1MLUA

Nitric oxide recombination to double mutants of myoglobin: the role of ligand diffusion in a fluctuating heme pocket
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
154
structure length
154
Chain Sequence
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKGGVTALTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nitric oxide recombination to double mutants of myoglobin: role of ligand diffusion in a fluctuating heme pocket.
pubmed doi rcsb
source organism Physeter catodon
molecule tags Oxygen storage
molecule keywords MYOGLOBIN
total genus 67
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 1994-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1mluA00
3GDJA 4N8TB 1DTIA 2GRZA 2XKIA 1S5XA 2YRSB 1C7DA 1MLGA 3A5AA 5CNDA 1PMBA 1EBCA 5HY8A 1M9PA 3WCUB 1VHBA 3WTGB 3AT5A 2HHDB 1S61A 4F6DA 1HBAA 1HBRB 1YIHB 1CO8A 1G0BA 3GOUB 4DWTA 1X46A 1VXBA 1YDZB 1UX9A 3QQQA 2IG3A 2NSSA 2O5OX 1AJGA 1LFTB 1HBBA 1LFVB 1YZIA 5B84A 3PI9B 1O1NA 3PIAB 3OK5A 1JWNA 3BJ2A 2MGLA 1Y22B 2MGGA 5CHQA 4ZVBA 1JF3A 4NI1A 4IT8A 1DUOA 1DXDA 3ASEA 1C7CA 1HBHA 3BCQB 105MA 1D8UA 1QSHB 1Y0AB 3ZOMA 5MBAA 1VXGA 1C7DB 5C6EB 1DXUA 4QAUA 3R0GA 2HBDB 1YGFA 1SI4A 3TM3A 2O5SX 2G0SA 1KFRA 4VHBA 4MQJB 2D5XB 5EOHA 4M4AB 1A00B 1A0ZB 3WFTA 1YEOA 2CMMA 1Y8KB 1COHB 1XZ7B 5HBIA 2W6VA 4ESAA 1DO3A 1YHEB 1BZ1B 3MJPB 3WCWA 5EE4C 3WCPB 4NXAA 3O89A 1R1XA 1MNOA 2ZFOD 1O1NB 3PIAA 3WCUD 3BJ2B 2W6YA 1CP5A 2QU0A 5ILMA 1HGBA 2V1IA 1QPWA 3HYUB 1MYTA 3WFWA 2ZS0B 3E5OA 5JDOD 5CHRA 2EB8A 1J40A 3HXNB 1GBVA 1V4UB 1SDKA 3SDHA 1MTIA 2LHBA 3EDAA 1MBAA 1MNHA 4MQKA 2R80A 3ORDA 1LFZB 3ZJSA 1HBSB 3QJCA 2D2MA 1COHA 1J3ZA 1MBOA 2LH2A 2LH6A 3GKVB 1YEQB 2JHOA 1Y2ZA 1OFJA 1BVDA 4ROLA 3BJ1B 1HABA 4NI0A 1DXCA 1YOIA 1MWBA 1ABSA 3HEPA 1Y0TB 3E55A 2FRKX 3FS4B 3G4QA 1Y7CB 2MYCA 2SPOA 1FN3A 3WFXA 2VEEA 1YHUA 1YHRA 2D2MC 2DHBB 3VRGA 1S56A 3LR7A 5AZQA 4FC3B 1BJEA 3LB4A 3FH9A 2DC3A 2LH1A 109MA 1O1JA 1YE2B 1Y83B 3UHNA 3PI3A 4HHBB 1MYGA 1CPWA 3GQRB 5CN7A 1MWDA 5F0BA 2MGKA 1BZ0A 1Y0DA 1RQ4A 2HHEB 4MXLA 3UH6A 2IN4A 4H2LA 3D4XB 3GQPA 1O1OA 4DC7A 3AQ6A 1Y85B 2W72C 2VYZA 1RQ3A 1YGDB 1Y4PA 1YENA 1YHUD 3KMFC 1WLAA 104MA 1HBIA 5HU6A 3ZJRA 1SPGB 1YVQA 3ARLA 1XZUB 1V4WB 3EOKB 1HDAB 4MQIB 2FALA 5HAVA 3VHBA 3UH7A 1YHUB 4O4TA 2ZFOB 3PI1A 3CY5A 2MGCA 1Y46A 1VXHA 3A59A 3WR1B 1A0UB 1OUUA 1UX8A 2SPMA 3ODQA 1O1MB 2HHBB 1JL6A 1JZMA 1MLRA 4N7NB 3QZXA 3OGBA 1LUEA 3NMLA 3UHDA 1C40B 4JACA 1BUWA 3ZJQA 2ZSQA 3UBVA 1R1YA 5CNCA 3OZUA 1Y0CA 1HACA 4YU3A 4TWUA 2ZSOA 4HRTB 1MBIA 3QM8A 1ASHA 5E83B 4TYXA 1GJNA 2AA1B 3QJEA 2EKTA 2EKUA 2LH3A 1XCHA 1ABWB 1QXEB 4MQGB 1DKEA 3OVUC 4U8UB 2O5LX 4FWXA 1AJ9A 3E5IA 2OHBA 1MLFA 4ODCA 4O4ZA 1NQPA 2HBFB 1O1MA 3PT8B 4OF9A 2VEBA 3GLNA 3M3AA 4F6IA 4PQCA 1LJWB 2FAMA 2W72A 4MPMA 5MBNA 3LB2A 1YMBA 3NL7B 2MGFA 1AZIA 1CG5A 1MGNA 1A3NA 1Y5JA 1X9FB 2WY4A 5KDQA 1CO9A 2ZS1D 1GLIB 3ECLA 4XS0A 3DHRB 3GOUA 3VAUA 4MQGA 3SZKA 2EB9A 1DKEB 3UHRA 3EU1B 1FSXB 1TU9A 3ZJHA 5CN6A 1WVPA 3VREA 1MLOA 2ZS1B 4NI1B 3AQ5A 1YG5A 1Y09B 1BZRA 1Y4QB 4PQBA 2ZSXA 1XZ5A 2ZLWB 4B3WA 1QSHA 3S1JA 3QM9A 3QJBB 2NSRA 2ZS1C 1S5YA 5KERB 1DO7A 1G9VB 3OZWA 1GDIA 1M6MA 1V4XB 1QXDA 1S69A 3RGKA 2OH8A 1Y5KA 1HJTA 2PGHB 1MLHA 3ZJPA 1DLYA 1LH3A 3D1AB 4MQJA 1MTJA 1A3OA 4X0LB 3UHKA 1MOAA 1Y8KA 1WMUA 1J7SB 3UHXA 3S66A 1YIEA 3UI0A 2MGBA 3S48C 3DHRA 2AURA 2D60A 4AVEA 1CH4A 1VXEA 1CQXA 3RJ6A 1DXVA 3MKBA 1JDOA 1R1XB 2RAOA 3ZJNA 1RPSB 3TM9A 2ZSTA 4HSXA 1Y4VA 3ARJA 1NPGA 1MBNA 2GL3A 3WCTA 3VREB 4O2GA 5JDOF 5SW7A 2ZS1A 3UHCA 3PELA 2WTGA 5ILPA 1CG8B 1SHRA 2XYKA 1B86A 1QI8A 1YFFB 2M6ZB 1M6CA 1F5PA 1LFLA 5CNBA 3ZJIA 3IA3B 1B0BA 3HF4B 2V1FA 1Y5KB 2PGHA 1V75A 2ZFBB 1LFYA 4ROMA 1IRDA 1FAWA 1FDHA 3UHHA 4X0LA 1HBSA 2WTHA 3QJCB 1WMUB 3UHEA 1J3ZB 1FLPA 3A2GA 3PI4A 1YEQA 4GZGA 2R1HB 2MB5A 1A4FB 1DLWA 4G51B 3BJ1A 5M3SA 2HBEA 3BOMA 1HV4A 1CMYB 1BBBA 2RI4A 1O1IA 2ZSPA 3OO5B 1UVXA 4MAXA 2QLSA 1G09B 1VXCA 4MBNA 3QJDA 3DUTA 3PELB 1I3EA 1PBXA 1JEBA 1ECAA 5CNEA 1QI8B 1OR4A 1YFFA 2AUOA 1BZZB 4HRRA 1XXTA 4MQCA 2DHBA 1XZVB 4FC3A 1V5HA 4F69A 1Y8IB 3GKTA 5JDOE 1W92A 3IC2B 1OFKA 1HBRA 1MODA 1YE2A 3BJ3A 1YH9A 2ZLXB 1O16A 2HBCB 3WHMA 2ZLUA 1LFTA 1AJHA 5EV5A 2HHEA 1OBMA 1I3DA 5AZRA 2VLXA 3MOUA 4FH6A 2QSSA 5EETA 2O5QX 2BMMA 1MYZA 4HSWA 3GQGA 1CMYA 2R4WA 1MNJA 1CH1A 2QMBB 1MLLA 1HGAA 3BCQA 2NRMA 1YVQB 1CH5A 1NXFA 5C6EA 4MQIA 1NIHA 2VLZA 5D5RA 1LHTA 1O1PB 2Z8AA 3WCVB 2G3HA 1KD2A 1DWTA 2DN1B 1A0ZA 2ZT1A 4KN3A 3DR9A 1Y0WA 2NRLA 1A6MA 1NS9B 1OUUB 1YHEA 1LHSA 1Y4FB 4N7OA 1RTXA 2ZLXA 4MXKA 3ODQB 1DO4A 1BZ1A 1Y7DA 1RQAB 4XDIA 3K8BB 1JZLA 2HBGA 1BABB 3UHTA 2QSSB 4FWZA 4H07A 3V2ZA 1QPWB 1HACB 4C0NA 1CH7A 1MBDA 2QMBA 4L7YB 3M38A 2QFKA 1ABYB 2EVPA 3HC9A 2HCOB 3QJEB 5E29B 3NFEA 1V4UA 1SDKB 3UGYA 5IKSA 1YEUA 1QXEA 3WCUC 2R80B 2W6XA 4U8UA 1GBUB 3U3EA 4F6FA 1DXTA 2BK9A 1AJ9B 1YE0B 3WI8A 1A6KA 1Y4FA 4N7OB 2H35B 3K9ZA 1NQPB 2HBFA 3PT8A 1J3YA 4O35A 1J41A 4ROLB 1HABB 3MBAA 1J3FA 3GYSA 3ZHWA 2SPNA 108MA 1VWTB 6HBIA 1YCBA 3UHGA 1MLNA 3D17A 3HENA 1Y0TA 1NEJB 4UIQA 1RVWB 5E6EB 1JP8A 3WCUA 1BZPA 1NPFA 1HDBA 3ZJLA 3ZOLA 3ECZA 4XS0B 1IT3A 1GCVB 1MDNA 1NWNA 5HLQA 5HLUA 1YEUB 3HEOA 3M3BA 1CIKA 2AV0A 4IROA 3G4WA 3S65A 2BNLA 2HZ1A 4F4OB 1RQ4B 3PI9A 1Y35A 1Y5FB 2B7HA 5CMVA 1Y4QA 1Y22A 3D4XA 3AQ9A 1RSEA 5EQMA 1HDSA 1YENB 3GYSB 2G0RA 1HCOA 3D17B 1UMOA 1S0HA 3UHWA 1RVWA 2DN3A 4F6JA 2ZLTA 2ZSYA 3B75A 1J7SA 1MBSA 1Y01B 2MBWA 4MU5A 2D5XA 1YIEB 4M4AA 2MGMA 3D7OB 2DN2A 1YEOB 1JPBA 2ZLVA 3UHZA 1VREA 1A0UA 3MKBB 1JZKA 2PEGA 3CIUB 1NS6A 1YVTB 2G11A 1GDJA 1HLBA 2HHBA 1LA6B 4F4OA 3GDJB 3AG0A 2HBSB 1FHJB 1Y7GA 3AT6B 1CG8A 1SHRB 1OUTA 1HGBB 2ZWJA 3MYMA 5JGGA 1JP6A 1X9FD 2D2NB 3MN0A 1X3KA 1M9PB 2AUQA 1Y0CB 3G4VA 4YU3B 1HCOB 2HHDA 112MA 2GTLB 4L2MA 1BZ6A 1ECNA 4NK1A 2ZS0A 1ECOA 3HXNA 1UIWB 2OH9A 1G0BB 2BWHA 2D2ND 3NMMB 3QM5A 4MQKB 5F2AA 1LH1A 2HZ2A 1A6NA 1YEVB 1LFVA 2H8FA 1HGCA 1MLUA 1T1NB 3ECXA 4BJAA 3GKVA 4UURA 1Y2ZB 3BOMB 4OODA 3QQRA 4HBIA 4DC8A 3OO5A 1MOBA 1CH3A 1C7CB 3QJDB 1BIJB 3E4NA 1LH2A 5EYSA 3AT6A 4UZVA 1IWHB 1CG5B 1LH7A 1A3NB 1NZ2A 1YOGA 2FRFA 1BZZA 2V1EA 1JP9A 3K3UA 1XXTB 4MQCB 1J7YA 2GTLA 3UHQA 1GLIA 4YU4A 111MA 1V07A 5CN4A 1YHRB 4PQ6A 2GRFA 1UIWA 3NMMA 3QZZA 3SDNA 2OLPA 2QSPB 4N7PB 5EUIA 1K0YB 3PI8B 2AUPA 1DM1A 3SZKB 1VRFA 1HGCB 2H8FB 4U8UD 3EU1A 2ZT0A 103MA 1LFQB 1Y4RB 1UVYA 3A9MA 2QU0B 3PI2A 3GQGB 5CN9A 1Y4PB 3OJ1A 3WCTC 3QM6A 1THBA 1Z8UB 1IWHA 2VRYA 1J40B 5HU6B 1NIHB 4WJG1 1MLSA 3D1AA 1HDAA 2V1JA 2MGHA 1LFZA 3D1KB 3G53A 1Y0WB 1EMYA 1NWIA 1NS9A 3S66B 3CY5B 4G1VA 1Y46B 1CP0A 2ZSSA 4TWVA 3DHTA 1Y7DB 2Z6SA 3PT7B 5EUIB 3QMAA 1DXVB 1UT0A 1KR7A 3AQ8A 1VXFA 1Y45A 1V9QA 2RAOB 2ZSNA 1JL7A 3S1IA 2V1HA 1G0AA 1Y8HA 1ITHA 1S5XB 1NZ4A 1VXAA 1MLQA 3G52A 1JY7A 2NX0A 4F6GA 1R1YB 1Y7CA 101MA 1CBMA 1Y4GA 1A6GA 3WTGA 3AT5B 1EWAA 1YHUC 4B4YA 1MYIA 5E29A 1DTMA 1XZ2A 1V75B 4DWUA 1HBAB 5KKKA 1XZ4B 4NK2A 4NZIA 1C7BA 1LH5A 1Y83A 3MVCA 1NAZA 1DXTB 2O58X 2OIFA 4NS2A 3GQRA 3WCVC 1YZIB 1GDLA 3DHTB 1J3YB 2MGEA 2BKMA 2EVKA 3GQPB 1GCWB 4MQHB 1Y45B 3A5BA 4JYQA 2BLJM 2MYAA 1RQ3B 2D2MD 1A01A 1O1LB 3HRWB 1BBBB 2RI4B 3KMFA 1MYHA 3A0GA 2VM0A 1NEJA 2MGAA 1Y7ZB 2ZSRA 1PBXB 1DXUB 2D5ZA 2AV3A 3UHBA 5E6EA 1YGFB 1Y5JB 1X9FA 1YMCA 3IXFA 1A9WE 1HDBB 3UH5A 5AB8A 4HRRB 1GCVA 1LTWA 2ZT4A 1A00A 2GTLC 1IRCA 2GLNA 1CQ2A 1XZVA 1A9WA 2VYWA 4ESAB 2BLHA 3IC2A 1VXDA 3RJNB 2VLYA 3GK9A 1XZ4A 1C7BB 3UHIA 4IROB 2HBCA 3WHMB 2Z6NA 3WCPA 2G10A 2ZLUB 3VRFB 3ZH0A 1FSXA 1NGKA 2ZT2A 5ILRA 4NXCA 5JOMA 4FH7A 5C6YA 3UH3A 1GCWA 4MQHA 1MBCA 1HDSB 1N9HA 1YG5B 1JF4A 5JDOC 1HBGA 3ONZA 3QJBA 1HGAB 3HYUA 4HRTA 3IC0A 1Y7ZA 1MTKA 1V4XA 5E83A 1F63A 3HHBB 3W4UB 2G14A 2ZLTB 3B75B 2R4YA 2ZS0C 1S6AA 1UFJA 2GRHA 3D7OA 2LH5A 1CH2A 2D6CA 1Q1FA 2ZFOC 1J52A 2D2MB 2DN1A 1EW6A 1IBEA 5EE4D 3OZVA 3R5IA 3NG6A 2PEGB 3WCWD 1Y31A 3CIUA 3WCWC 2D60B 2MGJA 1G08B 1DO1A 1O1KB 2MYDA 1CIOA 1RQAA 2FRJX 1LA6A 2XKHA 4NI0B 1RPSA 2W6WA 2ZS0D 2W72B 1Y4VB 2R50A 1OUTB 1SWMA 1SDLA 5JGGB 1UC3A 5SW7B 5B85A 3WFUA 6HBWB 2D2NA 4N8TA 2VYYA 2Z85A 5KDQB 3P5QA 4AVDA 2YRSA 3ONZB 4L7YA 1DWSA 3QM7A 5CNGA 1GVHA 5CN8A 1XQ5B 4G1BA 3KUNA 1LFYB 3NFEB 4ROMB 3MYNA 1NZ3A 1N9IA 1FAWB 3FH9B 3BA2A 1GBUA 4HHBA 1YDZA 1IBEB 1J7WA 1BZ0B 1Y0DB 1YE0A 3R5IB 3NG6B 1G08A 2EF2A 1O1KA 1O1OB 1CBLA 4G51A 2VHBA 3UHVA 2GTLD 1BIJA 1YGDA 1HV4B 3UHYA 1Y4BB 3H57A 1XY0A 2GKNA 1G9VA 1OR6A 4M4BA 1MLJA 1G09A 1VWTA 1QXDB 2R4XA 6HBWA 1Y0AA 3DUTB 2LH7A 3P5QB 1URVA 3UHSA 1J7YB 2HBDA 1SI4B 4SDHA 4ZVAA 1XQ5A 1Y8IA 3A59B 2QSPA 4N7PA 5EU2A 1XZ7A 1MOHA 2W6VB 1U7SA 3G46A 2SPLA 3WCVD 1J7WB 3MJPA 3WCWB 1IDRA 3WCTB 4C44A 1YMAA 4LPIA 4KMWA 2MHBA 1BUWB 1RTEA 5HLXA 3M39A 3G4UA 2OHAA 4O1TA 1Y4BA 2FRIX 1HSYA 1XY0B 2M6ZA 4M4BB 3MJUB 3HF4A 1IT2A 1LH6A 102MA 3A5GA 3H58A 2DXMA 2H8DB 1GBVB 3D1KA 1YCAA 1N9FA 1O1PA 1CH9A 3WCVA 1Y8WA 1ABWA 3UHUA 3V2VA 1KD2B 2DN2B 3PT7A 2ZLVB 1DUKA 1QSIA 4ODCB 4KJTA 1GDKA 1NS6B 2HBEB 2QRWA 3K8BA 3EDBA 1LJWA 1BABA 1H97A 2V1GA 1G0AB 1Y8HB 2O5MX 2MHBB 1JY7B 2HBSA 3NL7A 1FHJA 1Y7GB 1MKOB 4PNJA 2MYEA 1JEBB 1Y4GB 2MGDA 3FS4A 2BLIA 3ZJOA 1MZ0A 2G0XA 3WCTD 3MJUA 1FN3B 2KSCA 3KUOA 1XZ2B 4FWYA 4ILZA 2V1KA 2HCOA 1CLSB 106MA 2DXMB 2H8DA 3VRGB 1MNKA 3BJ3B 1YH9B 1Y8WB 3UBCA 3ED9A 3LHBA 3ZJJA 4H0BA 2MGIA 1MNIA 3G4RA 4U8UC 2HZ3A 1YEVA 2GDMA 1O1JB 3O7NA 4WCHD 1QSIB 1T1NA 1BVCA 3G4YA 2BW9M 2ZT3A 1A01B 1O1LA 2GNWA 3HRWA 3LR9A 1Y09A 4F68A 4H2LB 1XZ5B 2ZLWA 1MYFA 1NZ5A 1Y85A 3A0GB 1MWCA 1S5YB 5KERA 1F65A 2D5ZB 1MKOA 3AQ7A 1XYEA 1YOHA 1SPGA 5D1VA 1A3OB 1XZUA 1V4WA 3EOKA 1FCSA 1DWRA 4KMVA 2C0KA 4MBAA 1ECDA 1URYA 4YU4B 1SPEA 1CLSA 2ZFOA 2W31A 2Z6TA 1K1KA 1TESA 1MLMA 2G0ZA 2XKGA 3WR1A 2Z6NB 110MA 7HBIA 1K0YA 3PI8A 1FSLA 1JW8A 1HHOA 1MOCA 3VRFA 1IOPA 1U7RA 3OO4A 1MYMA 5CN5A 2O5BX 3S65B 3ARKA 2QFNA 1GZXB 2ZSZA 1LFQA 1Y4RA 2D2NC 3LQDB 4N7NA 1Y35B 1Y5FA 2B7HB 1C40A 3ZJMA 3UGZA 3LB1A 1MLKA 1B86B 1HRMA 3IC0B 1UFPA 1ABYA 5HY8B 1FDHG 1LFLB 1THBB 5ILEA 2O5TX 2GKMA 3HHBA 3W4UA 1X9FC 1XYEB 3TLDA 2ZFBA 2G12A 1F5OA 1IRDB 1N9XA 1L2KA 1S0HB 2R4ZA 2E2YA 2DN3B 2AA1A 1YIHA 4WJGA 1H1XA 1MCYA 2G0VA 1MYJA 4F6BA 1K1KB 1HBBB 1Y31B 2H35A 2GNVA 2R1HA 1BINA 2MYBA 1A4FA 1HLMA 1EBTA 1HHOB 1J41B 3OO4B 1YVTA 1O1IB 3LB3A 5CNFA 107MA 1GZXA 5EYJA 2QLSB 3LQDA 1SDLB 1HBHB 1OJ6A
