMV A;  2W6X A;  4ROL B;  2LH3 A;  5E83 A;  1C7B A;  3D1A B;  5HY8 A;  1Y0T B;  3LB2 A;  3V58 A;  1CH4 A;  4U8U B;  3OJ1 A;  2WY4 A;  1DUK A;  2MGM A;  2QSS A;  3O2C B;  5FVB M;  1A6M A;  3ZJQ A;  6HBW B;  1YE0 A;  4F4O A;  3PI1 A;  1S61 A;  3ECX A;  3S65 B;  2MYB A;  4HSX A;  2LH7 A;  5CNC A;  2XKH A;  3PMD A;  1VXE A;  2HBD B;  4DC7 A;  5F2A A;  3QJE B;  1BVC A;  1MLJ A;  1Y8W B;  1BIJ B;  111M A;  110M A;  2PEG A;  1SDK A;  3GUQ A;  1A4F B;  4XS0 B;  5AZR A;  1Y2Z B;  1Y8I A;  2Z6T A;  5EYS A;  2KSC A;  3PIA B;  4FH7 A;  1EBC A;  2ZS1 C;  1Y5K B;  2G10 A;  2WCR A;  3WCU D;  1LH5 A;  4N6S B;  1GZX B;  2Z85 A;  4A8Q A;  1HSY A;  4B3W A;  2VYZ A;  4M4B A;  1G9V A;  1VXG A;  1JWN A;  1Y85 A;  1NIH A;  2J96 A;  2ZLV A;  1YE2 A;  3QZX A;  2GKN A;  1O1P A;  2VJT B;  2DN1 A;  4MQC A;  1MLU A;  3GOU A;  1KFR A;  1FAW A;  1V5H A;  3VRE A;  1Y45 A;  3W4U B;  7HBI A;  1HBI A;  3QM7 A;  1BZ0 B;  5E6E B;  1URV A;  3HHB A;  1RSE A;  3BJ2 A;  4N7N B;  1LFL B;  1ECD A;  2HBS A;  2R4Z A;  101M A;  1YHU C;  2BKM A;  2BW9 M;  2O5B X;  3ONZ A;  2GNV A;  1DXD A;  3GLN A;  1Y5F A;  3PI8 A;  3WCU A;  2G12 A;  3MJP A;  1ECO A;  1GLI A;  1B86 B;  3G4Y A;  2FAL A;  2VJR A;  1M9P B;  1NWN A;  2YRS B;  1JY7 A;  1N9X A;  1NS6 B;  2ZFO D;  2FRK X;  3WCT D;  1HBG A;  1HGC B;  1MLL A;  3MYN A;  1KTP A;  2MGH A;  4F6I A;  3ECZ A;  1YH9 B;  1QGW C;  1DXC A;  5ILR A;  4A8F A;  2DN2 A;  5JDO E;  3WR1 A;  107M A;  4Z8K B;  1UVN A;  5AZQ A;  1O16 A;  1DXU B;  1ABY B;  3VHB A;  3PI9 A;  1N9H A;  3ZTA A;  5CHR A;  1C40 B;  1Y09 B;  3V57 A;  1HBS A;  3S1I A;  3UH7 A;  1XQ5 A;  2SPM A;  1MCY A;  1MNI A;  1B0B A;  2BLH A;  2C7J B;  1MNH A;  2AA1 B;  3UHI A;  2ZSZ A;  3VAU A;  1CIO A;  1OUU B;  1BBB B;  2OIF A;  3SDH A;  1YOG A;  1V4X A;  2MYC A;  2ZS0 C;  4NXA A;  1XXT A;  1PHN B;  3UHD A;  5HU6 B;  2W31 A;  4MQG A;  4NS2 A;  4ROL A;  3AT5 B;  1HA7 A;  2G0V A;  3ODQ B;  1GBV A;  4UUR A;  1YEN A;  2DN2 B;  5E83 B;  2LHB A;  2SPO A;  2MYE A;  1NS9 B;  3GKV A;  1UMO A;  1GBU A;  5HAV A;  