1DO7A

Carbonmonoxy-myoglobin (mutant l29w) rebinding structure after photolysis at t< 180k
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
153
structure length
153
Chain Sequence
VLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen storage/transport
molecule keywords MYOGLOBIN
publication title Ligand binding and conformational motions in myoglobin.
pubmed doi rcsb
source organism Physeter catodon
total genus 64
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1999-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1do7A00
4F68A 2HBGA 1S69A 5E6EA 3D1AB 3QJEB 3QM9A 3ZHWA 2R4YA 4F6GA 2D2ND 2Z8AA 3WCTD 5AB8A 3GKVB 1QPWA 2B7HB 3WI8A 1GJNA 1AJ9B 3LB2A 1XY0B 2MBWA 5CN6A 1A9WE 3OJ1A 3EDAA 3UHHA 2EVKA 1YHUA 3A59B 1MLRA 2SPMA 2V1FA 1YEVB 1XYEA 1J52A 4U8UD 3HRWB 2HHDA 1R1XB 2D2MB 3MKBA 2ZT3A 1K0YB 2ZS0B 3A0GA 1X9FC 2DXMB 4ILZA 5CN4A 1Y35B 1B0BA 2ZSPA 1MNKA 5JDOC 3R5IA 2BWHA 1Y22A 1MWBA 4MQIB 3AQ7A 2VYYA 6HBIA 4DC7A 1HBBA 3UH5A 4N7NA 1Y4FA 2EVPA 3WFXA 2R1HA 2SPLA 1S5YA 3PT8B 5C6YA 1CH3A 3QJDA 1DXVA 2R80A 3AT6B 3ARKA 2HBSA 2W6VA 2MGDA 5ILEA 5CHRA 1VXAA 3G4WA 1VREA 1XZVA 5HY8A 1SPGB 1FAWA 1Y4RA 3ORDA 3WCUC 2MYBA 1HGBB 2G14A 4O2GA 1S5XA 1JW8A 3DHRA 1HDSB 4N8TA 5E29A 1YCBA 3GQPA 4ROLB 3EU1B 1LFTB 1DWSA 2D5XA 1Y09A 1SDKA 1IBEA 5F0BA 3BCQA 1YHUD 2HZ1A 5EYJA 1XQ5A 1NGKA 1A0ZA 1BZ0B 4MAXA 3VRFB 1S61A 2GLNA 3WCWB 3AT5A 3HXNA 4UURA 2QSSA 1A6NA 3EDBA 3OZWA 3LQDA 1YHEB 3M39A 3WCVB 5EU2A 1IT2A 1DWTA 1HGAA 3U3EA 2H8FB 4L7YA 2QU0A 4O1TA 2ZSYA 3D17A 1Y8IB 5EE4C 1HHOB 3ZJRA 1MBDA 2OHBA 1MLSA 1LFVB 1MBNA 4ROMB 3S66A 2EKTA 3UHDA 1NEJA 3ZJSA 3GYSA 3ZOMA 2XYKA 1FN3A 3UBVA 1YFFA 1IRDB 3PELB 1Y5FA 1LH5A 1Y7GB 3GQGA 1COHA 2GTLB 1CLSB 3W4UA 2O5BX 2DN1A 3G4YA 1RPSB 3QMAA 2H8DB 1CH1A 1NS9B 1H1XA 4ZVAA 3GKTA 2G12A 3CIUA 1VXGA 5E83B 2QSPB 1FHJA 2V1IA 4JYQA 106MA 1YE2A 1J41A 1R1YA 1MKOA 1GBVA 1J7SB 1G0AA 4MQJB 3IC0A 5MBAA 1YZIB 1BIJA 1MLUA 3WCPB 1SWMA 2E2YA 2IN4A 2AA1B 1BVDA 4KJTA 1Y8HA 2ZSTA 5HAVA 1GZXA 3LR9A 4M4BB 1VRFA 1LJWB 5CMVA 1J3FA 2LHBA 3V2VA 3QM7A 1MYMA 1QXDA 4MQCB 5D5RA 1Y7ZA 1ECAA 1YGDB 3PI4A 1WVPA 4QAUA 3UHZA 2DN2B 5EYSA 1ABYA 1VHBA 1R1XA 1CH7A 1JP9A 2D60A 5SW7B 2HBDA 2WTGA 3UHNA 1K0YA 2ZS0A 1CG8A 1CP0A 3DUTB 2EB8A 1HBRB 1DXTA 2DXMA 1MLOA 1ITHA 1HLBA 2ZFBB 3WHMB 5MBNA 2FAMA 1THBB 1TU9A 2V1GA 1LH3A 3ZJIA 1SI4A 1T1NA 1JF4A 1CMYA 3BJ2B 1YG5B 1CH5A 3PT8A 4F6IA 1X9FB 2QMBB 1GDKA 3BA2A 3MJPB 5CNCA 3PT7B 3DHTB 1IWHA 2Z6NA 3RJNB 4OODA 1JP6A 1XZUB 1Y4GA 3ECZA 1LTWA 1MTJA 1J3ZA 4F4OB 5F2AA 5HBIA 2MGHA 1HBAA 1AJGA 1YDZA 4MPMA 5AZQA 1C40B 1NQPB 2G10A 2V1HA 1LHTA 1O1OA 3SZKB 3WCUB 2GDMA 2G0RA 1AJHA 2AUPA 4H2LB 1Y4PA 1HBIA 1HV4A 3WCWA 1DO4A 1U7SA 1XZ4B 1V75B 1UFPA 1MCYA 2D2MD 4WJGA 1YHEA 4HHBA 4WJG1 1MDNA 3GQRA 1UT0A 2ZS0D 1JY7A 1KD2A 1EWAA 1W92A 1Y01B 2H8FA 1A9WA 1J3YA 4NI0A 1UIWA 3IA3B 3VHBA 4NS2A 5C6EA 3G46A 2ZLWA 1C7DB 2PGHA 1LFQA 2G0ZA 5KKKA 1XZ2B 3WR1A 1SHRB 5KERB 1IRCA 2IG3A 1WMUB 2ZS1A 3HHBA 1YH9A 3QQQA 1BZZB 1HBHB 1N9FA 1ABSA 1Y4VA 1JZMA 4F6FA 2OH8A 2D2NA 1J40B 3OO5B 3SDNA 1RQ4B 3NMMB 3M3BA 3WTGA 1XZ7B 1NWNA 4UIQA 1B86B 1J7YB 1QSIB 3B75B 1G09B 2WY4A 1EMYA 2DHBA 3ED9A 1Y8WA 4VHBA 4MQKB 1MYZA 4U8UA 4G51A 5B85A 3AQ9A 1V07A 4YU4B 2ZFOC 1Y2ZA 3ZOLA 1HACB 4HRTA 2AA1A 3ZH0A 1Y46B 2MHBA 1MWCA 3WFTA 1UX8A 2O5QX 3KMFC 3NFEB 1BUWB 1Y4BA 1DO3A 1MYGA 1EBCA 2MGAA 3WCWD 1LJWA 3WCTC 1ABWB 2HHEA 2D6CA 1RQ3A 1Y0WA 2OIFA 4MQCA 1G9VB 1O1PB 1MLKA 5KDQB 1KFRA 1O1JA 4C44A 1QXEB 4NI1B 1G08B 1U7RA 3MJUB 2MYDA 2MGFA 2VLYA 3IXFA 3GDJB 1JF3A 1HDAA 3QZXA 1Y0AB 1NZ2A 1QSHA 3OGBA 1HDBA 1YGFB 3QJBB 1BBBB 3UHXA 1O1MA 4TYXA 4HSWA 2R4ZA 2GTLD 2GRFA 1BJEA 1DXUB 3AQ8A 1V9QA 5CNEA 4ODCA 1S56A 1M6CA 3BJ2A 1XCHA 1V4XB 2QFNA 3QM6A 4PQCA 4MQGA 2AV3A 3UH6A 1URYA 2GRHA 2NSRA 1Y4QB 5EUIA 1A01B 1JWNA 1MTIA 5CNFA 4F6JA 1HGCB 1Y8KA 1JL7A 1IOPA 4FC3A 4XS0A 3ODQA 5JOMA 1Y83A 1NS6B 1RTXA 1NQPA 4N7PA 2PEGA 4LPIA 4FWXA 1BZPA 4PQ6A 3S48C 1F5PA 2HCOA 3RGKA 1NIHB 2RAOA 4NZIA 3SZKA 4O4TA 3EOKB 1RQAA 3GLNA 1MYJA 3HF4B 3LB1A 1YHUC 2ZLXA 1YHRB 1YEQB 1Y7DB 1J7WA 1XZ4A 3PI9B 2ZSZA 6HBWA 2VYZA 1HLMA 1WLAA 3G52A 4OF9A 4JACA 2ZT4A 2VYWA 3HENA 1GLIB 3OVUC 1Y7CB 4MQHA 1CH4A 1NZ3A 3A5GA 1UMOA 1C7DA 1MLNA 4ESAA 2AURA 3NG6A 1Q1FA 5HU6B 2D5ZA 1MWDA 1ECNA 1K1KB 1DXDA 1VWTA 3ECLA 2M6ZB 1S6AA 3MOUA 1A6KA 5HLXA 2ZWJA 3A9MA 4F6DA 2ZT2A 4YU3A 2HHBA 3NL7B 2RI4B 1A6MA 3MVCA 2W6WA 3QZZA 1CO9A 1YENB 3OO5A 5JDOD 1Y31B 1HABB 3K8BB 3ARJA 1LHSA 2BLJM 3G4UA 5JGGB 1XZ7A 1LH7A 2ZT1A 1V4WB 3PI8B 4HRRB 1CQXA 4G1BA 2O5TX 1RVWB 5CN8A 4M4AB 1TESA 3LB3A 1JEBA 2LH6A 2YRSB 1OJ6A 1MOCA 4MBAA 3QM8A 1Y0TA 4YU4A 2MGCA 1GCWA 1Y0CB 1HACA 2HZ3A 1MODA 2JHOA 3S1IA 2VM0A 5JDOE 1YOIA 1QI8B 1PBXA 1NZ5A 3UHIA 3M3AA 4FH7A 1Y0DB 2AUQA 2HBFA 1IDRA 1O1PA 3OO4B 1A3OA 2ZFOB 1YEOB 1A00B 1LA6B 2H35A 1DLWA 1V4UB 1BABB 2HBEB 1ECDA 3VRGB 2V1JA 1YMCA 1MNOA 3PI1A 3MJUA 3WCTB 1S0HB 101MA 1NPFA 1C7BA 4TWVA 1HBSB 2QLSB 3OZUA 4X0LB 4XDIA 1OR6A 110MA 3HYUB 1CBMA 1A0UB 2WTHA 3UH3A 1F5OA 1A3NB 1C7CB 1OBMA 3D1AA 3QJEA 1DXUA 1O1KB 3NMLA 5EE4D 3GKVA 2B7HA 1IT3A 1GBUB 5B84A 1AJ9A 5ILMA 1CH9A 1XY0A 1HCOB 3A59A 1GCVB 1N9XA 1YEVA 3ONZB 3BOMB 1HGCA 3HRWA 1DM1A 3FS4B 7HBIA 3TM9A 3M38A 1Y85B 3ZJMA 2XKGA 1ASHA 2NRLA 2D2MA 1CH2A 3D4XB 1MLHA 1VXDA 3ZJHA 3UHRA 1OFKA 3LHBA 2BW9M 4DWUA 3D7OB 1LH2A 3ZJLA 2MGLA 1JZKA 1XZ5B 1Y35A 1HRMA 3VAUA 1MLLA 3O89A 1NWIA 1YVTB 1XXTB 4MQIA 1YIHB 1YIEB 1F63A 1M9PB 4NK1A 1O1NB 3HF4A 1LFZB 3AQ5A 3RJ6A 3ZJOA 1BVCA 1YE0B 1Y7DA 3AT6A 3H58A 5E6EB 1SPGA 1OR4A 4N7OB 4DC8A 1HGBA 4PQBA 2R4XA 1YVQB 1YHUB 4BJAA 1HDSA 4H07A 1XYEB 1VXBA 4ROLA 1CO8A 3UHUA 3EU1A 4B4YA 2ZSSA 1LFTA 2HHDB 3VREB 3NL7A 3MKBB 2BNLA 2R4WA 3QQRA 3A0GB 3KUNA 5JGGA 2LH1A 1BZ0A 3VRFA 3R5IB 1V4WA 4O35A 1Y22B 3WCVA 1DXCA 2G0SA 4G1VA 2W6XA 2MB5A 5AZRA 2GKMA 2R1HB 1S5YB 1Y8IA 3QJDB 1DXVB 2R80B 2HBSB 2W6VB 4AVEA 1HHOA 5HY8B 2FALA 1RSEA 3KUOA 5HLUA 1FAWB 3G4RA 3IC2B 1LFVA 1Y4RB 1X3KA 4FWZA 4ROMA 2XKIA 4WCHD 1IRDA 3PELA 4C0NA 1S5XB 1Y0DA 3DHRB 1Y7GA 2W72C 1SDLB 2GTLA 1CLSA 4N8TB 2ZSQA 3OO4A 5E29B 1RPSA 1MLQA 3GQPB 1DWRA 2EF2A 2H8DA 1NS9A 3R0GA 2D5XB 1Y09B 1MBCA 1SDKB 1CIOA 3QM5A 5E83A 5HLQA 2QSPA 3BCQB 3UH7A 1MLGA 1CQ2A 3ASEA 4UZVA 2MGKA 1BZ1B 1XQ5B 2VLXA 3UI0A 1HBSA 1A0ZB 1J7SA 4MQJA 2V1KA 3AT5B 1YZIA 3HXNB 2BKMA 3WCPA 2ZS1C 2QSSB 1M6MA 1A0UA 3LQDB 4IROB 1EW6A 2G11A 4L7YB 2QU0B 4M4BA 1CBLA 4MU5A 2D2NC 2ZSNA 3WFUA 2AUOA 3WCVD 1MLJA 4HSXA 3S66B 1YGDA 5D1VA 2DN2A 3GYSB 1GDJA 1FN3B 1YFFB 5SW7A 1VXHA 4U8UC 3GQGB 1COHB 3W4UB 4MBNA 2ZSXA 3DUTA 4MXKA 1NPGA 3UHQA 1HBRA 3GK9A 2ZFBA 1YEUB 3WHMA 2VRYA 1THBA 1YVTA 3PI2A 1XXTA 1EBTA 3CIUB 1CPWA 1YIEA 1M9PA 1FHJB 2LH5A 1O1NA 1YE2B 1J41B 3WFWA 1CG5B 2ZFOD 1R1YB 1MKOB 1PMBA 1GBVB 1G0AB 3E4NA 1YG5A 1X46A 3P5QB 2MYCA 3ZJPA 1BIJB 4MXLA 1X9FA 2QMBA 1Y8HB 3MJPA 3PT7A 1FDHG 3DHTA 3QJCB 4N7OA 3UHTA 3G4QA 1GZXB 1XZUA 2Z6SA 2MGJA 1NAZA 4F4OA 109MA 1YVQA 1C40A 3ARLA 1QXDB 2Z85A 1Y7ZB 102MA 1DO7A 2NRMA 3VREA 1ABYB 1YOHA 3FH9B 2D60B 3BJ1B 4H0BA 3WCUA 2DN3B 2HBDB 3S65B 3A5AA 1A6GA 1CG8B 1FLPA 4H2LA 3O7NA 1DXTB 2MYEA 3UHSA 1DUKA 3H57A 5CN5A 2ZSRA 3UHYA 1V75A 2ZLVB 1SI4B 3PI3A 1T1NB 1JZLA 4TWUA 1CMYB 1YCAA 2ZLUB 2NSSA 1VXFA 1MZ0A 1H97A 3UBCA 1XZ2A 1DKEB 1SHRA 5KERA 3IC2A 2O5OX 1WMUA 2SPOA 1IWHB 2Z6NB 2MGEA 1MOBA 4GZGA 1Y4GB 2ZLTB 1BZZA 1J3ZB 111MA 3MN0A 112MA 1HBHA 1O1IB 1HBAB 1LUEA 1YDZB 1X9FD 1HSYA 1SDLA 2VLZA 1J40A 2Z6TA 1RQ4A 3A2GA 3NMMA 1O1OB 4L2MA 4IT8A 2BLHA 1B86A 1J7YA 1MYHA 1QSIA 1DTMA 2R50A 3B75A 1G09A 2OLPA 1Y45B 1A4FB 2O5LX 1LFYB 1BZ1A 1Y4PB 4MQKA 1MBAA 2NX0A 1F65A 3AQ6A 3UHCA 2W72B 1FSLA 3UGYA 1HV4B 2LH2A 1I3EA 4KMVA 3S1JA 4IROA 4HHBB 3WCUD 1CIKA 1Y46A 5M3SA 3GQRB 3GOUB 1HBGA 1YMBA 1JY7B 1VXCA 3NFEA 1KD2B 1BUWA 1HJTA 2OHAA 1J3YB 4NI0B 2CMMA 1LFLB 4FWYA 1UIWB 1G0BB 4B3WA 5C6EB 2PGHB 2ZLWB 1LFQB 1ABWA 2V1EA 3HEPA 3WR1B 3E5IA 3TLDA 1G9VA 2G3HA 2OH9A 2ZS1B 3BJ3B 2HZ2A 108MA 3HHBB 5CHQA 2HBCB 1YH9B 5KDQA 2FRKX 4KN3A 3D1KB 1Y4VB 1QXEA 4NI1A 1URVA 1G08A 2O5MX 1FSXB 2D2NB 1ECOA 3GDJA 1L2KA 1OUUB 5CN9A 3WTGB 4F6BA 1Y0AA 1YEUA 1YGFA 2LH3A 1OUTB 3QJBA 1BBBA 4O4ZA 1BZ6A 3G4VA 2G0XA 2QFKA 2DHBB 1Y8WB 5ILPA 1CG5A 4U8UB 4G51B 2AV0A 2VEEA 1O1LB 4NXCA 2MGIA 1V4XA 3PIAB 3P5QA 4NXAA 5IKSA 5EV5A 1MNHA 1Y2ZB 1Y5JB 1Y4QA 4HRTB 1A01A 2MHBB 103MA 1MLMA 3QJCA 1Y4BB 1UVXA 2C0KA 1NS6A 3ZJJA 2HHEB 5EETA 3TM3A 1RQ3B 1Y0WB 3HEOA 3UGZA 1NIHA 2MGGA 3SDHA 2DC3A 3FH9A 3EOKA 1O1JB 3BJ1A 2DN3A 1MOHA 1GDIA 3S65A 1MGNA 1Y5KB 3ZJQA 2W6YA 3ZJNA 3K3UA 2FRFA 1YMAA 1V5HA 4AVDA 4DWTA 1DTIA 3K9ZA 5CNGA 1AZIA 1HDAB 1BZRA 1I3DA 1QSHB 1YHRA 1HDBB 107MA 1YEQA 3CY5B 2GNVA 2VEBA 3PI9A 1O1MB 2ZLVA 1GLIA 2D2MC 1Y7CA 2ZLUA 1QPWB 4ODCB 2GL3A 2O58X 1MTKA 2ZS0C 3E55A 1LH6A 4MQGB 1MLFA 3DR9A 1DKEA 5EUIB 5HU6A 2W31A 1LH1A 1K1KA 1DUOA 2M6ZA 1Y8KB 2ZLTA 3LR7A 4FC3B 4XS0B 2GKNA 3ODQB 1O1IA 1MNJA 2RI4A 1Y83B 1JPBA 3E5OA 1CP5A 2FRJX 2BMMA 3V2ZA 4N7PB 1YENA 1NZ4A 2PEGB 1Y31A 1HABA 2EB9A 3K8BA 2HCOB 1MBIA 2RAOB 3PI8A 4HRRA 1JP8A 3UHBA 1RQAB 1RVWA 4M4AA 1Y45A 1A4FA 1HBBB 2GRZA 3UHVA 1LFYA 4N7NB 3A5BA 1Y4FB 2YRSA 3OK5A 2W72A 1UX9A 2ZLXB 1Y0CA 1J7WB 4KMWA 1XZVB 6HBWB 2VHBA 2O5SX 1MYIA 3GOUA 3LB4A 4SDHA 4MQHB 2MGMA 1LFLA 3OZVA 5EOHA 4F69A 1QI8A 1G0BA 2ZT0A 4HBIA 4ESAB 2KSCA 1UC3A 4FH6A 3NG6B 2D5ZB 3WCWC 2ZFOA 1YEOA 1NXFA 1A00A 2GNWA 3BJ3A 1VWTB 1LA6A 2HBCA 3UHWA 3WCVC 1V4UA 1BABA 1MOAA 2HBEA 3D1KA 4YU3B 2HHBB 3VRGA 1IBEB 1FCSA 3KMFA 1MYTA 3HC9A 1FSXA 3WCTA 1S0HA 3ECXA 1N9HA 5EQMA 1OUUA 1JL6A 2QLSA 4X0LA 1OUTA 5CNDA 3HYUA 1A3NA 1C7CA 1HGAB 3UHEA 1JEBB 1O1KA 1DO1A 104MA 1GBUA 1O1LA 105MA 2GTLC 3D17B 3PIAA 1Y0TB 1GCWB 3MBAA 1KR7A 1HCOA 1Y5JA 4NK2A 1GCVA 4PNJA 3ONZA 3BOMA 1VXEA 2XKHA 1NEJB 3FS4A 2EKUA 1GVHA 2ZSOA 5CN7A 1PBXB 1Y85A 3D4XA 3MYMA 3AG0A 1Y5FB 2LH7A 3UHKA 3D7OA 2HBFB 1GDLA 2BK9A 1DLYA 1A3OB 2DN1B 2MGBA 2H35B 1XZ5A 3UHGA 1UFJA 1MBOA 3G53A 1JDOA 1N9IA 1Z8UB 2G0VA 1UVYA 1D8UA 1YIHA 1MNIA 5CNBA 1FDHA 1MYFA 1Y5KA 2FRIX 1MBSA 2MYAA 2BLIA 1RTEA 5JDOF 1LFZA 1C7BB 2ZS1D 5ILRA 2QRWA 4ZVBA 3IC0B 1YE0A 1SPEA 3CY5A 3MYNA 1BINA 2SPNA 1O16A 1YOGA 1OFJA