chains in the Genus database with same CATH superfamily
3GDJA 4N8TB 3VNCA 1DTIA 2GRZA 2XKIA 1S5XA 2YRSB 1C7DA 1MLGA 3A5AA 5CNDA 1PMBA 1EBCA 5HY8A 1M9PA 3WCUB 1VHBA 3WTGB 3AT5A 2HHDB 3PMDA 1S61A 4F6DA 1HBAA 1HBRB 3O2CB 1YIHB 1CO8A 1G0BA 3GOUB 4DWTA 1X46A 1VXBA 1YDZB 1UX9A 3QQQA 2IG3A 2NSSA 2O5OX 2UUNB 1AJGA 1LFTB 1HBBA 1LFVB 1YZIA 5B84A 3PI9B 1O1NA 3PIAB 3OK5A 1JWNA 3BJ2A 2MGLA 1Y22B 2MGGA 5CHQA 4ZVBA 4XXIA 1JF3A 4NI1A 4IT8A 1DUOA 1DXDA 3ASEA 1C7CA 1HBHA 3BCQB 105MA 1D8UA 1QSHB 1Y0AB 3ZOMA 5MBAA 4XXKA 1VXGA 1C7DB 5C6EB 1DXUA 4QAUA 3R0GA 2HBDB 1YGFA 1SI4A 3TM3A 2O5SX 2G0SA 1KFRA 4VHBA 4MQJB 2D5XB 5EOHA 4M4AB 1PHNB 1A00B 1A0ZB 3WFTA 1YEOA 2CMMA 1Y8KB 1COHB 1XDTT 1XZ7B 5HBIA 2W6VA 4ESAA 1DO3A 1YHEB 1BZ1B 3MJPB 3WCWA 5EE4C 3WCPB 4NXAA 3O89A 1R1XA 1MNOA 2ZFOD 1O1NB 3PIAA 3WCUD 3BJ2B 2W6YA 3MWNA 1CP5A 2QU0A 5ILMA 1HGBA 2V1IA 1QPWA 3HYUB 1MYTA 3WFWA 2ZS0B 3E5OA 5JDOD 5CHRA 2EB8A 1J40A 3HXNB 1GBVA 1V4UB 1SDKA 3SDHA 1MTIA 2LHBA 3EDAA 1MBAA 1MNHA 4MQKA 2R80A 3ORDA 1LFZB 3ZJSA 1HBSB 3QJCA 2D2MA 1COHA 1J3ZA 1MBOA 2DKDA 2LH2A 2LH6A 3GKVB 1YEQB 2JHOA 1Y2ZA 1OFJA 1BVDA 1KTPA 4ROLA 3BJ1B 1HABA 4NI0A 1DXCA 1YOIA 1MWBA 1ABSA 3HEPA 1Y0TB 3E55A 2FRKX 3FS4B 3O18A 3G4QA 1Y7CB 3FEWX 2MYCA 2SPOA 1FN3A 3V57A 3WFXA 2VEEA 1YHUA 1YHRA 2D2MC 2DHBB 3VRGA 1S56A 3LR7A 1BJEA 4FC3B 5AZQA 3LB4A 3FH9A 2DC3A 2LH1A 109MA 1O1JA 1YE2B 1Y83B 3UHNA 3PI3A 4HHBB 4ETVA 1MYGA 2V8AA 1CPWA 3GQRB 5CN7A 1MWDA 5F0BA 2MGKA 1BZ0A 1Y0DA 1RQ4A 1WACA 2HHEB 4MXLA 1CIIA 3UH6A 4A8KA 2IN4A 4H2LA 3D4XB 3GQPA 1O1OA 4DC7A 3AQ6A 1Y85B 2W72C 3BRPA 2VYZA 1RQ3A 1YGDB 1Y4PA 1YENA 1XF6C 1YHUD 3KMFC 1WLAA 104MA 1HBIA 5HU6A 3ZJRA 1SGKA 1SPGB 1YVQA 1F99A 3ARLA 1XZUB 1V4WB 3EOKB 1HDAB 4MQIB 2FALA 5HAVA 3VHBA 3UH7A 1YHUB 4O4TA 2ZFOB 3PI1A 3CY5A 2MGCA 2UULD 1Y46A 3LQ9A 1VXHA 3A59A 3WR1B 1A0UB 1OUUA 1UX8A 4YJJB 2UULB 2SPMA 3ODQA 1O1MB 2HHBB 1JL6A 1JZMA 1MLRA 4N7NB 3QZXA 3OGBA 1LUEA 3NMLA 3UHDA 1C40B 4JACA 1BUWA 3ZJQA 2ZSQA 3UBVA 1R1YA 4B02A 5CNCA 3OZUA 1Y0CA 1HACA 4YU3A 4TWUA 2ZSOA 4HRTB 1MBIA 3QM8A 1A87A 1ASHA 5E83B 1GJNA 4TYXA 2AA1B 3QJEA 2EKTA 2EKUA 2LH3A 1XCHA 1DDTA 1ABWB 1QXEB 4MQGB 4F0UB 1DKEA 3OVUC 4U8UB 2O5LX 4FWXA 1AJ9A 3E5IA 2OHBA 1MLFA 4ODCA 4O4ZA 1NQPA 2HBFB 3DBJA 1O1MA 3PT8B 4OF9A 2VEBA 3GLNA 3M3AA 4F6IA 1UVMA 4PQCA 1LJWB 1UVIA 2FAMA 2W72A 4MPMA 5MBNA 3LB2A 1YMBA 3RQRA 3NL7B 2MGFA 1AZIA 1CG5A 1MGNA 1A3NA 4H0MA 1Y5JA 1X9FB 2WY4A 4LMXB 5KDQA 1CO9A 2ZS1D 1GLIB 3ECLA 4GXEA 2C7LB 1ALLA 4XS0A 2C7KB 3DHRB 3GOUA 3VAUA 2UUNA 4MQGA 3SZKA 2EB9A 1DKEB 3UHRA 3EU1B 1FSXB 1TU9A 3ZJHA 5CN6A 1WVPA 3VREA 1MLOA 2ZS1B 4NI1B 3AQ5A 1YG5A 1Y09B 1BZRA 1Y4QB 4PQBA 2ZSXA 1XZ5A 2ZLWB 4B3WA 5B13A 1QSHA 3S1JA 3QM9A 3QJBB 2NSRA 2ZS1C 1S5YA 5KERB 1DO7A 1G9VB 2UUMB 1GDIA 3OZWA 1M6MA 1V4XB 1QXDA 1S69A 3RGKA 2OH8A 1Y5KA 1HJTA 2PGHB 1MLHA 3ZJPA 1DLYA 1LH3A 3D1AB 4MQJA 1MTJA 1A3OA 4X0LB 3UHKA 1MOAA 1Y8KA 1WMUA 1J7SB 3UHXA 3S66A 1YIEA 3UI0A 2MGBA 3S48C 2C7KA 3DHRA 2AURA 2D60A 4AVEA 1CH4A 1VXEA 1CQXA 3RJ6A 1DXVA 3MKBA 1JDOA 1R1XB 2RAOA 3ZJNA 1RPSB 3TM9A 2ZSTA 4HSXA 1Y4VA 3ARJA 1NPGA 1MBNA 2GL3A 3WCTA 3VREB 4O2GA 5JDOF 5SW7A 2ZS1A 3UHCA 3PELA 2WTGA 5ILPA 1CG8B 1SHRA 2XYKA 1B86A 1QI8A 1YFFB 1HI0P 4ZIZA 2M6ZB 1M6CA 1F5PA 1LFLA 5CNBA 3ZJIA 3IA3B 1B0BA 3HF4B 2V1FA 1Y5KB 2PGHA 1V75A 4ETUA 2ZFBB 1LFYA 2YSKA 4ROMA 1IRDA 1FAWA 1FDHA 3UHHA 4X0LA 1HBSA 2WTHA 3QJCB 4Q70A 1WMUB 3UHEA 1J3ZB 1FLPA 4F0TA 3A2GA 3PI4A 1YEQA 4GZGA 2R1HB 2X49A 2MB5A 1A4FB 1DLWA 4G51B 3BJ1A 5M3SA 2HBEA 3BOMA 1HV4A 1CMYB 1BBBA 2RI4A 1O1IA 2ZSPA 3OO5B 1UVXA 4MAXA 2QLSA 1G09B 1VXCA 4MBNA 3QJDA 3DUTA 1B33B 3PELB 1I3EA 1PBXA 1JEBA 1ECAA 5CNEA 1QI8B 3V57B 1OR4A 1YFFA 2AUOA 1BZZB 4HRRA 1XXTA 4MQCA 2DHBA 1XZVB 4FC3A 1V5HA 4F69A 1Y8IB 3GKTA 5JDOE 1W92A 3IC2B 1OFKA 1HBRA 1MODA 1YE2A 4Q70B 3BJ3A 1YH9A 2ZLXB 1O16A 2HBCB 3WHMA 4BJUA 2ZLUA 1LFTA 1AJHA 5EV5A 2HHEA 1OBMA 1I3DA 5AZRA 2VLXA 3MOUA 4FH6A 2QSSA 5EETA 2O5QX 2BMMA 1MYZA 4HSWA 3GQGA 1CMYA 4GY3B 2R4WA 1MNJA 1CH1A 2QMBB 1MLLA 1HGAA 3BCQA 2NRMA 1YVQB 1CH5A 1NXFA 5C6EA 4MQIA 1NIHA 2VLZA 5D5RA 2VMLB 1LHTA 1O1PB 2Z8AA 3WCVB 2G3HA 1KD2A 1GH0A 1PHNA 1DWTA 2BV8B 2DN1B 4A8QA 1A0ZA 2ZT1A 4KN3A 3DR9A 1Y0WA 2NRLA 1A6MA 1NS9B 1OUUB 1YHEA 1LHSA 1Y4FB 4N7OA 1RTXA 2ZLXA 4MXKA 3ODQB 1DO4A 1BZ1A 1Y7DA 1RQAB 4XDIA 1HHTP 3K8BB 1JZLA 2HBGA 1BABB 3UHTA 2QSSB 4FWZA 2VJTA 4H07A 3V2ZA 1QPWB 1HACB 4C0NA 1CH7A 1MBDA 2QMBA 3GIOA 4L7YB 3M38A 2QFKA 1ABYB 2EVPA 3HC9A 2HCOB 3QJEB 5E29B 3NFEA 1V4UA 1SDKB 3UGYA 5IKSA 4LMSB 1YEUA 1QXEA 3WCUC 2R80B 4F0UA 2W6XA 4U8UA 1GBUB 1XG0C 3U3EA 4F6FA 1DXTA 2BK9A 1AJ9B 1YE0B 3WI8A 1A6KA 1Y4FA 4N7OB 2H35B 4ESUA 3K9ZA 1NQPB 2HBFA 3PT8A 1J3YA 4O35A 1J41A 4ROLB 2DKAA 2WCQA 1HABB 1UVKA 3MBAA 1B8DB 2UUMX 1J3FA 4A8YA 3GYSA 3ZHWA 2SPNA 108MA 1VWTB 6HBIA 1YCBA 3UHGA 1MLNA 1CPCA 3D17A 3HENA 1Y0TA 1NEJB 4UIQA 1RVWB 5E6EB 1JP8A 3WCUA 1BZPA 1NPFA 1HDBA 2C7LA 3ZJLA 3ZOLA 3ECZA 4XS0B 4A8WA 1IT3A 1GCVB 1MDNA 1NWNA 5HLQA 5HLUA 1YEUB 3HEOA 3O2CA 3M3BA 1CIKA 2AV0A 4IROA 3G4WA 3S65A 2BNLA 2HZ1A 4F4OB 1RQ4B 3PI9A 1Y35A 1Y5FB 2B7HA 5CMVA 1Y4QA 1Y22A 3D4XA 3KVSA 4N6SA 4HH1A 3AQ9A 3BRPB 1RSEA 5EQMA 1HDSA 1B8DA 1YENB 3GYSB 2G0RA 1HCOA 1CPCB 3D17B 1UMOA 1F99B 1S0HA 3UHWA 1RVWA 1UVJA 2DN3A 4F6JA 2ZLTA 2ZSYA 3B75A 1J7SA 1MBSA 1Y01B 2MBWA 4MU5A 2D5XA 1YIEB 4M4AA 2MGMA 3D7OB 1I7YA 2DN2A 1YEOB 1JPBA 2ZLVA 3UHZA 3V58B 1VREA 1A0UA 3MKBB 4A8SA 1JZKA 2PEGA 4BS9A 3CIUB 1NS6A 1YVTB 2G11A 1GDJA 1HLBA 2UULH 5FVBM 2HHBA 1LA6B 4F4OA 3GDJB 3AG0A 2HBSB 1FHJB 1Y7GA 3AT6B 1CG8A 1SHRB 1OUTA 1HGBB 2ZWJA 3MYMA 5JGGA 1JP6A 1X9FD 2D2NB 3MN0A 1X3KA 1M9PB 2AUQA 1Y0CB 3G4VA 4YU3B 1HCOB 1UVNA 2HHDA 112MA 2GTLB 4L2MA 1BZ6A 1ECNA 4NK1A 1NY9A 2ZS0A 1ECOA 3HXNA 1UIWB 2OH9A 1G0BB 2BWHA 2D2ND 3NMMB 3QM5A 1EYXA 4MQKB 5F2AA 1HI8A 1LH1A 2HZ2A 1A6NA 1YEVB 1LFVA 2H8FA 1HGCA 1MLUA 4Z8KB 1T1NB 3ECXA 4BJAA 3GKVA 5AQDM 4UURA 1Y2ZB 3BOMB 4OODA 4PO5A 3QQRA 4HBIA 4DC8A 3DBJB 3OO5A 1MOBA 1CH3A 1C7CB 3QJDB 1BIJB 3E4NA 1LH2A 5EYSA 3AT6A 4UZVA 1IWHB 1CG5B 1LH7A 1A3NB 1NZ2A 1YOGA 2FRFA 4AE1A 1BZZA 2V1EA 1JP9A 3K3UA 1XXTB 4MQCB 1J7YA 2GTLA 3UHQA 1GLIA 4YU4A 111MA 1V07A 5CN4A 4ETTA 1YHRB 4PQ6A 2GRFA 2VJHB 5AQDA 1UIWA 3NMMA 3QZZA 3SDNA 2OLPA 2QSPB 4N7PB 5EUIA 1K0YB 3PI8B 2AUPA 1DM1A 3SZKB 1VRFA 1HGCB 2H8FB 4U8UD 3EU1A 2C7JB 2ZT0A 103MA 1LFQB 1Y4RB 1UVYA 3A9MA 2JL9A 2QU0B 3PI2A 3GQGB 1QGWC 5CN9A 2J96A 1Y4PB 3OJ1A 3WCTC 3QM6A 1THBA 3GUQA 1Z8UB 1IWHA 2VRYA 1J40B 5HU6B 2WCRA 1NIHB 4WJG1 1MLSA 1ON7B 3D1AA 1HDAA 2V1JA 2MGHA 1LFZA 3D1KB 3G53A 1Y0WB 1EMYA 1NWIA 1NS9A 3S66B 2VJHA 3CY5B 4G1VA 1Y46B 1CP0A 2ZSSA 4TWVA 3DHTA 1Y7DB 3PT7B 2Z6SA 5EUIB 3QMAA 1DXVB 1KTPB 1UT0A 1KR7A 3AQ8A 1VXFA 1Y45A 3PMCA 2UULC 1V9QA 2RAOB 2ZSNA 1JL7A 3S1IA 2V1HA 4TMAB 1G0AA 1Y8HA 1ITHA 1S5XB 1NZ4A 1VXAA 1MLQA 3G52A 1JY7A 2NX0A 4F6GA 1R1YB 1Y7CA 101MA 1CBMA 1Y4GA 1A6GA 3WTGA 4ZIZB 3AT5B 1EWAA 1YHUC 4B4YA 1MYIA 4ERTA 5E29A 1DTMA 1XZ2A 1V75B 4DWUA 1HBAB 5KKKA 1XZ4B 4NK2A 4NZIA 1C7BA 1LH5A 1Y83A 3MVCA 1NAZA 1DXTB 2O58X 2OIFA 4NS2A 3GQRA 3WCVC 1YZIB 1GDLA 3DHTB 1J3YB 2MGEA 2BKMA 2EVKA 3GQPB 1GCWB 4MQHB 1Y45B 3A5BA 4JYQA 2BLJM 2MYAA 1RQ3B 2D2MD 1A01A 1O1LB 3HRWB 1BBBB 2RI4B 3KMFA 1MYHA 3A0GA 5FVBA 2VM0A 1NEJA 2MGAA 1Y7ZB 1B33A 2ZSRA 1PBXB 1DXUB 2D5ZA 2AV3A 3UHBA 5E6EA 1YGFB 1Y5JB 1X9FA 1YMCA 3IXFA 1A9WE 1HDBB 3UH5A 5AB8A 3L0FA 4HRRB 1GCVA 1LTWA 2ZT4A 1A00A 2GTLC 1IRCA 2GLNA 1CQ2A 1XZVA 1A9WA 2VYWA 4GXEB 4ESAB 2BLHA 3IC2A 1VXDA 3RJNB 4A8FA 2VLYA 3GK9A 1XZ4A 4YJJA 1C7BB 3UHIA 4IROB 2HBCA 3WHMB 2Z6NA 3WCPA 2G10A 2ZLUB 3VRFB 3ZH0A 1FSXA 1NGKA 2ZT2A 5ILRA 1F0LA 4NXCA 5JOMA 4FH7A 5C6YA 3UH3A 1GCWA 4MQHA 1MBCA 1HDSB 1N9HA 1YG5B 1JF4A 5JDOC 1HBGA 3ONZA 3QJBA 1HGAB 3HYUA 4HRTA 3IC0A 1Y7ZA 1MTKA 3NUHB 1V4XA 5E83A 1F63A 3HHBB 3W4UB 2G14A 2ZLTB 3B75B 2R4YA 3L0FB 2ZS0C 1S6AA 1UFJA 2GRHA 4AE0A 3D7OA 2LH5A 1CH2A 2D6CA 1Q1FA 2ZFOC 1J52A 2D2MB 2DN1A 1EW6A 1IBEA 5EE4D 3OZVA 3R5IA 3NG6A 2PEGB 3WCWD 1Y31A 4ERVA 3CIUA 3WCWC 2D60B 2MGJA 1G08B 1DO1A 1O1KB 2MYDA 1CIOA 1RQAA 2FRJX 1RH1A 1LA6A 2XKHA 4NI0B 1RPSA 2W6WA 4L1EB 2ZS0D 2W72B 1Y4VB 2R50A 1OUTB 1SWMA 1SDLA 5JGGB 1UC3A 5SW7B 5B85A 3WFUA 4A8OA 6HBWB 2D2NA 4N8TA 2VYYA 2Z85A 5KDQB 3P5QA 4AVDA 2YRSA 3ONZB 4L7YA 1DWSA 3QM7A 5CNGA 1ALLB 1GVHA 5CN8A 1XQ5B 4G1BA 3KUNA 1LFYB 3NFEB 4ROMB 3MYNA 1NZ3A 1N9IA 1FAWB 3FH9B 3BA2A 1GBUA 4HHBA 4Z8KA 2V8AB 4F0TB 1YDZA 1IBEB 1J7WA 1LIAA 1UVLA 1BZ0B 1Y0DB 1YE0A 1JBOA 3R5IB 3NG6B 4PO5B 1G08A 2EF2A 1O1KA 1O1OB 1CBLA 4G51A 2VHBA 3UHVA 2GTLD 1BIJA 1YGDA 1HV4B 3UHYA 1Y4BB 3H57A 1XY0A 2GKNA 1G9VA 1OR6A 