2QU0 A;  3UH5 A;  3TLD A;  3MJU B;  4LM6 B;  2ZS0 B;  1THB B;  1W92 A;  1MYI A;  2ZT2 A;  3AQ5 A;  4DC8 A;  1YIE A;  1YG5 A;  4F0T A;  1MNO A;  1YDZ A;  1J7S B;  3OK5 A;  1AJ9 B;  2UUM B;  3FEW X;  3G46 A;  3OVU C;  1NEJ A;  1YFF A;  3A5B A;  3LQ9 A;  1J41 B;  2HHB B;  1PMB A;  1O1I B;  1O1N A;  2O5O X;  3WCV B;  1MYM A;  2QSP A;  4YU3 A;  5AQD M;  2ZLT B;  4PNJ A;  3D17 B;  4A8W A;  1ECA A;  1S5X A;  3UHQ A;  1CH1 A;  5B13 G;  3K3U A;  4Z8K A;  3HRW A;  1KR7 A;  1Y4B B;  2ZSY A;  3WFX A;  2FRJ X;  4F0U A;  4WJG A;  1A9W A;  1HBH A;  2D2N D;  1UT0 A;  4OOD A;  5CHQ A;  1C7D B;  1YMB A;  3WCP A;  2ZT3 A;  3ZJM A;  5E6E A;  108M A;  3HYU B;  4B02 A;  2QSP B;  4YU3 B;  3MWN A;  1MBC A;  1I7Y A;  4AVD A;  1CG5 A;  2ZLT A;  2QRW A;  1YGD B;  2DN1 B;  1K0Y A;  1YVT B;  1DDT A;  4GZG A;  1SPE A;  3ZH0 A;  4KMW A;  1Y4B A;  4ROM B;  1PHN A;  1KD2 A;  1PBX A;  2OHA A;  4HSW A;  2AUQ A;  1Y4R B;  1Y4V B;  3HHB B;  4BJU A;  1QXE A;  1LFT A;  1I3D A;  3DHR B;  1MNK A;  1Y7Z A;  4MBA A;  4NK2 A;  3QQQ A;  2Z6S A;  5HLX A;  3B75 B;  3MJU A;  5D1V A;  4L1E A;  2DN3 B;  1G08 A;  1NXF A;  4MQH B;  1BUW B;  3E4N A;  3KVS B;  1C7D A;  3WCW C;  5C6E B;  1SWM A;  1T1N A;  1YG5 B;  3E5I A;  4Q70 B;  1Y8K B;  4ETV A;  1YGF A;  1MOD A;  1B33 A;  1GDI A;  2HHD A;  2ZT1 A;  1SDK B;  5JGG B;  1JEB A;  3FS4 A;  5FVB A;  1LHT A;  1S6A A;  2AV0 A;  5EOH A;  3ZJN A;  2SPL A;  1Y7Z B;  3PT8 B;  3KUO A;  3UHT A;  2UUL C;  3RJ6 A;  1FLP A;  1PBX B;  3EOK A;  1OUT A;  2R1H A;  3V2V A;  4ESU A;  4HHB B;  4XDI A;  1Y5J B;  1CG8 B;  2Z6N A;  3H58 A;  1MLF A;  2B7H B;  3V57 B;  3MKB B;  2GDM A;  1C40 A;  3PI8 B;  1S56 A;  1DO7 A;  2QFK A;  3TM3 A;  3VRG B;  3HF4 B;  1S0H A;  1HGB B;  1HAC B;  109M A;  2MGE A;  1XZ5 A;  2VRY A;  3D17 A;  1JY7 B;  4PQ6 A;  1O1M A;  1LFY B;  4MQK B;  1UVL A;  1ABW A;  2AV3 A;  1CBL A;  1CO8 A;  1MLO A;  3UHS A;  1RQA A;  2ZFB A;  2VEB A;  1NPF A;  4F0U B;  3CY5 A;  1HI0 P;  1RTE A;  1JW8 A;  1IBE A;  1K0Y B;  2LH5 A;  3WCP B;  1YVQ A;  1YEN B;  1HLM