chains in the Genus database with same CATH superfamily
4F68A 2HBGA 1S69A 5E6EA 3D1AB 3QJEB 3QM9A 3ZHWA 2R4YA 4F6GA 2D2ND 2Z8AA 3WCTD 5AB8A 3GKVB 1QPWA 2B7HB 1UVMA 3WI8A 1GJNA 1AJ9B 3LB2A 1XY0B 2MBWA 5CN6A 1A9WE 3OJ1A 2DKDA 3EDAA 2EVKA 3UHHA 1YHUA 3A59B 1MLRA 2SPMA 2V1FA 1YEVB 1XYEA 1J52A 4U8UD 3HRWB 2HHDA 1R1XB 2D2MB 3MKBA 2ZT3A 1K0YB 2ZS0B 3A0GA 4ETVA 1X9FC 2DXMB 4ILZA 5CN4A 1Y35B 1B0BA 2ZSPA 1MNKA 5JDOC 3R5IA 2BWHA 1Y22A 1MWBA 4MQIB 3AQ7A 2VYYA 6HBIA 4DC7A 1HBBA 3UH5A 4N7NA 1Y4FA 2EVPA 3WFXA 1TOXA 2R1HA 2SPLA 1S5YA 3PT8B 5C6YA 1CH3A 3QJDA 1DXVA 2R80A 3AT6B 3ARKA 2HBSA 2W6VA 2MGDA 5ILEA 5CHRA 1VXAA 3G4WA 1VREA 1XZVA 5HY8A 1SPGB 1FAWA 1Y4RA 3ORDA 3WCUC 3VNCA 2MYBA 4A8YA 1HGBB 2G14A 4O2GA 1S5XA 1JW8A 3O18A 3DHRA 1HDSB 4N8TA 3GUQA 5E29A 1YCBA 3GQPA 4ROLB 3EU1B 1LFTB 1DWSA 2D5XA 1Y09A 1SDKA 1IBEA 5F0BA 3BCQA 1YHUD 2HZ1A 5EYJA 1XQ5A 1NGKA 1A0ZA 1BZ0B 4MAXA 3VRFB 1S61A 2GLNA 5AQDA 3WCWB 3AT5A 3HXNA 4L1EA 2WCRA 4UURA 2QSSA 1A6NA 3EDBA 3OZWA 3LQDA 1YHEB 3M39A 3WCVB 5EU2A 1IT2A 1DWTA 1HGAA 3U3EA 3NUHB 2H8FB 4L7YA 2QU0A 4O1TA 2ZSYA 3D17A 2JLFA 1Y8IB 5EE4C 1HHOB 3ZJRA 1MBDA 2OHBA 1MLSA 1LFVB 1MBNA 4ROMB 3S66A 2EKTA 3UHDA 1NEJA 3ZJSA 3GYSA 3ZOMA 2XYKA 1FN3A 3UBVA 1YFFA 1IRDB 3PELB 1Y5FA 1LH5A 1Y7GB 3GQGA 1COHA 2GTLB 1CLSB 3W4UA 2O5BX 2DN1A 3G4YA 1RPSB 3QMAA 2H8DB 1CH1A 1NS9B 1H1XA 4HH1A 4ZVAA 3GKTA 2X4AA 2G12A 3CIUA 1VXGA 1B33A 5E83B 2QSPB 1FHJA 3FEWX 2V1IA 4JYQA 106MA 1YE2A 1J41A 1R1YA 1MKOA 3O2CA 1GBVA 1J7SB 1G0AA 3GIOA 4MQJB 3IC0A 5MBAA 1YZIB 1BIJA 1MLUA 3WCPB 1SWMA 1HA7A 2E2YA 2IN4A 2AA1B 1BVDA 4KJTA 1Y8HA 2ZSTA 5HAVA 1GZXA 3LR9A 4B02A 4M4BB 1VRFA 1LJWB 5CMVA 1J3FA 2LHBA 3V2VA 3QM7A 1MYMA 4YJJB 1QXDA 4MQCB 5D5RA 1Y7ZA 1ECAA 1YGDB 3PI4A 1WVPA 4QAUA 3UHZA 2DN2B 5EYSA 1ABYA 1VHBA 1R1XA 1CH7A 1JP9A 2D60A 5SW7B 1A87A 2HBDA 2WTGA 3UHNA 1K0YA 2ZS0A 1CG8A 1CP0A 3DUTB 2V8AA 2EB8A 1KN1B 1HBRB 1DXTA 2DXMA 1MLOA 1ITHA 1UVKA 1HLBA 2ZFBB 3WHMB 5MBNA 2FAMA 1THBB 1TU9A 2V1GA 2VJTB 1LH3A 3ZJIA 1SI4A 1T1NA 1JF4A 4XXIA 2WCQA 2YSKA 1CMYA 3BJ2B 1YG5B 1CH5A 3PT8A 4F6IA 1X9FB 2QMBB 1GDKA 3BA2A 2UULA 3MJPB 5CNCA 3PT7B 3DHTB 1IWHA 2Z6NA 3RJNB 4PO5A 4OODA 2UULH 1JP6A 1XZUB 1Y4GA 3ECZA 1LTWA 1MTJA 1J3ZA 4F4OB 5F2AA 5HBIA 2MGHA 1HBAA 1AJGA 1YDZA 4MPMA 5AZQA 1C40B 1NQPB 2C7LB 2JL9A 2G10A 2V1HA 1EYXB 1LHTA 1O1OA 3SZKB 3WCUB 2GDMA 2G0RA 1AJHA 2AUPA 4H2LB 1Y4PA 3BRPA 1HBIA 1MDTA 1HV4A 3WCWA 1DO4A 1U7SA 1XZ4B 1V75B 1UFPA 1MCYA 2D2MD 4WJGA 1YHEA 4HHBA 4WJG1 1MDNA 3GQRA 1UT0A 1DDTA 3DBJA 2ZS0D 1JY7A 1KD2A 1EWAA 1W92A 1Y01B 2H8FA 1A9WA 1J3YA 4NI0A 1UIWA 3IA3B 3VHBA 4NS2A 5C6EA 3G46A 2ZLWA 1C7DB 2PGHA 1LFQA 2G0ZA 5KKKA 1XZ2B 3V58B 3WR1A 1SHRB 5KERB 1IRCA 2IG3A 1WMUB 2ZS1A 3HHBA 1YH9A 2VMLB 3QQQA 1BZZB 1HBHB 1N9FA 1ABSA 4A8KA 1Y4VA 1JZMA 4F6FA 2OH8A 2D2NA 1J40B 2UULD 3OO5B 3SDNA 3PMCA 1RQ4B 3NMMB 4N6SB 3M3BA 3WTGA 1XZ7B 1NWNA 4UIQA 1B86B 1J7YB 1QSIB 3B75B 1G09B 1ON7A 2WY4A 1EMYA 2DHBA 3ED9A 1Y8WA 4VHBA 4MQKB 1MYZA 4U8UA 4G51A 5B85A 3AQ9A 1V07A 4YU4B 2ZFOC 1Y2ZA 3ZOLA 1HACB 4HRTA 2AA1A 3ZH0A 1Y46B 1COLA 2MHBA 1MWCA 3WFTA 1UX8A 2O5QX 3KMFC 3NFEB 1BUWB 1Y4BA 1DO3A 1MYGA 1EBCA 2MGAA 1HI0P 3WCWD 1LJWA 3WCTC 1ABWB 2HHEA 3LQ9A 2D6CA 1RQ3A 1Y0WA 2OIFA 4MQCA 1G9VB 1O1PB 1HHTP 1MLKA 5KDQB 5FVBM 1KFRA 1O1JA 4C44A 1QXEB 4NI1B 1G08B 1U7RA 3MJUB 2MYDA 2MGFA 2VLYA 3IXFA 3GDJB 1JF3A 1HDAA 3QZXA 1Y0AB 1NZ2A 1QSHA 3OGBA 1HDBA 1YGFB 3QJBB 1BBBB 3UHXA 1O1MA 4TYXA 4HSWA 2R4ZA 2C7JB 2GTLD 2GRFA 1BJEA 1DXUB 3AQ8A 1V9QA 5CNEA 4ODCA 1S56A 1M6CA 3BJ2A 1XCHA 1V4XB 2QFNA 3QM6A 4PQCA 4MQGA 2AV3A 3UH6A 1URYA 2GRHA 2NSRA 1Y4QB 5EUIA 1A01B 1JWNA 1MTIA 5CNFA 4F6JA 1HGCB 1Y8KA 2BV8B 3KVSA 1JL7A 1IOPA 4FC3A 4XS0A 3ODQA 5JOMA 1Y83A 1NS6B 1RTXA 1JBOB 1NQPA 4N7PA 2PEGA 4LPIA 4FWXA 1BZPA 4PQ6A 3S48C 1F5PA 2HCOA 3RGKA 1NIHB 1I7YB 2RAOA 4NZIA 3SZKA 4O4TA 3EOKB 1RQAA 3GLNA 2VJRA 1MYJA 3HF4B 3LB1A 4F0UB 1YHUC 2ZLXA 1YHRB 1YEQB 1Y7DB 1J7WA 1XZ4A 3PI9B 1CPCB 2ZSZA 6HBWA 2VYZA 1HLMA 1WLAA 3G52A 2C7KB 4OF9A 4JACA 2ZT4A 2VYWA 3HENA 1GLIB 3OVUC 4RMPA 1Y7CB 4MQHA 1CH4A 1NZ3A 3A5GA 1UMOA 1C7DA 1MLNA 4ESAA 2AURA 3NG6A 1Q1FA 5HU6B 2D5ZA 2JLGA 1MWDA 1ECNA 1K1KB 1DXDA 1VWTA 3ECLA 2M6ZB 1S6AA 3MOUA 1A6KA 5HLXA 4TMAB 2ZWJA 3A9MA 4ERVA 4F6DA 3L0FB 2ZT2A 4YU3A 2HHBA 4GY3B 3NL7B 2RI4B 4GXEB 1A6MA 1F0LA 3MVCA 2W6WA 3QZZA 1CO9A 4Q70B 1ALLB 1YENB 3OO5A 5JDOD 1Y31B 1HABB 3K8BB 3ARJA 1LHSA 2BLJM 3G4UA 5JGGB 1XZ7A 1LH7A 2ZT1A 1V4WB 3PI8B 4HRRB 1CQXA 4F0TA 4G1BA 2O5TX 1RVWB 5CN8A 4M4AB 1GH0B 1TESA 1HI1A 1JEBA 3LB3A 2LH6A 2YRSB 3V57B 1LIAA 1OJ6A 1MOCA 4MBAA 1NY9A 3QM8A 1Y0TA 4YU4A 2MGCA 1GCWA 1Y0CB 1HACA 2HZ3A 1MODA 1XF6C 2JHOA 3S1IA 2VM0A 5JDOE 1YOIA 1QI8B 1PBXA 2UUNB 1NZ5A 3UHIA 3M3AA 4FH7A 1Y0DB 2AUQA 2HBFA 1IDRA 1O1PA 3OO4B 4ZIZB 4H0MB 1A3OA 2ZFOB 1YEOB 1A00B 1LA6B 2H35A 1KTPB 1DLWA 1V4UB 1BABB 2HBEB 1ECDA 1XG0C 2UUMB 3VRGB 2V1JA 1YMCA 1MNOA 3PI1A 3MJUA 3WCTB 1S0HB 101MA 1F99B 1NPFA 1C7BA 4TWVA 1HBSB 2QLSB 3OZUA 4X0LB 4XDIA 1OR6A 110MA 4ETUA 3HYUB 1CBMA 1A0UB 2WTHA 3UH3A 1F5OA 1A3NB 1C7CB 1OBMA 3D1AA 3QJEA 1DXUA 1O1KB 3NMLA 5EE4D 3GKVA 2B7HA 1IT3A 1GBUB 5B84A 1AJ9A 5ILMA 1CH9A 1XY0A 4ETTA 1HCOB 3A59A 3MWNA 1GCVB 1N9XA 1YEVA 3ONZB 3BOMB 1HGCA 3HRWA 1DM1A 3FS4B 7HBIA 3TM9A 3M38A 1Y85B 3ZJMA 2XKGA 1ASHA 2NRLA 2D2MA 1CH2A 3D4XB 1MLHA 1VXDA 3ZJHA 1SGKA 3UHRA 1OFKA 3LHBA 2BW9M 4DWUA 3D7OB 1LH2A 3ZJLA 2MGLA 1JZKA 1XZ5B 1Y35A 1HRMA 3VAUA 1MLLA 3O89A 1NWIA 1YVTB 1XXTB 4MQIA 1YIHB 1YIEB 4A8WA 4LMXB 1F63A 1M9PB 4BS9A 4NK1A 1O1NB 3HF4A 1LFZB 3AQ5A 3RJ6A 3ZJOA 1BVCA 1YE0B 1Y7DA 3AT6A 3H58A 5E6EB 1SPGA 1OR4A 3ZTAA 4N7OB 4DC8A 1HGBA 4PQBA 2R4XA 1YVQB 1YHUB 4BJAA 1HDSA 4H07A 1XYEB 1VXBA 4ROLA 1CO8A 3UHUA 3EU1A 4B4YA 2ZSSA 1LFTA 2HHDB 3L0FA 3VREB 3NL7A 3MKBB 4GXEA 2BNLA 2R4WA 3QQRA 4Q70A 3A0GB 3KUNA 5JGGA 2LH1A 1BZ0A 3VRFA 2UULC 3R5IB 1V4WA 4O35A 1Y22B 3WCVA 1DXCA 2G0SA 4G1VA 2W6XA 2MB5A 5AZRA 2GKMA 2R1HB 1B8DB 1S5YB 1Y8IA 3QJDB 1DXVB 2R80B 2HBSB 2W6VB 4AVEA 1HHOA 5HY8B 2FALA 1RSEA 3KUOA 5HLUA 2X49A 1FAWB 3G4RA 3IC2B 1LFVA 1Y4RB 1X3KA 4FWZA 4ROMA 2XKIA 4WCHD 1IRDA 3PELA 4C0NA 1S5XB 1Y0DA 3DHRB 1Y7GA 2W72C 1SDLB 2GTLA 1CLSA 4N8TB 2ZSQA 3OO4A 5E29B 1RPSA 1MLQA 3GQPB 1DWRA 2EF2A 2H8DA 1NS9A 3R0GA 2D5XB 1Y09B 1MBCA 1SDKB 1CIOA 3QM5A 5E83A 5HLQA 2QSPA 3BCQB 3UH7A 1MLGA 1CQ2A 3ASEA 4UZVA 2MGKA 1BZ1B 1XQ5B 2VLXA 3UI0A 1HBSA 1A0ZB 1J7SA 4MQJA 2V1KA 3AT5B 1YZIA 3HXNB 4L1EB 2BKMA 3WCPA 2ZS1C 2QSSB 1M6MA 1A0UA 3LQDB 4IROB 1EW6A 2G11A 4L7YB 2QU0B 4M4BA 1CBLA 4MU5A 2D2NC 2ZSNA 3WFUA 2AUOA 3WCVD 4YJJA 1MLJA 4HSXA 3S66B 1YGDA 5D1VA 2DN2A 3GYSB 1GDJA 1FN3B 1YFFB 5SW7A 1VXHA 4U8UC 3GQGB 1COHB 3W4UB 4MBNA 2ZSXA 3DUTA 4MXKA 1NPGA 3UHQA 1KN1A 1HBRA 3GK9A 2ZFBA 1YEUB 3WHMA 2VRYA 1THBA 1YVTA 3PI2A 1XXTA 1EBTA 3CIUB 1CPWA 1YIEA 2VJTA 2UUND 1B33B 1M9PA 1FHJB 2LH5A 1O1NA 1YE2B 1J41B 3WFWA 1CG5B 2ZFOD 1R1YB 1MKOB 1PMBA 1GBVB 3O2CB 1G0AB 3E4NA 1YG5A 2UUMX 1X46A 3P5QB 2MYCA 3ZJPA 1BIJB 4MXLA 1X9FA 2QMBA 1HA7B 1Y8HB 3MJPA 3PT7A 1FDHG 3DHTA 3QJCB 4N7OA 3UHTA 3G4QA 1GZXB 1XZUA 1CIIA 2Z6SA 1PHNB 2MGJA 1NAZA 4F4OA 109MA 1YVQA 1C40A 3ARLA 2C7LA 1QXDB 2Z85A 1Y7ZB 102MA 1DO7A 1EYXA 2NRMA 3VREA 1ABYB 1YOHA 3FH9B 2D60B 3BJ1B 4H0BA 3WCUA 2DN3B 2HBDB 3S65B 3A5AA 1A6GA 1CG8B 1FLPA 4H2LA 2V8AB 3O7NA 1DXTB 2MYEA 3UHSA 1DUKA 3H57A 5CN5A 2ZSRA 3UHYA 1V75A 2ZLVB 1SI4B 3PI3A 1T1NB 1JZLA 4TWUA 1CMYB 1YCAA 2ZLUB 2NSSA 1VXFA 4AE0A 1MZ0A 1B8DA 1H97A 3UBCA 1XZ2A 3V58A 1DKEB 1SHRA 2VJHB 5KERA 2UULB 3IC2A 2O5OX 1WMUA 2SPOA 1IWHB 2Z6NB 2MGEA 4PO5B 1MOBA 4GZGA 2VMLA 1Y4GB 2ZLTB 1BZZA 1UVNA 1J3ZB 111MA 3MN0A 112MA 1HBHA 1O1IB 1HBAB 1LUEA 1YDZB 1X9FD 1HSYA 4A8SA 1SDLA 2VLZA 1J40A 2Z6TA 1RQ4A 3A2GA 3NMMA 1O1OB 4N6SA 4L2MA 4IT8A 1WACA 2BLHA 1B86A 1J7YA 1MYHA 1QSIA 1DTMA 2R50A 3B75A 1G09A 2OLPA 1Y45B 1A4FB 2O5LX 1LFYB 1BZ1A 1Y4PB 4MQKA 1MBAA 2NX0A 3BRPB 1F65A 3AQ6A 3UHCA 2W72B 1FSLA 3UGYA 1HV4B 2LH2A 1I3EA 4KMVA 3S1JA 4XXKA 4IROA 5AQDM 4HHBB 3WCUD 1CIKA 1Y46A 5M3SA 3GQRB 3DBJB 3GOUB 1HBGA 1YMBA 1JY7B 1VXCA 3NFEA 1KD2B 1BUWA 1HJTA 2OHAA 1J3YB 4NI0B 2CMMA 5B13A 1LFLB 4FWYA 1UIWB 4Z8KB 1G0BB 4B3WA 1HI8A 5C6EB 2PGHB 2ZLWB 1LFQB 1ABWA 2V1EA 3HEPA 3WR1B 3E5IA 3TLDA 1G9VA 2G3HA 2OH9A 2ZS1B 3BJ3B 2HZ2A 108MA 3HHBB 5CHQA 2HBCB 1YH9B 5KDQA 2FRKX 4BJUA 4KN3A 3D1KB 5B13G 1Y4VB 1QXEA 4NI1A 1URVA 1G08A 2O5MX 1FSXB 2D2NB 1ECOA 3GDJA 1L2KA 1OUUB 5CN9A 3WTGB 4F6BA 1Y0AA 1YEUA 1YGFA 2LH3A 1OUTB 4LMSB 3QJBA 1BBBA 4O4ZA 1BZ6A 1ON7B 2C7JA 3G4VA 2G0XA 2QFKA 2DHBB 1Y8WB 5ILPA 1CG5A 4U8UB 4G51B 2AV0A 2VEEA 1O1LB 4NXCA 2MGIA 4HH0A 1V4XA 3PIAB 3P5QA 4NXAA 5IKSA 5EV5A 1MNHA 1Y2ZB 1Y5JB 1Y4QA 4HRTB 1A01A 2MHBB 4AE1A 103MA 1MLMA 3QJCA 1Y4BB 1UVXA 2BV8A 2C0KA 3PMDA 