4M4BA 1MLJA 1G09A 1VWTA 1QXDB 2R4XA 6HBWA 1Y0AA 3DUTB 2LH7A 3P5QB 1URVA 2DKCA 3UHSA 1J7YB 2HBDA 1MDTA 1SI4B 1HI1A 4SDHA 4ZVAA 1XQ5A 2X4AA 1Y8IA 3A59B 2QSPA 4N7PA 4LM6B 5EU2A 1XZ7A 1MOHA 2W6VB 1U7SA 3G46A 2SPLA 5B13G 3WCVD 1J7WB 1LIAB 3MJPA 3WCWB 1IDRA 1JBOB 3WCTB 4C44A 1YMAA 4LPIA 4KMWA 2MHBA 1BUWB 1RTEA 5HLXA 3M39A 3G4UA 4GY3A 2OHAA 4O1TA 1Y4BA 2FRIX 1HSYA 1XY0B 2M6ZA 4M4BB 3MJUB 3HF4A 1IT2A 1LH6A 102MA 3A5GA 3H58A 2DXMA 2H8DB 1GBVB 3D1KA 2VMLA 1YCAA 1N9FA 1O1PA 1CH9A 3WCVA 1Y8WA 1ABWA 3UHUA 3V2VA 1GH0B 1KD2B 2BV8A 1I7YB 2DN2B 3PT7A 2ZLVB 1DUKA 1QSIA 4ODCB 4RMPB 4KJTA 1GDKA 1NS6B 2HBEB 2QRWA 3ZTAA 4A8MP 3K8BA 3EDBA 1LJWA 1BABA 1H97A 2V1GA 1G0AB 1Y8HB 2O5MX 2MHBB 1HA7B 2JLFA 1JY7B 2VJTB 2HBSA 3NL7A 1FHJA 1Y7GB 1MKOB 4PNJA 2MYEA 1JEBB 4H0MB 1Y4GB 2MGDA 3O18B 2BLIA 3FS4A 3ZJOA 1MZ0A 2G0XA 3WCTD 3MJUA 1FN3B 2KSCA 3KUOA 1XZ2B 4FWYA 4ILZA 2V1KA 2HCOA 1CLSB 106MA 2DXMB 2H8DA 3VRGB 1MNKA 3BJ3B 1YH9B 1COLA 1Y8WB 3UBCA 1EYXB 3LHBA 3ED9A 3ZJJA 4H0BA 2MGIA 2UUND 1MNIA 3G4RA 1HHSA 4U8UC 2HZ3A 1YEVA 2GDMA 1O1JB 3O7NA 4WCHD 1QSIB 1T1NA 1BVCA 4RMPA 3G4YA 2BW9M 2ZT3A 1A01B 1O1LA 2GNWA 3HRWA 3LR9A 1Y09A 4F68A 4H2LB 1XZ5B 2ZLWA 1MYFA 1NZ5A 1Y85A 3A0GB 1HA7A 1MWCA 1S5YB 5KERA 1F65A 2UUMA 2D5ZB 1MKOA 4HH0A 3AQ7A 1XYEA 1YOHA 1TOXA 1SPGA 5D1VA 1A3OB 1XZUA 1V4WA 3EOKA 1FCSA 1DWRA 4KMVA 2C0KA 4MBAA 1ECDA 1KN1A 1URYA 4YU4B 1SPEA 1CLSA 2ZFOA 2W31A 2Z6TA 1K1KA 1TESA 1MLMA 2G0ZA 2VJRB 2XKGA 3WR1A 2Z6NB 110MA 7HBIA 1K0YA 3PI8A 1FSLA 1JW8A 1HHOA 1MOCA 3VRFA 1IOPA 1U7RA 2UULA 3OO4A 2C7JA 1MYMA 5CN5A 2O5BX 3S65B 3ARKA 2QFNA 1GZXB 2ZSZA 1LFQA 1Y4RA 2D2NC 3LQDB 4N7NA 1Y35B 1Y5FA 2B7HB 1C40A 3ZJMA 3UGZA 3LB1A 1MLKA 1B86B 3KVSB 4N6SB 1HRMA 3IC0B 1UFPA 1ABYA 5HY8B 1FDHG 1LFLB 1THBB 5ILEA 2O5TX 2GKMA 3HHBA 3W4UA 1X9FC 1XYEB 3TLDA 2ZFBA 2G12A 1F5OA 1IRDB 1N9XA 1L2KA 1S0HB 1ON7A 2R4ZA 2E2YA 2DN3B 2AA1A 1YIHA 4WJGA 1H1XA 1KN1B 1MCYA 2G0VA 2I88A 1MYJA 4F6BA 1K1KB 1HBBB 1Y31B 2H35A 2GNVA 2R1HA 1BINA 2MYBA 2VJRA 3V58A 1A4FA 1HLMA 1EBTA 1HHOB 1J41B 3OO4B 1YVTA 4L1EA 1O1IB 2JLGA 3LB3A 5CNFA 107MA 1GZXA 5EYJA 2QLSB 3LQDA 1SDLB 1HBHB 1OJ6A
chains in the Genus database with same CATH topology
3GDJA 4N8TB 1DTIA 2GRZA 2XKIA 1S5XA 2YRSB 1C7DA 1MLGA 3A5AA 5CNDA 1PMBA 1EBCA 5HY8A 1M9PA 3WCUB 1VHBA 3WTGB 3AT5A 2HHDB 1S61A 4F6DA 1HBAA 1HBRB 1YIHB 1CO8A 1G0BA 3GOUB 4DWTA 1X46A 1VXBA 1YDZB 1UX9A 3QQQA 2IG3A 2NSSA 2O5OX 1AJGA 1LFTB 1HBBA 1LFVB 1YZIA 5B84A 3PI9B 1O1NA 3PIAB 3OK5A 1JWNA 3BJ2A 2MGLA 1Y22B 2MGGA 5CHQA 4ZVBA 1JF3A 4NI1A 4IT8A 1DUOA 1DXDA 3ASEA 1C7CA 1HBHA 3BCQB 105MA 1D8UA 1QSHB 1Y0AB 3ZOMA 5MBAA 1VXGA 1C7DB 5C6EB 1DXUA 4QAUA 3R0GA 2HBDB 1YGFA 1SI4A 3TM3A 2O5SX 2G0SA 1KFRA 4VHBA 4MQJB 2D5XB 5EOHA 4M4AB 1A00B 1A0ZB 3WFTA 1YEOA 2CMMA 1Y8KB 1COHB 1XZ7B 5HBIA 2W6VA 4ESAA 1DO3A 1YHEB 1BZ1B 3MJPB 3WCWA 5EE4C 3WCPB 4NXAA 3O89A 1R1XA 1MNOA 2ZFOD 1O1NB 3PIAA 3WCUD 3BJ2B 2W6YA 1CP5A 2QU0A 5ILMA 1HGBA 2V1IA 1QPWA 3HYUB 1MYTA 3WFWA 2ZS0B 3E5OA 5JDOD 5CHRA 2EB8A 1J40A 3HXNB 1GBVA 1V4UB 1SDKA 3SDHA 1MTIA 2LHBA 3EDAA 1MBAA 1MNHA 4MQKA 2R80A 3ORDA 1LFZB 3ZJSA 1HBSB 3QJCA 2D2MA 1COHA 1J3ZA 1MBOA 2LH2A 2LH6A 3GKVB 1YEQB 2JHOA 1Y2ZA 1OFJA 1BVDA 4ROLA 3BJ1B 1HABA 4NI0A 1DXCA 1YOIA 1MWBA 1ABSA 3HEPA 1Y0TB 3E55A 2FRKX 3FS4B 3G4QA 1Y7CB 2MYCA 2SPOA 1FN3A 3WFXA 2VEEA 1YHUA 1YHRA 2D2MC 2DHBB 3VRGA 1S56A 3LR7A 5AZQA 4FC3B 1BJEA 3LB4A 3FH9A 2DC3A 2LH1A 109MA 1O1JA 1YE2B 1Y83B 3UHNA 3PI3A 4HHBB 1MYGA 1CPWA 3GQRB 5CN7A 1MWDA 5F0BA 2MGKA 1BZ0A 1Y0DA 1RQ4A 2HHEB 4MXLA 3UH6A 2IN4A 4H2LA 3D4XB 3GQPA 1O1OA 4DC7A 3AQ6A 1Y85B 2W72C 2VYZA 1RQ3A 1YGDB 1Y4PA 1YENA 1YHUD 3KMFC 1WLAA 104MA 1HBIA 5HU6A 3ZJRA 1SPGB 1YVQA 3ARLA 1XZUB 1V4WB 3EOKB 1HDAB 4MQIB 2FALA 5HAVA 3VHBA 3UH7A 1YHUB 4O4TA 2ZFOB 3PI1A 3CY5A 2MGCA 1Y46A 1VXHA 3A59A 3WR1B 1A0UB 1OUUA 1UX8A 2SPMA 3ODQA 1O1MB 2HHBB 1JL6A 1JZMA 1MLRA 4N7NB 3QZXA 3OGBA 1LUEA 3NMLA 3UHDA 1C40B 4JACA 1BUWA 3ZJQA 2ZSQA 3UBVA 1R1YA 5CNCA 3OZUA 1Y0CA 1HACA 4YU3A 4TWUA 2ZSOA 4HRTB 1MBIA 3QM8A 1ASHA 5E83B 4TYXA 1GJNA 2AA1B 3QJEA 2EKTA 2EKUA 2LH3A 1XCHA 1ABWB 1QXEB 4MQGB 1DKEA 3OVUC 4U8UB 2O5LX 4FWXA 1AJ9A 3E5IA 2OHBA 1MLFA 4ODCA 4O4ZA 1NQPA 2HBFB 1O1MA 3PT8B 4OF9A 2VEBA 3GLNA 3M3AA 4F6IA 4PQCA 1LJWB 2FAMA 2W72A 4MPMA 5MBNA 3LB2A 1YMBA 3NL7B 2MGFA 1AZIA 1CG5A 1MGNA 1A3NA 1Y5JA 1X9FB 2WY4A 5KDQA 1CO9A 2ZS1D 1GLIB 3ECLA 4XS0A 3DHRB 3GOUA 3VAUA 4MQGA 3SZKA 2EB9A 1DKEB 3UHRA 3EU1B 1FSXB 1TU9A 3ZJHA 5CN6A 1WVPA 3VREA 1MLOA 2ZS1B 4NI1B 3AQ5A 1YG5A 1Y09B 1BZRA 1Y4QB 4PQBA 2ZSXA 1XZ5A 2ZLWB 4B3WA 1QSHA 3S1JA 3QM9A 3QJBB 2NSRA 2ZS1C 1S5YA 5KERB 1DO7A 1G9VB 3OZWA 1GDIA 1M6MA 1V4XB 1QXDA 1S69A 3RGKA 2OH8A 1Y5KA 1HJTA 2PGHB 1MLHA 3ZJPA 1DLYA 1LH3A 3D1AB 4MQJA 1MTJA 1A3OA 4X0LB 3UHKA 1MOAA 1Y8KA 1WMUA 1J7SB 3UHXA 3S66A 1YIEA 3UI0A 2MGBA 3S48C 3DHRA 2AURA 2D60A 4AVEA 1CH4A 1VXEA 1CQXA 3RJ6A 1DXVA 3MKBA 1JDOA 1R1XB 2RAOA 3ZJNA 1RPSB 3TM9A 2ZSTA 4HSXA 1Y4VA 3ARJA 1NPGA 1MBNA 2GL3A 3WCTA 3VREB 4O2GA 5JDOF 5SW7A 2ZS1A 3UHCA 3PELA 2WTGA 5ILPA 1CG8B 1SHRA 2XYKA 1B86A 1QI8A 1YFFB 2M6ZB 1M6CA 1F5PA 1LFLA 5CNBA 3ZJIA 3IA3B 1B0BA 3HF4B 2V1FA 1Y5KB 2PGHA 1V75A 2ZFBB 1LFYA 4ROMA 1IRDA 1FAWA 1FDHA 3UHHA 4X0LA 1HBSA 2WTHA 3QJCB 1WMUB 3UHEA 1J3ZB 1FLPA 3A2GA 3PI4A 1YEQA 4GZGA 2R1HB 2MB5A 1A4FB 1DLWA 4G51B 3BJ1A 5M3SA 2HBEA 3BOMA 1HV4A 1CMYB 1BBBA 2RI4A 1O1IA 2ZSPA 3OO5B 1UVXA 4MAXA 2QLSA 1G09B 1VXCA 4MBNA 3QJDA 3DUTA 3PELB 1I3EA 1PBXA 1JEBA 1ECAA 5CNEA 1QI8B 1OR4A 1YFFA 2AUOA 1BZZB 4HRRA 1XXTA 4MQCA 2DHBA 1XZVB 4FC3A 1V5HA 4F69A 1Y8IB 3GKTA 5JDOE 1W92A 3IC2B 1OFKA 1HBRA 1MODA 1YE2A 3BJ3A 1YH9A 2ZLXB 1O16A 2HBCB 3WHMA 2ZLUA 1LFTA 1AJHA 5EV5A 2HHEA 1OBMA 1I3DA 5AZRA 2VLXA 3MOUA 4FH6A 2QSSA 5EETA 2O5QX 2BMMA 1MYZA 4HSWA 3GQGA 1CMYA 2R4WA 1MNJA 1CH1A 2QMBB 1MLLA 1HGAA 3BCQA 2NRMA 1YVQB 1CH5A 1NXFA 5C6EA 4MQIA 1NIHA 2VLZA 5D5RA 1LHTA 1O1PB 2Z8AA 3WCVB 2G3HA 1KD2A 1DWTA 2DN1B 1A0ZA 2ZT1A 4KN3A 3DR9A 1Y0WA 2NRLA 1A6MA 1NS9B 1OUUB 1YHEA 1LHSA 1Y4FB 4N7OA 1RTXA 2ZLXA 4MXKA 3ODQB 1DO4A 1BZ1A 1Y7DA 1RQAB 4XDIA 3K8BB 1JZLA 2HBGA 1BABB 3UHTA 2QSSB 4FWZA 4H07A 3V2ZA 1QPWB 1HACB 4C0NA 1CH7A 1MBDA 2QMBA 4L7YB 3M38A 2QFKA 1ABYB 2EVPA 3HC9A 2HCOB 3QJEB 5E29B 3NFEA 1V4UA 1SDKB 3UGYA 5IKSA 1YEUA 1QXEA 3WCUC 2R80B 2W6XA 4U8UA 1GBUB 3U3EA 4F6FA 1DXTA 2BK9A 1AJ9B 1YE0B 3WI8A 1A6KA 1Y4FA 4N7OB 2H35B 3K9ZA 1NQPB 2HBFA 3PT8A 1J3YA 4O35A 1J41A 4ROLB 1HABB 3MBAA 1J3FA 3GYSA 3ZHWA 2SPNA 108MA 1VWTB 6HBIA 1YCBA 3UHGA 1MLNA 3D17A 3HENA 1Y0TA 1NEJB 4UIQA 1RVWB 5E6EB 1JP8A 3WCUA 1BZPA 1NPFA 1HDBA 3ZJLA 3ZOLA 3ECZA 4XS0B 1IT3A 1GCVB 1MDNA 1NWNA 5HLQA 5HLUA 1YEUB 3HEOA 3M3BA 1CIKA 2AV0A 4IROA 3G4WA 3S65A 2BNLA 2HZ1A 4F4OB 1RQ4B 3PI9A 1Y35A 1Y5FB 2B7HA 5CMVA 1Y4QA 1Y22A 3D4XA 3AQ9A 1RSEA 5EQMA 1HDSA 1YENB 3GYSB 2G0RA 1HCOA 3D17B 1UMOA 1S0HA 3UHWA 1RVWA 2DN3A 4F6JA 2ZLTA 2ZSYA 3B75A 1J7SA 1MBSA 1Y01B 2MBWA 4MU5A 2D5XA 1YIEB 4M4AA 2MGMA 3D7OB 2DN2A 1YEOB 1JPBA 2ZLVA 3UHZA 1VREA 1A0UA 3MKBB 1JZKA 2PEGA 3CIUB 1NS6A 1YVTB 2G11A 1GDJA 1HLBA 2HHBA 1LA6B 4F4OA 3GDJB 3AG0A 2HBSB 1FHJB 1Y7GA 3AT6B 1CG8A 1SHRB 1OUTA 1HGBB 2ZWJA 3MYMA 5JGGA 1JP6A 1X9FD 2D2NB 3MN0A 1X3KA 1M9PB 2AUQA 1Y0CB 3G4VA 4YU3B 1HCOB 2HHDA 112MA 2GTLB 4L2MA 1BZ6A 1ECNA 4NK1A 2ZS0A 1ECOA 3HXNA 1UIWB 2OH9A 1G0BB 2BWHA 2D2ND 3NMMB 3QM5A 4MQKB 5F2AA 1LH1A 2HZ2A 1A6NA 1YEVB 1LFVA 2H8FA 1HGCA 1MLUA 1T1NB 3ECXA 4BJAA 3GKVA 4UURA 1Y2ZB 3BOMB 4OODA 3QQRA 4HBIA 4DC8A 3OO5A 1MOBA 1CH3A 1C7CB 3QJDB 1BIJB 3E4NA 1LH2A 5EYSA 3AT6A 4UZVA 1IWHB 1CG5B 1LH7A 1A3NB 1NZ2A 1YOGA 2FRFA 1BZZA 2V1EA 1JP9A 3K3UA 1XXTB 4MQCB 1J7YA 2GTLA 3UHQA 1GLIA 4YU4A 111MA 1V07A 5CN4A 1YHRB 4PQ6A 2GRFA 1UIWA 3NMMA 3QZZA 3SDNA 2OLPA 2QSPB 4N7PB 5EUIA 1K0YB 3PI8B 2AUPA 1DM1A 3SZKB 1VRFA 1HGCB 2H8FB 4U8UD 3EU1A 2ZT0A 103MA 1LFQB 1Y4RB 1UVYA 3A9MA 2QU0B 3PI2A 3GQGB 5CN9A 1Y4PB 3OJ1A 3WCTC 3QM6A 1THBA 1Z8UB 1IWHA 2VRYA 1J40B 5HU6B 1NIHB 4WJG1 1MLSA 3D1AA 1HDAA 2V1JA 2MGHA 1LFZA 3D1KB 3G53A 1Y0WB 1EMYA 1NWIA 1NS9A 3S66B 3CY5B 4G1VA 1Y46B 1CP0A 2ZSSA 4TWVA 3DHTA 1Y7DB 2Z6SA 3PT7B 5EUIB 3QMAA 1DXVB 1UT0A 1KR7A 3AQ8A 1VXFA 1Y45A 1V9QA 2RAOB 2ZSNA 1JL7A 3S1IA 2V1HA 1G0AA 1Y8HA 1ITHA 1S5XB 1NZ4A 1VXAA 1MLQA 3G52A 1JY7A 2NX0A 4F6GA 1R1YB 1Y7CA 101MA 1CBMA 1Y4GA 1A6GA 3WTGA 3AT5B 1EWAA 1YHUC 4B4YA 1MYIA 5E29A 1DTMA 1XZ2A 1V75B 4DWUA 1HBAB 5KKKA 1XZ4B 4NK2A 4NZIA 1C7BA 1LH5A 1Y83A 3MVCA 1NAZA 1DXTB 2O58X 2OIFA 4NS2A 3GQRA 3WCVC 1YZIB 1GDLA 3DHTB 1J3YB 2MGEA 2BKMA 2EVKA 3GQPB 1GCWB 4MQHB 1Y45B 3A5BA 4JYQA 2BLJM 2MYAA 1RQ3B 2D2MD 1A01A 1O1LB 3HRWB 1BBBB 2RI4B 3KMFA 1MYHA 3A0GA 2VM0A 1NEJA 2MGAA 1Y7ZB 2ZSRA 1PBXB 1DXUB 2D5ZA 2AV3A 3UHBA 5E6EA 1YGFB 1Y5JB 1X9FA 1YMCA 3IXFA 1A9WE 1HDBB 3UH5A 5AB8A 4HRRB 1GCVA 1LTWA 2ZT4A 1A00A 2GTLC 1IRCA 2GLNA 1CQ2A 1XZVA 1A9WA 2VYWA 4ESAB 2BLHA 3IC2A 1VXDA 3RJNB 2VLYA 3GK9A 1XZ4A 1C7BB 3UHIA 4IROB 2HBCA 3WHMB 2Z6NA 3WCPA 2G10A 2ZLUB 3VRFB 3ZH0A 1FSXA 1NGKA 2ZT2A 5ILRA 4NXCA 5JOMA 4FH7A 5C6YA 3UH3A 1GCWA 4MQHA 1MBCA 1HDSB 1N9HA 1YG5B 1JF4A 5JDOC 1HBGA 3ONZA 3QJBA 1HGAB 3HYUA 4HRTA 3IC0A 1Y7ZA 1MTKA 1V4XA 5E83A 1F63A 3HHBB 3W4UB 2G14A 2ZLTB 3B75B 2R4YA 2ZS0C 1S6AA 1UFJA 2GRHA 3D7OA 2LH5A 1CH2A 2D6CA 1Q1FA 2ZFOC 1J52A 2D2MB 2DN1A 1EW6A 1IBEA 5EE4D 3OZVA 3R5IA 3NG6A 2PEGB 3WCWD 1Y31A 3CIUA 3WCWC 2D60B 2MGJA 1G08B 1DO1A 1O1KB 2MYDA 1CIOA 1RQAA 2FRJX 1LA6A 2XKHA 4NI0B 1RPSA 2W6WA 2ZS0D 2W72B 