A;  1A00 B;  1Y4R A;  3UHC A;  1S0H B;  1FHJ A;  2C7K B;  2VML B;  1CH7 A;  1VXB A;  1A0U B;  4LMS B;  2ZST A;  4L7Y A;  1Y0W A;  3WCV D;  1XDT T;  4GXE A;  2D5X B;  4O2G A;  3V2Z A;  2HHE B;  3K8B B;  1R1X B;  3QM5 A;  4PO5 B;  1MOA A;  1D8U A;  2GRZ A;  3UHB A;  1J40 A;  2ZSP A;  3ARK A;  1SHR B;  1LFQ A;  2ZSQ A;  3UHH A;  5HLU A;  1L2K A;  5ILE A;  3UHW A;  2G0R A;  4MQK A;  1Y45 B;  1V4W A;  1ON7 A;  2HBC A;  1MLK A;  1DKE A;  5JDO C;  2AA1 A;  5E29 A;  4HH0 A;  2QSS B;  3O2C A;  2V1K A;  4KJT A;  3DR9 A;  4NI0 A;  1OJ6 A;  1YHU A;  1X46 A;  3BOM B;  1O1O B;  4G51 A;  4KN3 A;  3IXF A;  5KER B;  1ECN A;  3E5O A;  2AUR A;  1YGD A;  1HA7 B;  1J3Y A;  1MLQ A;  4HHB A;  2ZS0 A;  2O5L X;  3AT6 A;  1A6G A;  1NS6 A;  3QQR A;  2RAO B;  4ZIZ B;  1GBU B;  1SPG A;  3PEL B;  1YH9 A;  2XKG A;  5EET A;  2HCO B;  3GYS B;  3PIA A;  1NGK A;  1XG0 C;  4RMP B;  2QFN A;  1EYX A;  2WCQ A;  1VWT B;  2NRM A;  3WCU C;  5SW7 A;  3WFW A;  3DBJ A;  1UVM A;  5KDQ B;  1YE2 B;  1JBO A;  1J3Y B;  1S5Y B;  1G08 B;  2EKU A;  1V4X B;  3MYM A;  3A2G A;  112M A;  3ZOL A;  1EMY A;  1YHU B;  3UHN A;  2LH2 A;  5M3S A;  1GCW B;  1J41 A;  1MWC A;  2QMB A;  1HI8 A;  3ZJH A;  5MBA A;  1J52 A;  4YJJ B;  1QPW B;  1CH2 A;  4X0L B;  1BBB A;  4MQI B;  1U7R A;  1UFP A;  3MN0 A;  3GOU B;  3QMA A;  1LH6 A;  2MYA A;  5EE4 C;  1BAB A;  1YEV A;  1K1K A;  3ZOM A;  1FHJ B;  1I3E A;  3GQG B;  1MWD A;  1NQP B;  1HBB B;  1TES A;  3BJ2 B;  4N7N A;  1UC3 A;  2DXM A;  4IRO B;  4DWU A;  2VM0 A;  1QXD A;  1HGC A;  2R50 A;  5CNG A;  2D5Z A;  3WR1 B;  4MQI A;  2LH6 A;  1M9P A;  5KER A;  1YEU B;  2GNW A;  2VYY A;  4O4T A;  1BZ1 A;  4AE0 A;  3QM8 A;  3WFU A;  1HBB A;  2BLJ M;  3GQG A;  2ZLX A;  4N7O A;  1MLH A;  3NG6 B;  1HHO B;  2D60 B;  4WJG 1;  3EU1 B;  2HHB A;  105M A;  3S66 B;  1BZ0 A;  1H1X A;  1N9I A;  2HCO A;  1NIH B;  3U3E A;  1JP9 A;  4F4O B;  1YEQ A;  3PI9 B;  1MLN A;  2HHE A;  1UVX A;  1JPB A;  2D5X A;  2CMM A;  1JF4 A;  1U7S A;  2H8F A;  4VHB A;  1XZ2 A;  2GTL A;  4ILZ A;  2C7L A;  3OO4 B;  1B33 