1PHNA 4A8MP 1NS6A 3ZJJA 2HHEB 2DKAA 5EETA 3TM3A 1RQ3B 1JBOA 1Y0WB 1XDTT 3HEOA 3UGZA 1NIHA 2MGGA 1I7YA 3SDHA 2DC3A 3FH9A 3EOKA 1O1JB 3BJ1A 2DN3A 4LM6B 1MOHA 1GDIA 3S65A 1MGNA 1Y5KB 3ZJQA 2W6YA 3ZJNA 3K3UA 2FRFA 1YMAA 2I88A 1V5HA 4AVDA 4DWTA 1DTIA 4F0UA 3K9ZA 5CNGA 1AZIA 1HDAB 2DKCA 1BZRA 1I3DA 1QSHB 1YHRA 1HDBB 107MA 1YEQA 3CY5B 2GNVA 2VEBA 3PI9A 1CPCA 1O1MB 2ZLVA 2C7KA 1GLIA 2D2MC 1Y7CA 2ZLUA 1QPWB 4ODCB 2GL3A 2O58X 1MTKA 2ZS0C 3E55A 1LH6A 4MQGB 1MLFA 3DR9A 1DKEA 5EUIB 5HU6A 2VJHA 2W31A 1LH1A 1K1KA 1DUOA 2M6ZA 1Y8KB 3KVSB 2ZLTA 3LR7A 4FC3B 4XS0B 2GKNA 4GY3A 3ODQB 1O1IA 1MNJA 2RI4A 1Y83B 1JPBA 3E5OA 1CP5A 2FRJX 2BMMA 3V2ZA 4N7PB 1ALLA 1YENA 1NZ4A 2PEGB 1Y31A 1HABA 2EB9A 3K8BA 2HCOB 1MBIA 2RAOB 3PI8A 4HRRA 1JP8A 3RQRA 3UHBA 1RQAB 1RVWA 4M4AA 1Y45A 1A4FA 1GH0A 1HBBB 1RH1A 2GRZA 2VJRB 3UHVA 1LFYA 4N7NB 3A5BA 1Y4FB 2YRSA 3OK5A 3V57A 2W72A 1UX9A 2ZLXB 1Y0CA 1J7WB 4KMWA 1XZVB 6HBWB 2VHBA 2O5SX 1MYIA 3GOUA 3LB4A 4A8QA 4SDHA 4RMPB 4MQHB 2MGMA 1LFLA 3OZVA 5EOHA 4F69A 4Z8KA 1QI8A 1G0BA 2ZT0A 4HBIA 4ESAB 2UUNA 2KSCA 3O18B 1UC3A 4FH6A 3NG6B 2D5ZB 3WCWC 4ZIZA 4H0MA 2J96A 2ZFOA 1YEOA 1NXFA 1A00A 2GNWA 3BJ3A 1VWTB 1LA6A 1KTPA 2HBCA 3UHWA 3WCVC 1V4UA 1BABA 1MOAA 2HBEA 3D1KA 2UUMA 4YU3B 2HHBB 3VRGA 1IBEB 1FCSA 3KMFA 1MYTA 3HC9A 1FSXA 3WCTA 1S0HA 3ECXA 1N9HA 5EQMA 1F99A 1OUUA 1JL6A 2QLSA 4X0LA 1OUTA 5CNDA 4ERTA 3HYUA 4F0TB 4A8OA 1A3NA 1C7CA 1HGAB 3UHEA 1JEBB 1O1KA 1DO1A 104MA 1GBUA 1LIAB 1O1LA 105MA 2GTLC 4ESUA 3D17B 3PIAA 1Y0TB 1UVJA 1UVLA 1GCWB 3MBAA 1KR7A 1HCOA 1Y5JA 4NK2A 1GCVA 4PNJA 5FVBA 3ONZA 3BOMA 1VXEA 2XKHA 1NEJB 3FS4A 2EKUA 1GVHA 2ZSOA 5CN7A 1PBXB 1Y85A 3D4XA 3MYMA 3AG0A 1Y5FB 2LH7A 3UHKA 3D7OA 2HBFB 1GDLA 2BK9A 1DLYA 1A3OB 1QGWC 2DN1B 2MGBA 2H35B 1XZ5A 4A8FA 3UHGA 1UFJA 1MBOA 3G53A 1JDOA 1HHSA 1N9IA 1Z8UB 2G0VA 1UVYA 1D8UA 1YIHA 1MNIA 5CNBA 1FDHA 1MYFA 1Y5KA 2FRIX 1MBSA 2MYAA 2BLIA 1RTEA 5JDOF 1LFZA 1C7BB 2ZS1D 5ILRA 2QRWA 4ZVBA 3IC0B 1YE0A 1SPEA 3CY5A 3MYNA 1UVIA 1BINA 2SPNA 1O16A 1YOGA 1OFJA
chains in the Genus database with same CATH topology
4F68A 2HBGA 1S69A 5E6EA 3D1AB 3QJEB 3QM9A 3ZHWA 2R4YA 4F6GA 2D2ND 2Z8AA 3WCTD 5AB8A 3GKVB 1QPWA 2B7HB 3WI8A 1GJNA 1AJ9B 3LB2A 1XY0B 2MBWA 5CN6A 1A9WE 3OJ1A 3EDAA 3UHHA 2EVKA 1YHUA 3A59B 1MLRA 2SPMA 2V1FA 1YEVB 1XYEA 1J52A 4U8UD 3HRWB 2HHDA 1R1XB 2D2MB 3MKBA 2ZT3A 1K0YB 2ZS0B 3A0GA 1X9FC 2DXMB 4ILZA 5CN4A 1Y35B 1B0BA 2ZSPA 1MNKA 5JDOC 3R5IA 2BWHA 1Y22A 1MWBA 4MQIB 3AQ7A 2VYYA 6HBIA 4DC7A 1HBBA 3UH5A 4N7NA 1Y4FA 2EVPA 3WFXA 2R1HA 2SPLA 1S5YA 3PT8B 5C6YA 1CH3A 3QJDA 1DXVA 2R80A 3AT6B 3ARKA 2HBSA 2W6VA 2MGDA 5ILEA 5CHRA 1VXAA 3G4WA 1VREA 1XZVA 5HY8A 1SPGB 1FAWA 1Y4RA 3ORDA 3WCUC 2MYBA 1HGBB 2G14A 4O2GA 1S5XA 1JW8A 3DHRA 1HDSB 4N8TA 5E29A 1YCBA 3GQPA 4ROLB 3EU1B 1LFTB 1DWSA 2D5XA 1Y09A 1SDKA 1IBEA 5F0BA 3BCQA 1YHUD 2HZ1A 5EYJA 1XQ5A 1NGKA 1A0ZA 1BZ0B 4MAXA 3VRFB 1S61A 2GLNA 3WCWB 3AT5A 3HXNA 4UURA 2QSSA 1A6NA 3EDBA 3OZWA 3LQDA 1YHEB 3M39A 3WCVB 5EU2A 1IT2A 1DWTA 1HGAA 3U3EA 2H8FB 4L7YA 2QU0A 4O1TA 2ZSYA 3D17A 1Y8IB 5EE4C 1HHOB 3ZJRA 1MBDA 2OHBA 1MLSA 1LFVB 1MBNA 4ROMB 3S66A 2EKTA 3UHDA 1NEJA 3ZJSA 3GYSA 3ZOMA 2XYKA 1FN3A 3UBVA 1YFFA 1IRDB 3PELB 1Y5FA 1LH5A 1Y7GB 3GQGA 1COHA 2GTLB 1CLSB 3W4UA 2O5BX 2DN1A 3G4YA 1RPSB 3QMAA 2H8DB 1CH1A 1NS9B 1H1XA 4ZVAA 3GKTA 2G12A 3CIUA 1VXGA 5E83B 2QSPB 1FHJA 2V1IA 4JYQA 106MA 1YE2A 1J41A 1R1YA 1MKOA 1GBVA 1J7SB 1G0AA 4MQJB 3IC0A 5MBAA 1YZIB 1BIJA 1MLUA 3WCPB 1SWMA 2E2YA 2IN4A 2AA1B 1BVDA 4KJTA 1Y8HA 2ZSTA 5HAVA 1GZXA 3LR9A 4M4BB 1VRFA 1LJWB 5CMVA 1J3FA 2LHBA 3V2VA 3QM7A 1MYMA 1QXDA 4MQCB 5D5RA 1Y7ZA 1ECAA 1YGDB 3PI4A 1WVPA 4QAUA 3UHZA 2DN2B 5EYSA 1ABYA 1VHBA 1R1XA 1CH7A 1JP9A 2D60A 5SW7B 2HBDA 2WTGA 3UHNA 1K0YA 2ZS0A 1CG8A 1CP0A 3DUTB 2EB8A 1HBRB 1DXTA 2DXMA 1MLOA 1ITHA 1HLBA 2ZFBB 3WHMB 5MBNA 2FAMA 1THBB 1TU9A 2V1GA 1LH3A 3ZJIA 1SI4A 1T1NA 1JF4A 1CMYA 3BJ2B 1YG5B 1CH5A 3PT8A 4F6IA 1X9FB 2QMBB 1GDKA 3BA2A 3MJPB 5CNCA 3PT7B 3DHTB 1IWHA 2Z6NA 3RJNB 4OODA 1JP6A 1XZUB 1Y4GA 3ECZA 1LTWA 1MTJA 1J3ZA 4F4OB 5F2AA 5HBIA 2MGHA 1HBAA 1AJGA 1YDZA 4MPMA 5AZQA 1C40B 1NQPB 2G10A 2V1HA 1LHTA 1O1OA 3SZKB 3WCUB 2GDMA 2G0RA 1AJHA 2AUPA 4H2LB 1Y4PA 1HBIA 1HV4A 3WCWA 1DO4A 1U7SA 1XZ4B 1V75B 1UFPA 1MCYA 2D2MD 4WJGA 1YHEA 4HHBA 4WJG1 1MDNA 3GQRA 1UT0A 2ZS0D 1JY7A 1KD2A 1EWAA 1W92A 1Y01B 2H8FA 1A9WA 1J3YA 4NI0A 1UIWA 3IA3B 3VHBA 4NS2A 5C6EA 3G46A 2ZLWA 1C7DB 2PGHA 1LFQA 2G0ZA 5KKKA 1XZ2B 3WR1A 1SHRB 5KERB 1IRCA 2IG3A 1WMUB 2ZS1A 3HHBA 1YH9A 3QQQA 1BZZB 1HBHB 1N9FA 1ABSA 1Y4VA 1JZMA 4F6FA 2OH8A 2D2NA 1J40B 3OO5B 3SDNA 1RQ4B 3NMMB 3M3BA 3WTGA 1XZ7B 1NWNA 4UIQA 1B86B 1J7YB 1QSIB 3B75B 1G09B 2WY4A 1EMYA 2DHBA 3ED9A 1Y8WA 4VHBA 4MQKB 1MYZA 4U8UA 4G51A 5B85A 3AQ9A 1V07A 4YU4B 2ZFOC 1Y2ZA 3ZOLA 1HACB 4HRTA 2AA1A 3ZH0A 1Y46B 2MHBA 1MWCA 3WFTA 1UX8A 2O5QX 3KMFC 3NFEB 1BUWB 1Y4BA 1DO3A 1MYGA 1EBCA 2MGAA 3WCWD 1LJWA 3WCTC 1ABWB 2HHEA 2D6CA 1RQ3A 1Y0WA 2OIFA 4MQCA 1G9VB 1O1PB 1MLKA 5KDQB 1KFRA 1O1JA 4C44A 1QXEB 4NI1B 1G08B 1U7RA 3MJUB 2MYDA 2MGFA 2VLYA 3IXFA 3GDJB 1JF3A 1HDAA 3QZXA 1Y0AB 1NZ2A 1QSHA 3OGBA 1HDBA 1YGFB 3QJBB 1BBBB 3UHXA 1O1MA 4TYXA 4HSWA 2R4ZA 2GTLD 2GRFA 1BJEA 1DXUB 3AQ8A 1V9QA 5CNEA 4ODCA 1S56A 1M6CA 3BJ2A 1XCHA 1V4XB 2QFNA 3QM6A 4PQCA 4MQGA 2AV3A 3UH6A 1URYA 2GRHA 2NSRA 1Y4QB 5EUIA 1A01B 1JWNA 1MTIA 5CNFA 4F6JA 1HGCB 1Y8KA 1JL7A 1IOPA 4FC3A 4XS0A 3ODQA 5JOMA 1Y83A 1NS6B 1RTXA 1NQPA 4N7PA 2PEGA 4LPIA 4FWXA 1BZPA 4PQ6A 3S48C 1F5PA 2HCOA 3RGKA 1NIHB 2RAOA 4NZIA 3SZKA 4O4TA 3EOKB 1RQAA 3GLNA 1MYJA 3HF4B 3LB1A 1YHUC 2ZLXA 1YHRB 1YEQB 1Y7DB 1J7WA 1XZ4A 3PI9B 2ZSZA 6HBWA 2VYZA 1HLMA 1WLAA 3G52A 4OF9A 4JACA 2ZT4A 2VYWA 3HENA 1GLIB 3OVUC 1Y7CB 4MQHA 1CH4A 1NZ3A 3A5GA 1UMOA 1C7DA 1MLNA 4ESAA 2AURA 3NG6A 1Q1FA 5HU6B 2D5ZA 1MWDA 1ECNA 1K1KB 1DXDA 1VWTA 3ECLA 2M6ZB 1S6AA 3MOUA 1A6KA 5HLXA 2ZWJA 3A9MA 4F6DA 2ZT2A 4YU3A 2HHBA 3NL7B 2RI4B 1A6MA 3MVCA 2W6WA 3QZZA 1CO9A 1YENB 3OO5A 5JDOD 1Y31B 1HABB 3K8BB 3ARJA 1LHSA 2BLJM 3G4UA 5JGGB 1XZ7A 1LH7A 2ZT1A 1V4WB 3PI8B 4HRRB 1CQXA 4G1BA 2O5TX 1RVWB 5CN8A 4M4AB 1TESA 3LB3A 1JEBA 2LH6A 2YRSB 1OJ6A 1MOCA 4MBAA 3QM8A 1Y0TA 4YU4A 2MGCA 1GCWA 1Y0CB 1HACA 2HZ3A 1MODA 2JHOA 3S1IA 2VM0A 5JDOE 1YOIA 1QI8B 1PBXA 1NZ5A 3UHIA 3M3AA 4FH7A 1Y0DB 2AUQA 2HBFA 1IDRA 1O1PA 3OO4B 1A3OA 2ZFOB 1YEOB 1A00B 1LA6B 2H35A 1DLWA 1V4UB 1BABB 2HBEB 1ECDA 3VRGB 2V1JA 1YMCA 1MNOA 3PI1A 3MJUA 3WCTB 1S0HB 101MA 1NPFA 1C7BA 4TWVA 1HBSB 2QLSB 3OZUA 4X0LB 4XDIA 1OR6A 110MA 3HYUB 1CBMA 1A0UB 2WTHA 3UH3A 1F5OA 1A3NB 1C7CB 1OBMA 3D1AA 3QJEA 1DXUA 1O1KB 3NMLA 5EE4D 3GKVA 2B7HA 1IT3A 1GBUB 5B84A 1AJ9A 5ILMA 1CH9A 1XY0A 1HCOB 3A59A 1GCVB 1N9XA 1YEVA 3ONZB 3BOMB 1HGCA 3HRWA 1DM1A 3FS4B 7HBIA 3TM9A 3M38A 1Y85B 3ZJMA 2XKGA 1ASHA 2NRLA 2D2MA 1CH2A 3D4XB 1MLHA 1VXDA 3ZJHA 3UHRA 1OFKA 3LHBA 2BW9M 4DWUA 3D7OB 1LH2A 3ZJLA 2MGLA 1JZKA 1XZ5B 1Y35A 1HRMA 3VAUA 1MLLA 3O89A 1NWIA 1YVTB 1XXTB 4MQIA 1YIHB 1YIEB 1F63A 1M9PB 4NK1A 1O1NB 3HF4A 1LFZB 3AQ5A 3RJ6A 3ZJOA 1BVCA 1YE0B 1Y7DA 3AT6A 3H58A 5E6EB 1SPGA 1OR4A 4N7OB 4DC8A 1HGBA 4PQBA 2R4XA 1YVQB 1YHUB 4BJAA 1HDSA 4H07A 1XYEB 1VXBA 4ROLA 1CO8A 3UHUA 3EU1A 4B4YA 2ZSSA 1LFTA 2HHDB 3VREB 3NL7A 3MKBB 2BNLA 2R4WA 3QQRA 3A0GB 3KUNA 5JGGA 2LH1A 1BZ0A 3VRFA 3R5IB 1V4WA 4O35A 1Y22B 3WCVA 1DXCA 2G0SA 4G1VA 2W6XA 2MB5A 5AZRA 2GKMA 2R1HB 1S5YB 1Y8IA 3QJDB 1DXVB 2R80B 2HBSB 2W6VB 4AVEA 1HHOA 5HY8B 2FALA 1RSEA 3KUOA 5HLUA 1FAWB 3G4RA 3IC2B 1LFVA 1Y4RB 1X3KA 4FWZA 4ROMA 2XKIA 4WCHD 1IRDA 3PELA 4C0NA 1S5XB 1Y0DA 3DHRB 1Y7GA 2W72C 1SDLB 2GTLA 1CLSA 4N8TB 2ZSQA 3OO4A 5E29B 1RPSA 1MLQA 3GQPB 1DWRA 2EF2A 2H8DA 1NS9A 3R0GA 2D5XB 1Y09B 1MBCA 1SDKB 1CIOA 3QM5A 5E83A 5HLQA 2QSPA 3BCQB 3UH7A 1MLGA 1CQ2A 3ASEA 4UZVA 2MGKA 1BZ1B 1XQ5B 2VLXA 3UI0A 1HBSA 1A0ZB 1J7SA 4MQJA 2V1KA 3AT5B 1YZIA 3HXNB 2BKMA 3WCPA 2ZS1C 2QSSB 1M6MA 1A0UA 3LQDB 4IROB 1EW6A 2G11A 4L7YB 2QU0B 4M4BA 1CBLA 4MU5A 2D2NC 2ZSNA 3WFUA 2AUOA 3WCVD 1MLJA 4HSXA 3S66B 1YGDA 5D1VA 2DN2A 3GYSB 1GDJA 1FN3B 1YFFB 5SW7A 1VXHA 4U8UC 3GQGB 1COHB 3W4UB 4MBNA 2ZSXA 3DUTA 4MXKA 1NPGA 3UHQA 1HBRA 3GK9A 2ZFBA 1YEUB 3WHMA 2VRYA 1THBA 1YVTA 3PI2A 1XXTA 1EBTA 3CIUB 1CPWA 1YIEA 1M9PA 1FHJB 2LH5A 1O1NA 1YE2B 1J41B 3WFWA 1CG5B 2ZFOD 1R1YB 1MKOB 1PMBA 1GBVB 1G0AB 3E4NA 1YG5A 1X46A 3P5QB 2MYCA 3ZJPA 1BIJB 4MXLA 1X9FA 2QMBA 1Y8HB 3MJPA 3PT7A 1FDHG 3DHTA 3QJCB 4N7OA 3UHTA 3G4QA 1GZXB 1XZUA 2Z6SA 2MGJA 1NAZA 4F4OA 109MA 1YVQA 1C40A 3ARLA 1QXDB 2Z85A 1Y7ZB 102MA 1DO7A 2NRMA 3VREA 1ABYB 1YOHA 3FH9B 2D60B 3BJ1B 4H0BA 3WCUA 2DN3B 2HBDB 3S65B 3A5AA 1A6GA 1CG8B 1FLPA 4H2LA 3O7NA 1DXTB 2MYEA 3UHSA 1DUKA 3H57A 5CN5A 2ZSRA 3UHYA 1V75A 2ZLVB 1SI4B 3PI3A 1T1NB 1JZLA 4TWUA 1CMYB 1YCAA 2ZLUB 2NSSA 1VXFA 1MZ0A 1H97A 3UBCA 1XZ2A 1DKEB 1SHRA 5KERA 3IC2A 2O5OX 1WMUA 2SPOA 1IWHB 2Z6NB 2MGEA 1MOBA 4GZGA 1Y4GB 2ZLTB 1BZZA 1J3ZB 111MA 3MN0A 112MA 1HBHA 1O1IB 1HBAB 1LUEA 1YDZB 1X9FD 1HSYA 1SDLA 2VLZA 1J40A 2Z6TA 1RQ4A 3A2GA 3NMMA 1O1OB 4L2MA 4IT8A 2BLHA 1B86A 1J7YA 1MYHA 1QSIA 1DTMA 2R50A 3B75A 1G09A 2OLPA 1Y45B 1A4FB 2O5LX 1LFYB 1BZ1A 1Y4PB 4MQKA 1MBAA 2NX0A 1F65A 3AQ6A 3UHCA 2W72B 1FSLA 3UGYA 1HV4B 2LH2A 1I3EA 4KMVA 3S1JA 4IROA 4HHBB 3WCUD 1CIKA 1Y46A 5M3SA 3GQRB 3GOUB 1HBGA 1YMBA 1JY7B 1VXCA 3NFEA 1KD2B 1BUWA 1HJTA 2OHAA 1J3YB 4NI0B 2CMMA 1LFLB 4FWYA 1UIWB 1G0BB 4B3WA 5C6EB 2PGHB 2ZLWB 1LFQB 1ABWA 2V1EA 3HEPA 3WR1B 3E5IA 3TLDA 1G9VA 