1IWHA

Crystal structure of horse carbonmonoxyhemoglobin-bezafibrate complex at 1.55a resolution: a novel allosteric binding site in r-state hemoglobin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Horse Carbonmonoxyhemoglobin-Bezafibrate Complex at 1.55A Resolution. A Novel Allosteric Binding Site in R-State Hemoglobin
pubmed doi rcsb
molecule tags Oxygen storage/transport
molecule keywords Hemoglobin alpha chain
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1iwhA00
1HBHB 3GQRA 2B7HA 1DWSA 1XZ4B 1Y7GB 1HBSB 3LR9A 3ZJPA 4F69A 3LQDA 1YEVB 4ZVBA 3NFEB 3UHCA 4PNJA 3BJ1A 5KKKA 2QSPB 3G4QA 4MQCA 1K0YA 1RQ4A 2R4XA 1A6GA 4XS0B 5E83A 1HDAA 1FHJA 2DXMB 1Y09B 3HHBB 1Y7DB 2D2MB 5HLUA 1Y0DA 1IWHA 1VXCA 1FCSA 3DHRA 3GK9A 3ECXA 1UIWA 3UI0A 2XKGA 3TLDA 1MLQA 1DO7A 1DWTA 1F63A 5HBIA 1CP5A 2DHBB 1IRDA 1YGFB 1ECAA 1Q1FA 1YENA 1DUKA 3AQ9A 1Y85A 3MN0A 3NFEA 1MKOB 1NZ2A 1XZ7B 1YHEB 3MJUB 3QJCB 3D7OB 1XZVA 2OHAA 2NSSA 1RSEA 2HHBB 1LFVA 1FHJB 1HACB 1TU9A 4G1VA 2G0VA 2ZS1A 2ZSOA 4HRTA 4MQHA 1C7DB 1LFQB 7HBIA 2HHEB 2MYBA 3UBVA 1JL7A 3PI8B 3QJDB 4ROMB 1H1XA 2O5OX 1CO8A 2VLZA 3HYUA 2D2MD 2H8FA 2ZSZA 1DO3A 1MLUA 3WFUA 3WCVC 1HHOA 3PT8B 1BINA 1CBLA 3UH5A 5JDOF 4N7OA 3CY5A 1GJNA 1A0ZB 1BBBA 1RVWB 1UX9A 1O1OB 4NXAA 1KFRA 1NZ4A 2KSCA 1A6KA 2G0XA 4F68A 1MNHA 1V4XA 1BZ0A 4ILZA 5CNCA 1Y5KB 4AVEA 2QRWA 1YDZB 1VXGA 2DXMA 2QFKA 5JGGB 1XQ5A 4NI1B 3FS4A 5SW7B 4MPMA 2PGHB 4O1TA 1ECOA 1LJWA 1BUWB 5HU6B 1WVPA 1NQPB 1TESA 2O58X 2D2NC 1IBEA 3GOUB 1IT2A 1OUUA 4QAUA 1G09B 1A9WA 1Y7GA 1BVCA 3UHGA 1Y0TB 4O35A 1C7CB 1A3NB 1J7SB 1A4FB 1HSYA 1HV4B 2HBFB 1J7WA 1O1IA 1N9IA 3WCVA 1VWTB 2FRKX 3AT6B 2GDMA 1MOHA 1UC3A 1XZUA 1MLGA 5C6YA 3MKBA 5AB8A 1O1JA 3WR1A 3AQ6A 1MNKA 2MYDA 2HBFA 1Y01B 2MHBA 2V1HA 1C7BA 3HF4A 2EKUA 4HSWA 1MOCA 1DUOA 2FRJX 3VRGA 4IROA 3ZJMA 