1Y4VB 2R50A 1OUTB 1SWMA 1SDLA 5JGGB 1UC3A 5SW7B 5B85A 3WFUA 6HBWB 2D2NA 4N8TA 2VYYA 2Z85A 5KDQB 3P5QA 4AVDA 2YRSA 3ONZB 4L7YA 1DWSA 3QM7A 5CNGA 1GVHA 5CN8A 1XQ5B 4G1BA 3KUNA 1LFYB 3NFEB 4ROMB 3MYNA 1NZ3A 1N9IA 1FAWB 3FH9B 3BA2A 1GBUA 4HHBA 1YDZA 1IBEB 1J7WA 1BZ0B 1Y0DB 1YE0A 3R5IB 3NG6B 1G08A 2EF2A 1O1KA 1O1OB 1CBLA 4G51A 2VHBA 3UHVA 2GTLD 1BIJA 1YGDA 1HV4B 3UHYA 1Y4BB 3H57A 1XY0A 2GKNA 1G9VA 1OR6A 4M4BA 1MLJA 1G09A 1VWTA 1QXDB 2R4XA 6HBWA 1Y0AA 3DUTB 2LH7A 3P5QB 1URVA 3UHSA 1J7YB 2HBDA 1SI4B 4SDHA 4ZVAA 1XQ5A 1Y8IA 3A59B 2QSPA 4N7PA 5EU2A 1XZ7A 1MOHA 2W6VB 1U7SA 3G46A 2SPLA 3WCVD 1J7WB 3MJPA 3WCWB 1IDRA 3WCTB 4C44A 1YMAA 4LPIA 4KMWA 2MHBA 1BUWB 1RTEA 5HLXA 3M39A 3G4UA 2OHAA 4O1TA 1Y4BA 2FRIX 1HSYA 1XY0B 2M6ZA 4M4BB 3MJUB 3HF4A 1IT2A 1LH6A 102MA 3A5GA 3H58A 2DXMA 2H8DB 1GBVB 3D1KA 1YCAA 1N9FA 1O1PA 1CH9A 3WCVA 1Y8WA 1ABWA 3UHUA 3V2VA 1KD2B 2DN2B 3PT7A 2ZLVB 1DUKA 1QSIA 4ODCB 4KJTA 1GDKA 1NS6B 2HBEB 2QRWA 3K8BA 3EDBA 1LJWA 1BABA 1H97A 2V1GA 1G0AB 1Y8HB 2O5MX 2MHBB 1JY7B 2HBSA 3NL7A 1FHJA 1Y7GB 1MKOB 4PNJA 2MYEA 1JEBB 1Y4GB 2MGDA 3FS4A 2BLIA 3ZJOA 1MZ0A 2G0XA 3WCTD 3MJUA 1FN3B 2KSCA 3KUOA 1XZ2B 4FWYA 4ILZA 2V1KA 2HCOA 1CLSB 106MA 2DXMB 2H8DA 3VRGB 1MNKA 3BJ3B 1YH9B 1Y8WB 3UBCA 3ED9A 3LHBA 3ZJJA 4H0BA 2MGIA 1MNIA 3G4RA 4U8UC 2HZ3A 1YEVA 2GDMA 1O1JB 3O7NA 4WCHD 1QSIB 1T1NA 1BVCA 3G4YA 2BW9M 2ZT3A 1A01B 1O1LA 2GNWA 3HRWA 3LR9A 1Y09A 4F68A 4H2LB 1XZ5B 2ZLWA 1MYFA 1NZ5A 1Y85A 3A0GB 1MWCA 1S5YB 5KERA 1F65A 2D5ZB 1MKOA 3AQ7A 1XYEA 1YOHA 1SPGA 5D1VA 1A3OB 1XZUA 1V4WA 3EOKA 1FCSA 1DWRA 4KMVA 2C0KA 4MBAA 1ECDA 1URYA 4YU4B 1SPEA 1CLSA 2ZFOA 2W31A 2Z6TA 1K1KA 1TESA 1MLMA 2G0ZA 2XKGA 3WR1A 2Z6NB 110MA 7HBIA 1K0YA 3PI8A 1FSLA 1JW8A 1HHOA 1MOCA 3VRFA 1IOPA 1U7RA 3OO4A 1MYMA 5CN5A 2O5BX 3S65B 3ARKA 2QFNA 1GZXB 2ZSZA 1LFQA 1Y4RA 2D2NC 3LQDB 4N7NA 1Y35B 1Y5FA 2B7HB 1C40A 3ZJMA 3UGZA 3LB1A 1MLKA 1B86B 1HRMA 3IC0B 1UFPA 1ABYA 5HY8B 1FDHG 1LFLB 1THBB 5ILEA 2O5TX 2GKMA 3HHBA 3W4UA 1X9FC 1XYEB 3TLDA 2ZFBA 2G12A 1F5OA 1IRDB 1N9XA 1L2KA 1S0HB 2R4ZA 2E2YA 2DN3B 2AA1A 1YIHA 4WJGA 1H1XA 1MCYA 2G0VA 1MYJA 4F6BA 1K1KB 1HBBB 1Y31B 2H35A 2GNVA 2R1HA 1BINA 2MYBA 1A4FA 1HLMA 1EBTA 1HHOB 1J41B 3OO4B 1YVTA 1O1IB 3LB3A 5CNFA 107MA 1GZXA 5EYJA 2QLSB 3LQDA 1SDLB 1HBHB 1OJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDJ A;  4N8T B;  1DTI A;  2GRZ A;  2XKI A;  1S5X A;  2YRS B;  1C7D A;  1MLG A;  3A5A A;  5CND A;  1PMB A;  1EBC A;  5HY8 A;  1M9P A;  3WCU B;  1VHB A;  3WTG B;  3AT5 A;  2HHD B;  1S61 A;  4F6D A;  1HBA A;  1HBR B;  1YIH B;  1CO8 A;  1G0B A;  3GOU B;  4DWT A;  1X46 A;  1VXB A;  1YDZ B;  1UX9 A;  3QQQ A;  2IG3 A;  2NSS A;  2O5O X;  1AJG A;  1LFT B;  1HBB A;  1LFV B;  1YZI A;  5B84 A;  3PI9 B;  1O1N A;  3PIA B;  3OK5 A;  1JWN A;  3BJ2 A;  2MGL A;  1Y22 B;  2MGG A;  5CHQ A;  4ZVB A;  1JF3 A;  4NI1 A;  4IT8 A;  1DUO A;  1DXD A;  3ASE A;  1C7C A;  1HBH A;  3BCQ B;  105M A;  1D8U A;  1QSH B;  1Y0A B;  3ZOM A;  5MBA A;  1VXG A;  1C7D B;  5C6E B;  1DXU A;  4QAU A;  3R0G A;  2HBD B;  1YGF A;  1SI4 A;  3TM3 A;  2O5S X;  2G0S A;  1KFR A;  4VHB A;  4MQJ B;  2D5X B;  5EOH A;  4M4A B;  1A00 B;  1A0Z B;  3WFT A;  1YEO A;  2CMM A;  1Y8K B;  1COH B;  1XZ7 B;  5HBI A;  2W6V A;  4ESA A;  1DO3 A;  1YHE B;  1BZ1 B;  3MJP B;  3WCW A;  5EE4 C;  3WCP B;  4NXA A;  3O89 A;  1R1X A;  1MNO A;  2ZFO D;  1O1N B;  3PIA A;  3WCU D;  3BJ2 B;  2W6Y A;  1CP5 A;  2QU0 A;  5ILM A;  1HGB A;  2V1I A;  1QPW A;  3HYU B;  1MYT A;  3WFW A;  2ZS0 B;  3E5O A;  5JDO D;  5CHR A;  2EB8 A;  1J40 A;  3HXN B;  1GBV A;  1V4U B;  1SDK A;  3SDH A;  1MTI A;  2LHB A;  3EDA A;  1MBA A;  1MNH A;  4MQK A;  2R80 A;  3ORD A;  1LFZ B;  3ZJS A;  1HBS B;  3QJC A;  2D2M A;  1COH A;  1J3Z A;  1MBO A;  2LH2 A;  2LH6 A;  3GKV B;  1YEQ B;  2JHO A;  1Y2Z A;  1OFJ A;  1BVD A;  4ROL A;  3BJ1 B;  1HAB A;  4NI0 A;  1DXC A;  1YOI A;  1MWB A;  1ABS A;  3HEP A;  1Y0T B;  3E55 A;  2FRK X;  3FS4 B;  3G4Q A;  1Y7C B;  2MYC A;  2SPO A;  1FN3 A;  3WFX A;  2VEE A;  1YHU A;  1YHR A;  2D2M C;  2DHB B;  3VRG A;  1S56 A;  3LR7 A;  5AZQ A;  4FC3 B;  1BJE A;  3LB4 A;  3FH9 A;  2DC3 A;  2LH1 A;  109M A;  1O1J A;  1YE2 B;  1Y83 B;  3UHN A;  3PI3 A;  4HHB B;  1MYG A;  1CPW A;  3GQR B;  5CN7 A;  1MWD A;  5F0B A;  2MGK A;  1BZ0 A;  1Y0D A;  1RQ4 A;  2HHE B;  4MXL A;  3UH6 A;  2IN4 A;  4H2L A;  3D4X B;  3GQP A;  1O1O A;  4DC7 A;  3AQ6 A;  1Y85 B;  2W72 C;  2VYZ A;  1RQ3 A;  1YGD B;  1Y4P A;  1YEN A;  1YHU D;  3KMF C;  1WLA A;  104M A;  1HBI A;  5HU6 A;  3ZJR A;  1SPG B;  1YVQ A;  3ARL A;  1XZU B;  1V4W B;  3EOK B;  1HDA B;  4MQI B;  2FAL A;  5HAV A;  3VHB A;  3UH7 A;  1YHU B;  4O4T A;  2ZFO B;  3PI1 A;  3CY5 A;  2MGC A;  1Y46 A;  1VXH A;  3A59 A;  3WR1 B;  1A0U B;  1OUU A;  1UX8 A;  2SPM A;  3ODQ A;  1O1M B;  2HHB B;  1JL6 A;  1JZM A;  1MLR A;  4N7N B;  3QZX A;  3OGB A;  1LUE A;  3NML A;  3UHD A;  1C40 B;  4JAC A;  1BUW A;  3ZJQ A;  2ZSQ A;  3UBV A;  1R1Y A;  5CNC A;  3OZU A;  1Y0C A;  1HAC A;  4YU3 A;  4TWU A;  2ZSO A;  4HRT B;  1MBI A;  3QM8 A;  1ASH A;  5E83 B;  4TYX A;  1GJN A;  2AA1 B;  3QJE A;  2EKT A;  2EKU A;  2LH3 A;  1XCH A;  1ABW B;  1QXE B;  4MQG B;  1DKE A;  3OVU C;  4U8U B;  2O5L X;  4FWX A;  1AJ9 A;  3E5I A;  2OHB A;  1MLF A;  4ODC A;  4O4Z A;  1NQP A;  2HBF B;  1O1M A;  3PT8 B;  4OF9 A;  2VEB A;  3GLN A;  3M3A A;  4F6I A;  4PQC A;  1LJW B;  2FAM A;  2W72 A;  4MPM A;  5MBN A;  3LB2 A;  1YMB A;  3NL7 B;  2MGF A;  1AZI A;  1CG5 A;  1MGN A;  1A3N A;  1Y5J A;  1X9F B;  2WY4 A;  5KDQ A;  1CO9 A;  2ZS1 D;  1GLI B;  3ECL A;  4XS0 A;  3DHR B;  3GOU A;  3VAU A;  4MQG A;  3SZK A;  2EB9 A;  1DKE B;  3UHR A;  3EU1 B;  1FSX B;  1TU9 A;  3ZJH A;  5CN6 A;  1WVP A;  3VRE A;  1MLO A;  2ZS1 B;  4NI1 B;  3AQ5 A;  1YG5 A;  1Y09 B;  1BZR A;  1Y4Q B;  4PQB A;  2ZSX A;  1XZ5 A;  2ZLW B;  4B3W A;  1QSH A;  3S1J A;  3QM9 A;  3QJB B;  2NSR A;  2ZS1 C;  1S5Y A;  5KER B;  1DO7 A;  1G9V B;  3OZW A;  1GDI A;  1M6M A;  1V4X B;  1QXD A;  1S69 A;  3RGK A;  2OH8 A;  1Y5K A;  1HJT A;  2PGH B;  1MLH A;  3ZJP A;  1DLY A;  1LH3 A;  3D1A B;  4MQJ A;  1MTJ A;  1A3O A;  4X0L B;  3UHK A;  1MOA A;  1Y8K A;  1WMU A;  1J7S B;  3UHX A;  3S66 A;  1YIE A;  3UI0 A;  2MGB A;  3S48 C;  3DHR A;  2AUR A;  2D60 A;  4AVE A;  1CH4 A;  1VXE A;  1CQX A;  3RJ6 A;  1DXV A;  3MKB A;  1JDO A;  1R1X B;  2RAO A;  3ZJN A;  1RPS B;  3TM9 A;  2ZST A;  4HSX A;  1Y4V A;  3ARJ A;  1NPG A;  1MBN A;  2GL3 A;  3WCT A;  3VRE B;  4O2G A;  5JDO F;  5SW7 A;  2ZS1 A;  3UHC A;  3PEL A;  2WTG A;  5ILP A;  1CG8 B;  1SHR A;  2XYK A;  1B86 A;  1QI8 A;  1YFF B;  2M6Z B;  1M6C A;  1F5P A;  1LFL A;  5CNB A;  3ZJI A;  3IA3 B;  1B0B A;  3HF4 B;  2V1F A;  1Y5K B;  2PGH A;  1V75 A;  2ZFB B;  1LFY A;  4ROM A;  1IRD A;  1FAW A;  1FDH A;  3UHH A;  4X0L A;  1HBS A;  2WTH A;  3QJC B;  1WMU B;  3UHE A;  1J3Z B;  1FLP A;  3A2G A;  3PI4 A;  1YEQ A;  4GZG A;  2R1H B;  2MB5 A;  1A4F B;  1DLW A;  4G51 B;  3BJ1 A;  5M3S A;  2HBE A;  3BOM A;  1HV4 A;  1CMY B;  1BBB A;  2RI4 A;  1O1I A;  2ZSP A;  3OO5 B;  1UVX A;  4MAX A;  2QLS A;  1G09 B;  1VXC A;  4MBN A;  3QJD A;  3DUT A;  3PEL B;  1I3E A;  1PBX A;  1JEB A;  1ECA A;  5CNE A;  1QI8 B;  1OR4 A;  1YFF A;  2AUO A;  1BZZ B;  4HRR A;  1XXT A;  4MQC A;  2DHB A;  1XZV B;  4FC3 A;  1V5H A;  4F69 A;  1Y8I B;  3GKT A;  5JDO E;  1W92 A;  3IC2 B;  1OFK A;  1HBR A;  1MOD A;  1YE2 A;  3BJ3 A;  1YH9 A;  2ZLX B;  1O16 A;  2HBC B;  3WHM A;  2ZLU A;  1LFT A;  1AJH A;  5EV5 A;  2HHE A;  1OBM A;  1I3D A;  5AZR A;  2VLX A;  3MOU A;  4FH6 A;  2QSS A;  5EET A;  2O5Q X;  2BMM A;  1MYZ A;  4HSW A;  3GQG A;  1CMY A;  2R4W A;  1MNJ A;  1CH1 A;  2QMB B;  1MLL A;  1HGA A;  3BCQ A;  2NRM A;  1YVQ B;  1CH5 A;  1NXF A;  5C6E A;  4MQI A;  1NIH A;  2VLZ A;  5D5R A;  1LHT A;  1O1P B;  2Z8A A;  3WCV B;  2G3H A;  1KD2 A;  1DWT A;  2DN1 B;  1A0Z A;  2ZT1 A;  4KN3 A;  3DR9 A;  1Y0W A;  2NRL A;  1A6M A;  1NS9 B;  1OUU B;  1YHE A;  1LHS A;  1Y4F B;  4N7O A;  1RTX A;  2ZLX A;  4MXK A;  3ODQ B;  1DO4 A;  1BZ1 A;  1Y7D A;  1RQA B;  4XDI A;  3K8B B;  1JZL A;  2HBG A;  1BAB B;  3UHT A;  2QSS B;  4FWZ A;  4H07 A;  3V2Z A;  1QPW B;  1HAC B;  4C0N A;  1CH7 A;  1MBD A;  2QMB A;  4L7Y B;  3M38 A;  2QFK A;  1ABY B;  2EVP A;  3HC9 A;  2HCO B;  3QJE B;  5E29 B;  3NFE A;  1V4U A;  1SDK B;  3UGY A;  5IKS A;  1YEU A;  1QXE A;  3WCU C;  2R80 B;  2W6X A;  4U8U A;  1GBU B;  3U3E A;  4F6F A;  1DXT A;  2BK9 A;  1AJ9 B;  1YE0 B;  3WI8 A;  1A6K A;  1Y4F A;  4N7O B;  2H35 B;  3K9Z A;  1NQP B;  2HBF A;  3PT8 A;  1J3Y A;  4O35 A;  1J41 A;  4ROL B;  1HAB B;  3MBA A;  1J3F A;  3GYS A;  3ZHW A;  2SPN A;  108M A;  1VWT B;  6HBI A;  1YCB A;  3UHG A;  1MLN A;  3D17 A;  3HEN A;  1Y0T A;  1NEJ B;  4UIQ A;  1RVW B;  5E6E B;  1JP8 A;  3WCU A;  1BZP A;  1NPF A;  1HDB A;  3ZJL A;  3ZOL A;  3ECZ A;  4XS0 B;  1IT3 A;  1GCV B;  1MDN A;  1NWN A;  5HLQ A;  5HLU A;  1YEU B;  3HEO A;  3M3B A;  1CIK A;  2AV0 A;  4IRO A;  3G4W A;  3S65 A;  2BNL A;  2HZ1 A;  4F4O B;  1RQ4 B;  3PI9 A;  1Y35 A;  1Y5F B;  2B7H A;  5CMV A;  1Y4Q A;  1Y22 A;  3D4X A;  3AQ9 A;  1RSE A;  5EQM A;  1HDS A;  1YEN B;  3GYS B;  2G0R A;  1HCO A;  3D17 B;  1UMO A;  1S0H A;  3UHW A;  1RVW A;  2DN3 A;  4F6J A;  2ZLT A;  2ZSY A;  3B75 A;  1J7S A;  1MBS A;  1Y01 B;  2MBW A;  4MU5 A;  