2G3HA 2OH9A 2ZS1B 3BJ3B 2HZ2A 108MA 3HHBB 5CHQA 2HBCB 1YH9B 5KDQA 2FRKX 4KN3A 3D1KB 1Y4VB 1QXEA 4NI1A 1URVA 1G08A 2O5MX 1FSXB 2D2NB 1ECOA 3GDJA 1L2KA 1OUUB 5CN9A 3WTGB 4F6BA 1Y0AA 1YEUA 1YGFA 2LH3A 1OUTB 3QJBA 1BBBA 4O4ZA 1BZ6A 3G4VA 2G0XA 2QFKA 2DHBB 1Y8WB 5ILPA 1CG5A 4U8UB 4G51B 2AV0A 2VEEA 1O1LB 4NXCA 2MGIA 1V4XA 3PIAB 3P5QA 4NXAA 5IKSA 5EV5A 1MNHA 1Y2ZB 1Y5JB 1Y4QA 4HRTB 1A01A 2MHBB 103MA 1MLMA 3QJCA 1Y4BB 1UVXA 2C0KA 1NS6A 3ZJJA 2HHEB 5EETA 3TM3A 1RQ3B 1Y0WB 3HEOA 3UGZA 1NIHA 2MGGA 3SDHA 2DC3A 3FH9A 3EOKA 1O1JB 3BJ1A 2DN3A 1MOHA 1GDIA 3S65A 1MGNA 1Y5KB 3ZJQA 2W6YA 3ZJNA 3K3UA 2FRFA 1YMAA 1V5HA 4AVDA 4DWTA 1DTIA 3K9ZA 5CNGA 1AZIA 1HDAB 1BZRA 1I3DA 1QSHB 1YHRA 1HDBB 107MA 1YEQA 3CY5B 2GNVA 2VEBA 3PI9A 1O1MB 2ZLVA 1GLIA 2D2MC 1Y7CA 2ZLUA 1QPWB 4ODCB 2GL3A 2O58X 1MTKA 2ZS0C 3E55A 1LH6A 4MQGB 1MLFA 3DR9A 1DKEA 5EUIB 5HU6A 2W31A 1LH1A 1K1KA 1DUOA 2M6ZA 1Y8KB 2ZLTA 3LR7A 4FC3B 4XS0B 2GKNA 3ODQB 1O1IA 1MNJA 2RI4A 1Y83B 1JPBA 3E5OA 1CP5A 2FRJX 2BMMA 3V2ZA 4N7PB 1YENA 1NZ4A 2PEGB 1Y31A 1HABA 2EB9A 3K8BA 2HCOB 1MBIA 2RAOB 3PI8A 4HRRA 1JP8A 3UHBA 1RQAB 1RVWA 4M4AA 1Y45A 1A4FA 1HBBB 2GRZA 3UHVA 1LFYA 4N7NB 3A5BA 1Y4FB 2YRSA 3OK5A 2W72A 1UX9A 2ZLXB 1Y0CA 1J7WB 4KMWA 1XZVB 6HBWB 2VHBA 2O5SX 1MYIA 3GOUA 3LB4A 4SDHA 4MQHB 2MGMA 1LFLA 3OZVA 5EOHA 4F69A 1QI8A 1G0BA 2ZT0A 4HBIA 4ESAB 2KSCA 1UC3A 4FH6A 3NG6B 2D5ZB 3WCWC 2ZFOA 1YEOA 1NXFA 1A00A 2GNWA 3BJ3A 1VWTB 1LA6A 2HBCA 3UHWA 3WCVC 1V4UA 1BABA 1MOAA 2HBEA 3D1KA 4YU3B 2HHBB 3VRGA 1IBEB 1FCSA 3KMFA 1MYTA 3HC9A 1FSXA 3WCTA 1S0HA 3ECXA 1N9HA 5EQMA 1OUUA 1JL6A 2QLSA 4X0LA 1OUTA 5CNDA 3HYUA 1A3NA 1C7CA 1HGAB 3UHEA 1JEBB 1O1KA 1DO1A 104MA 1GBUA 1O1LA 105MA 2GTLC 3D17B 3PIAA 1Y0TB 1GCWB 3MBAA 1KR7A 1HCOA 1Y5JA 4NK2A 1GCVA 4PNJA 3ONZA 3BOMA 1VXEA 2XKHA 1NEJB 3FS4A 2EKUA 1GVHA 2ZSOA 5CN7A 1PBXB 1Y85A 3D4XA 3MYMA 3AG0A 1Y5FB 2LH7A 3UHKA 3D7OA 2HBFB 1GDLA 2BK9A 1DLYA 1A3OB 2DN1B 2MGBA 2H35B 1XZ5A 3UHGA 1UFJA 1MBOA 3G53A 1JDOA 1N9IA 1Z8UB 2G0VA 1UVYA 1D8UA 1YIHA 1MNIA 5CNBA 1FDHA 1MYFA 1Y5KA 2FRIX 1MBSA 2MYAA 2BLIA 1RTEA 5JDOF 1LFZA 1C7BB 2ZS1D 5ILRA 2QRWA 4ZVBA 3IC0B 1YE0A 1SPEA 3CY5A 3MYNA 1BINA 2SPNA 1O16A 1YOGA 1OFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F68 A;  2HBG A;  1S69 A;  5E6E A;  3D1A B;  3QJE B;  3QM9 A;  3ZHW A;  2R4Y A;  4F6G A;  2D2N D;  2Z8A A;  3WCT D;  5AB8 A;  3GKV B;  1QPW A;  2B7H B;  3WI8 A;  1GJN A;  1AJ9 B;  3LB2 A;  1XY0 B;  2MBW A;  5CN6 A;  1A9W E;  3OJ1 A;  3EDA A;  3UHH A;  2EVK A;  1YHU A;  3A59 B;  1MLR A;  2SPM A;  2V1F A;  1YEV B;  1XYE A;  1J52 A;  4U8U D;  3HRW B;  2HHD A;  1R1X B;  2D2M B;  3MKB A;  2ZT3 A;  1K0Y B;  2ZS0 B;  3A0G A;  1X9F C;  2DXM B;  4ILZ A;  5CN4 A;  1Y35 B;  1B0B A;  2ZSP A;  1MNK A;  5JDO C;  3R5I A;  2BWH A;  1Y22 A;  1MWB A;  4MQI B;  3AQ7 A;  2VYY A;  6HBI A;  4DC7 A;  1HBB A;  3UH5 A;  4N7N A;  1Y4F A;  2EVP A;  3WFX A;  2R1H A;  2SPL A;  1S5Y A;  3PT8 B;  5C6Y A;  1CH3 A;  3QJD A;  1DXV A;  2R80 A;  3AT6 B;  3ARK A;  2HBS A;  2W6V A;  2MGD A;  5ILE A;  5CHR A;  1VXA A;  3G4W A;  1VRE A;  1XZV A;  5HY8 A;  1SPG B;  1FAW A;  1Y4R A;  3ORD A;  3WCU C;  2MYB A;  1HGB B;  2G14 A;  4O2G A;  1S5X A;  1JW8 A;  3DHR A;  1HDS B;  4N8T A;  5E29 A;  1YCB A;  3GQP A;  4ROL B;  3EU1 B;  1LFT B;  1DWS A;  2D5X A;  1Y09 A;  1SDK A;  1IBE A;  5F0B A;  3BCQ A;  1YHU D;  2HZ1 A;  5EYJ A;  1XQ5 A;  1NGK A;  1A0Z A;  1BZ0 B;  4MAX A;  3VRF B;  1S61 A;  2GLN A;  3WCW B;  3AT5 A;  3HXN A;  4UUR A;  2QSS A;  1A6N A;  3EDB A;  3OZW A;  3LQD A;  1YHE B;  3M39 A;  3WCV B;  5EU2 A;  1IT2 A;  1DWT A;  1HGA A;  3U3E A;  2H8F B;  4L7Y A;  2QU0 A;  4O1T A;  2ZSY A;  3D17 A;  1Y8I B;  5EE4 C;  1HHO B;  3ZJR A;  1MBD A;  2OHB A;  1MLS A;  1LFV B;  1MBN A;  4ROM B;  3S66 A;  2EKT A;  3UHD A;  1NEJ A;  3ZJS A;  3GYS A;  3ZOM A;  2XYK A;  1FN3 A;  3UBV A;  1YFF A;  1IRD B;  3PEL B;  1Y5F A;  1LH5 A;  1Y7G B;  3GQG A;  1COH A;  2GTL B;  1CLS B;  3W4U A;  2O5B X;  2DN1 A;  3G4Y A;  1RPS B;  3QMA A;  2H8D B;  1CH1 A;  1NS9 B;  1H1X A;  4ZVA A;  3GKT A;  2G12 A;  3CIU A;  1VXG A;  5E83 B;  2QSP B;  1FHJ A;  2V1I A;  4JYQ A;  106M A;  1YE2 A;  1J41 A;  1R1Y A;  1MKO A;  1GBV A;  1J7S B;  1G0A A;  4MQJ B;  3IC0 A;  5MBA A;  1YZI B;  1BIJ A;  1MLU A;  3WCP B;  1SWM A;  2E2Y A;  2IN4 A;  2AA1 B;  1BVD A;  4KJT A;  1Y8H A;  2ZST A;  5HAV A;  1GZX A;  3LR9 A;  4M4B B;  1VRF A;  1LJW B;  5CMV A;  1J3F A;  2LHB A;  3V2V A;  3QM7 A;  1MYM A;  1QXD A;  4MQC B;  5D5R A;  1Y7Z A;  1ECA A;  1YGD B;  3PI4 A;  1WVP A;  4QAU A;  3UHZ A;  2DN2 B;  5EYS A;  1ABY A;  1VHB A;  1R1X A;  1CH7 A;  1JP9 A;  2D60 A;  5SW7 B;  2HBD A;  2WTG A;  3UHN A;  1K0Y A;  2ZS0 A;  1CG8 A;  1CP0 A;  3DUT B;  2EB8 A;  1HBR B;  1DXT A;  2DXM A;  1MLO A;  1ITH A;  1HLB A;  2ZFB B;  3WHM B;  5MBN A;  2FAM A;  1THB B;  1TU9 A;  2V1G A;  1LH3 A;  3ZJI A;  1SI4 A;  1T1N A;  1JF4 A;  1CMY A;  3BJ2 B;  1YG5 B;  1CH5 A;  3PT8 A;  4F6I A;  1X9F B;  2QMB B;  1GDK A;  3BA2 A;  3MJP B;  5CNC A;  3PT7 B;  3DHT B;  1IWH A;  2Z6N A;  3RJN B;  4OOD A;  1JP6 A;  1XZU B;  1Y4G A;  3ECZ A;  1LTW A;  1MTJ A;  1J3Z A;  4F4O B;  5F2A A;  5HBI A;  2MGH A;  1HBA A;  1AJG A;  1YDZ A;  4MPM A;  5AZQ A;  1C40 B;  1NQP B;  2G10 A;  2V1H A;  1LHT A;  1O1O A;  3SZK B;  3WCU B;  2GDM A;  2G0R A;  1AJH A;  2AUP A;  4H2L B;  1Y4P A;  1HBI A;  1HV4 A;  3WCW A;  1DO4 A;  1U7S A;  1XZ4 B;  1V75 B;  1UFP A;  1MCY A;  2D2M D;  4WJG A;  1YHE A;  4HHB A;  4WJG 1;  1MDN A;  3GQR A;  1UT0 A;  2ZS0 D;  1JY7 A;  1KD2 A;  1EWA A;  1W92 A;  1Y01 B;  2H8F A;  1A9W A;  1J3Y A;  4NI0 A;  1UIW A;  3IA3 B;  3VHB A;  4NS2 A;  5C6E A;  3G46 A;  2ZLW A;  1C7D B;  2PGH A;  1LFQ A;  2G0Z A;  5KKK A;  1XZ2 B;  3WR1 A;  1SHR B;  5KER B;  1IRC A;  2IG3 A;  1WMU B;  2ZS1 A;  3HHB A;  1YH9 A;  3QQQ A;  1BZZ B;  1HBH B;  1N9F A;  1ABS A;  1Y4V A;  1JZM A;  4F6F A;  2OH8 A;  2D2N A;  1J40 B;  3OO5 B;  3SDN A;  1RQ4 B;  3NMM B;  3M3B A;  3WTG A;  1XZ7 B;  1NWN A;  4UIQ A;  1B86 B;  1J7Y B;  1QSI B;  3B75 B;  1G09 B;  2WY4 A;  1EMY A;  2DHB A;  3ED9 A;  1Y8W A;  4VHB A;  4MQK B;  1MYZ A;  4U8U A;  4G51 A;  5B85 A;  3AQ9 A;  1V07 A;  4YU4 B;  2ZFO C;  1Y2Z A;  3ZOL A;  1HAC B;  4HRT A;  2AA1 A;  3ZH0 A;  1Y46 B;  2MHB A;  1MWC A;  3WFT A;  1UX8 A;  2O5Q X;  3KMF C;  3NFE B;  1BUW B;  1Y4B A;  1DO3 A;  1MYG A;  1EBC A;  2MGA A;  3WCW D;  1LJW A;  3WCT C;  1ABW B;  2HHE A;  2D6C A;  1RQ3 A;  1Y0W A;  2OIF A;  4MQC A;  1G9V B;  1O1P B;  1MLK A;  5KDQ B;  1KFR A;  1O1J A;  4C44 A;  1QXE B;  4NI1 B;  1G08 B;  1U7R A;  3MJU B;  2MYD A;  2MGF A;  2VLY A;  3IXF A;  3GDJ B;  1JF3 A;  1HDA A;  3QZX A;  1Y0A B;  1NZ2 A;  1QSH A;  3OGB A;  1HDB A;  1YGF B;  3QJB B;  1BBB B;  3UHX A;  1O1M A;  4TYX A;  4HSW A;  2R4Z A;  2GTL D;  2GRF A;  1BJE A;  1DXU B;  3AQ8 A;  1V9Q A;  5CNE A;  4ODC A;  1S56 A;  1M6C A;  3BJ2 A;  1XCH A;  1V4X B;  2QFN A;  3QM6 A;  4PQC A;  4MQG A;  2AV3 A;  3UH6 A;  1URY A;  2GRH A;  2NSR A;  1Y4Q B;  5EUI A;  1A01 B;  1JWN A;  1MTI A;  5CNF A;  4F6J A;  1HGC B;  1Y8K A;  1JL7 A;  1IOP A;  4FC3 A;  4XS0 A;  3ODQ A;  5JOM A;  1Y83 A;  1NS6 B;  1RTX A;  1NQP A;  4N7P A;  2PEG A;  4LPI A;  4FWX A;  1BZP A;  4PQ6 A;  3S48 C;  1F5P A;  2HCO A;  3RGK A;  1NIH B;  2RAO A;  4NZI A;  3SZK A;  4O4T A;  3EOK B;  1RQA A;  3GLN A;  1MYJ A;  3HF4 B;  3LB1 A;  1YHU C;  2ZLX A;  1YHR B;  1YEQ B;  1Y7D B;  1J7W A;  1XZ4 A;  3PI9 B;  2ZSZ A;  6HBW A;  2VYZ A;  1HLM A;  1WLA A;  3G52 A;  4OF9 A;  4JAC A;  2ZT4 A;  2VYW A;  3HEN A;  1GLI B;  3OVU C;  1Y7C B;  4MQH A;  1CH4 A;  1NZ3 A;  3A5G A;  1UMO A;  1C7D A;  1MLN A;  4ESA A;  2AUR A;  3NG6 A;  1Q1F A;  5HU6 B;  2D5Z A;  1MWD A;  1ECN A;  1K1K B;  1DXD A;  1VWT A;  3ECL A;  2M6Z B;  1S6A A;  3MOU A;  1A6K A;  5HLX A;  2ZWJ A;  3A9M A;  4F6D A;  2ZT2 A;  4YU3 A;  2HHB A;  3NL7 B;  2RI4 B;  1A6M A;  3MVC A;  2W6W A;  3QZZ A;  1CO9 A;  1YEN B;  3OO5 A;  5JDO D;  1Y31 B;  1HAB B;  3K8B B;  3ARJ A;  1LHS A;  2BLJ M;  3G4U A;  5JGG B;  1XZ7 A;  1LH7 A;  2ZT1 A;  1V4W B;  3PI8 B;  4HRR B;  1CQX A;  4G1B A;  2O5T X;  1RVW B;  5CN8 A;  4M4A B;  1TES A;  3LB3 A;  1JEB A;  2LH6 A;  2YRS B;  1OJ6 A;  1MOC A;  4MBA A;  3QM8 A;  1Y0T A;  4YU4 A;  2MGC A;  1GCW A;  1Y0C B;  1HAC A;  2HZ3 A;  1MOD A;  2JHO A;  3S1I A;  2VM0 A;  5JDO E;  1YOI A;  1QI8 B;  1PBX A;  1NZ5 A;  3UHI A;  3M3A A;  4FH7 A;  1Y0D B;  2AUQ A;  2HBF A;  1IDR A;  1O1P A;  3OO4 B;  1A3O A;  2ZFO B;  1YEO B;  1A00 B;  1LA6 B;  2H35 A;  1DLW A;  1V4U B;  1BAB B;  2HBE B;  1ECD A;  3VRG B;  2V1J A;  1YMC A;  1MNO A;  3PI1 A;  3MJU A;  3WCT B;  1S0H B;  101M A;  1NPF A;  1C7B A;  4TWV A;  1HBS B;  2QLS B;  3OZU A;  4X0L B;  4XDI A;  1OR6 A;  110M A;  3HYU B;  1CBM A;  1A0U B;  2WTH A;  3UH3 A;  1F5O A;  1A3N B;  1C7C B;  1OBM A;  3D1A A;  3QJE A;  1DXU A;  1O1K B;  3NML A;  5EE4 D;  3GKV A;  2B7H A;  1IT3 A;  1GBU B;  5B84 A;  1AJ9 A;  5ILM A;  1CH9 A;  1XY0 A;  1HCO B;  3A59 A;  1GCV B;  1N9X A;  1YEV A;  3ONZ B;  3BOM B;  1HGC A;  3HRW A;  1DM1 A;  3FS4 B;  7HBI A;  3TM9 A;  3M38 A;  1Y85 B;  3ZJM A;  2XKG A;  1ASH A;  2NRL A;  2D2M A;  1CH2 A;  3D4X B;  1MLH A;  1VXD A;  3ZJH A;  3UHR A;  1OFK A;  3LHB A;  2BW9 M;  4DWU A;  3D7O B;  1LH2 A;  