B;  1HDS A;  1QI8 B;  1SI4 A;  1MBI A;  4F68 A;  2ZLX B;  2V1G A;  3WCW A;  3ZJL A;  1J3Z A;  1YMC A;  5CNB A;  1A4F A;  1NS9 A;  3GKV B;  2IG3 A;  1BIJ A;  2OH9 A;  1GDK A;  4N7P B;  2SPN A;  1JBO B;  4ESA A;  1XY0 B;  1GLI B;  2ZT0 A;  1O1O A;  1QSH B;  1NZ2 A;  4UZV A;  2W6Y A;  1Y83 A;  1SHR A;  3ARL A;  2C7L B;  3NMM A;  3M39 A;  2IN4 A;  5CN8 A;  3UHY A;  1G0B A;  5E29 B;  1HV4 A;  2HBF A;  1BVD A;  2ZSN A;  3QJB B;  1RQA B;  1Y4G A;  4U8U C;  3PEL A;  2D5Z B;  1YMA A;  1VHB A;  3GKT A;  4F6F A;  4RMP A;  3WHM A;  4ESA B;  2VJH B;  1O1P B;  3BA2 A;  6HBW A;  1Y7D B;  2H35 A;  1G09 A;  1OR6 A;  3GIO A;  1X9F B;  3D7O A;  4C0N A;  3GQR A;  5SW7 B;  4ZIZ A;  1SDL A;  1DO1 A;  1DXT B;  1Y0T A;  1XZU A;  2BNL A;  4H2L B;  2XYK A;  3GYS A;  1J7Y B;  3NL7 B;  4PQC A;  2VML A;  3BJ1 B;  4PQB A;  4ETT A;  1RPS B;  1GCV A;  2VLY A;  4G1V A;  3S66 A;  1HDB B;  4H0M A;  2BK9 A;  3VRF B;  1RQ3 B;  3O7N A;  4GXE B;  2UUL A;  1J3F A;  2R4W A;  2GTL C;  5AQD A;  1CQX A;  1OR4 A;  2GKM A;  5KKK A;  3MKB A;  3LQD B;  1M6M A;  1TU9 A;  2Z6N B;  3O18 A;  1F65 A;  1HHO A;  1VXD A;  2D60 A;  1FSL A;  1LFZ B;  1SGK A;  1UIW B;  5IKS A;  2V1I A;  2OHB A;  1CQ2 A;  3AQ9 A;  2UUM A;  5CN6 A;  3UHR A;  3PT7 A;  1GDL A;  5ILP A;  4YJJ A;  3R5I A;  2UUL H;  2H35 B;  2V8A B;  1GDJ A;  5ILM A;  3CIU A;  3HXN B;  3G4V A;  2VJT A;  3D4X B;  3WTG A;  2V1J A;  3G4Q A;  1LFT B;  2D2M D;  3DUT B;  1DTI A;  5KDQ A;  2Z8A A;  4HRR B;  2QLS B;  3AT5 A;  1JL7 A;  1XZV B;  2HZ1 A;  3DHT A;  1JEB B;  1MOB A;  3A0G A;  1V4U A;  1QSI B;  1DM1 A;  3D1K B;  1A01 B;  4TWU A;  1NPG A;  3OO5 B;  3R0G A;  1MDN A;  3PT8 A;  1JL6 A;  3BCQ B;  1ITH A;  5CN5 A;  2R1H B;  2FRI X;  3EOK B;  1S5Y A;  5CNE A;  1Y22 A;  2VYW A;  2VLX A;  4HRT A;  3VRG A;  2NX0 A;  4AE1 A;  1MLM A;  2DKD A;  2DHB B;  4NK1 A;  1BZZ A;  2ZT4 A;  2WTG A;  1IT2 A;  1UVK A;  3GQP A;  3BRP B;  1JDO A;  1GH0 A;  1IWH B;  1V75 A;  1ABW B;  1O1N B;  3B75 A;  1A6N A;  2ZLW A;  5JDO F;  2D2N B;  1DXV B;  1MGN A;  1AJG A;  