2D5X A;  1YIE B;  4M4A A;  2MGM A;  3D7O B;  2DN2 A;  1YEO B;  1JPB A;  2ZLV A;  3UHZ A;  1VRE A;  1A0U A;  3MKB B;  1JZK A;  2PEG A;  3CIU B;  1NS6 A;  1YVT B;  2G11 A;  1GDJ A;  1HLB A;  2HHB A;  1LA6 B;  4F4O A;  3GDJ B;  3AG0 A;  2HBS B;  1FHJ B;  1Y7G A;  3AT6 B;  1CG8 A;  1SHR B;  1OUT A;  1HGB B;  2ZWJ A;  3MYM A;  5JGG A;  1JP6 A;  1X9F D;  2D2N B;  3MN0 A;  1X3K A;  1M9P B;  2AUQ A;  1Y0C B;  3G4V A;  4YU3 B;  1HCO B;  2HHD A;  112M A;  2GTL B;  4L2M A;  1BZ6 A;  1ECN A;  4NK1 A;  2ZS0 A;  1ECO A;  3HXN A;  1UIW B;  2OH9 A;  1G0B B;  2BWH A;  2D2N D;  3NMM B;  3QM5 A;  4MQK B;  5F2A A;  1LH1 A;  2HZ2 A;  1A6N A;  1YEV B;  1LFV A;  2H8F A;  1HGC A;  1MLU A;  1T1N B;  3ECX A;  4BJA A;  3GKV A;  4UUR A;  1Y2Z B;  3BOM B;  4OOD A;  3QQR A;  4HBI A;  4DC8 A;  3OO5 A;  1MOB A;  1CH3 A;  1C7C B;  3QJD B;  1BIJ B;  3E4N A;  1LH2 A;  5EYS A;  3AT6 A;  4UZV A;  1IWH B;  1CG5 B;  1LH7 A;  1A3N B;  1NZ2 A;  1YOG A;  2FRF A;  1BZZ A;  2V1E A;  1JP9 A;  3K3U A;  1XXT B;  4MQC B;  1J7Y A;  2GTL A;  3UHQ A;  1GLI A;  4YU4 A;  111M A;  1V07 A;  5CN4 A;  1YHR B;  4PQ6 A;  2GRF A;  1UIW A;  3NMM A;  3QZZ A;  3SDN A;  2OLP A;  2QSP B;  4N7P B;  5EUI A;  1K0Y B;  3PI8 B;  2AUP A;  1DM1 A;  3SZK B;  1VRF A;  1HGC B;  2H8F B;  4U8U D;  3EU1 A;  2ZT0 A;  103M A;  1LFQ B;  1Y4R B;  1UVY A;  3A9M A;  2QU0 B;  3PI2 A;  3GQG B;  5CN9 A;  1Y4P B;  3OJ1 A;  3WCT C;  3QM6 A;  1THB A;  1Z8U B;  1IWH A;  2VRY A;  1J40 B;  5HU6 B;  1NIH B;  4WJG 1;  1MLS A;  3D1A A;  1HDA A;  2V1J A;  2MGH A;  1LFZ A;  3D1K B;  3G53 A;  1Y0W B;  1EMY A;  1NWI A;  1NS9 A;  3S66 B;  3CY5 B;  4G1V A;  1Y46 B;  1CP0 A;  2ZSS A;  4TWV A;  3DHT A;  1Y7D B;  2Z6S A;  3PT7 B;  5EUI B;  3QMA A;  1DXV B;  1UT0 A;  1KR7 A;  3AQ8 A;  1VXF A;  1Y45 A;  1V9Q A;  2RAO B;  2ZSN A;  1JL7 A;  3S1I A;  2V1H A;  1G0A A;  1Y8H A;  1ITH A;  1S5X B;  1NZ4 A;  1VXA A;  1MLQ A;  3G52 A;  1JY7 A;  2NX0 A;  4F6G A;  1R1Y B;  1Y7C A;  101M A;  1CBM A;  1Y4G A;  1A6G A;  3WTG A;  3AT5 B;  1EWA A;  1YHU C;  4B4Y A;  1MYI A;  5E29 A;  1DTM A;  1XZ2 A;  1V75 B;  4DWU A;  1HBA B;  5KKK A;  1XZ4 B;  4NK2 A;  4NZI A;  1C7B A;  1LH5 A;  1Y83 A;  3MVC A;  1NAZ A;  1DXT B;  2O58 X;  2OIF A;  4NS2 A;  3GQR A;  3WCV C;  1YZI B;  1GDL A;  3DHT B;  1J3Y B;  2MGE A;  2BKM A;  2EVK A;  3GQP B;  1GCW B;  4MQH B;  1Y45 B;  3A5B A;  4JYQ A;  2BLJ M;  2MYA A;  1RQ3 B;  2D2M D;  1A01 A;  1O1L B;  3HRW B;  1BBB B;  2RI4 B;  3KMF A;  1MYH A;  3A0G A;  2VM0 A;  1NEJ A;  2MGA A;  1Y7Z B;  2ZSR A;  1PBX B;  1DXU B;  2D5Z A;  2AV3 A;  3UHB A;  5E6E A;  1YGF B;  1Y5J B;  1X9F A;  1YMC A;  3IXF A;  1A9W E;  1HDB B;  3UH5 A;  5AB8 A;  4HRR B;  1GCV A;  1LTW A;  2ZT4 A;  1A00 A;  2GTL C;  1IRC A;  2GLN A;  1CQ2 A;  1XZV A;  1A9W A;  2VYW A;  4ESA B;  2BLH A;  3IC2 A;  1VXD A;  3RJN B;  2VLY A;  3GK9 A;  1XZ4 A;  1C7B B;  3UHI A;  4IRO B;  2HBC A;  3WHM B;  2Z6N A;  3WCP A;  2G10 A;  2ZLU B;  3VRF B;  3ZH0 A;  1FSX A;  1NGK A;  2ZT2 A;  5ILR A;  4NXC A;  5JOM A;  4FH7 A;  5C6Y A;  3UH3 A;  1GCW A;  4MQH A;  1MBC A;  1HDS B;  1N9H A;  1YG5 B;  1JF4 A;  5JDO C;  1HBG A;  3ONZ A;  3QJB A;  1HGA B;  3HYU A;  4HRT A;  3IC0 A;  1Y7Z A;  1MTK A;  1V4X A;  5E83 A;  1F63 A;  3HHB B;  3W4U B;  2G14 A;  2ZLT B;  3B75 B;  2R4Y A;  2ZS0 C;  1S6A A;  1UFJ A;  2GRH A;  3D7O A;  2LH5 A;  1CH2 A;  2D6C A;  1Q1F A;  2ZFO C;  1J52 A;  2D2M B;  2DN1 A;  1EW6 A;  1IBE A;  5EE4 D;  3OZV A;  3R5I A;  3NG6 A;  2PEG B;  3WCW D;  1Y31 A;  3CIU A;  3WCW C;  2D60 B;  2MGJ A;  1G08 B;  1DO1 A;  1O1K B;  2MYD A;  1CIO A;  1RQA A;  2FRJ X;  1LA6 A;  2XKH A;  4NI0 B;  1RPS A;  2W6W A;  2ZS0 D;  2W72 B;  1Y4V B;  2R50 A;  1OUT B;  1SWM A;  1SDL A;  5JGG B;  1UC3 A;  5SW7 B;  5B85 A;  3WFU A;  6HBW B;  2D2N A;  4N8T A;  2VYY A;  2Z85 A;  5KDQ B;  3P5Q A;  4AVD A;  2YRS A;  3ONZ B;  4L7Y A;  1DWS A;  3QM7 A;  5CNG A;  1GVH A;  5CN8 A;  1XQ5 B;  4G1B A;  3KUN A;  1LFY B;  3NFE B;  4ROM B;  3MYN A;  1NZ3 A;  1N9I A;  1FAW B;  3FH9 B;  3BA2 A;  1GBU A;  4HHB A;  1YDZ A;  1IBE B;  1J7W A;  1BZ0 B;  1Y0D B;  1YE0 A;  3R5I B;  3NG6 B;  1G08 A;  2EF2 A;  1O1K A;  1O1O B;  1CBL A;  4G51 A;  2VHB A;  3UHV A;  2GTL D;  1BIJ A;  1YGD A;  1HV4 B;  3UHY A;  1Y4B B;  3H57 A;  1XY0 A;  2GKN A;  1G9V A;  1OR6 A;  4M4B A;  1MLJ A;  1G09 A;  1VWT A;  1QXD B;  2R4X A;  6HBW A;  1Y0A A;  3DUT B;  2LH7 A;  3P5Q B;  1URV A;  3UHS A;  1J7Y B;  2HBD A;  1SI4 B;  4SDH A;  4ZVA A;  1XQ5 A;  1Y8I A;  3A59 B;  2QSP A;  4N7P A;  5EU2 A;  1XZ7 A;  1MOH A;  2W6V B;  1U7S A;  3G46 A;  2SPL A;  3WCV D;  1J7W B;  3MJP A;  3WCW B;  1IDR A;  3WCT B;  4C44 A;  1YMA A;  4LPI A;  4KMW A;  2MHB A;  1BUW B;  1RTE A;  5HLX A;  3M39 A;  3G4U A;  2OHA A;  4O1T A;  1Y4B A;  2FRI X;  1HSY A;  1XY0 B;  2M6Z A;  4M4B B;  3MJU B;  3HF4 A;  1IT2 A;  1LH6 A;  102M A;  3A5G A;  3H58 A;  2DXM A;  2H8D B;  1GBV B;  3D1K A;  1YCA A;  1N9F A;  1O1P A;  1CH9 A;  3WCV A;  1Y8W A;  1ABW A;  3UHU A;  3V2V A;  1KD2 B;  2DN2 B;  3PT7 A;  2ZLV B;  1DUK A;  1QSI A;  4ODC B;  4KJT A;  1GDK A;  1NS6 B;  2HBE B;  2QRW A;  3K8B A;  3EDB A;  1LJW A;  1BAB A;  1H97 A;  2V1G A;  1G0A B;  1Y8H B;  2O5M X;  2MHB B;  1JY7 B;  2HBS A;  3NL7 A;  1FHJ A;  1Y7G B;  1MKO B;  4PNJ A;  2MYE A;  1JEB B;  1Y4G B;  2MGD A;  3FS4 A;  2BLI A;  3ZJO A;  1MZ0 A;  2G0X A;  3WCT D;  3MJU A;  1FN3 B;  2KSC A;  3KUO A;  1XZ2 B;  4FWY A;  4ILZ A;  2V1K A;  2HCO A;  1CLS B;  106M A;  2DXM B;  2H8D A;  3VRG B;  1MNK A;  3BJ3 B;  1YH9 B;  1Y8W B;  3UBC A;  3ED9 A;  3LHB A;  3ZJJ A;  4H0B A;  2MGI A;  1MNI A;  3G4R A;  4U8U C;  2HZ3 A;  1YEV A;  2GDM A;  1O1J B;  3O7N A;  4WCH D;  1QSI B;  1T1N A;  1BVC A;  3G4Y A;  2BW9 M;  2ZT3 A;  1A01 B;  1O1L A;  2GNW A;  3HRW A;  3LR9 A;  1Y09 A;  4F68 A;  4H2L B;  1XZ5 B;  2ZLW A;  1MYF A;  1NZ5 A;  1Y85 A;  3A0G B;  1MWC A;  1S5Y B;  5KER A;  1F65 A;  2D5Z B;  1MKO A;  3AQ7 A;  1XYE A;  1YOH A;  1SPG A;  5D1V A;  1A3O B;  1XZU A;  1V4W A;  3EOK A;  1FCS A;  1DWR A;  4KMV A;  2C0K A;  4MBA A;  1ECD A;  1URY A;  4YU4 B;  1SPE A;  1CLS A;  2ZFO A;  2W31 A;  2Z6T A;  1K1K A;  1TES A;  1MLM A;  2G0Z A;  2XKG A;  3WR1 A;  2Z6N B;  110M A;  7HBI A;  1K0Y A;  3PI8 A;  1FSL A;  1JW8 A;  1HHO A;  1MOC A;  3VRF A;  1IOP A;  1U7R A;  3OO4 A;  1MYM A;  5CN5 A;  2O5B X;  3S65 B;  3ARK A;  2QFN A;  1GZX B;  2ZSZ A;  1LFQ A;  1Y4R A;  2D2N C;  3LQD B;  4N7N A;  1Y35 B;  1Y5F A;  2B7H B;  1C40 A;  3ZJM A;  3UGZ A;  3LB1 A;  1MLK A;  1B86 B;  1HRM A;  3IC0 B;  1UFP A;  1ABY A;  5HY8 B;  1FDH G;  1LFL B;  1THB B;  5ILE A;  2O5T X;  2GKM A;  3HHB A;  3W4U A;  1X9F C;  1XYE B;  3TLD A;  2ZFB A;  2G12 A;  1F5O A;  1IRD B;  1N9X A;  1L2K A;  1S0H B;  2R4Z A;  2E2Y A;  2DN3 B;  2AA1 A;  1YIH A;  4WJG A;  1H1X A;  1MCY A;  2G0V A;  1MYJ A;  4F6B A;  1K1K B;  1HBB B;  1Y31 B;  2H35 A;  2GNV A;  2R1H A;  1BIN A;  2MYB A;  1A4F A;  1HLM A;  1EBT A;  1HHO B;  1J41 B;  3OO4 B;  1YVT A;  1O1I B;  3LB3 A;  5CNF A;  107M A;  1GZX A;  5EYJ A;  2QLS B;  3LQD A;  1SDL B;  1HBH B;  1OJ6 A; 
#chains in the Genus database with same CATH topology
 3GDJ A;  4N8T B;  3VNC A;  1DTI A;  2GRZ A;  2XKI A;  1S5X A;  2YRS B;  1C7D A;  1MLG A;  3A5A A;  5CND A;  1PMB A;  1EBC A;  5HY8 A;  1M9P A;  3WCU B;  1VHB A;  3WTG B;  3AT5 A;  2HHD B;  3PMD A;  1S61 A;  4F6D A;  1HBA A;  1HBR B;  3O2C B;  1YIH B;  1CO8 A;  1G0B A;  3GOU B;  4DWT A;  1X46 A;  1VXB A;  1YDZ B;  1UX9 A;  3QQQ A;  2IG3 A;  2NSS A;  2O5O X;  2UUN B;  1AJG A;  1LFT B;  1HBB A;  1LFV B;  1YZI A;  5B84 A;  3PI9 B;  1O1N A;  3PIA B;  3OK5 A;  1JWN A;  3BJ2 A;  2MGL A;  1Y22 B;  2MGG A;  5CHQ A;  4ZVB A;  4XXI A;  1JF3 A;  4NI1 A;  4IT8 A;  1DUO A;  1DXD A;  3ASE A;  1C7C A;  1HBH A;  3BCQ B;  105M A;  1D8U A;  1QSH B;  1Y0A B;  3ZOM A;  5MBA A;  4XXK A;  1VXG A;  1C7D B;  5C6E B;  1DXU A;  4QAU A;  3R0G A;  2HBD B;  1YGF A;  1SI4 A;  3TM3 A;  2O5S X;  2G0S A;  1KFR A;  4VHB A;  4MQJ B;  2D5X B;  5EOH A;  4M4A B;  1PHN B;  1A00 B;  1A0Z B;  3WFT A;  1YEO A;  2CMM A;  1Y8K B;  1COH B;  1XDT T;  1XZ7 B;  5HBI A;  2W6V A;  4ESA A;  1DO3 A;  1YHE B;  1BZ1 B;  3MJP B;  3WCW A;  5EE4 C;  3WCP B;  4NXA A;  3O89 A;  1R1X A;  1MNO A;  2ZFO D;  1O1N B;  3PIA A;  3WCU D;  3BJ2 B;  2W6Y A;  3MWN A;  1CP5 A;  2QU0 A;  5ILM A;  1HGB A;  2V1I A;  1QPW A;  3HYU B;  1MYT A;  3WFW A;  2ZS0 B;  3E5O A;  5JDO D;  5CHR A;  2EB8 A;  1J40 A;  3HXN B;  1GBV A;  1V4U B;  1SDK A;  3SDH A;  1MTI A;  2LHB A;  3EDA A;  1MBA A;  1MNH A;  4MQK A;  2R80 A;  3ORD A;  1LFZ B;  3ZJS A;  1HBS B;  3QJC A;  2D2M A;  1COH A;  1J3Z A;  1MBO A;  2DKD A;  2LH2 A;  2LH6 A;  3GKV B;  1YEQ B;  2JHO A;  1Y2Z A;  1OFJ A;  1BVD A;  1KTP A;  4ROL A;  3BJ1 B;  1HAB A;  4NI0 A;  1DXC A;  1YOI A;  1MWB A;  1ABS A;  3HEP A;  1Y0T B;  3E55 A;  2FRK X;  3FS4 B;  3O18 A;  3G4Q A;  1Y7C B;  3FEW X;  2MYC A;  2SPO A;  1FN3 A;  3V57 A;  3WFX A;  2VEE A;  1YHU A;  1YHR A;  2D2M C;  2DHB B;  3VRG A;  1S56 A;  3LR7 A;  1BJE A;  4FC3 B;  5AZQ A;  3LB4 A;  3FH9 A;  2DC3 A;  2LH1 A;  109M A;  1O1J A;  1YE2 B;  1Y83 B;  3UHN A;  3PI3 A;  4HHB B;  4ETV A;  1MYG A;  2V8A A;  1CPW A;  3GQR B;  5CN7 A;  1MWD A;  5F0B A;  2MGK A;  1BZ0 A;  1Y0D A;  1RQ4 