3ZJL A;  2MGL A;  1JZK A;  1XZ5 B;  1Y35 A;  1HRM A;  3VAU A;  1MLL A;  3O89 A;  1NWI A;  1YVT B;  1XXT B;  4MQI A;  1YIH B;  1YIE B;  1F63 A;  1M9P B;  4NK1 A;  1O1N B;  3HF4 A;  1LFZ B;  3AQ5 A;  3RJ6 A;  3ZJO A;  1BVC A;  1YE0 B;  1Y7D A;  3AT6 A;  3H58 A;  5E6E B;  1SPG A;  1OR4 A;  4N7O B;  4DC8 A;  1HGB A;  4PQB A;  2R4X A;  1YVQ B;  1YHU B;  4BJA A;  1HDS A;  4H07 A;  1XYE B;  1VXB A;  4ROL A;  1CO8 A;  3UHU A;  3EU1 A;  4B4Y A;  2ZSS A;  1LFT A;  2HHD B;  3VRE B;  3NL7 A;  3MKB B;  2BNL A;  2R4W A;  3QQR A;  3A0G B;  3KUN A;  5JGG A;  2LH1 A;  1BZ0 A;  3VRF A;  3R5I B;  1V4W A;  4O35 A;  1Y22 B;  3WCV A;  1DXC A;  2G0S A;  4G1V A;  2W6X A;  2MB5 A;  5AZR A;  2GKM A;  2R1H B;  1S5Y B;  1Y8I A;  3QJD B;  1DXV B;  2R80 B;  2HBS B;  2W6V B;  4AVE A;  1HHO A;  5HY8 B;  2FAL A;  1RSE A;  3KUO A;  5HLU A;  1FAW B;  3G4R A;  3IC2 B;  1LFV A;  1Y4R B;  1X3K A;  4FWZ A;  4ROM A;  2XKI A;  4WCH D;  1IRD A;  3PEL A;  4C0N A;  1S5X B;  1Y0D A;  3DHR B;  1Y7G A;  2W72 C;  1SDL B;  2GTL A;  1CLS A;  4N8T B;  2ZSQ A;  3OO4 A;  5E29 B;  1RPS A;  1MLQ A;  3GQP B;  1DWR A;  2EF2 A;  2H8D A;  1NS9 A;  3R0G A;  2D5X B;  1Y09 B;  1MBC A;  1SDK B;  1CIO A;  3QM5 A;  5E83 A;  5HLQ A;  2QSP A;  3BCQ B;  3UH7 A;  1MLG A;  1CQ2 A;  3ASE A;  4UZV A;  2MGK A;  1BZ1 B;  1XQ5 B;  2VLX A;  3UI0 A;  1HBS A;  1A0Z B;  1J7S A;  4MQJ A;  2V1K A;  3AT5 B;  1YZI A;  3HXN B;  2BKM A;  3WCP A;  2ZS1 C;  2QSS B;  1M6M A;  1A0U A;  3LQD B;  4IRO B;  1EW6 A;  2G11 A;  4L7Y B;  2QU0 B;  4M4B A;  1CBL A;  4MU5 A;  2D2N C;  2ZSN A;  3WFU A;  2AUO A;  3WCV D;  1MLJ A;  4HSX A;  3S66 B;  1YGD A;  5D1V A;  2DN2 A;  3GYS B;  1GDJ A;  1FN3 B;  1YFF B;  5SW7 A;  1VXH A;  4U8U C;  3GQG B;  1COH B;  3W4U B;  4MBN A;  2ZSX A;  3DUT A;  4MXK A;  1NPG A;  3UHQ A;  1HBR A;  3GK9 A;  2ZFB A;  1YEU B;  3WHM A;  2VRY A;  1THB A;  1YVT A;  3PI2 A;  1XXT A;  1EBT A;  3CIU B;  1CPW A;  1YIE A;  1M9P A;  1FHJ B;  2LH5 A;  1O1N A;  1YE2 B;  1J41 B;  3WFW A;  1CG5 B;  2ZFO D;  1R1Y B;  1MKO B;  1PMB A;  1GBV B;  1G0A B;  3E4N A;  1YG5 A;  1X46 A;  3P5Q B;  2MYC A;  3ZJP A;  1BIJ B;  4MXL A;  1X9F A;  2QMB A;  1Y8H B;  3MJP A;  3PT7 A;  1FDH G;  3DHT A;  3QJC B;  4N7O A;  3UHT A;  3G4Q A;  1GZX B;  1XZU A;  2Z6S A;  2MGJ A;  1NAZ A;  4F4O A;  109M A;  1YVQ A;  1C40 A;  3ARL A;  1QXD B;  2Z85 A;  1Y7Z B;  102M A;  1DO7 A;  2NRM A;  3VRE A;  1ABY B;  1YOH A;  3FH9 B;  2D60 B;  3BJ1 B;  4H0B A;  3WCU A;  2DN3 B;  2HBD B;  3S65 B;  3A5A A;  1A6G A;  1CG8 B;  1FLP A;  4H2L A;  3O7N A;  1DXT B;  2MYE A;  3UHS A;  1DUK A;  3H57 A;  5CN5 A;  2ZSR A;  3UHY A;  1V75 A;  2ZLV B;  1SI4 B;  3PI3 A;  1T1N B;  1JZL A;  4TWU A;  1CMY B;  1YCA A;  2ZLU B;  2NSS A;  1VXF A;  1MZ0 A;  1H97 A;  3UBC A;  1XZ2 A;  1DKE B;  1SHR A;  5KER A;  3IC2 A;  2O5O X;  1WMU A;  2SPO A;  1IWH B;  2Z6N B;  2MGE A;  1MOB A;  4GZG A;  1Y4G B;  2ZLT B;  1BZZ A;  1J3Z B;  111M A;  3MN0 A;  112M A;  1HBH A;  1O1I B;  1HBA B;  1LUE A;  1YDZ B;  1X9F D;  1HSY A;  1SDL A;  2VLZ A;  1J40 A;  2Z6T A;  1RQ4 A;  3A2G A;  3NMM A;  1O1O B;  4L2M A;  4IT8 A;  2BLH A;  1B86 A;  1J7Y A;  1MYH A;  1QSI A;  1DTM A;  2R50 A;  3B75 A;  1G09 A;  2OLP A;  1Y45 B;  1A4F B;  2O5L X;  1LFY B;  1BZ1 A;  1Y4P B;  4MQK A;  1MBA A;  2NX0 A;  1F65 A;  3AQ6 A;  3UHC A;  2W72 B;  1FSL A;  3UGY A;  1HV4 B;  2LH2 A;  1I3E A;  4KMV A;  3S1J A;  4IRO A;  4HHB B;  3WCU D;  1CIK A;  1Y46 A;  5M3S A;  3GQR B;  3GOU B;  1HBG A;  1YMB A;  1JY7 B;  1VXC A;  3NFE A;  1KD2 B;  1BUW A;  1HJT A;  2OHA A;  1J3Y B;  4NI0 B;  2CMM A;  1LFL B;  4FWY A;  1UIW B;  1G0B B;  4B3W A;  5C6E B;  2PGH B;  2ZLW B;  1LFQ B;  1ABW A;  2V1E A;  3HEP A;  3WR1 B;  3E5I A;  3TLD A;  1G9V A;  2G3H A;  2OH9 A;  2ZS1 B;  3BJ3 B;  2HZ2 A;  108M A;  3HHB B;  5CHQ A;  2HBC B;  1YH9 B;  5KDQ A;  2FRK X;  4KN3 A;  3D1K B;  1Y4V B;  1QXE A;  4NI1 A;  1URV A;  1G08 A;  2O5M X;  1FSX B;  2D2N B;  1ECO A;  3GDJ A;  1L2K A;  1OUU B;  5CN9 A;  3WTG B;  4F6B A;  1Y0A A;  1YEU A;  1YGF A;  2LH3 A;  1OUT B;  3QJB A;  1BBB A;  4O4Z A;  1BZ6 A;  3G4V A;  2G0X A;  2QFK A;  2DHB B;  1Y8W B;  5ILP A;  1CG5 A;  4U8U B;  4G51 B;  2AV0 A;  2VEE A;  1O1L B;  4NXC A;  2MGI A;  1V4X A;  3PIA B;  3P5Q A;  4NXA A;  5IKS A;  5EV5 A;  1MNH A;  1Y2Z B;  1Y5J B;  1Y4Q A;  4HRT B;  1A01 A;  2MHB B;  103M A;  1MLM A;  3QJC A;  1Y4B B;  1UVX A;  2C0K A;  1NS6 A;  3ZJJ A;  2HHE B;  5EET A;  3TM3 A;  1RQ3 B;  1Y0W B;  3HEO A;  3UGZ A;  1NIH A;  2MGG A;  3SDH A;  2DC3 A;  3FH9 A;  3EOK A;  1O1J B;  3BJ1 A;  2DN3 A;  1MOH A;  1GDI A;  3S65 A;  1MGN A;  1Y5K B;  3ZJQ A;  2W6Y A;  3ZJN A;  3K3U A;  2FRF A;  1YMA A;  1V5H A;  4AVD A;  4DWT A;  1DTI A;  3K9Z A;  5CNG A;  1AZI A;  1HDA B;  1BZR A;  1I3D A;  1QSH B;  1YHR A;  1HDB B;  107M A;  1YEQ A;  3CY5 B;  2GNV A;  2VEB A;  3PI9 A;  1O1M B;  2ZLV A;  1GLI A;  2D2M C;  1Y7C A;  2ZLU A;  1QPW B;  4ODC B;  2GL3 A;  2O58 X;  1MTK A;  2ZS0 C;  3E55 A;  1LH6 A;  4MQG B;  1MLF A;  3DR9 A;  1DKE A;  5EUI B;  5HU6 A;  2W31 A;  1LH1 A;  1K1K A;  1DUO A;  2M6Z A;  1Y8K B;  2ZLT A;  3LR7 A;  4FC3 B;  4XS0 B;  2GKN A;  3ODQ B;  1O1I A;  1MNJ A;  2RI4 A;  1Y83 B;  1JPB A;  3E5O A;  1CP5 A;  2FRJ X;  2BMM A;  3V2Z A;  4N7P B;  1YEN A;  1NZ4 A;  2PEG B;  1Y31 A;  1HAB A;  2EB9 A;  3K8B A;  2HCO B;  1MBI A;  2RAO B;  3PI8 A;  4HRR A;  1JP8 A;  3UHB A;  1RQA B;  1RVW A;  4M4A A;  1Y45 A;  1A4F A;  1HBB B;  2GRZ A;  3UHV A;  1LFY A;  4N7N B;  3A5B A;  1Y4F B;  2YRS A;  3OK5 A;  2W72 A;  1UX9 A;  2ZLX B;  1Y0C A;  1J7W B;  4KMW A;  1XZV B;  6HBW B;  2VHB A;  2O5S X;  1MYI A;  3GOU A;  3LB4 A;  4SDH A;  4MQH B;  2MGM A;  1LFL A;  3OZV A;  5EOH A;  4F69 A;  1QI8 A;  1G0B A;  2ZT0 A;  4HBI A;  4ESA B;  2KSC A;  1UC3 A;  4FH6 A;  3NG6 B;  2D5Z B;  3WCW C;  2ZFO A;  1YEO A;  1NXF A;  1A00 A;  2GNW A;  3BJ3 A;  1VWT B;  1LA6 A;  2HBC A;  3UHW A;  3WCV C;  1V4U A;  1BAB A;  1MOA A;  2HBE A;  3D1K A;  4YU3 B;  2HHB B;  3VRG A;  1IBE B;  1FCS A;  3KMF A;  1MYT A;  3HC9 A;  1FSX A;  3WCT A;  1S0H A;  3ECX A;  1N9H A;  5EQM A;  1OUU A;  1JL6 A;  2QLS A;  4X0L A;  1OUT A;  5CND A;  3HYU A;  1A3N A;  1C7C A;  1HGA B;  3UHE A;  1JEB B;  1O1K A;  1DO1 A;  104M A;  1GBU A;  1O1L A;  105M A;  2GTL C;  3D17 B;  3PIA A;  1Y0T B;  1GCW B;  3MBA A;  1KR7 A;  1HCO A;  1Y5J A;  4NK2 A;  1GCV A;  4PNJ A;  3ONZ A;  3BOM A;  1VXE A;  2XKH A;  1NEJ B;  3FS4 A;  2EKU A;  1GVH A;  2ZSO A;  5CN7 A;  1PBX B;  1Y85 A;  3D4X A;  3MYM A;  3AG0 A;  1Y5F B;  2LH7 A;  3UHK A;  3D7O A;  2HBF B;  1GDL A;  2BK9 A;  1DLY A;  1A3O B;  2DN1 B;  2MGB A;  2H35 B;  1XZ5 A;  3UHG A;  1UFJ A;  1MBO A;  3G53 A;  1JDO A;  1N9I A;  1Z8U B;  2G0V A;  1UVY A;  1D8U A;  1YIH A;  1MNI A;  5CNB A;  1FDH A;  1MYF A;  1Y5K A;  2FRI X;  1MBS A;  2MYA A;  2BLI A;  1RTE A;  5JDO F;  1LFZ A;  1C7B B;  2ZS1 D;  5ILR A;  2QRW A;  4ZVB A;  3IC0 B;  1YE0 A;  1SPE A;  3CY5 A;  3MYN A;  1BIN A;  2SPN A;  1O16 A;  1YOG A;  1OFJ A; 
#chains in the Genus database with same CATH topology
 4F68 A;  2HBG A;  1S69 A;  5E6E A;  3D1A B;  3QJE B;  3QM9 A;  3ZHW A;  2R4Y A;  4F6G A;  2D2N D;  2Z8A A;  3WCT D;  5AB8 A;  3GKV B;  1QPW A;  2B7H B;  1UVM A;  3WI8 A;  1GJN A;  1AJ9 B;  3LB2 A;  1XY0 B;  2MBW A;  5CN6 A;  1A9W E;  3OJ1 A;  2DKD A;  3EDA A;  2EVK A;  3UHH A;  1YHU A;  3A59 B;  1MLR A;  2SPM A;  2V1F A;  1YEV B;  1XYE A;  1J52 A;  4U8U D;  3HRW B;  2HHD A;  1R1X B;  2D2M B;  3MKB A;  2ZT3 A;  1K0Y B;  2ZS0 B;  3A0G A;  4ETV A;  1X9F C;  2DXM B;  4ILZ A;  5CN4 A;  1Y35 B;  1B0B A;  2ZSP A;  1MNK A;  5JDO C;  3R5I A;  2BWH A;  1Y22 A;  1MWB A;  4MQI B;  3AQ7 A;  2VYY A;  6HBI A;  4DC7 A;  1HBB A;  3UH5 A;  4N7N A;  1Y4F A;  2EVP A;  3WFX A;  1TOX A;  2R1H A;  2SPL A;  1S5Y A;  3PT8 B;  5C6Y A;  1CH3 A;  3QJD A;  1DXV A;  2R80 A;  3AT6 B;  3ARK A;  2HBS A;  2W6V A;  2MGD A;  5ILE A;  5CHR A;  1VXA A;  3G4W A;  1VRE A;  1XZV A;  5HY8 A;  1SPG B;  1FAW A;  1Y4R A;  3ORD A;  3WCU C;  3VNC A;  2MYB A;  4A8Y A;  1HGB B;  2G14 A;  4O2G A;  1S5X A;  1JW8 A;  3O18 A;  3DHR A;  1HDS B;  4N8T A;  3GUQ A;  5E29 A;  1YCB A;  3GQP A;  4ROL B;  3EU1 B;  1LFT B;  1DWS A;  2D5X A;  1Y09 A;  1SDK A;  1IBE A;  5F0B A;  3BCQ A;  1YHU D;  2HZ1 A;  5EYJ A;  1XQ5 A;  1NGK A;  1A0Z A;  1BZ0 B;  4MAX A;  3VRF B;  1S61 A;  2GLN A;  5AQD A;  3WCW B;  3AT5 A;  3HXN A;  4L1E A;  2WCR A;  4UUR A;  2QSS A;  1A6N A;  3EDB A;  3OZW A;  3LQD A;  1YHE B;  3M39 A;  3WCV B;  5EU2 A;  1IT2 A;  1DWT A;  1HGA A;  3U3E A;  3NUH B;  2H8F B;  4L7Y A;  2QU0 A;  4O1T A;  2ZSY A;  3D17 A;  2JLF A;  1Y8I B;  5EE4 C;  1HHO B;  3ZJR A;  1MBD A;  2OHB A;  1MLS A;  1LFV B;  1MBN A;  4ROM B;  3S66 A;  2EKT A;  3UHD A;  1NEJ A;  3ZJS A;  3GYS A;  3ZOM A;  2XYK A;  1FN3 A;  3UBV A;  1YFF A;  1IRD B;  3PEL B;  1Y5F A;  1LH5 A;  1Y7G B;  3GQG A;  1COH A;  2GTL B;  1CLS B;  3W4U A;  2O5B X;  2DN1 A;  3G4Y A;  1RPS B;  3QMA A;  2H8D B;  1CH1 A;  1NS9 B;  1H1X A;  4HH1 A;  4ZVA A;  3GKT A;  2X4A A;  2G12 A;  3CIU A;  1VXG A;  1B33 A;  5E83 B;  2QSP B;  1FHJ A;  3FEW X;  2V1I A;  4JYQ A;  106M A;  1YE2 A;  1J41 A;  1R1Y A;  1MKO A;  3O2C A;  1GBV A;  1J7S B;  1G0A A;  3GIO A;  4MQJ B;  3IC0 