2IN4A 3OK5A 4O4TA 3GDJA 3E55A 2R50A 3LB2A 1YFFA 2LH5A 3QM9A 3HYUB 2LH1A 1VXFA 3D17A 1Y4GB 6HBWA 3TM9A 1Y2ZB 3ZJHA 1GBUA 1RPSB 2HHDB 2ZFOB 4DC7A 5AZRA 1S5YA 1YMAA 1N9FA 5C6EA 2W72B 1MLFA 2SPOA 3P5QB 3UH7A 1MYMA 3UHYA 4H2LB 4NI0A 2HZ3A 1S5XA 1IDRA 3S1JA 1C40A 1Y7CB 2SPNA 1G08A 3NMMA 1RQ3A 1NAZA 1MBIA 1Y0AB 4MQCB 2W6YA 1Y5JA 3S65A 1G0AB 1YGDB 2AV0A 3D1AB 1Y8HB 2O5MX 3HXNB 3QZXA 1GCWB 1BZ0B 2D2MA 3S1IA 1LFYA 1X46A 1Y7ZB 4WJG1 1YIEA 5E6EB 1NIHB 1MBAA 4ZVAA 1YVQB 2AUPA 1V4UB 3EU1A 3WFXA 1JP9A 4B4YA 1OJ6A 1YENB 4F6JA 2G14A 2ZS0C 4F6BA 1G08B 2ZSNA 2MBWA 1PBXB 1URYA 3PI1A 1XXTA 1B86A 1UVYA 1NS9A 1ABYA 2AA1A 1YOHA 1MLNA 2H8DA 111MA 3S66B 3DR9A 3CY5B 3G4RA 1GCVB 1LHSA 1YIEB 2ZS1B 4HRTB 5E6EA 3QJEA 2GTLC 1A00A 3E5IA 3AT5B 1EWAA 1VHBA 2ZSPA 3KMFA 2MGDA 4MQJA 1Y2ZA 3BJ3B 1Y8WA 2W31A 3QJDA 1BZZB 2FRIX 1O1OA 1HBBA 1HBRA 3GKTA 1O16A 1CH1A 1HDBB 3G53A 1CLSB 4FC3B 4U8UA 3UHQA 1C40B 1S6AA 2WTGA 1QSHA 1RQAB 1LA6A 2HBCB 3GLNA 4MXKA 1LH7A 3NG6B 1ASHA 2DN1B 3HEPA 1HRMA 3MOUA 1FN3A 1XY0A 1AJGA 3UHDA 4XS0A 1CH9A 3D1KB 1MTIA 5F2AA 4HRRB 3ONZB 3ZJQA 2D2NA 2ZSTA 2MGGA 4G51A 1YE0A 1ABWB 1Y7DA 2D2MC 2XKHA 1LA6B 2HBCA 1CG8A 2V1KA 1J3ZB 1JF4A 2QU0A 2D60A 1XXTB 4MBAA 3UHWA 1OFKA 1C7CA 1Y5FB 1OBMA 1X3KA 1YEOB 1IRDB 1YGFA 3QQRA 1SDKA 2G0ZA 1G0BB 1Y85B 1C7BB 3WFTA 1V75B 1Y0WB 2O5SX 1O1JB 1MZ0A 1GZXB 3MYMA 4BJAA 3WCWA 1YHUB 3PI8A 1NS9B 3ASEA 1XZ5A 1Y35B 4HSXA 2CMMA 2GRZA 1AJHA 1HGBB 1CIOA 2DN1A 3W4UB 5C6EB 2ZFOD 1SI4A 2HBSB 1HHOB 4MQIB 1MODA 2MB5A 1KR7A 3VHBA 2ZT4A 1NZ5A 3WCWD 1MNIA 4TYXA 5KDQA 3ZJOA 103MA 1LFLA 3QM5A 1YVTA 1V5HA 2HBEB 2V1IA 3WTGA 4UIQA 1Y7ZA 1LFTA 4MBNA 1YE0B 3NL7A 2MYCA 5CNFA 1LH5A 2W6VB 3S65B 2OHBA 4ROLA 3KMFC 1MYFA 2GNWA 4M4AB 1KD2A 3VRFA 1GDLA 4FWXA 5CHQA 1G9VB 1YEQA 1JZMA 1A01A 2G11A 2HBDB 1M6MA 3ARKA 2QSSA 3QMAA 2AA1B 1THBA 1Y8IB 