A;  1WAC A;  2HHE B;  4MXL A;  1CII A;  3UH6 A;  4A8K A;  2IN4 A;  4H2L A;  3D4X B;  3GQP A;  1O1O A;  4DC7 A;  3AQ6 A;  1Y85 B;  2W72 C;  3BRP A;  2VYZ A;  1RQ3 A;  1YGD B;  1Y4P A;  1YEN A;  1XF6 C;  1YHU D;  3KMF C;  1WLA A;  104M A;  1HBI A;  5HU6 A;  3ZJR A;  1SGK A;  1SPG B;  1YVQ A;  1F99 A;  3ARL A;  1XZU B;  1V4W B;  3EOK B;  1HDA B;  4MQI B;  2FAL A;  5HAV A;  3VHB A;  3UH7 A;  1YHU B;  4O4T A;  2ZFO B;  3PI1 A;  3CY5 A;  2MGC A;  2UUL D;  1Y46 A;  3LQ9 A;  1VXH A;  3A59 A;  3WR1 B;  1A0U B;  1OUU A;  1UX8 A;  4YJJ B;  2UUL B;  2SPM A;  3ODQ A;  1O1M B;  2HHB B;  1JL6 A;  1JZM A;  1MLR A;  4N7N B;  3QZX A;  3OGB A;  1LUE A;  3NML A;  3UHD A;  1C40 B;  4JAC A;  1BUW A;  3ZJQ A;  2ZSQ A;  3UBV A;  1R1Y A;  4B02 A;  5CNC A;  3OZU A;  1Y0C A;  1HAC A;  4YU3 A;  4TWU A;  2ZSO A;  4HRT B;  1MBI A;  3QM8 A;  1A87 A;  1ASH A;  5E83 B;  1GJN A;  4TYX A;  2AA1 B;  3QJE A;  2EKT A;  2EKU A;  2LH3 A;  1XCH A;  1DDT A;  1ABW B;  1QXE B;  4MQG B;  4F0U B;  1DKE A;  3OVU C;  4U8U B;  2O5L X;  4FWX A;  1AJ9 A;  3E5I A;  2OHB A;  1MLF A;  4ODC A;  4O4Z A;  1NQP A;  2HBF B;  3DBJ A;  1O1M A;  3PT8 B;  4OF9 A;  2VEB A;  3GLN A;  3M3A A;  4F6I A;  1UVM A;  4PQC A;  1LJW B;  1UVI A;  2FAM A;  2W72 A;  4MPM A;  5MBN A;  3LB2 A;  1YMB A;  3RQR A;  3NL7 B;  2MGF A;  1AZI A;  1CG5 A;  1MGN A;  1A3N A;  4H0M A;  1Y5J A;  1X9F B;  2WY4 A;  4LMX B;  5KDQ A;  1CO9 A;  2ZS1 D;  1GLI B;  3ECL A;  4GXE A;  2C7L B;  1ALL A;  4XS0 A;  2C7K B;  3DHR B;  3GOU A;  3VAU A;  2UUN A;  4MQG A;  3SZK A;  2EB9 A;  1DKE B;  3UHR A;  3EU1 B;  1FSX B;  1TU9 A;  3ZJH A;  5CN6 A;  1WVP A;  3VRE A;  1MLO A;  2ZS1 B;  4NI1 B;  3AQ5 A;  1YG5 A;  1Y09 B;  1BZR A;  1Y4Q B;  4PQB A;  2ZSX A;  1XZ5 A;  2ZLW B;  4B3W A;  5B13 A;  1QSH A;  3S1J A;  3QM9 A;  3QJB B;  2NSR A;  2ZS1 C;  1S5Y A;  5KER B;  1DO7 A;  1G9V B;  2UUM B;  1GDI A;  3OZW A;  1M6M A;  1V4X B;  1QXD A;  1S69 A;  3RGK A;  2OH8 A;  1Y5K A;  1HJT A;  2PGH B;  1MLH A;  3ZJP A;  1DLY A;  1LH3 A;  3D1A B;  4MQJ A;  1MTJ A;  1A3O A;  4X0L B;  3UHK A;  1MOA A;  1Y8K A;  1WMU A;  1J7S B;  3UHX A;  3S66 A;  1YIE A;  3UI0 A;  2MGB A;  3S48 C;  2C7K A;  3DHR A;  2AUR A;  2D60 A;  4AVE A;  1CH4 A;  1VXE A;  1CQX A;  3RJ6 A;  1DXV A;  3MKB A;  1JDO A;  1R1X B;  2RAO A;  3ZJN A;  1RPS B;  3TM9 A;  2ZST A;  4HSX A;  1Y4V A;  3ARJ A;  1NPG A;  1MBN A;  2GL3 A;  3WCT A;  3VRE B;  4O2G A;  5JDO F;  5SW7 A;  2ZS1 A;  3UHC A;  3PEL A;  2WTG A;  5ILP A;  1CG8 B;  1SHR A;  2XYK A;  1B86 A;  1QI8 A;  1YFF B;  1HI0 P;  4ZIZ A;  2M6Z B;  1M6C A;  1F5P A;  1LFL A;  5CNB A;  3ZJI A;  3IA3 B;  1B0B A;  3HF4 B;  2V1F A;  1Y5K B;  2PGH A;  1V75 A;  4ETU A;  2ZFB B;  1LFY A;  2YSK A;  4ROM A;  1IRD A;  1FAW A;  1FDH A;  3UHH A;  4X0L A;  1HBS A;  2WTH A;  3QJC B;  4Q70 A;  1WMU B;  3UHE A;  1J3Z B;  1FLP A;  4F0T A;  3A2G A;  3PI4 A;  1YEQ A;  4GZG A;  2R1H B;  2X49 A;  2MB5 A;  1A4F B;  1DLW A;  4G51 B;  3BJ1 A;  5M3S A;  2HBE A;  3BOM A;  1HV4 A;  1CMY B;  1BBB A;  2RI4 A;  1O1I A;  2ZSP A;  3OO5 B;  1UVX A;  4MAX A;  2QLS A;  1G09 B;  1VXC A;  4MBN A;  3QJD A;  3DUT A;  1B33 B;  3PEL B;  1I3E A;  1PBX A;  1JEB A;  1ECA A;  5CNE A;  1QI8 B;  3V57 B;  1OR4 A;  1YFF A;  2AUO A;  1BZZ B;  4HRR A;  1XXT A;  4MQC A;  2DHB A;  1XZV B;  4FC3 A;  1V5H A;  4F69 A;  1Y8I B;  3GKT A;  5JDO E;  1W92 A;  3IC2 B;  1OFK A;  1HBR A;  1MOD A;  1YE2 A;  4Q70 B;  3BJ3 A;  1YH9 A;  2ZLX B;  1O16 A;  2HBC B;  3WHM A;  4BJU A;  2ZLU A;  1LFT A;  1AJH A;  5EV5 A;  2HHE A;  1OBM A;  1I3D A;  5AZR A;  2VLX A;  3MOU A;  4FH6 A;  2QSS A;  5EET A;  2O5Q X;  2BMM A;  1MYZ A;  4HSW A;  3GQG A;  1CMY A;  4GY3 B;  2R4W A;  1MNJ A;  1CH1 A;  2QMB B;  1MLL A;  1HGA A;  3BCQ A;  2NRM A;  1YVQ B;  1CH5 A;  1NXF A;  5C6E A;  4MQI A;  1NIH A;  2VLZ A;  5D5R A;  2VML B;  1LHT A;  1O1P B;  2Z8A A;  3WCV B;  2G3H A;  1KD2 A;  1GH0 A;  1PHN A;  1DWT A;  2BV8 B;  2DN1 B;  4A8Q A;  1A0Z A;  2ZT1 A;  4KN3 A;  3DR9 A;  1Y0W A;  2NRL A;  1A6M A;  1NS9 B;  1OUU B;  1YHE A;  1LHS A;  1Y4F B;  4N7O A;  1RTX A;  2ZLX A;  4MXK A;  3ODQ B;  1DO4 A;  1BZ1 A;  1Y7D A;  1RQA B;  4XDI A;  1HHT P;  3K8B B;  1JZL A;  2HBG A;  1BAB B;  3UHT A;  2QSS B;  4FWZ A;  2VJT A;  4H07 A;  3V2Z A;  1QPW B;  1HAC B;  4C0N A;  1CH7 A;  1MBD A;  2QMB A;  3GIO A;  4L7Y B;  3M38 A;  2QFK A;  1ABY B;  2EVP A;  3HC9 A;  2HCO B;  3QJE B;  5E29 B;  3NFE A;  1V4U A;  1SDK B;  3UGY A;  5IKS A;  4LMS B;  1YEU A;  1QXE A;  3WCU C;  2R80 B;  4F0U A;  2W6X A;  4U8U A;  1GBU B;  1XG0 C;  3U3E A;  4F6F A;  1DXT A;  2BK9 A;  1AJ9 B;  1YE0 B;  3WI8 A;  1A6K A;  1Y4F A;  4N7O B;  2H35 B;  4ESU A;  3K9Z A;  1NQP B;  2HBF A;  3PT8 A;  1J3Y A;  4O35 A;  1J41 A;  4ROL B;  2DKA A;  2WCQ A;  1HAB B;  1UVK A;  3MBA A;  1B8D B;  2UUM X;  1J3F A;  4A8Y A;  3GYS A;  3ZHW A;  2SPN A;  108M A;  1VWT B;  6HBI A;  1YCB A;  3UHG A;  1MLN A;  1CPC A;  3D17 A;  3HEN A;  1Y0T A;  1NEJ B;  4UIQ A;  1RVW B;  5E6E B;  1JP8 A;  3WCU A;  1BZP A;  1NPF A;  1HDB A;  2C7L A;  3ZJL A;  3ZOL A;  3ECZ A;  4XS0 B;  4A8W A;  1IT3 A;  1GCV B;  1MDN A;  1NWN A;  5HLQ A;  5HLU A;  1YEU B;  3HEO A;  3O2C A;  3M3B A;  1CIK A;  2AV0 A;  4IRO A;  3G4W A;  3S65 A;  2BNL A;  2HZ1 A;  4F4O B;  1RQ4 B;  3PI9 A;  1Y35 A;  1Y5F B;  2B7H A;  5CMV A;  1Y4Q A;  1Y22 A;  3D4X A;  3KVS A;  4N6S A;  4HH1 A;  3AQ9 A;  3BRP B;  1RSE A;  5EQM A;  1HDS A;  1B8D A;  1YEN B;  3GYS B;  2G0R A;  1HCO A;  1CPC B;  3D17 B;  1UMO A;  1F99 B;  1S0H A;  3UHW A;  1RVW A;  1UVJ A;  2DN3 A;  4F6J A;  2ZLT A;  2ZSY A;  3B75 A;  1J7S A;  1MBS A;  1Y01 B;  2MBW A;  4MU5 A;  2D5X A;  1YIE B;  4M4A A;  2MGM A;  3D7O B;  1I7Y A;  2DN2 A;  1YEO B;  1JPB A;  2ZLV A;  3UHZ A;  3V58 B;  1VRE A;  1A0U A;  3MKB B;  4A8S A;  1JZK A;  2PEG A;  4BS9 A;  3CIU B;  1NS6 A;  1YVT B;  2G11 A;  1GDJ A;  1HLB A;  2UUL H;  5FVB M;  2HHB A;  1LA6 B;  4F4O A;  3GDJ B;  3AG0 A;  2HBS B;  1FHJ B;  1Y7G A;  3AT6 B;  1CG8 A;  1SHR B;  1OUT A;  1HGB B;  2ZWJ A;  3MYM A;  5JGG A;  1JP6 A;  1X9F D;  2D2N B;  3MN0 A;  1X3K A;  1M9P B;  2AUQ A;  1Y0C B;  3G4V A;  4YU3 B;  1HCO B;  1UVN A;  2HHD A;  112M A;  2GTL B;  4L2M A;  1BZ6 A;  1ECN A;  4NK1 A;  1NY9 A;  2ZS0 A;  1ECO A;  3HXN A;  1UIW B;  2OH9 A;  1G0B B;  2BWH A;  2D2N D;  3NMM B;  3QM5 A;  1EYX A;  4MQK B;  5F2A A;  1HI8 A;  1LH1 A;  2HZ2 A;  1A6N A;  1YEV B;  1LFV A;  2H8F A;  1HGC A;  1MLU A;  4Z8K B;  1T1N B;  3ECX A;  4BJA A;  3GKV A;  5AQD M;  4UUR A;  1Y2Z B;  3BOM B;  4OOD A;  4PO5 A;  3QQR A;  4HBI A;  4DC8 A;  3DBJ B;  3OO5 A;  1MOB A;  1CH3 A;  1C7C B;  3QJD B;  1BIJ B;  3E4N A;  1LH2 A;  5EYS A;  3AT6 A;  4UZV A;  1IWH B;  1CG5 B;  1LH7 A;  1A3N B;  1NZ2 A;  1YOG A;  2FRF A;  4AE1 A;  1BZZ A;  2V1E A;  1JP9 A;  3K3U A;  1XXT B;  4MQC B;  1J7Y A;  2GTL A;  3UHQ A;  1GLI A;  4YU4 A;  111M A;  1V07 A;  5CN4 A;  4ETT A;  1YHR B;  4PQ6 A;  2GRF A;  2VJH B;  5AQD A;  1UIW A;  3NMM A;  3QZZ A;  3SDN A;  2OLP A;  2QSP B;  4N7P B;  5EUI A;  1K0Y B;  3PI8 B;  2AUP A;  1DM1 A;  3SZK B;  1VRF A;  1HGC B;  2H8F B;  4U8U D;  3EU1 A;  2C7J B;  2ZT0 A;  103M A;  1LFQ B;  1Y4R B;  1UVY A;  3A9M A;  2JL9 A;  2QU0 B;  3PI2 A;  3GQG B;  1QGW C;  5CN9 A;  2J96 A;  1Y4P B;  3OJ1 A;  3WCT C;  3QM6 A;  1THB A;  3GUQ A;  1Z8U B;  1IWH A;  2VRY A;  1J40 B;  5HU6 B;  2WCR A;  1NIH B;  4WJG 1;  1MLS A;  1ON7 B;  3D1A A;  1HDA A;  2V1J A;  2MGH A;  1LFZ A;  3D1K B;  3G53 A;  1Y0W B;  1EMY A;  1NWI A;  1NS9 A;  3S66 B;  2VJH A;  3CY5 B;  4G1V A;  1Y46 B;  1CP0 A;  2ZSS A;  4TWV A;  3DHT A;  1Y7D B;  3PT7 B;  2Z6S A;  5EUI B;  3QMA A;  1DXV B;  1KTP B;  1UT0 A;  1KR7 A;  3AQ8 A;  1VXF A;  1Y45 A;  3PMC A;  2UUL C;  1V9Q A;  2RAO B;  2ZSN A;  1JL7 A;  3S1I A;  2V1H A;  4TMA B;  1G0A A;  1Y8H A;  1ITH A;  1S5X B;  1NZ4 A;  1VXA A;  1MLQ A;  3G52 A;  1JY7 A;  2NX0 A;  4F6G A;  1R1Y B;  1Y7C A;  101M A;  1CBM A;  1Y4G A;  1A6G A;  3WTG A;  4ZIZ B;  3AT5 B;  1EWA A;  1YHU C;  4B4Y A;  1MYI A;  4ERT A;  5E29 A;  1DTM A;  1XZ2 A;  1V75 B;  4DWU A;  1HBA B;  5KKK A;  1XZ4 B;  4NK2 A;  4NZI A;  1C7B A;  1LH5 A;  1Y83 A;  3MVC A;  1NAZ A;  1DXT B;  2O58 X;  2OIF A;  4NS2 A;  3GQR A;  3WCV C;  1YZI B;  1GDL A;  3DHT B;  1J3Y B;  2MGE A;  2BKM A;  2EVK A;  3GQP B;  1GCW B;  4MQH B;  1Y45 B;  3A5B A;  4JYQ A;  2BLJ M;  2MYA A;  1RQ3 B;  2D2M D;  1A01 A;  1O1L B;  3HRW B;  1BBB B;  2RI4 B;  3KMF A;  1MYH A;  3A0G A;  5FVB A;  2VM0 A;  1NEJ A;  2MGA A;  1Y7Z B;  1B33 A;  2ZSR A;  1PBX B;  1DXU B;  2D5Z A;  2AV3 A;  3UHB A;  5E6E A;  1YGF B;  1Y5J B;  1X9F A;  1YMC A;  3IXF A;  1A9W E;  1HDB B;  3UH5 A;  5AB8 A;  3L0F A;  4HRR B;  1GCV A;  1LTW A;  2ZT4 A;  1A00 A;  2GTL C;  1IRC A;  2GLN A;  1CQ2 A;  1XZV A;  1A9W A;  2VYW A;  4GXE B;  4ESA B;  2BLH A;  3IC2 A;  1VXD A;  3RJN B;  4A8F A;  2VLY A;  3GK9 A;  1XZ4 A;  4YJJ A;  1C7B B;  3UHI A;  4IRO B;  2HBC A;  3WHM B;  2Z6N A;  3WCP A;  2G10 A;  2ZLU B;  3VRF B;  3ZH0 A;  1FSX A;  1NGK A;  2ZT2 A;  5ILR A;  1F0L A;  4NXC A;  5JOM A;  4FH7 A;  5C6Y A;  3UH3 A;  1GCW A;  4MQH A;  1MBC A;  1HDS B;  1N9H A;  1YG5 B;  1JF4 A;  5JDO C;  1HBG A;  3ONZ A;  3QJB A;  1HGA B;  3HYU A;  4HRT A;  3IC0 A;  1Y7Z A;  1MTK A;  3NUH B;  1V4X A;  5E83 