A;  5MBA A;  1YZI B;  1BIJ A;  1MLU A;  3WCP B;  1SWM A;  1HA7 A;  2E2Y A;  2IN4 A;  2AA1 B;  1BVD A;  4KJT A;  1Y8H A;  2ZST A;  5HAV A;  1GZX A;  3LR9 A;  4B02 A;  4M4B B;  1VRF A;  1LJW B;  5CMV A;  1J3F A;  2LHB A;  3V2V A;  3QM7 A;  1MYM A;  4YJJ B;  1QXD A;  4MQC B;  5D5R A;  1Y7Z A;  1ECA A;  1YGD B;  3PI4 A;  1WVP A;  4QAU A;  3UHZ A;  2DN2 B;  5EYS A;  1ABY A;  1VHB A;  1R1X A;  1CH7 A;  1JP9 A;  2D60 A;  5SW7 B;  1A87 A;  2HBD A;  2WTG A;  3UHN A;  1K0Y A;  2ZS0 A;  1CG8 A;  1CP0 A;  3DUT B;  2V8A A;  2EB8 A;  1KN1 B;  1HBR B;  1DXT A;  2DXM A;  1MLO A;  1ITH A;  1UVK A;  1HLB A;  2ZFB B;  3WHM B;  5MBN A;  2FAM A;  1THB B;  1TU9 A;  2V1G A;  2VJT B;  1LH3 A;  3ZJI A;  1SI4 A;  1T1N A;  1JF4 A;  4XXI A;  2WCQ A;  2YSK A;  1CMY A;  3BJ2 B;  1YG5 B;  1CH5 A;  3PT8 A;  4F6I A;  1X9F B;  2QMB B;  1GDK A;  3BA2 A;  2UUL A;  3MJP B;  5CNC A;  3PT7 B;  3DHT B;  1IWH A;  2Z6N A;  3RJN B;  4PO5 A;  4OOD A;  2UUL H;  1JP6 A;  1XZU B;  1Y4G A;  3ECZ A;  1LTW A;  1MTJ A;  1J3Z A;  4F4O B;  5F2A A;  5HBI A;  2MGH A;  1HBA A;  1AJG A;  1YDZ A;  4MPM A;  5AZQ A;  1C40 B;  1NQP B;  2C7L B;  2JL9 A;  2G10 A;  2V1H A;  1EYX B;  1LHT A;  1O1O A;  3SZK B;  3WCU B;  2GDM A;  2G0R A;  1AJH A;  2AUP A;  4H2L B;  1Y4P A;  3BRP A;  1HBI A;  1MDT A;  1HV4 A;  3WCW A;  1DO4 A;  1U7S A;  1XZ4 B;  1V75 B;  1UFP A;  1MCY A;  2D2M D;  4WJG A;  1YHE A;  4HHB A;  4WJG 1;  1MDN A;  3GQR A;  1UT0 A;  1DDT A;  3DBJ A;  2ZS0 D;  1JY7 A;  1KD2 A;  1EWA A;  1W92 A;  1Y01 B;  2H8F A;  1A9W A;  1J3Y A;  4NI0 A;  1UIW A;  3IA3 B;  3VHB A;  4NS2 A;  5C6E A;  3G46 A;  2ZLW A;  1C7D B;  2PGH A;  1LFQ A;  2G0Z A;  5KKK A;  1XZ2 B;  3V58 B;  3WR1 A;  1SHR B;  5KER B;  1IRC A;  2IG3 A;  1WMU B;  2ZS1 A;  3HHB A;  1YH9 A;  2VML B;  3QQQ A;  1BZZ B;  1HBH B;  1N9F A;  1ABS A;  4A8K A;  1Y4V A;  1JZM A;  4F6F A;  2OH8 A;  2D2N A;  1J40 B;  2UUL D;  3OO5 B;  3SDN A;  3PMC A;  1RQ4 B;  3NMM B;  4N6S B;  3M3B A;  3WTG A;  1XZ7 B;  1NWN A;  4UIQ A;  1B86 B;  1J7Y B;  1QSI B;  3B75 B;  1G09 B;  1ON7 A;  2WY4 A;  1EMY A;  2DHB A;  3ED9 A;  1Y8W A;  4VHB A;  4MQK B;  1MYZ A;  4U8U A;  4G51 A;  5B85 A;  3AQ9 A;  1V07 A;  4YU4 B;  2ZFO C;  1Y2Z A;  3ZOL A;  1HAC B;  4HRT A;  2AA1 A;  3ZH0 A;  1Y46 B;  1COL A;  2MHB A;  1MWC A;  3WFT A;  1UX8 A;  2O5Q X;  3KMF C;  3NFE B;  1BUW B;  1Y4B A;  1DO3 A;  1MYG A;  1EBC A;  2MGA A;  1HI0 P;  3WCW D;  1LJW A;  3WCT C;  1ABW B;  2HHE A;  3LQ9 A;  2D6C A;  1RQ3 A;  1Y0W A;  2OIF A;  4MQC A;  1G9V B;  1O1P B;  1HHT P;  1MLK A;  5KDQ B;  5FVB M;  1KFR A;  1O1J A;  4C44 A;  1QXE B;  4NI1 B;  1G08 B;  1U7R A;  3MJU B;  2MYD A;  2MGF A;  2VLY A;  3IXF A;  3GDJ B;  1JF3 A;  1HDA A;  3QZX A;  1Y0A B;  1NZ2 A;  1QSH A;  3OGB A;  1HDB A;  1YGF B;  3QJB B;  1BBB B;  3UHX A;  1O1M A;  4TYX A;  4HSW A;  2R4Z A;  2C7J B;  2GTL D;  2GRF A;  1BJE A;  1DXU B;  3AQ8 A;  1V9Q A;  5CNE A;  4ODC A;  1S56 A;  1M6C A;  3BJ2 A;  1XCH A;  1V4X B;  2QFN A;  3QM6 A;  4PQC A;  4MQG A;  2AV3 A;  3UH6 A;  1URY A;  2GRH A;  2NSR A;  1Y4Q B;  5EUI A;  1A01 B;  1JWN A;  1MTI A;  5CNF A;  4F6J A;  1HGC B;  1Y8K A;  2BV8 B;  3KVS A;  1JL7 A;  1IOP A;  4FC3 A;  4XS0 A;  3ODQ A;  5JOM A;  1Y83 A;  1NS6 B;  1RTX A;  1JBO B;  1NQP A;  4N7P A;  2PEG A;  4LPI A;  4FWX A;  1BZP A;  4PQ6 A;  3S48 C;  1F5P A;  2HCO A;  3RGK A;  1NIH B;  1I7Y B;  2RAO A;  4NZI A;  3SZK A;  4O4T A;  3EOK B;  1RQA A;  3GLN A;  2VJR A;  1MYJ A;  3HF4 B;  3LB1 A;  4F0U B;  1YHU C;  2ZLX A;  1YHR B;  1YEQ B;  1Y7D B;  1J7W A;  1XZ4 A;  3PI9 B;  1CPC B;  2ZSZ A;  6HBW A;  2VYZ A;  1HLM A;  1WLA A;  3G52 A;  2C7K B;  4OF9 A;  4JAC A;  2ZT4 A;  2VYW A;  3HEN A;  1GLI B;  3OVU C;  4RMP A;  1Y7C B;  4MQH A;  1CH4 A;  1NZ3 A;  3A5G A;  1UMO A;  1C7D A;  1MLN A;  4ESA A;  2AUR A;  3NG6 A;  1Q1F A;  5HU6 B;  2D5Z A;  2JLG A;  1MWD A;  1ECN A;  1K1K B;  1DXD A;  1VWT A;  3ECL A;  2M6Z B;  1S6A A;  3MOU A;  1A6K A;  5HLX A;  4TMA B;  2ZWJ A;  3A9M A;  4ERV A;  4F6D A;  3L0F B;  2ZT2 A;  4YU3 A;  2HHB A;  4GY3 B;  3NL7 B;  2RI4 B;  4GXE B;  1A6M A;  1F0L A;  3MVC A;  2W6W A;  3QZZ A;  1CO9 A;  4Q70 B;  1ALL B;  1YEN B;  3OO5 A;  5JDO D;  1Y31 B;  1HAB B;  3K8B B;  3ARJ A;  1LHS A;  2BLJ M;  3G4U A;  5JGG B;  1XZ7 A;  1LH7 A;  2ZT1 A;  1V4W B;  3PI8 B;  4HRR B;  1CQX A;  4F0T A;  4G1B A;  2O5T X;  1RVW B;  5CN8 A;  4M4A B;  1GH0 B;  1TES A;  1HI1 A;  1JEB A;  3LB3 A;  2LH6 A;  2YRS B;  3V57 B;  1LIA A;  1OJ6 A;  1MOC A;  4MBA A;  1NY9 A;  3QM8 A;  1Y0T A;  4YU4 A;  2MGC A;  1GCW A;  1Y0C B;  1HAC A;  2HZ3 A;  1MOD A;  1XF6 C;  2JHO A;  3S1I A;  2VM0 A;  5JDO E;  1YOI A;  1QI8 B;  1PBX A;  2UUN B;  1NZ5 A;  3UHI A;  3M3A A;  4FH7 A;  1Y0D B;  2AUQ A;  2HBF A;  1IDR A;  1O1P A;  3OO4 B;  4ZIZ B;  4H0M B;  1A3O A;  2ZFO B;  1YEO B;  1A00 B;  1LA6 B;  2H35 A;  1KTP B;  1DLW A;  1V4U B;  1BAB B;  2HBE B;  1ECD A;  1XG0 C;  2UUM B;  3VRG B;  2V1J A;  1YMC A;  1MNO A;  3PI1 A;  3MJU A;  3WCT B;  1S0H B;  101M A;  1F99 B;  1NPF A;  1C7B A;  4TWV A;  1HBS B;  2QLS B;  3OZU A;  4X0L B;  4XDI A;  1OR6 A;  110M A;  4ETU A;  3HYU B;  1CBM A;  1A0U B;  2WTH A;  3UH3 A;  1F5O A;  1A3N B;  1C7C B;  1OBM A;  3D1A A;  3QJE A;  1DXU A;  1O1K B;  3NML A;  5EE4 D;  3GKV A;  2B7H A;  1IT3 A;  1GBU B;  5B84 A;  1AJ9 A;  5ILM A;  1CH9 A;  1XY0 A;  4ETT A;  1HCO B;  3A59 A;  3MWN A;  1GCV B;  1N9X A;  1YEV A;  3ONZ B;  3BOM B;  1HGC A;  3HRW A;  1DM1 A;  3FS4 B;  7HBI A;  3TM9 A;  3M38 A;  1Y85 B;  3ZJM A;  2XKG A;  1ASH A;  2NRL A;  2D2M A;  1CH2 A;  3D4X B;  1MLH A;  1VXD A;  3ZJH A;  1SGK A;  3UHR A;  1OFK A;  3LHB A;  2BW9 M;  4DWU A;  3D7O B;  1LH2 A;  3ZJL A;  2MGL A;  1JZK A;  1XZ5 B;  1Y35 A;  1HRM A;  3VAU A;  1MLL A;  3O89 A;  1NWI A;  1YVT B;  1XXT B;  4MQI A;  1YIH B;  1YIE B;  4A8W A;  4LMX B;  1F63 A;  1M9P B;  4BS9 A;  4NK1 A;  1O1N B;  3HF4 A;  1LFZ B;  3AQ5 A;  3RJ6 A;  3ZJO A;  1BVC A;  1YE0 B;  1Y7D A;  3AT6 A;  3H58 A;  5E6E B;  1SPG A;  1OR4 A;  3ZTA A;  4N7O B;  4DC8 A;  1HGB A;  4PQB A;  2R4X A;  1YVQ B;  1YHU B;  4BJA A;  1HDS A;  4H07 A;  1XYE B;  1VXB A;  4ROL A;  1CO8 A;  3UHU A;  3EU1 A;  4B4Y A;  2ZSS A;  1LFT A;  2HHD B;  3L0F A;  3VRE B;  3NL7 A;  3MKB B;  4GXE A;  2BNL A;  2R4W A;  3QQR A;  4Q70 A;  3A0G B;  3KUN A;  5JGG A;  2LH1 A;  1BZ0 A;  3VRF A;  2UUL C;  3R5I B;  1V4W A;  4O35 A;  1Y22 B;  3WCV A;  1DXC A;  2G0S A;  4G1V A;  2W6X A;  2MB5 A;  5AZR A;  2GKM A;  2R1H B;  1B8D B;  1S5Y B;  1Y8I A;  3QJD B;  1DXV B;  2R80 B;  2HBS B;  2W6V B;  4AVE A;  1HHO A;  5HY8 B;  2FAL A;  1RSE A;  3KUO A;  5HLU A;  2X49 A;  1FAW B;  3G4R A;  3IC2 B;  1LFV A;  1Y4R B;  1X3K A;  4FWZ A;  4ROM A;  2XKI A;  4WCH D;  1IRD A;  3PEL A;  4C0N A;  1S5X B;  1Y0D A;  3DHR B;  1Y7G A;  2W72 C;  1SDL B;  2GTL A;  1CLS A;  4N8T B;  2ZSQ A;  3OO4 A;  5E29 B;  1RPS A;  1MLQ A;  3GQP B;  1DWR A;  2EF2 A;  2H8D A;  1NS9 A;  3R0G A;  2D5X B;  1Y09 B;  1MBC A;  1SDK B;  1CIO A;  3QM5 A;  5E83 A;  5HLQ A;  2QSP A;  3BCQ B;  3UH7 A;  1MLG A;  1CQ2 A;  3ASE A;  4UZV A;  2MGK A;  1BZ1 B;  1XQ5 B;  2VLX A;  3UI0 A;  1HBS A;  1A0Z B;  1J7S A;  4MQJ A;  2V1K A;  3AT5 B;  1YZI A;  3HXN B;  4L1E B;  2BKM A;  3WCP A;  2ZS1 C;  2QSS B;  1M6M A;  1A0U A;  3LQD B;  4IRO B;  1EW6 A;  2G11 A;  4L7Y B;  2QU0 B;  4M4B A;  1CBL A;  4MU5 A;  2D2N C;  2ZSN A;  3WFU A;  2AUO A;  3WCV D;  4YJJ A;  1MLJ A;  4HSX A;  3S66 B;  1YGD A;  5D1V A;  2DN2 A;  3GYS B;  1GDJ A;  1FN3 B;  1YFF B;  5SW7 A;  1VXH A;  4U8U C;  3GQG B;  1COH B;  3W4U B;  4MBN A;  2ZSX A;  3DUT A;  4MXK A;  1NPG A;  3UHQ A;  1KN1 A;  1HBR A;  3GK9 A;  2ZFB A;  1YEU B;  3WHM A;  2VRY A;  1THB A;  1YVT A;  3PI2 A;  1XXT A;  1EBT A;  3CIU B;  1CPW A;  1YIE A;  2VJT A;  2UUN D;  1B33 B;  1M9P A;  1FHJ B;  2LH5 A;  1O1N A;  1YE2 B;  1J41 B;  3WFW A;  1CG5 B;  2ZFO D;  1R1Y B;  1MKO B;  1PMB A;  1GBV B;  3O2C B;  1G0A B;  3E4N A;  1YG5 A;  2UUM X;  1X46 A;  3P5Q B;  2MYC A;  3ZJP A;  1BIJ B;  4MXL A;  1X9F A;  2QMB A;  1HA7 B;  1Y8H B;  3MJP A;  3PT7 A;  1FDH G;  3DHT A;  3QJC B;  4N7O A;  3UHT A;  3G4Q A;  1GZX B;  1XZU A;  1CII A;  2Z6S A;  1PHN B;  2MGJ A;  1NAZ A;  4F4O A;  109M A;  1YVQ A;  1C40 A;  3ARL A;  2C7L A;  1QXD B;  2Z85 A;  1Y7Z B;  102M A;  1DO7 A;  1EYX A;  2NRM A;  3VRE A;  1ABY B;  1YOH A;  3FH9 B;  2D60 B;  3BJ1 B;  4H0B A;  3WCU A;  2DN3 B;  2HBD B;  3S65 B;  3A5A A;  1A6G A;  1CG8 B;  1FLP A;  4H2L A;  2V8A B;  3O7N A;  1DXT B;  2MYE A;  3UHS A;  1DUK A;  3H57 A;  5CN5 A;  2ZSR A;  3UHY A;  1V75 A;  2ZLV B;  1SI4 B;  3PI3 A;  1T1N B;  1JZL A;  4TWU A;  1CMY B;  1YCA A;  2ZLU B;  2NSS A;  1VXF A;  4AE0 A;  1MZ0 A;  1B8D A;  1H97 A;  3UBC A;  1XZ2 A;  3V58 A;  1DKE B;  1SHR A;  2VJH B;  5KER A;  2UUL B;  3IC2 A;  2O5O X;  1WMU A;  2SPO A;  1IWH B;  2Z6N B;  2MGE A;  4PO5 B;  1MOB A;  4GZG A;  2VML A;  1Y4G B;  2ZLT B;  1BZZ A;  1UVN A;  1J3Z B;  111M A;  3MN0 A;  112M A;  1HBH A;  1O1I B;  1HBA B;  1LUE A;  1YDZ B;  1X9F D;  1HSY A;  4A8S A;  1SDL A;  2VLZ A;  1J40 A;  2Z6T A;  1RQ4 A;  3A2G A;  3NMM A;  1O1O B;  4N6S A;  4L2M A;  4IT8 A;  1WAC A;  2BLH A;  1B86 A;  1J7Y A;  1MYH A;  1QSI A;  1DTM A;  2R50 A;  3B75 A;  1G09 A;  2OLP A;  