4U8UD 3IC2A 1Y22A 1Y4RA 2Z6SA 2V1EA 1MBOA 3AT6A 4OF9A 1YHEA 1VWTA 3ECLA 1V07A 1BIJB 2OLPA 3UHSA 1U7RA 1MYGA 4F6IA 2D5XA 3R0GA 4JACA 4H0BA 1JL6A 4MQKA 1CH4A 1LTWA 2R4YA 3AG0A 2ZLXB 1A6MA 3KUOA 1YEQB 3ZH0A 1Y83A 3E4NA 3MJUA 2DN3A 1PBXA 3EU1B 1UMOA 1YE2A 2MGBA 1NS6B 1Y4VB 1HCOA 2PEGB 1HLBA 1Y46A 1LFZB 1O1PA 2ZLWB 2LH6A 2M6ZB 2GTLB 1JEBA 4YU4A 1R1XA 4FH6A 4NI0B 4FC3A 4U8UB 3H58A 1B0BA 3ODQA 1FDHA 1BBBB 1RVWA 5CN4A 1QI8B 2R4WA 1R1YA 3UHNA 1JF3A 4N7NA 1A6NA 5M3SA 1J41A 1GLIB 1X9FD 3QM6A 4XDIA 1UFPA 1Y4PA 2ZT2A 1G9VA 3UHIA 2R80A 3OO5B 1DO1A 3ECZA 3V2ZA 1MLHA 3WCUD 3MJPB 3D1KA 4NS2A 5JDOE 3K9ZA 4MU5A 1COHB 1K1KA 3DUTB 1FSXA 1HGBA 2NSRA 4X0LB 3O7NA 3EOKB 3WHMA 4ESAB 2ZSXA 2O5LX 4KMVA 2D5XB 2AUOA 4WJGA 1J41B 1GLIA 5ILPA 2ZLTA 3MBAA 5HY8B 1XZUB 3A2GA 3WCVB 1G0BA 2XKIA 1D8UA 2H8DB 2G12A 1DKEB 1LFVB 2MGLA 1YG5A 3WCTA 1O1NB 1MLKA 4OODA 3NMLA 3BA2A 3D4XA 1SPGB 1Y8KA 1QXEA 1V75A 1FDHG 3OZVA 3OJ1A 2BLHA 2QMBA 1HBBB 1HACA 3NMMB 2MGJA 5CNGA 1YEOA 1LFZA 1BZPA 2WY4A 1J52A 1EW6A 3LB1A 1A9WE 1MBDA 4B3WA 1BIJA 4F4OB 1DXTA 3GQGB 3GKVA 3DHTB 5HAVA 1M9PA 1ABSA 4DC8A 108MA 1YG5B 106MA 3OVUC 3BCQA 3WFWA 1YVQA 1YEVA 3A59A 3H57A 1DLYA 2Z85A 2JHOA 3ARJA 2HBEA 1JP6A 3RGKA 2GKNA 3M39A 1Y4FB 1FSXB 1CH2A 3FH9A 4H2LA 2RAOA 1NZ3A 4HRRA 4VHBA 2ZLUB 1ITHA 3MVCA 4FH7A 2Z6NB 1IRCA 2OH8A 1J3FA 1NIHA 1YHRA 2HBGA 1GDIA 1LFLB 1ABWA 1N9XA 3GQRB 1Y4QA 2GKMA 1NPFA 1HABB 3ZOMA 2VLYA 1S0HB 3AT5A 1JWNA 4MXLA 2MGFA 2PGHA 1HJTA 3MKBB 1NWNA 4M4BB 1HDSB 1Y31B 3IC0B 3PI2A 4MQGB 4U8UC 1CG5A 4PQCA 1Y83B 1YDZA 2NX0A 4KMWA 2QFNA 2VYYA 4SDHA 2D5ZB 1CG8B 1UX8A 5F0BA 1XZ7A 1Y45A 2GRHA 4LPIA 1LHTA 1Y0DB 2FRFA 4GZGA 1MLMA 1UIWB 3WCUB 1HCOB 1WMUB 2MHBB 1Y46B 1MWDA 3A9MA 4WCHD 3OGBA 1HGCB 1NGKA 1MOBA 4G1BA 1FAWA 2BLJM 3S66A 1CBMA 3WCWC 4ODCA 2SPMA 2GTLA 5HLQA 3HRWB 1YE2B 4MQKB 2GNVA 