A;  1F63 A;  3HHB B;  3W4U B;  2G14 A;  2ZLT B;  3B75 B;  2R4Y A;  3L0F B;  2ZS0 C;  1S6A A;  1UFJ A;  2GRH A;  4AE0 A;  3D7O A;  2LH5 A;  1CH2 A;  2D6C A;  1Q1F A;  2ZFO C;  1J52 A;  2D2M B;  2DN1 A;  1EW6 A;  1IBE A;  5EE4 D;  3OZV A;  3R5I A;  3NG6 A;  2PEG B;  3WCW D;  1Y31 A;  4ERV A;  3CIU A;  3WCW C;  2D60 B;  2MGJ A;  1G08 B;  1DO1 A;  1O1K B;  2MYD A;  1CIO A;  1RQA A;  2FRJ X;  1RH1 A;  1LA6 A;  2XKH A;  4NI0 B;  1RPS A;  2W6W A;  4L1E B;  2ZS0 D;  2W72 B;  1Y4V B;  2R50 A;  1OUT B;  1SWM A;  1SDL A;  5JGG B;  1UC3 A;  5SW7 B;  5B85 A;  3WFU A;  4A8O A;  6HBW B;  2D2N A;  4N8T A;  2VYY A;  2Z85 A;  5KDQ B;  3P5Q A;  4AVD A;  2YRS A;  3ONZ B;  4L7Y A;  1DWS A;  3QM7 A;  5CNG A;  1ALL B;  1GVH A;  5CN8 A;  1XQ5 B;  4G1B A;  3KUN A;  1LFY B;  3NFE B;  4ROM B;  3MYN A;  1NZ3 A;  1N9I A;  1FAW B;  3FH9 B;  3BA2 A;  1GBU A;  4HHB A;  4Z8K A;  2V8A B;  4F0T B;  1YDZ A;  1IBE B;  1J7W A;  1LIA A;  1UVL A;  1BZ0 B;  1Y0D B;  1YE0 A;  1JBO A;  3R5I B;  3NG6 B;  4PO5 B;  1G08 A;  2EF2 A;  1O1K A;  1O1O B;  1CBL A;  4G51 A;  2VHB A;  3UHV A;  2GTL D;  1BIJ A;  1YGD A;  1HV4 B;  3UHY A;  1Y4B B;  3H57 A;  1XY0 A;  2GKN A;  1G9V A;  1OR6 A;  4M4B A;  1MLJ A;  1G09 A;  1VWT A;  1QXD B;  2R4X A;  6HBW A;  1Y0A A;  3DUT B;  2LH7 A;  3P5Q B;  1URV A;  2DKC A;  3UHS A;  1J7Y B;  2HBD A;  1MDT A;  1SI4 B;  1HI1 A;  4SDH A;  4ZVA A;  1XQ5 A;  2X4A A;  1Y8I A;  3A59 B;  2QSP A;  4N7P A;  4LM6 B;  5EU2 A;  1XZ7 A;  1MOH A;  2W6V B;  1U7S A;  3G46 A;  2SPL A;  5B13 G;  3WCV D;  1J7W B;  1LIA B;  3MJP A;  3WCW B;  1IDR A;  1JBO B;  3WCT B;  4C44 A;  1YMA A;  4LPI A;  4KMW A;  2MHB A;  1BUW B;  1RTE A;  5HLX A;  3M39 A;  3G4U A;  4GY3 A;  2OHA A;  4O1T A;  1Y4B A;  2FRI X;  1HSY A;  1XY0 B;  2M6Z A;  4M4B B;  3MJU B;  3HF4 A;  1IT2 A;  1LH6 A;  102M A;  3A5G A;  3H58 A;  2DXM A;  2H8D B;  1GBV B;  3D1K A;  2VML A;  1YCA A;  1N9F A;  1O1P A;  1CH9 A;  3WCV A;  1Y8W A;  1ABW A;  3UHU A;  3V2V A;  1GH0 B;  1KD2 B;  2BV8 A;  1I7Y B;  2DN2 B;  3PT7 A;  2ZLV B;  1DUK A;  1QSI A;  4ODC B;  4RMP B;  4KJT A;  1GDK A;  1NS6 B;  2HBE B;  2QRW A;  3ZTA A;  4A8M P;  3K8B A;  3EDB A;  1LJW A;  1BAB A;  1H97 A;  2V1G A;  1G0A B;  1Y8H B;  2O5M X;  2MHB B;  1HA7 B;  2JLF A;  1JY7 B;  2VJT B;  2HBS A;  3NL7 A;  1FHJ A;  1Y7G B;  1MKO B;  4PNJ A;  2MYE A;  1JEB B;  4H0M B;  1Y4G B;  2MGD A;  3O18 B;  2BLI A;  3FS4 A;  3ZJO A;  1MZ0 A;  2G0X A;  3WCT D;  3MJU A;  1FN3 B;  2KSC A;  3KUO A;  1XZ2 B;  4FWY A;  4ILZ A;  2V1K A;  2HCO A;  1CLS B;  106M A;  2DXM B;  2H8D A;  3VRG B;  1MNK A;  3BJ3 B;  1YH9 B;  1COL A;  1Y8W B;  3UBC A;  1EYX B;  3LHB A;  3ED9 A;  3ZJJ A;  4H0B A;  2MGI A;  2UUN D;  1MNI A;  3G4R A;  1HHS A;  4U8U C;  2HZ3 A;  1YEV A;  2GDM A;  1O1J B;  3O7N A;  4WCH D;  1QSI B;  1T1N A;  1BVC A;  4RMP A;  3G4Y A;  2BW9 M;  2ZT3 A;  1A01 B;  1O1L A;  2GNW A;  3HRW A;  3LR9 A;  1Y09 A;  4F68 A;  4H2L B;  1XZ5 B;  2ZLW A;  1MYF A;  1NZ5 A;  1Y85 A;  3A0G B;  1HA7 A;  1MWC A;  1S5Y B;  5KER A;  1F65 A;  2UUM A;  2D5Z B;  1MKO A;  4HH0 A;  3AQ7 A;  1XYE A;  1YOH A;  1TOX A;  1SPG A;  5D1V A;  1A3O B;  1XZU A;  1V4W A;  3EOK A;  1FCS A;  1DWR A;  4KMV A;  2C0K A;  4MBA A;  1ECD A;  1KN1 A;  1URY A;  4YU4 B;  1SPE A;  1CLS A;  2ZFO A;  2W31 A;  2Z6T A;  1K1K A;  1TES A;  1MLM A;  2G0Z A;  2VJR B;  2XKG A;  3WR1 A;  2Z6N B;  110M A;  7HBI A;  1K0Y A;  3PI8 A;  1FSL A;  1JW8 A;  1HHO A;  1MOC A;  3VRF A;  1IOP A;  1U7R A;  2UUL A;  3OO4 A;  2C7J A;  1MYM A;  5CN5 A;  2O5B X;  3S65 B;  3ARK A;  2QFN A;  1GZX B;  2ZSZ A;  1LFQ A;  1Y4R A;  2D2N C;  3LQD B;  4N7N A;  1Y35 B;  1Y5F A;  2B7H B;  1C40 A;  3ZJM A;  3UGZ A;  3LB1 A;  1MLK A;  1B86 B;  3KVS B;  4N6S B;  1HRM A;  3IC0 B;  1UFP A;  1ABY A;  5HY8 B;  1FDH G;  1LFL B;  1THB B;  5ILE A;  2O5T X;  2GKM A;  3HHB A;  3W4U A;  1X9F C;  1XYE B;  3TLD A;  2ZFB A;  2G12 A;  1F5O A;  1IRD B;  1N9X A;  1L2K A;  1S0H B;  1ON7 A;  2R4Z A;  2E2Y A;  2DN3 B;  2AA1 A;  1YIH A;  4WJG A;  1H1X A;  1KN1 B;  1MCY A;  2G0V A;  2I88 A;  1MYJ A;  4F6B A;  1K1K B;  1HBB B;  1Y31 B;  2H35 A;  2GNV A;  2R1H A;  1BIN A;  2MYB A;  2VJR A;  3V58 A;  1A4F A;  1HLM A;  1EBT A;  1HHO B;  1J41 B;  3OO4 B;  1YVT A;  4L1E A;  1O1I B;  2JLG A;  3LB3 A;  5CNF A;  107M A;  1GZX A;  5EYJ A;  2QLS B;  3LQD A;  1SDL B;  1HBH B;  1OJ6 A; 
#chains in the Genus database with same CATH homology
 3GDJ A;  4N8T B;  1DTI A;  2GRZ A;  2XKI A;  1S5X A;  2YRS B;  1C7D A;  1MLG A;  3A5A A;  5CND A;  1PMB A;  1EBC A;  5HY8 A;  1M9P A;  3WCU B;  1VHB A;  3WTG B;  3AT5 A;  2HHD B;  1S61 A;  4F6D A;  1HBA A;  1HBR B;  1YIH B;  1CO8 A;  1G0B A;  3GOU B;  4DWT A;  1X46 A;  1VXB A;  1YDZ B;  1UX9 A;  3QQQ A;  2IG3 A;  2NSS A;  2O5O X;  1AJG A;  1LFT B;  1HBB A;  1LFV B;  1YZI A;  5B84 A;  3PI9 B;  1O1N A;  3PIA B;  3OK5 A;  1JWN A;  3BJ2 A;  2MGL A;  1Y22 B;  2MGG A;  5CHQ A;  4ZVB A;  1JF3 A;  4NI1 A;  4IT8 A;  1DUO A;  1DXD A;  3ASE A;  1C7C A;  1HBH A;  3BCQ B;  105M A;  1D8U A;  1QSH B;  1Y0A B;  3ZOM A;  5MBA A;  1VXG A;  1C7D B;  5C6E B;  1DXU A;  4QAU A;  3R0G A;  2HBD B;  1YGF A;  1SI4 A;  3TM3 A;  2O5S X;  2G0S A;  1KFR A;  4VHB A;  4MQJ B;  2D5X B;  5EOH A;  4M4A B;  1A00 B;  1A0Z B;  3WFT A;  1YEO A;  2CMM A;  1Y8K B;  1COH B;  1XZ7 B;  5HBI A;  2W6V A;  4ESA A;  1DO3 A;  1YHE B;  1BZ1 B;  3MJP B;  3WCW A;  5EE4 C;  3WCP B;  4NXA A;  3O89 A;  1R1X A;  1MNO A;  2ZFO D;  1O1N B;  3PIA A;  3WCU D;  3BJ2 B;  2W6Y A;  1CP5 A;  2QU0 A;  5ILM A;  1HGB A;  2V1I A;  1QPW A;  3HYU B;  1MYT A;  3WFW A;  2ZS0 B;  3E5O A;  5JDO D;  5CHR A;  2EB8 A;  1J40 A;  3HXN B;  1GBV A;  1V4U B;  1SDK A;  3SDH A;  1MTI A;  2LHB A;  3EDA A;  1MBA A;  1MNH A;  4MQK A;  2R80 A;  3ORD A;  1LFZ B;  3ZJS A;  1HBS B;  3QJC A;  2D2M A;  1COH A;  1J3Z A;  1MBO A;  2LH2 A;  2LH6 A;  3GKV B;  1YEQ B;  2JHO A;  1Y2Z A;  1OFJ A;  1BVD A;  4ROL A;  3BJ1 B;  1HAB A;  4NI0 A;  1DXC A;  1YOI A;  1MWB A;  1ABS A;  3HEP A;  1Y0T B;  3E55 A;  2FRK X;  3FS4 B;  3G4Q A;  1Y7C B;  2MYC A;  2SPO A;  1FN3 A;  3WFX A;  2VEE A;  1YHU A;  1YHR A;  2D2M C;  2DHB B;  3VRG A;  1S56 A;  3LR7 A;  5AZQ A;  4FC3 B;  1BJE A;  3LB4 A;  3FH9 A;  2DC3 A;  2LH1 A;  109M A;  1O1J A;  1YE2 B;  1Y83 B;  3UHN A;  3PI3 A;  4HHB B;  1MYG A;  1CPW A;  3GQR B;  5CN7 A;  1MWD A;  5F0B A;  2MGK A;  1BZ0 A;  1Y0D A;  1RQ4 A;  2HHE B;  4MXL A;  3UH6 A;  2IN4 A;  4H2L A;  3D4X B;  3GQP A;  1O1O A;  4DC7 A;  3AQ6 A;  1Y85 B;  2W72 C;  2VYZ A;  1RQ3 A;  1YGD B;  1Y4P A;  1YEN A;  1YHU D;  3KMF C;  1WLA A;  104M A;  1HBI A;  5HU6 A;  3ZJR A;  1SPG B;  1YVQ A;  3ARL A;  1XZU B;  1V4W B;  3EOK B;  1HDA B;  4MQI B;  2FAL A;  5HAV A;  3VHB A;  3UH7 A;  1YHU B;  4O4T A;  2ZFO B;  3PI1 A;  3CY5 A;  2MGC A;  1Y46 A;  1VXH A;  3A59 A;  3WR1 B;  1A0U B;  1OUU A;  1UX8 A;  2SPM A;  3ODQ A;  1O1M B;  2HHB B;  1JL6 A;  1JZM A;  1MLR A;  4N7N B;  3QZX A;  3OGB A;  1LUE A;  3NML A;  3UHD A;  1C40 B;  4JAC A;  1BUW A;  3ZJQ A;  2ZSQ A;  3UBV A;  1R1Y A;  5CNC A;  3OZU A;  1Y0C A;  1HAC A;  4YU3 A;  4TWU A;  2ZSO A;  4HRT B;  1MBI A;  3QM8 A;  1ASH A;  5E83 B;  4TYX A;  1GJN A;  2AA1 B;  3QJE A;  2EKT A;  2EKU A;  2LH3 A;  1XCH A;  1ABW B;  1QXE B;  4MQG B;  1DKE A;  3OVU C;  4U8U B;  2O5L X;  4FWX A;  1AJ9 A;  3E5I A;  2OHB A;  1MLF A;  4ODC A;  4O4Z A;  1NQP A;  2HBF B;  1O1M A;  3PT8 B;  4OF9 A;  2VEB A;  3GLN A;  3M3A A;  4F6I A;  4PQC A;  1LJW B;  2FAM A;  2W72 A;  4MPM A;  5MBN A;  3LB2 A;  1YMB A;  3NL7 B;  2MGF A;  1AZI A;  1CG5 A;  1MGN A;  1A3N A;  1Y5J A;  1X9F B;  2WY4 A;  5KDQ A;  1CO9 A;  2ZS1 D;  1GLI B;  3ECL A;  4XS0 A;  3DHR B;  3GOU A;  3VAU A;  4MQG A;  3SZK A;  2EB9 A;  1DKE B;  3UHR A;  3EU1 B;  1FSX B;  1TU9 A;  3ZJH A;  5CN6 A;  1WVP A;  3VRE A;  1MLO A;  2ZS1 B;  4NI1 B;  3AQ5 A;  1YG5 A;  1Y09 B;  1BZR A;  1Y4Q B;  4PQB A;  2ZSX A;  1XZ5 A;  2ZLW B;  4B3W A;  1QSH A;  3S1J A;  3QM9 A;  3QJB B;  2NSR A;  2ZS1 C;  1S5Y A;  5KER B;  1DO7 A;  1G9V B;  3OZW A;  1GDI A;  1M6M A;  1V4X B;  1QXD A;  1S69 A;  3RGK A;  2OH8 A;  1Y5K A;  1HJT A;  2PGH B;  1MLH A;  3ZJP A;  1DLY A;  1LH3 A;  3D1A B;  4MQJ A;  1MTJ A;  1A3O A;  4X0L B;  3UHK A;  1MOA A;  1Y8K A;  1WMU A;  1J7S B;  3UHX A;  3S66 A;  1YIE A;  3UI0 A;  2MGB A;  3S48 C;  3DHR A;  2AUR A;  2D60 A;  4AVE A;  1CH4 A;  1VXE A;  1CQX A;  3RJ6 A;  1DXV A;  3MKB A;  1JDO A;  1R1X B;  2RAO A;  3ZJN A;  1RPS B;  3TM9 A;  2ZST A;  4HSX A;  1Y4V A;  3ARJ A;  1NPG A;  1MBN A;  2GL3 A;  3WCT A;  3VRE B;  4O2G A;  5JDO F;  5SW7 A;  2ZS1 A;  3UHC A;  3PEL A;  2WTG A;  5ILP A;  1CG8 B;  1SHR A;  2XYK A;  1B86 A;  1QI8 A;  1YFF B;  2M6Z B;  1M6C A;  1F5P A;  1LFL A;  5CNB A;  3ZJI A;  3IA3 B;  1B0B A;  3HF4 B;  2V1F A;  1Y5K B;  2PGH A;  1V75 A;  2ZFB B;  1LFY A;  4ROM A;  1IRD A;  1FAW A;  1FDH A;  3UHH A;  4X0L A;  1HBS A;  2WTH A;  3QJC B;  1WMU B;  3UHE A;  1J3Z B;  1FLP A;  3A2G A;  3PI4 A;  1YEQ A;  4GZG A;  2R1H B;  2MB5 A;  1A4F B;  1DLW A;  4G51 B;  3BJ1 A;  5M3S A;  2HBE A;  3BOM A;  1HV4 A;  1CMY B;  1BBB A;  2RI4 A;  1O1I A;  2ZSP A;  3OO5 B;  1UVX A;  4MAX A;  2QLS A;  1G09 B;  1VXC A;  4MBN A;  3QJD A;  3DUT A;  3PEL B;  1I3E A;  1PBX A;  1JEB A;  1ECA A;  