1Y45 B;  1A4F B;  2O5L X;  1LFY B;  1BZ1 A;  1Y4P B;  4MQK A;  1MBA A;  2NX0 A;  3BRP B;  1F65 A;  3AQ6 A;  3UHC A;  2W72 B;  1FSL A;  3UGY A;  1HV4 B;  2LH2 A;  1I3E A;  4KMV A;  3S1J A;  4XXK A;  4IRO A;  5AQD M;  4HHB B;  3WCU D;  1CIK A;  1Y46 A;  5M3S A;  3GQR B;  3DBJ B;  3GOU B;  1HBG A;  1YMB A;  1JY7 B;  1VXC A;  3NFE A;  1KD2 B;  1BUW A;  1HJT A;  2OHA A;  1J3Y B;  4NI0 B;  2CMM A;  5B13 A;  1LFL B;  4FWY A;  1UIW B;  4Z8K B;  1G0B B;  4B3W A;  1HI8 A;  5C6E B;  2PGH B;  2ZLW B;  1LFQ B;  1ABW A;  2V1E A;  3HEP A;  3WR1 B;  3E5I A;  3TLD A;  1G9V A;  2G3H A;  2OH9 A;  2ZS1 B;  3BJ3 B;  2HZ2 A;  108M A;  3HHB B;  5CHQ A;  2HBC B;  1YH9 B;  5KDQ A;  2FRK X;  4BJU A;  4KN3 A;  3D1K B;  5B13 G;  1Y4V B;  1QXE A;  4NI1 A;  1URV A;  1G08 A;  2O5M X;  1FSX B;  2D2N B;  1ECO A;  3GDJ A;  1L2K A;  1OUU B;  5CN9 A;  3WTG B;  4F6B A;  1Y0A A;  1YEU A;  1YGF A;  2LH3 A;  1OUT B;  4LMS B;  3QJB A;  1BBB A;  4O4Z A;  1BZ6 A;  1ON7 B;  2C7J A;  3G4V A;  2G0X A;  2QFK A;  2DHB B;  1Y8W B;  5ILP A;  1CG5 A;  4U8U B;  4G51 B;  2AV0 A;  2VEE A;  1O1L B;  4NXC A;  2MGI A;  4HH0 A;  1V4X A;  3PIA B;  3P5Q A;  4NXA A;  5IKS A;  5EV5 A;  1MNH A;  1Y2Z B;  1Y5J B;  1Y4Q A;  4HRT B;  1A01 A;  2MHB B;  4AE1 A;  103M A;  1MLM A;  3QJC A;  1Y4B B;  1UVX A;  2BV8 A;  2C0K A;  3PMD A;  1PHN A;  4A8M P;  1NS6 A;  3ZJJ A;  2HHE B;  2DKA A;  5EET A;  3TM3 A;  1RQ3 B;  1JBO A;  1Y0W B;  1XDT T;  3HEO A;  3UGZ A;  1NIH A;  2MGG A;  1I7Y A;  3SDH A;  2DC3 A;  3FH9 A;  3EOK A;  1O1J B;  3BJ1 A;  2DN3 A;  4LM6 B;  1MOH A;  1GDI A;  3S65 A;  1MGN A;  1Y5K B;  3ZJQ A;  2W6Y A;  3ZJN A;  3K3U A;  2FRF A;  1YMA A;  2I88 A;  1V5H A;  4AVD A;  4DWT A;  1DTI A;  4F0U A;  3K9Z A;  5CNG A;  1AZI A;  1HDA B;  2DKC A;  1BZR A;  1I3D A;  1QSH B;  1YHR A;  1HDB B;  107M A;  1YEQ A;  3CY5 B;  2GNV A;  2VEB A;  3PI9 A;  1CPC A;  1O1M B;  2ZLV A;  2C7K A;  1GLI A;  2D2M C;  1Y7C A;  2ZLU A;  1QPW B;  4ODC B;  2GL3 A;  2O58 X;  1MTK A;  2ZS0 C;  3E55 A;  1LH6 A;  4MQG B;  1MLF A;  3DR9 A;  1DKE A;  5EUI B;  5HU6 A;  2VJH A;  2W31 A;  1LH1 A;  1K1K A;  1DUO A;  2M6Z A;  1Y8K B;  3KVS B;  2ZLT A;  3LR7 A;  4FC3 B;  4XS0 B;  2GKN A;  4GY3 A;  3ODQ B;  1O1I A;  1MNJ A;  2RI4 A;  1Y83 B;  1JPB A;  3E5O A;  1CP5 A;  2FRJ X;  2BMM A;  3V2Z A;  4N7P B;  1ALL A;  1YEN A;  1NZ4 A;  2PEG B;  1Y31 A;  1HAB A;  2EB9 A;  3K8B A;  2HCO B;  1MBI A;  2RAO B;  3PI8 A;  4HRR A;  1JP8 A;  3RQR A;  3UHB A;  1RQA B;  1RVW A;  4M4A A;  1Y45 A;  1A4F A;  1GH0 A;  1HBB B;  1RH1 A;  2GRZ A;  2VJR B;  3UHV A;  1LFY A;  4N7N B;  3A5B A;  1Y4F B;  2YRS A;  3OK5 A;  3V57 A;  2W72 A;  1UX9 A;  2ZLX B;  1Y0C A;  1J7W B;  4KMW A;  1XZV B;  6HBW B;  2VHB A;  2O5S X;  1MYI A;  3GOU A;  3LB4 A;  4A8Q A;  4SDH A;  4RMP B;  4MQH B;  2MGM A;  1LFL A;  3OZV A;  5EOH A;  4F69 A;  4Z8K A;  1QI8 A;  1G0B A;  2ZT0 A;  4HBI A;  4ESA B;  2UUN A;  2KSC A;  3O18 B;  1UC3 A;  4FH6 A;  3NG6 B;  2D5Z B;  3WCW C;  4ZIZ A;  4H0M A;  2J96 A;  2ZFO A;  1YEO A;  1NXF A;  1A00 A;  2GNW A;  3BJ3 A;  1VWT B;  1LA6 A;  1KTP A;  2HBC A;  3UHW A;  3WCV C;  1V4U A;  1BAB A;  1MOA A;  2HBE A;  3D1K A;  2UUM A;  4YU3 B;  2HHB B;  3VRG A;  1IBE B;  1FCS A;  3KMF A;  1MYT A;  3HC9 A;  1FSX A;  3WCT A;  1S0H A;  3ECX A;  1N9H A;  5EQM A;  1F99 A;  1OUU A;  1JL6 A;  2QLS A;  4X0L A;  1OUT A;  5CND A;  4ERT A;  3HYU A;  4F0T B;  4A8O A;  1A3N A;  1C7C A;  1HGA B;  3UHE A;  1JEB B;  1O1K A;  1DO1 A;  104M A;  1GBU A;  1LIA B;  1O1L A;  105M A;  2GTL C;  4ESU A;  3D17 B;  3PIA A;  1Y0T B;  1UVJ A;  1UVL A;  1GCW B;  3MBA A;  1KR7 A;  1HCO A;  1Y5J A;  4NK2 A;  1GCV A;  4PNJ A;  5FVB A;  3ONZ A;  3BOM A;  1VXE A;  2XKH A;  1NEJ B;  3FS4 A;  2EKU A;  1GVH A;  2ZSO A;  5CN7 A;  1PBX B;  1Y85 A;  3D4X A;  3MYM A;  3AG0 A;  1Y5F B;  2LH7 A;  3UHK A;  3D7O A;  2HBF B;  1GDL A;  2BK9 A;  1DLY A;  1A3O B;  1QGW C;  2DN1 B;  2MGB A;  2H35 B;  1XZ5 A;  4A8F A;  3UHG A;  1UFJ A;  1MBO A;  3G53 A;  1JDO A;  1HHS A;  1N9I A;  1Z8U B;  2G0V A;  1UVY A;  1D8U A;  1YIH A;  1MNI A;  5CNB A;  1FDH A;  1MYF A;  1Y5K A;  2FRI X;  1MBS A;  2MYA A;  2BLI A;  1RTE A;  5JDO F;  1LFZ A;  1C7B B;  2ZS1 D;  5ILR A;  2QRW A;  4ZVB A;  3IC0 B;  1YE0 A;  1SPE A;  3CY5 A;  3MYN A;  1UVI A;  1BIN A;  2SPN A;  1O16 A;  1YOG A;  1OFJ A; 
#chains in the Genus database with same CATH homology
 4F68 A;  2HBG A;  1S69 A;  5E6E A;  3D1A B;  3QJE B;  3QM9 A;  3ZHW A;  2R4Y A;  4F6G A;  2D2N D;  2Z8A A;  3WCT D;  5AB8 A;  3GKV B;  1QPW A;  2B7H B;  3WI8 A;  1GJN A;  1AJ9 B;  3LB2 A;  1XY0 B;  2MBW A;  5CN6 A;  1A9W E;  3OJ1 A;  3EDA A;  3UHH A;  2EVK A;  1YHU A;  3A59 B;  1MLR A;  2SPM A;  2V1F A;  1YEV B;  1XYE A;  1J52 A;  4U8U D;  3HRW B;  2HHD A;  1R1X B;  2D2M B;  3MKB A;  2ZT3 A;  1K0Y B;  2ZS0 B;  3A0G A;  1X9F C;  2DXM B;  4ILZ A;  5CN4 A;  1Y35 B;  1B0B A;  2ZSP A;  1MNK A;  5JDO C;  3R5I A;  2BWH A;  1Y22 A;  1MWB A;  4MQI B;  3AQ7 A;  2VYY A;  6HBI A;  4DC7 A;  1HBB A;  3UH5 A;  4N7N A;  1Y4F A;  2EVP A;  3WFX A;  2R1H A;  2SPL A;  1S5Y A;  3PT8 B;  5C6Y A;  1CH3 A;  3QJD A;  1DXV A;  2R80 A;  3AT6 B;  3ARK A;  2HBS A;  2W6V A;  2MGD A;  5ILE A;  5CHR A;  1VXA A;  3G4W A;  1VRE A;  1XZV A;  5HY8 A;  1SPG B;  1FAW A;  1Y4R A;  3ORD A;  3WCU C;  2MYB A;  1HGB B;  2G14 A;  4O2G A;  1S5X A;  1JW8 A;  3DHR A;  1HDS B;  4N8T A;  5E29 A;  1YCB A;  3GQP A;  4ROL B;  3EU1 B;  1LFT B;  1DWS A;  2D5X A;  1Y09 A;  1SDK A;  1IBE A;  5F0B A;  3BCQ A;  1YHU D;  2HZ1 A;  5EYJ A;  1XQ5 A;  1NGK A;  1A0Z A;  1BZ0 B;  4MAX A;  3VRF B;  1S61 A;  2GLN A;  3WCW B;  3AT5 A;  3HXN A;  4UUR A;  2QSS A;  1A6N A;  3EDB A;  3OZW A;  3LQD A;  1YHE B;  3M39 A;  3WCV B;  5EU2 A;  1IT2 A;  1DWT A;  1HGA A;  3U3E A;  2H8F B;  4L7Y A;  2QU0 A;  4O1T A;  2ZSY A;  3D17 A;  1Y8I B;  5EE4 C;  1HHO B;  3ZJR A;  1MBD A;  2OHB A;  1MLS A;  1LFV B;  1MBN A;  4ROM B;  3S66 A;  2EKT A;  3UHD A;  1NEJ A;  3ZJS A;  3GYS A;  3ZOM A;  2XYK A;  1FN3 A;  3UBV A;  1YFF A;  1IRD B;  3PEL B;  1Y5F A;  1LH5 A;  1Y7G B;  3GQG A;  1COH A;  2GTL B;  1CLS B;  3W4U A;  2O5B X;  2DN1 A;  3G4Y A;  1RPS B;  3QMA A;  2H8D B;  1CH1 A;  1NS9 B;  1H1X A;  4ZVA A;  3GKT A;  2G12 A;  3CIU A;  1VXG A;  5E83 B;  2QSP B;  1FHJ A;  2V1I A;  4JYQ A;  106M A;  1YE2 A;  1J41 A;  1R1Y A;  1MKO A;  1GBV A;  1J7S B;  1G0A A;  4MQJ B;  3IC0 A;  5MBA A;  1YZI B;  1BIJ A;  1MLU A;  3WCP B;  1SWM A;  2E2Y A;  2IN4 A;  2AA1 B;  1BVD A;  4KJT A;  1Y8H A;  2ZST A;  5HAV A;  1GZX A;  3LR9 A;  4M4B B;  1VRF A;  1LJW B;  5CMV A;  1J3F A;  2LHB A;  3V2V A;  3QM7 A;  1MYM A;  1QXD A;  4MQC B;  5D5R A;  1Y7Z A;  1ECA A;  1YGD B;  3PI4 A;  1WVP A;  4QAU A;  3UHZ A;  2DN2 B;  5EYS A;  1ABY A;  1VHB A;  1R1X A;  1CH7 A;  1JP9 A;  2D60 A;  5SW7 B;  2HBD A;  2WTG A;  3UHN A;  1K0Y A;  2ZS0 A;  1CG8 A;  1CP0 A;  3DUT B;  2EB8 A;  1HBR B;  1DXT A;  2DXM A;  1MLO A;  1ITH A;  1HLB A;  2ZFB B;  3WHM B;  5MBN A;  2FAM A;  1THB B;  1TU9 A;  2V1G A;  1LH3 A;  3ZJI A;  1SI4 A;  1T1N A;  1JF4 A;  1CMY A;  3BJ2 B;  1YG5 B;  1CH5 A;  3PT8 A;  4F6I A;  1X9F B;  2QMB B;  1GDK A;  3BA2 A;  3MJP B;  5CNC A;  3PT7 B;  3DHT B;  1IWH A;  2Z6N A;  3RJN B;  4OOD A;  1JP6 A;  1XZU B;  1Y4G A;  3ECZ A;  1LTW A;  1MTJ A;  1J3Z A;  4F4O B;  5F2A A;  5HBI A;  2MGH A;  1HBA A;  1AJG A;  1YDZ A;  4MPM A;  5AZQ A;  1C40 B;  1NQP B;  2G10 A;  2V1H A;  1LHT A;  1O1O A;  3SZK B;  3WCU B;  2GDM A;  2G0R A;  1AJH A;  2AUP A;  4H2L B;  1Y4P A;  1HBI A;  1HV4 A;  3WCW A;  1DO4 A;  1U7S A;  1XZ4 B;  1V75 B;  1UFP A;  1MCY A;  2D2M D;  4WJG A;  1YHE A;  4HHB A;  4WJG 1;  1MDN A;  3GQR A;  1UT0 A;  2ZS0 D;  1JY7 A;  1KD2 A;  1EWA A;  1W92 A;  1Y01 B;  2H8F A;  1A9W A;  1J3Y A;  4NI0 A;  1UIW A;  3IA3 B;  3VHB A;  4NS2 A;  5C6E A;  3G46 A;  2ZLW A;  1C7D B;  2PGH A;  1LFQ A;  2G0Z A;  5KKK A;  1XZ2 B;  3WR1 A;  1SHR B;  5KER B;  1IRC A;  2IG3 A;  1WMU B;  2ZS1 A;  3HHB A;  1YH9 A;  3QQQ A;  1BZZ B;  1HBH B;  1N9F A;  1ABS A;  1Y4V A;  1JZM A;  4F6F A;  2OH8 A;  2D2N A;  1J40 B;  3OO5 B;  3SDN A;  1RQ4 B;  3NMM B;  3M3B A;  3WTG A;  1XZ7 B;  1NWN A;  4UIQ A;  1B86 B;  1J7Y B;  1QSI B;  3B75 B;  1G09 B;  2WY4 A;  1EMY A;  2DHB A;  3ED9 A;  1Y8W A;  4VHB A;  4MQK B;  1MYZ A;  4U8U A;  4G51 A;  5B85 A;  3AQ9 A;  1V07 A;  4YU4 B;  2ZFO C;  1Y2Z A;  3ZOL A;  1HAC B;  4HRT A;  2AA1 A;  3ZH0 A;  1Y46 B;  2MHB A;  1MWC A;  3WFT A;  1UX8 A;  2O5Q X;  3KMF C;  3NFE B;  1BUW B;  1Y4B A;  1DO3 A;  1MYG A;  1EBC A;  2MGA A;  3WCW D;  1LJW A;  3WCT C;  1ABW B;  2HHE A;  2D6C A;  1RQ3 A;  1Y0W A;  2OIF A;  4MQC A;  1G9V B;  1O1P B;  1MLK A;  5KDQ B;  1KFR A;  1O1J A;  4C44 A;  1QXE B;  4NI1 B;  1G08 B;  1U7R A;  3MJU B;  2MYD A;  2MGF A;  2VLY A;  3IXF A;  3GDJ B;  1JF3 A;  1HDA A;  3QZX A;  1Y0A B;  1NZ2 A;  1QSH A;  3OGB A;  1HDB A;  1YGF B;  3QJB B;  1BBB B;  3UHX A;  1O1M A;  4TYX A;  4HSW A;  2R4Z A;  2GTL D;  2GRF A;  1BJE A;  1DXU B;  3AQ8 A;  1V9Q A;  5CNE A;  4ODC A;  1S56 A;  1M6C A;  3BJ2 A;  1XCH A;  1V4X B;  2QFN A;  3QM6 A;  4PQC A;  4MQG A;  2AV3 A;  3UH6 A;  1URY A;  2GRH A;  2NSR A;  1Y4Q B;  5EUI A;  1A01 B;  1JWN A;  1MTI A;  5CNF A;  4F6J A;  1HGC B;  1Y8K A;  1JL7 A;  