5JDOD 2NRMA 1HBSA 1BZ6A 2M6ZA 2ZFOC 1FAWB 2B7HB 3WCTB 3QZZA 3UBCA 4TWUA 1VXHA 1Y8KB 1MWCA 1U7SA 3P5QA 5EU2A 2LHBA 2ZSQA 3PELB 2W6XA 5CNDA 3VREA 4UURA 1MYTA 2H8FB 2HZ2A 2D6CA 3EOKA 3WHMB 1O1LA 3PIAA 1YVTB 3NG6A 1Y0CA 2ZT3A 1JW8A 1CQ2A 1SWMA 1Y0AA 1F65A 3A5GA 2MYAA 1FSLA 2QSPA 1K1KB 3VRFB 1A3NA 2ZLVB 2MYEA 3LQDB 3A0GA 1GCWA 5CN8A 3VRGB 1V4XB 1Y4QB 3FH9B 2QSSB 2G0SA 1BABA 1YEUB 1QPWB 1CO9A 3CIUB 5CNEA 1MYIA 2HCOA 1YFFB 1HBGA 1GDJA 1ECDA 3WI8A 101MA 1YMBA 2LH2A 1MBNA 5MBAA 2O5QX 1VRFA 2BLIA 1RPSA 1XZVB 4DWTA 4L2MA 109MA 3M38A 1MKOA 1JEBB 4YU4B 1VXAA 2GRFA 1BJEA 2BMMA 1HGAB 1NEJA 3AQ5A 1DO4A 1MYJA 1V4WA 3DHTA 1MLSA 3OZUA 2ZS0D 2OIFA 1Y8WB 2C0KA 4O4ZA 2DN2B 5CN7A 3D7OA 2LH3A 1Y4VA 3QQQA 4MQHB 3PI3A 5E83B 3E5OA 2VHBA 3A5AA 1Y5JB 5ILEA 2Z6NA 1A0ZA 1H97A 1XZ2A 5E29B 1ABYB 2ZS0A 1THBB 1Y7CA 1S69A 2V1GA 1O1MA 3GQPB 1OUUB 1IBEB 1HBHA 4ROMA 3UHTA 3HENA 4M4AA 1I3DA 2VYZA 2ZSYA 3K3UA 3K8BB 3FS4B 1URVA 4F6DA 1XYEB 5CHRA 3PT8A 1HDSA 3O89A 4DWUA 2FALA 1COHA 104MA 1N9HA 2G0RA 2RAOB 1SDLA 5EOHA 1EMYA 3ORDA 1KD2B 1YGDA 1SPEA 1YOIA 5HU6A 1MOAA 1V9QA 1OR4A 1DXDA 4X0LA 1RQ3B 3ZJLA 3RJ6A 1LH3A 1WMUA 4YU3A 1A4FA 1HV4A 1QSIB 1LH2A 3BJ3A 1B86B 2HHEA 3BJ2A 3WCTC 1A0UA 1G09A 1A00B 3PT7A 1YMCA 2ZS1D 2BNLA 4ODCB 5AZQA 2ZT1A 2H35B 2ZFBB 1HGCA 2ZS1C 4JYQA 5ILRA 1YEUA 4PQ6A 1MLRA 2E2YA 2XYKA 1MTKA 5EETA 1DXVA 1BZ1B 1YIHA 2ZT0A 4IROB 2VRYA 1SHRB 3GYSB 4HHBB 3RJNB 1MLOA 5EYSA 3V2VA 1Y4BB 4NI1A 4N7OB 1DWRA 3G4YA 4UZVA 2ZS0B 3HEOA 1XZ4A 3ED9A 1DTMA 1OR6A 5EV5A 1NQPA 1XZ5B 3PIAB 4FWYA 2IG3A 4N7PA 1YOGA 6HBIA 3WR1B 3LHBA 3BOMB 2VEBA 5JDOC 5MBNA 1NEJB 1Y0TA 1MBCA 5JOMA 1V4UA 2MGMA 1O1IB 1IT3A 1DXCA 3M3BA 2ZWJA 1J7YB 3MYNA 2MGHA 1LH1A 1J3YB 3GOUA 2RI4B 1XCHA 3WCVD 3UGZA 2QLSB 1FN3B 2ZLVA 2QMBB 1CMYA 3UGYA 1XYEA 2MGIA 1HABA 1O1NA 2D60B 4IT8A 1X9FC 3GKVB 2VYWA 2W6VA 