5CNE A;  1QI8 B;  1OR4 A;  1YFF A;  2AUO A;  1BZZ B;  4HRR A;  1XXT A;  4MQC A;  2DHB A;  1XZV B;  4FC3 A;  1V5H A;  4F69 A;  1Y8I B;  3GKT A;  5JDO E;  1W92 A;  3IC2 B;  1OFK A;  1HBR A;  1MOD A;  1YE2 A;  3BJ3 A;  1YH9 A;  2ZLX B;  1O16 A;  2HBC B;  3WHM A;  2ZLU A;  1LFT A;  1AJH A;  5EV5 A;  2HHE A;  1OBM A;  1I3D A;  5AZR A;  2VLX A;  3MOU A;  4FH6 A;  2QSS A;  5EET A;  2O5Q X;  2BMM A;  1MYZ A;  4HSW A;  3GQG A;  1CMY A;  2R4W A;  1MNJ A;  1CH1 A;  2QMB B;  1MLL A;  1HGA A;  3BCQ A;  2NRM A;  1YVQ B;  1CH5 A;  1NXF A;  5C6E A;  4MQI A;  1NIH A;  2VLZ A;  5D5R A;  1LHT A;  1O1P B;  2Z8A A;  3WCV B;  2G3H A;  1KD2 A;  1DWT A;  2DN1 B;  1A0Z A;  2ZT1 A;  4KN3 A;  3DR9 A;  1Y0W A;  2NRL A;  1A6M A;  1NS9 B;  1OUU B;  1YHE A;  1LHS A;  1Y4F B;  4N7O A;  1RTX A;  2ZLX A;  4MXK A;  3ODQ B;  1DO4 A;  1BZ1 A;  1Y7D A;  1RQA B;  4XDI A;  3K8B B;  1JZL A;  2HBG A;  1BAB B;  3UHT A;  2QSS B;  4FWZ A;  4H07 A;  3V2Z A;  1QPW B;  1HAC B;  4C0N A;  1CH7 A;  1MBD A;  2QMB A;  4L7Y B;  3M38 A;  2QFK A;  1ABY B;  2EVP A;  3HC9 A;  2HCO B;  3QJE B;  5E29 B;  3NFE A;  1V4U A;  1SDK B;  3UGY A;  5IKS A;  1YEU A;  1QXE A;  3WCU C;  2R80 B;  2W6X A;  4U8U A;  1GBU B;  3U3E A;  4F6F A;  1DXT A;  2BK9 A;  1AJ9 B;  1YE0 B;  3WI8 A;  1A6K A;  1Y4F A;  4N7O B;  2H35 B;  3K9Z A;  1NQP B;  2HBF A;  3PT8 A;  1J3Y A;  4O35 A;  1J41 A;  4ROL B;  1HAB B;  3MBA A;  1J3F A;  3GYS A;  3ZHW A;  2SPN A;  108M A;  1VWT B;  6HBI A;  1YCB A;  3UHG A;  1MLN A;  3D17 A;  3HEN A;  1Y0T A;  1NEJ B;  4UIQ A;  1RVW B;  5E6E B;  1JP8 A;  3WCU A;  1BZP A;  1NPF A;  1HDB A;  3ZJL A;  3ZOL A;  3ECZ A;  4XS0 B;  1IT3 A;  1GCV B;  1MDN A;  1NWN A;  5HLQ A;  5HLU A;  1YEU B;  3HEO A;  3M3B A;  1CIK A;  2AV0 A;  4IRO A;  3G4W A;  3S65 A;  2BNL A;  2HZ1 A;  4F4O B;  1RQ4 B;  3PI9 A;  1Y35 A;  1Y5F B;  2B7H A;  5CMV A;  1Y4Q A;  1Y22 A;  3D4X A;  3AQ9 A;  1RSE A;  5EQM A;  1HDS A;  1YEN B;  3GYS B;  2G0R A;  1HCO A;  3D17 B;  1UMO A;  1S0H A;  3UHW A;  1RVW A;  2DN3 A;  4F6J A;  2ZLT A;  2ZSY A;  3B75 A;  1J7S A;  1MBS A;  1Y01 B;  2MBW A;  4MU5 A;  2D5X A;  1YIE B;  4M4A A;  2MGM A;  3D7O B;  2DN2 A;  1YEO B;  1JPB A;  2ZLV A;  3UHZ A;  1VRE A;  1A0U A;  3MKB B;  1JZK A;  2PEG A;  3CIU B;  1NS6 A;  1YVT B;  2G11 A;  1GDJ A;  1HLB A;  2HHB A;  1LA6 B;  4F4O A;  3GDJ B;  3AG0 A;  2HBS B;  1FHJ B;  1Y7G A;  3AT6 B;  1CG8 A;  1SHR B;  1OUT A;  1HGB B;  2ZWJ A;  3MYM A;  5JGG A;  1JP6 A;  1X9F D;  2D2N B;  3MN0 A;  1X3K A;  1M9P B;  2AUQ A;  1Y0C B;  3G4V A;  4YU3 B;  1HCO B;  2HHD A;  112M A;  2GTL B;  4L2M A;  1BZ6 A;  1ECN A;  4NK1 A;  2ZS0 A;  1ECO A;  3HXN A;  1UIW B;  2OH9 A;  1G0B B;  2BWH A;  2D2N D;  3NMM B;  3QM5 A;  4MQK B;  5F2A A;  1LH1 A;  2HZ2 A;  1A6N A;  1YEV B;  1LFV A;  2H8F A;  1HGC A;  1MLU A;  1T1N B;  3ECX A;  4BJA A;  3GKV A;  4UUR A;  1Y2Z B;  3BOM B;  4OOD A;  3QQR A;  4HBI A;  4DC8 A;  3OO5 A;  1MOB A;  1CH3 A;  1C7C B;  3QJD B;  1BIJ B;  3E4N A;  1LH2 A;  5EYS A;  3AT6 A;  4UZV A;  1IWH B;  1CG5 B;  1LH7 A;  1A3N B;  1NZ2 A;  1YOG A;  2FRF A;  1BZZ A;  2V1E A;  1JP9 A;  3K3U A;  1XXT B;  4MQC B;  1J7Y A;  2GTL A;  3UHQ A;  1GLI A;  4YU4 A;  111M A;  1V07 A;  5CN4 A;  1YHR B;  4PQ6 A;  2GRF A;  1UIW A;  3NMM A;  3QZZ A;  3SDN A;  2OLP A;  2QSP B;  4N7P B;  5EUI A;  1K0Y B;  3PI8 B;  2AUP A;  1DM1 A;  3SZK B;  1VRF A;  1HGC B;  2H8F B;  4U8U D;  3EU1 A;  2ZT0 A;  103M A;  1LFQ B;  1Y4R B;  1UVY A;  3A9M A;  2QU0 B;  3PI2 A;  3GQG B;  5CN9 A;  1Y4P B;  3OJ1 A;  3WCT C;  3QM6 A;  1THB A;  1Z8U B;  1IWH A;  2VRY A;  1J40 B;  5HU6 B;  1NIH B;  4WJG 1;  1MLS A;  3D1A A;  1HDA A;  2V1J A;  2MGH A;  1LFZ A;  3D1K B;  3G53 A;  1Y0W B;  1EMY A;  1NWI A;  1NS9 A;  3S66 B;  3CY5 B;  4G1V A;  1Y46 B;  1CP0 A;  2ZSS A;  4TWV A;  3DHT A;  1Y7D B;  2Z6S A;  3PT7 B;  5EUI B;  3QMA A;  1DXV B;  1UT0 A;  1KR7 A;  3AQ8 A;  1VXF A;  1Y45 A;  1V9Q A;  2RAO B;  2ZSN A;  1JL7 A;  3S1I A;  2V1H A;  1G0A A;  1Y8H A;  1ITH A;  1S5X B;  1NZ4 A;  1VXA A;  1MLQ A;  3G52 A;  1JY7 A;  2NX0 A;  4F6G A;  1R1Y B;  1Y7C A;  101M A;  1CBM A;  1Y4G A;  1A6G A;  3WTG A;  3AT5 B;  1EWA A;  1YHU C;  4B4Y A;  1MYI A;  5E29 A;  1DTM A;  1XZ2 A;  1V75 B;  4DWU A;  1HBA B;  5KKK A;  1XZ4 B;  4NK2 A;  4NZI A;  1C7B A;  1LH5 A;  1Y83 A;  3MVC A;  1NAZ A;  1DXT B;  2O58 X;  2OIF A;  4NS2 A;  3GQR A;  3WCV C;  1YZI B;  1GDL A;  3DHT B;  1J3Y B;  2MGE A;  2BKM A;  2EVK A;  3GQP B;  1GCW B;  4MQH B;  1Y45 B;  3A5B A;  4JYQ A;  2BLJ M;  2MYA A;  1RQ3 B;  2D2M D;  1A01 A;  1O1L B;  3HRW B;  1BBB B;  2RI4 B;  3KMF A;  1MYH A;  3A0G A;  2VM0 A;  1NEJ A;  2MGA A;  1Y7Z B;  2ZSR A;  1PBX B;  1DXU B;  2D5Z A;  2AV3 A;  3UHB A;  5E6E A;  1YGF B;  1Y5J B;  1X9F A;  1YMC A;  3IXF A;  1A9W E;  1HDB B;  3UH5 A;  5AB8 A;  4HRR B;  1GCV A;  1LTW A;  2ZT4 A;  1A00 A;  2GTL C;  1IRC A;  2GLN A;  1CQ2 A;  1XZV A;  1A9W A;  2VYW A;  4ESA B;  2BLH A;  3IC2 A;  1VXD A;  3RJN B;  2VLY A;  3GK9 A;  1XZ4 A;  1C7B B;  3UHI A;  4IRO B;  2HBC A;  3WHM B;  2Z6N A;  3WCP A;  2G10 A;  2ZLU B;  3VRF B;  3ZH0 A;  1FSX A;  1NGK A;  2ZT2 A;  5ILR A;  4NXC A;  5JOM A;  4FH7 A;  5C6Y A;  3UH3 A;  1GCW A;  4MQH A;  1MBC A;  1HDS B;  1N9H A;  1YG5 B;  1JF4 A;  5JDO C;  1HBG A;  3ONZ A;  3QJB A;  1HGA B;  3HYU A;  4HRT A;  3IC0 A;  1Y7Z A;  1MTK A;  1V4X A;  5E83 A;  1F63 A;  3HHB B;  3W4U B;  2G14 A;  2ZLT B;  3B75 B;  2R4Y A;  2ZS0 C;  1S6A A;  1UFJ A;  2GRH A;  3D7O A;  2LH5 A;  1CH2 A;  2D6C A;  1Q1F A;  2ZFO C;  1J52 A;  2D2M B;  2DN1 A;  1EW6 A;  1IBE A;  5EE4 D;  3OZV A;  3R5I A;  3NG6 A;  2PEG B;  3WCW D;  1Y31 A;  3CIU A;  3WCW C;  2D60 B;  2MGJ A;  1G08 B;  1DO1 A;  1O1K B;  2MYD A;  1CIO A;  1RQA A;  2FRJ X;  1LA6 A;  2XKH A;  4NI0 B;  1RPS A;  2W6W A;  2ZS0 D;  2W72 B;  1Y4V B;  2R50 A;  1OUT B;  1SWM A;  1SDL A;  5JGG B;  1UC3 A;  5SW7 B;  5B85 A;  3WFU A;  6HBW B;  2D2N A;  4N8T A;  2VYY A;  2Z85 A;  5KDQ B;  3P5Q A;  4AVD A;  2YRS A;  3ONZ B;  4L7Y A;  1DWS A;  3QM7 A;  5CNG A;  1GVH A;  5CN8 A;  1XQ5 B;  4G1B A;  3KUN A;  1LFY B;  3NFE B;  4ROM B;  3MYN A;  1NZ3 A;  1N9I A;  1FAW B;  3FH9 B;  3BA2 A;  1GBU A;  4HHB A;  1YDZ A;  1IBE B;  1J7W A;  1BZ0 B;  1Y0D B;  1YE0 A;  3R5I B;  3NG6 B;  1G08 A;  2EF2 A;  1O1K A;  1O1O B;  1CBL A;  4G51 A;  2VHB A;  3UHV A;  2GTL D;  1BIJ A;  1YGD A;  1HV4 B;  3UHY A;  1Y4B B;  3H57 A;  1XY0 A;  2GKN A;  1G9V A;  1OR6 A;  4M4B A;  1MLJ A;  1G09 A;  1VWT A;  1QXD B;  2R4X A;  6HBW A;  1Y0A A;  3DUT B;  2LH7 A;  3P5Q B;  1URV A;  3UHS A;  1J7Y B;  2HBD A;  1SI4 B;  4SDH A;  4ZVA A;  1XQ5 A;  1Y8I A;  3A59 B;  2QSP A;  4N7P A;  5EU2 A;  1XZ7 A;  1MOH A;  2W6V B;  1U7S A;  3G46 A;  2SPL A;  3WCV D;  1J7W B;  3MJP A;  3WCW B;  1IDR A;  3WCT B;  4C44 A;  1YMA A;  4LPI A;  4KMW A;  2MHB A;  1BUW B;  1RTE A;  5HLX A;  3M39 A;  3G4U A;  2OHA A;  4O1T A;  1Y4B A;  2FRI X;  1HSY A;  1XY0 B;  2M6Z A;  4M4B B;  3MJU B;  3HF4 A;  1IT2 A;  1LH6 A;  102M A;  3A5G A;  3H58 A;  2DXM A;  2H8D B;  1GBV B;  3D1K A;  1YCA A;  1N9F A;  1O1P A;  1CH9 A;  3WCV A;  1Y8W A;  1ABW A;  3UHU A;  3V2V A;  1KD2 B;  2DN2 B;  3PT7 A;  2ZLV B;  1DUK A;  1QSI A;  4ODC B;  4KJT A;  1GDK A;  1NS6 B;  2HBE B;  2QRW A;  3K8B A;  3EDB A;  1LJW A;  1BAB A;  1H97 A;  2V1G A;  1G0A B;  1Y8H B;  2O5M X;  2MHB B;  1JY7 B;  2HBS A;  3NL7 A;  1FHJ A;  1Y7G B;  1MKO B;  4PNJ A;  2MYE A;  1JEB B;  1Y4G B;  2MGD A;  3FS4 A;  2BLI A;  3ZJO A;  1MZ0 A;  2G0X A;  3WCT D;  3MJU A;  1FN3 B;  2KSC A;  3KUO A;  1XZ2 B;  4FWY A;  4ILZ A;  2V1K A;  2HCO A;  1CLS B;  106M A;  2DXM B;  2H8D A;  3VRG B;  1MNK A;  3BJ3 B;  1YH9 B;  1Y8W B;  3UBC A;  3ED9 A;  3LHB A;  3ZJJ A;  4H0B A;  2MGI A;  1MNI A;  3G4R A;  4U8U C;  2HZ3 A;  1YEV A;  2GDM A;  1O1J B;  3O7N A;  4WCH D;  1QSI B;  1T1N A;  1BVC A;  3G4Y A;  2BW9 M;  2ZT3 A;  1A01 B;  1O1L A;  2GNW A;  3HRW A;  3LR9 A;  1Y09 A;  4F68 A;  4H2L B;  1XZ5 B;  2ZLW A;  1MYF A;  1NZ5 A;  1Y85 A;  3A0G B;  1MWC A;  1S5Y B;  5KER A;  1F65 A;  2D5Z B;  1MKO A;  3AQ7 A;  1XYE A;  1YOH A;  1SPG A;  5D1V A;  1A3O B;  1XZU A;  1V4W A;  3EOK A;  1FCS A;  1DWR A;  4KMV A;  2C0K A;  4MBA A;  1ECD A;  1URY A;  4YU4 B;  1SPE A;  1CLS A;  2ZFO A;  2W31 A;  2Z6T A;  1K1K A;  1TES A;  1MLM A;  2G0Z A;  2XKG A;  3WR1 A;  2Z6N B;  110M A;  7HBI A;  1K0Y A;  3PI8 A;  1FSL A;  1JW8 A;  1HHO A;  1MOC A;  3VRF A;  1IOP A;  1U7R A;  3OO4 A;  1MYM A;  5CN5 A;  2O5B X;  3S65 B;  3ARK A;  2QFN A;  1GZX B;  2ZSZ A;  1LFQ A;  1Y4R A;  2D2N C;  3LQD B;  4N7N A;  1Y35 B;  1Y5F A;  2B7H B;  1C40 A;  3ZJM A;  3UGZ A;  3LB1 A;  1MLK A;  1B86 B;  1HRM A;  3IC0 B;  1UFP A;  1ABY A;  5HY8 B;  1FDH G;  1LFL B;  1THB B;  5ILE A;  2O5T X;  2GKM A;  3HHB A;  3W4U A;  1X9F C;  1XYE B;  3TLD A;  2ZFB A;  2G12 A;  1F5O A;  1IRD B;  1N9X A;  1L2K A;  1S0H B;  2R4Z A;  2E2Y A;  2DN3 B;  2AA1 A;  1YIH A;  4WJG A;  1H1X A;  1MCY A;  2G0V A;  1MYJ A;  4F6B A;  1K1K B;  1HBB B;  1Y31 B;  2H35 A;  2GNV A;  2R1H A;  1BIN A;  2MYB A;  1A4F A;  1HLM A;  1EBT A;  1HHO B;  1J41 B;  3OO4 B;  1YVT A;  1O1I B;  3LB3 A;  5CNF A;  107M A;  1GZX A;  5EYJ A;  2QLS B;  3LQD A;  1SDL B;  1HBH B;  1OJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...