3HEN A;  1BIN A;  1YVQ B;  1A01 A;  1HLB A;  3L0F B;  1T1N B;  1EW6 A;  4FC3 A;  1Y8H B;  4A8S A;  1MWB A;  1R1Y B;  2DN3 A;  3OGB A;  2ZSR A;  3HYU A;  1COH B;  2H8D A;  1NAZ A;  3ASE A;  5C6E A;  3K8B A;  2EVP A;  1X9F D;  2MYD A;  1MYT A;  4QAU A;  3UBV A;  3HEP A;  2MHB B;  4M4A A;  3ODQ A;  3AG0 A;  1YVT A;  1A3N B;  1UX9 A;  1YIH A;  2AUO A;  1YHR B;  2V1F A;  1LJW A;  1FSX B;  3IA3 B;  4HBI A;  1MTI A;  1V4U B;  1MZ0 A;  1Y0C B;  3DHR A;  3WCT B;  3UHZ A;  1RPS A;  3OZW A;  1RQ4 B;  5EYJ A;  2R4Y A;  1HDA B;  3BJ1 A;  2UUM X;  4H0M B;  2VJH A;  4N6S A;  2R80 A;  1DO3 A;  2ZFB B;  1ABS A;  5CNF A;  4ZVB A;  4F6D A;  1LA6 B;  2ZWJ A;  1UFJ A;  1CMY B;  3NFE A;  1Y85 B;  3HEO A;  4XS0 A;  1DXT A;  1TOX A;  3BJ3 A;  1Y09 A;  2NSR A;  1RVW A;  4SDH A;  2RI4 B;  4A8K A;  4BS9 A;  2D2M B;  2UUL B;  3K9Z A;  2DHB A;  3WCV A;  3WCT C;  4O1T A;  1O1I A;  1VXF A;  3H57 A;  3RJN B;  1VRE A;  3KUN A;  3P5Q A;  2O5T X;  1A3O A;  2ZLU A;  1MNJ A;  2AUP A;  1EYX B;  1IWH A;  3ONZ B;  4GY3 A;  1HGA A;  2QU0 B;  1Y5J A;  3WHM B;  1SPG B;  1GVH A;  1MYJ A;  1AJH A;  4NI1 A;  1HBA A;  1G09 B;  2ZFO B;  2MGA A;  1GBV B;  3QJC A;  4O4Z A;  3NML A;  1Y4Q A;  1IRD A;  3ZHW A;  1CPW A;  1SDL B;  1V07 A;  3SZK B;  3ZJO A;  2DC3 A;  2YSK A;  4MQJ B;  2O5M X;  2E2Y A;  1YFF B;  3G4U A;  1OUT B;  1JF3 A;  1Y7D A;  1CH3 A;  1BZ6 A;  4NI0 B;  1J3Z B;  3BCQ A;  3WTG B;  4ZVA A;  1VRF A;  2ZS0 D;  2FAM A;  1JZM A;  2HBG A;  1KD2 B;  5EE4 D;  1XCH A;  3UHU A;  1HDS B;  1QI8 A;  4L1E B;  1Y22 B;  4A8O A;  1Y2Z A;  1Y8I B;  3OO4 A;  4HRT B;  1QXE B;  1Y0D A;  4G1B A;  3M3A A;  1COL A;  1HDB A;  1KN1 B;  1RQ4 A;  3EDB A;  2C7J A;  1G0B B;  3S48 C;  4ERV A;  5CND A;  1YOI A;  1XZ4 B;  1WVP A;  1HBA B;  1F0L A;  2FRF A;  4L7Y B;  5AB8 A;  1IRC A;  3KMF C;  4KMV A;  3TM9 A;  1A3N A;  1YIH B;  3AQ8 A;  4FWX A;  1Y5F B;  1J40 B;  4IRO A;  1CH5 A;  2XKI A;  1UIW A;  1XF6 C;  3WFT A;  1F5P A;  3V58 B;  1Y35 A;  2MGG A;  1LIA B;  3QJD B;  4ROM A;  4A8M P;  1WMU A;  2UUN B;  2HBE B;  