1JY7A 2D2ND 2MGCA 1Y35A 2Z8AA 1O1KA 1BABB 1YZIA 1HDAB 1SI4B 2HBSA 4TWVA 3A5BA 110MA 4MQJB 1LFQA 1DXUA 1QXDB 2EB9A 3QJEB 3QJBA 1SPGA 2EF2A 3GQGA 3W4UA 2DC3A 3R5IB 1Y0WA 1L2KA 1GBVA 3UHKA 3ZHWA 1MNOA 2ZLWA 2GLNA 3EDAA 2R1HB 2V1JA 3B75A 4O2GA 1SDKB 2W6WA 1GBUB 2HHDA 1MBSA 1HBAB 1DM1A 3WCWB 1MDNA 4H07A 3VAUA 2WTHA 5D5RA 4ROLB 4PQBA 3EDBA 4L7YB 1BVDA 1GCVA 3VREB 1S56A 3NL7B 1Y5KA 1S0HA 4C0NA 1FLPA 3PI9A 3D1AA 1M6CA 5KDQB 3R5IA 2D2NB 1W92A 3GQPA 3UH3A 2ZSSA 3G4WA 4MQIA 3M3AA 1DLWA 1K0YB 1RQ4B 3WCUA 1CPWA 1DTIA 2ZLUA 3ZJSA 3HC9A 2BK9A 3IC2B 3UHHA 2R80B 3OO5A 2G10A 1HLMA 1CIKA 3AQ8A 3UHEA 1PMBA 3G52A 3PT7B 2SPLA 1YHRB 2YRSB 5HLXA 3DUTA 1R1YB 4G51B 1CQXA 1Y45B 2HCOB 3BJ1B 1MNJA 3G46A 1JDOA 2Z6TA 1OFJA 1RTEA 2EB8A 2MGKA 1EBTA 1J3ZA 1OUTB 1JY7B 1GVHA 1HDBA 5EYJA 2D5ZA 3CIUA 3WCPB 1JZLA 3QJCA 1BZ1A 2O5BX 1CG5B 3LB3A 3SDNA 2PEGA 4NZIA 5HY8A 4N8TA 2GL3A 5B85A 4AVDA 1HBAA 3OZWA 5EQMA 2DN3B 2EVPA 3AQ7A 1YHUA 3ODQB 3ONZA 3ZJIA 3HF4B 3A0GB 1VREA 1O1MB 1NS6A 4MAXA 4F6GA 2MGEA 1IOPA 1VXDA 4N7PB 2VLXA 3LB4A 2QU0B 1SHRA 1YHUD 3GYSA 1J40B 1T1NB 2BWHA 3BOMA 2HBDA 1Z8UB 3UHBA 4F4OA 1QI8A 5CN6A 1X9FB 3BCQB 1J7YA 2FAMA 2DHBA 1Y8HA 1NWIA 1AZIA 5EUIB 5B84A 1XQ5B 2HZ1A 3SDHA 1G0AA 2AURA 4L7YA 3DHRB 1MCYA 4NK2A 1LFYB 1LJWB 5IKSA 1ECNA 3WCUC 2MGAA 1MYZA 5SW7A 1DKEA 3LR7A 3SZKB 5KERB 1YH9A 1A3OB 4ESAA 1A01B 1A0UB 1IWHB 102MA 1QXEB 1Y09A 3HXNA 4YU3B 2ZLTB 3MJPA 1MLJA 3G4UA 1JPBA 3UHUA 1Y8IA 3ZJJA 1YZIB 2LH7A 1CMYB 2V1FA 3IA3B 3OO4A 4NK1A 3KUNA 3UHZA 1O1KB 1DXVB 1O1PB 3UHXA 3PI4A 4M4BA 5D1VA 4HBIA 5CN9A 1V4WB 4FWZA 1NPGA 1MTJA 3S48C 4KN3A 2H35A 2ZFBA 3UH6A 1LH6A 1F5OA 1DXTB 2NRLA 1YIHB 6HBWB 1MLLA 1HBRB 3WCPA 105MA 2R1HA 3UHRA 1S61A 5EE4C 3PI9B 2G3HA 2ZFOA 3WTGB 1CH5A 2O5TX 2HHBA 2GTLD 3GDJB 1SDLB 3WCTD 2W72C 1MGNA 5EE4D 1BZRA 1Y4BA 1F5PA 1UFJA 5CN5A 