1IOP A;  4FC3 A;  4XS0 A;  3ODQ A;  5JOM A;  1Y83 A;  1NS6 B;  1RTX A;  1NQP A;  4N7P A;  2PEG A;  4LPI A;  4FWX A;  1BZP A;  4PQ6 A;  3S48 C;  1F5P A;  2HCO A;  3RGK A;  1NIH B;  2RAO A;  4NZI A;  3SZK A;  4O4T A;  3EOK B;  1RQA A;  3GLN A;  1MYJ A;  3HF4 B;  3LB1 A;  1YHU C;  2ZLX A;  1YHR B;  1YEQ B;  1Y7D B;  1J7W A;  1XZ4 A;  3PI9 B;  2ZSZ A;  6HBW A;  2VYZ A;  1HLM A;  1WLA A;  3G52 A;  4OF9 A;  4JAC A;  2ZT4 A;  2VYW A;  3HEN A;  1GLI B;  3OVU C;  1Y7C B;  4MQH A;  1CH4 A;  1NZ3 A;  3A5G A;  1UMO A;  1C7D A;  1MLN A;  4ESA A;  2AUR A;  3NG6 A;  1Q1F A;  5HU6 B;  2D5Z A;  1MWD A;  1ECN A;  1K1K B;  1DXD A;  1VWT A;  3ECL A;  2M6Z B;  1S6A A;  3MOU A;  1A6K A;  5HLX A;  2ZWJ A;  3A9M A;  4F6D A;  2ZT2 A;  4YU3 A;  2HHB A;  3NL7 B;  2RI4 B;  1A6M A;  3MVC A;  2W6W A;  3QZZ A;  1CO9 A;  1YEN B;  3OO5 A;  5JDO D;  1Y31 B;  1HAB B;  3K8B B;  3ARJ A;  1LHS A;  2BLJ M;  3G4U A;  5JGG B;  1XZ7 A;  1LH7 A;  2ZT1 A;  1V4W B;  3PI8 B;  4HRR B;  1CQX A;  4G1B A;  2O5T X;  1RVW B;  5CN8 A;  4M4A B;  1TES A;  3LB3 A;  1JEB A;  2LH6 A;  2YRS B;  1OJ6 A;  1MOC A;  4MBA A;  3QM8 A;  1Y0T A;  4YU4 A;  2MGC A;  1GCW A;  1Y0C B;  1HAC A;  2HZ3 A;  1MOD A;  2JHO A;  3S1I A;  2VM0 A;  5JDO E;  1YOI A;  1QI8 B;  1PBX A;  1NZ5 A;  3UHI A;  3M3A A;  4FH7 A;  1Y0D B;  2AUQ A;  2HBF A;  1IDR A;  1O1P A;  3OO4 B;  1A3O A;  2ZFO B;  1YEO B;  1A00 B;  1LA6 B;  2H35 A;  1DLW A;  1V4U B;  1BAB B;  2HBE B;  1ECD A;  3VRG B;  2V1J A;  1YMC A;  1MNO A;  3PI1 A;  3MJU A;  3WCT B;  1S0H B;  101M A;  1NPF A;  1C7B A;  4TWV A;  1HBS B;  2QLS B;  3OZU A;  4X0L B;  4XDI A;  1OR6 A;  110M A;  3HYU B;  1CBM A;  1A0U B;  2WTH A;  3UH3 A;  1F5O A;  1A3N B;  1C7C B;  1OBM A;  3D1A A;  3QJE A;  1DXU A;  1O1K B;  3NML A;  5EE4 D;  3GKV A;  2B7H A;  1IT3 A;  1GBU B;  5B84 A;  1AJ9 A;  5ILM A;  1CH9 A;  1XY0 A;  1HCO B;  3A59 A;  1GCV B;  1N9X A;  1YEV A;  3ONZ B;  3BOM B;  1HGC A;  3HRW A;  1DM1 A;  3FS4 B;  7HBI A;  3TM9 A;  3M38 A;  1Y85 B;  3ZJM A;  2XKG A;  1ASH A;  2NRL A;  2D2M A;  1CH2 A;  3D4X B;  1MLH A;  1VXD A;  3ZJH A;  3UHR A;  1OFK A;  3LHB A;  2BW9 M;  4DWU A;  3D7O B;  1LH2 A;  3ZJL A;  2MGL A;  1JZK A;  1XZ5 B;  1Y35 A;  1HRM A;  3VAU A;  1MLL A;  3O89 A;  1NWI A;  1YVT B;  1XXT B;  4MQI A;  1YIH B;  1YIE B;  1F63 A;  1M9P B;  4NK1 A;  1O1N B;  3HF4 A;  1LFZ B;  3AQ5 A;  3RJ6 A;  3ZJO A;  1BVC A;  1YE0 B;  1Y7D A;  3AT6 A;  3H58 A;  5E6E B;  1SPG A;  1OR4 A;  4N7O B;  4DC8 A;  1HGB A;  4PQB A;  2R4X A;  1YVQ B;  1YHU B;  4BJA A;  1HDS A;  4H07 A;  1XYE B;  1VXB A;  4ROL A;  1CO8 A;  3UHU A;  3EU1 A;  4B4Y A;  2ZSS A;  1LFT A;  2HHD B;  3VRE B;  3NL7 A;  3MKB B;  2BNL A;  2R4W A;  3QQR A;  3A0G B;  3KUN A;  5JGG A;  2LH1 A;  1BZ0 A;  3VRF A;  3R5I B;  1V4W A;  4O35 A;  1Y22 B;  3WCV A;  1DXC A;  2G0S A;  4G1V A;  2W6X A;  2MB5 A;  5AZR A;  2GKM A;  2R1H B;  1S5Y B;  1Y8I A;  3QJD B;  1DXV B;  2R80 B;  2HBS B;  2W6V B;  4AVE A;  1HHO A;  5HY8 B;  2FAL A;  1RSE A;  3KUO A;  5HLU A;  1FAW B;  3G4R A;  3IC2 B;  1LFV A;  1Y4R B;  1X3K A;  4FWZ A;  4ROM A;  2XKI A;  4WCH D;  1IRD A;  3PEL A;  4C0N A;  1S5X B;  1Y0D A;  3DHR B;  1Y7G A;  2W72 C;  1SDL B;  2GTL A;  1CLS A;  4N8T B;  2ZSQ A;  3OO4 A;  5E29 B;  1RPS A;  1MLQ A;  3GQP B;  1DWR A;  2EF2 A;  2H8D A;  1NS9 A;  3R0G A;  2D5X B;  1Y09 B;  1MBC A;  1SDK B;  1CIO A;  3QM5 A;  5E83 A;  5HLQ A;  2QSP A;  3BCQ B;  3UH7 A;  1MLG A;  1CQ2 A;  3ASE A;  4UZV A;  2MGK A;  1BZ1 B;  1XQ5 B;  2VLX A;  3UI0 A;  1HBS A;  1A0Z B;  1J7S A;  4MQJ A;  2V1K A;  3AT5 B;  1YZI A;  3HXN B;  2BKM A;  3WCP A;  2ZS1 C;  2QSS B;  1M6M A;  1A0U A;  3LQD B;  4IRO B;  1EW6 A;  2G11 A;  4L7Y B;  2QU0 B;  4M4B A;  1CBL A;  4MU5 A;  2D2N C;  2ZSN A;  3WFU A;  2AUO A;  3WCV D;  1MLJ A;  4HSX A;  3S66 B;  1YGD A;  5D1V A;  2DN2 A;  3GYS B;  1GDJ A;  1FN3 B;  1YFF B;  5SW7 A;  1VXH A;  4U8U C;  3GQG B;  1COH B;  3W4U B;  4MBN A;  2ZSX A;  3DUT A;  4MXK A;  1NPG A;  3UHQ A;  1HBR A;  3GK9 A;  2ZFB A;  1YEU B;  3WHM A;  2VRY A;  1THB A;  1YVT A;  3PI2 A;  1XXT A;  1EBT A;  3CIU B;  1CPW A;  1YIE A;  1M9P A;  1FHJ B;  2LH5 A;  1O1N A;  1YE2 B;  1J41 B;  3WFW A;  1CG5 B;  2ZFO D;  1R1Y B;  1MKO B;  1PMB A;  1GBV B;  1G0A B;  3E4N A;  1YG5 A;  1X46 A;  3P5Q B;  2MYC A;  3ZJP A;  1BIJ B;  4MXL A;  1X9F A;  2QMB A;  1Y8H B;  3MJP A;  3PT7 A;  1FDH G;  3DHT A;  3QJC B;  4N7O A;  3UHT A;  3G4Q A;  1GZX B;  1XZU A;  2Z6S A;  2MGJ A;  1NAZ A;  4F4O A;  109M A;  1YVQ A;  1C40 A;  3ARL A;  1QXD B;  2Z85 A;  1Y7Z B;  102M A;  1DO7 A;  2NRM A;  3VRE A;  1ABY B;  1YOH A;  3FH9 B;  2D60 B;  3BJ1 B;  4H0B A;  3WCU A;  2DN3 B;  2HBD B;  3S65 B;  3A5A A;  1A6G A;  1CG8 B;  1FLP A;  4H2L A;  3O7N A;  1DXT B;  2MYE A;  3UHS A;  1DUK A;  3H57 A;  5CN5 A;  2ZSR A;  3UHY A;  1V75 A;  2ZLV B;  1SI4 B;  3PI3 A;  1T1N B;  1JZL A;  4TWU A;  1CMY B;  1YCA A;  2ZLU B;  2NSS A;  1VXF A;  1MZ0 A;  1H97 A;  3UBC A;  1XZ2 A;  1DKE B;  1SHR A;  5KER A;  3IC2 A;  2O5O X;  1WMU A;  2SPO A;  1IWH B;  2Z6N B;  2MGE A;  1MOB A;  4GZG A;  1Y4G B;  2ZLT B;  1BZZ A;  1J3Z B;  111M A;  3MN0 A;  112M A;  1HBH A;  1O1I B;  1HBA B;  1LUE A;  1YDZ B;  1X9F D;  1HSY A;  1SDL A;  2VLZ A;  1J40 A;  2Z6T A;  1RQ4 A;  3A2G A;  3NMM A;  1O1O B;  4L2M A;  4IT8 A;  2BLH A;  1B86 A;  1J7Y A;  1MYH A;  1QSI A;  1DTM A;  2R50 A;  3B75 A;  1G09 A;  2OLP A;  1Y45 B;  1A4F B;  2O5L X;  1LFY B;  1BZ1 A;  1Y4P B;  4MQK A;  1MBA A;  2NX0 A;  1F65 A;  3AQ6 A;  3UHC A;  2W72 B;  1FSL A;  3UGY A;  1HV4 B;  2LH2 A;  1I3E A;  4KMV A;  3S1J A;  4IRO A;  4HHB B;  3WCU D;  1CIK A;  1Y46 A;  5M3S A;  3GQR B;  3GOU B;  1HBG A;  1YMB A;  1JY7 B;  1VXC A;  3NFE A;  1KD2 B;  1BUW A;  1HJT A;  2OHA A;  1J3Y B;  4NI0 B;  2CMM A;  1LFL B;  4FWY A;  1UIW B;  1G0B B;  4B3W A;  5C6E B;  2PGH B;  2ZLW B;  1LFQ B;  1ABW A;  2V1E A;  3HEP A;  3WR1 B;  3E5I A;  3TLD A;  1G9V A;  2G3H A;  2OH9 A;  2ZS1 B;  3BJ3 B;  2HZ2 A;  108M A;  3HHB B;  5CHQ A;  2HBC B;  1YH9 B;  5KDQ A;  2FRK X;  4KN3 A;  3D1K B;  1Y4V B;  1QXE A;  4NI1 A;  1URV A;  1G08 A;  2O5M X;  1FSX B;  2D2N B;  1ECO A;  3GDJ A;  1L2K A;  1OUU B;  5CN9 A;  3WTG B;  4F6B A;  1Y0A A;  1YEU A;  1YGF A;  2LH3 A;  1OUT B;  3QJB A;  1BBB A;  4O4Z A;  1BZ6 A;  3G4V A;  2G0X A;  2QFK A;  2DHB B;  1Y8W B;  5ILP A;  1CG5 A;  4U8U B;  4G51 B;  2AV0 A;  2VEE A;  1O1L B;  4NXC A;  2MGI A;  1V4X A;  3PIA B;  3P5Q A;  4NXA A;  5IKS A;  5EV5 A;  1MNH A;  1Y2Z B;  1Y5J B;  1Y4Q A;  4HRT B;  1A01 A;  2MHB B;  103M A;  1MLM A;  3QJC A;  1Y4B B;  1UVX A;  2C0K A;  1NS6 A;  3ZJJ A;  2HHE B;  5EET A;  3TM3 A;  1RQ3 B;  1Y0W B;  3HEO A;  3UGZ A;  1NIH A;  2MGG A;  3SDH A;  2DC3 A;  3FH9 A;  3EOK A;  1O1J B;  3BJ1 A;  2DN3 A;  1MOH A;  1GDI A;  3S65 A;  1MGN A;  1Y5K B;  3ZJQ A;  2W6Y A;  3ZJN A;  3K3U A;  2FRF A;  1YMA A;  1V5H A;  4AVD A;  4DWT A;  1DTI A;  3K9Z A;  5CNG A;  1AZI A;  1HDA B;  1BZR A;  1I3D A;  1QSH B;  1YHR A;  1HDB B;  107M A;  1YEQ A;  3CY5 B;  2GNV A;  2VEB A;  3PI9 A;  1O1M B;  2ZLV A;  1GLI A;  2D2M C;  1Y7C A;  2ZLU A;  1QPW B;  4ODC B;  2GL3 A;  2O58 X;  1MTK A;  2ZS0 C;  3E55 A;  1LH6 A;  4MQG B;  1MLF A;  3DR9 A;  1DKE A;  5EUI B;  5HU6 A;  2W31 A;  1LH1 A;  1K1K A;  1DUO A;  2M6Z A;  1Y8K B;  2ZLT A;  3LR7 A;  4FC3 B;  4XS0 B;  2GKN A;  3ODQ B;  1O1I A;  1MNJ A;  2RI4 A;  1Y83 B;  1JPB A;  3E5O A;  1CP5 A;  2FRJ X;  2BMM A;  3V2Z A;  4N7P B;  1YEN A;  1NZ4 A;  2PEG B;  1Y31 A;  1HAB A;  2EB9 A;  3K8B A;  2HCO B;  1MBI A;  2RAO B;  3PI8 A;  4HRR A;  1JP8 A;  3UHB A;  1RQA B;  1RVW A;  4M4A A;  1Y45 A;  1A4F A;  1HBB B;  2GRZ A;  3UHV A;  1LFY A;  4N7N B;  3A5B A;  1Y4F B;  2YRS A;  3OK5 A;  2W72 A;  1UX9 A;  2ZLX B;  1Y0C A;  1J7W B;  4KMW A;  1XZV B;  6HBW B;  2VHB A;  2O5S X;  1MYI A;  3GOU A;  3LB4 A;  4SDH A;  4MQH B;  2MGM A;  1LFL A;  3OZV A;  5EOH A;  4F69 A;  1QI8 A;  1G0B A;  2ZT0 A;  4HBI A;  4ESA B;  2KSC A;  1UC3 A;  4FH6 A;  3NG6 B;  2D5Z B;  3WCW C;  2ZFO A;  1YEO A;  1NXF A;  1A00 A;  2GNW A;  3BJ3 A;  1VWT B;  1LA6 A;  2HBC A;  3UHW A;  3WCV C;  1V4U A;  1BAB A;  1MOA A;  2HBE A;  3D1K A;  4YU3 B;  2HHB B;  3VRG A;  1IBE B;  1FCS A;  3KMF A;  1MYT A;  3HC9 A;  1FSX A;  3WCT A;  1S0H A;  3ECX A;  1N9H A;  5EQM A;  1OUU A;  1JL6 A;  2QLS A;  4X0L A;  1OUT A;  5CND A;  3HYU A;  1A3N A;  1C7C A;  1HGA B;  3UHE A;  1JEB B;  1O1K A;  1DO1 A;  104M A;  1GBU A;  1O1L A;  105M A;  2GTL C;  3D17 B;  3PIA A;  1Y0T B;  1GCW B;  3MBA A;  1KR7 A;  1HCO A;  1Y5J A;  4NK2 A;  1GCV A;  4PNJ A;  3ONZ A;  3BOM A;  1VXE A;  2XKH A;  1NEJ B;  3FS4 A;  2EKU A;  1GVH A;  2ZSO A;  5CN7 A;  1PBX B;  1Y85 A;  3D4X A;  3MYM A;  3AG0 A;  1Y5F B;  2LH7 A;  3UHK A;  3D7O A;  2HBF B;  1GDL A;  2BK9 A;  1DLY A;  1A3O B;  2DN1 B;  2MGB A;  2H35 B;  1XZ5 A;  3UHG A;  1UFJ A;  1MBO A;  3G53 A;  1JDO A;  1N9I A;  1Z8U B;  2G0V A;  1UVY A;  1D8U A;  1YIH A;  1MNI A;  5CNB A;  1FDH A;  1MYF A;  1Y5K A;  2FRI X;  1MBS A;  2MYA A;  2BLI A;  1RTE A;  5JDO F;  1LFZ A;  1C7B B;  2ZS1 D;  5ILR A;  2QRW A;  4ZVB A;  3IC0 B;  1YE0 A;  1SPE A;  3CY5 A;  3MYN A;  1BIN A;  2SPN A;  1O16 A;  1YOG A;  1OFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...