2O5S X;  1Y7C A;  1YOH A;  1XZU B;  2MGI A;  2PEG B;  2QLS A;  4PO5 A;  3HXN A;  4FC3 B;  1F63 A;  3QM9 A;  2BLI A;  1G0A A;  2G14 A;  3BJ3 B;  1LFV A;  4N7O B;  1OFJ A;  4GY3 B;  4JAC A;  2MGB A;  3ZJS A;  1RQ3 A;  2MGJ A;  1J7S A;  1MYH A;  4F0T B;  1JZL A;  1NWI A;  5HLQ A;  2D2N C;  5B13 A;  1MLR A;  1J7Y A;  2JHO A;  4YU4 A;  1FAW B;  3VRE B;  1WMU B;  1YCB A;  4O35 A;  1VXA A;  3UGY A;  3G53 A;  1GZX A;  1HI1 A;  1MLS A;  3VNC A;  4U8U A;  2O58 X;  1HRM A;  1A9W E;  2MGD A;  3ZJI A;  1O1K A;  3GDJ B;  1DWS A;  1VXH A;  4M4A B;  4N8T B;  3GK9 A;  3A9M A;  1Y31 B;  1HHS A;  2D6C A;  3UHE A;  3WCU B;  3W4U A;  3DBJ B;  3PMC A;  2ZS1 D;  1XYE B;  3OZU A;  2YRS A;  4DWT A;  2X49 A;  1Y0W B;  4IT8 A;  3EU1 A;  3UHG A;  1KN1 A;  2MGL A;  5B85 A;  4U8U D;  4NZI A;  1XZ5 B;  2W6W A;  1UVJ A;  1CII A;  1HBR B;  3FH9 B;  1NZ4 A;  1DXV A;  2HBD A;  2ZSS A;  5CN7 A;  2EF2 A;  4AVE A;  2QMB B;  3WCW D;  1Y46 B;  5EUI B;  1BZR A;  1MLG A;  1Y8H A;  4MQC B;  4HH1 A;  1Y4Q B;  1C7B B;  4BJA A;  3QJD A;  2RAO A;  3ARJ A;  1XQ5 B;  1ALL A;  2BWH A;  4MQJ A;  1OFK A;  3SZK A;  4N7P A;  2UUL D;  1HGA B;  1MYG A;  1O1L B;  1HBR A;  1Y83 B;  4FWY A;  3WCW B;  1S69 A;  3S65 A;  1R1X A;  1HBS B;  1A00 A;  1ASH A;  102M A;  3D1A A;  5HY8 B;  1CIK A;  1O1J A;  2W6V B;  1A0U A;  1DO4 A;  1Y0C A;  1MTJ A;  1RH1 A;  3PI3 A;  3S1J A;  2PGH A;  3PI4 A;  1HAB A;  1RTX A;  2V1H A;  1OBM A;  1CO9 A;  4H0B A;  1YGF B;  1LA6 A;  1CP0 A;  1NZ3 A;  4H07 A;  1LUE A;  4ODC B;  1XZ7 B;  1EBT A;  2W72 B;  3LR7 A;  3GQR B;  1YHE B;  2C0K A;  3HF4 A;  4TWV A;  1G9V B;  5CN4 A;  1Y0A A;  1K1K B;  4XXK A;  1AJ9 A;  3MOU A;  3A0G B;  1J7W A;  2G0S A;  5F0B A;  2VHB A;  6HBI A;  3O89 A;  1DLW A;  2UUN A;  1Y7G A;  1THB A;  2X4A A;  1O1L A;  4X0L A;  4G51 B;  3UH3 A;  2BV8 A;  2NSS A;  1O1M B;  2G11 A;  3BOM A;  3WCV C;  1MBO A;  1COH A;  1FDH A;  3UGZ A;  2MGC A;  3G4W A; 
#chains in the Genus database with same CATH homology
 1NY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...