1UT0A 1XY0B 2R4ZA 3K8BA 3A59B 3HHBA 1JZKA 3B75B 2ZSRA 2AV3A 3ZJRA 1A3OA 1GDKA 3HRWA 5CMVA 1HBIA 2OH9A 1BUWA 3ZOLA 2BKMA 1YCBA 2ZLXA 2YRSA 1Y22B 1Y4RB 2QLSA 5JGGA 112MA 3SZKA 1J40A 1T1NA 3G4VA 4F6FA 2RI4A 1JP8A 1YH9B 2VEEA 1J3YA 1RTXA 4KJTA 1OUTA 1RQAA 1QSIA 1Y5FA 5EUIA 3UHVA 3QM8A 1DXUB 2EKTA 1EBCA 1VXBA 1WLAA 1CP0A 1J7WB 1J7SA 3D4XB 1GBVB 1CH3A 1VXEA 3OO4B 1I3EA 107MA 2EVKA 4MQGA 1QPWA 3BJ2B 5ILMA 1LUEA 3QJBB 1GZXA 3ARLA 1HGAA 1QXDA 1Y31A 3IC0A 4C44A 1AJ9A 1S5YB 1NXFA 1YCAA 3TM3A 2VM0A 2DN2A 1BZZA 4N7NB 1Y0CB 1S5XB 4NXCA 1YHUC 1AJ9B 1MWBA 3IXFA 1QSHB 3D17B 2AUQA 1CH7A 1Y4GA 1O1LB 1C7DA 1UVXA 1M9PB 1R1XB 4N8TB 2W72A 1XZ2B 5E29A 1CLSA 3PELA 3ZJNA 1Y4PB 1Y4FA 2BW9M 1LFTB 3QM7A 1MYHA 3U3EA 4HHBA 1X9FA 5KERA 5CNBA
chains in the Genus database with same CATH superfamily
1HBHB 3GQRA 2B7HA 1DWSA 1XZ4B 1Y7GB 1HBSB 3LR9A 3ZJPA 4F69A 3LQDA 1YEVB 4F0UA 4ZVBA 3NFEB 3UHCA 4PNJA 3BJ1A 5KKKA 1B8DA 2QSPB 3G4QA 4MQCA 2VJRA 1K0YA 1RQ4A 2UUMB 2R4XA 1A6GA 4XS0B 5E83A 1HDAA 1FHJA 2DXMB 2VJTB 1Y09B 3HHBB 1Y7DB 2D2MB 3RQRA 5HLUA 1Y0DA 1IWHA 1VXCA 1FCSA 3DHRA 3GK9A 3ECXA 1UIWA 3UI0A 2XKGA 3TLDA 1MLQA 1DO7A 1DWTA 4L1EA 1F63A 5HBIA 1CP5A 2DHBB 1IRDA 1YGFB 1ECAA 1Q1FA 1YENA 1DUKA 3AQ9A 1Y85A 3MN0A 4PO5A 3NFEA 1MKOB 1NZ2A 1XZ7B 1YHEB 3MJUB 3QJCB 3D7OB 1XZVA 2OHAA 2NSSA 1RSEA 2HHBB 1LFVA 1FHJB 1HACB 1TU9A 4G1VA 2G0VA 2ZS1A 2ZSOA 4HRTA 2C7LA 4MQHA 4HH1A 1C7DB 1LFQB 7HBIA 2HHEB 2MYBA 3UBVA 1JL7A 1XF6C 3PI8B 3QJDB 1B33A 4ROMB 1H1XA 2O5OX 1CO8A 3GUQA 2VLZA 3HYUA 2D2MD 2H8FA 2ZSZA 1DO3A 1MLUA 3WFUA 3WCVC 1HHOA 3PT8B 1BINA 1CBLA 1COLA 3UH5A 5JDOF 4N7OA 3CY5A 1GJNA 1A0ZB 4HH0A 1BBBA 1RVWB 2C7KA 1UX9A 1O1OB 4NXAA 1KFRA 1UVNA 1NZ4A 2KSCA 1A6KA 2G0XA 4F68A 1MNHA 1V4XA 1BZ0A 4ILZA 5CNCA 1Y5KB 4AVEA 2QRWA 1YDZB 1VXGA 2DXMA 2VJTA 2QFKA 5JGGB 1EYXA 1XQ5A 1ON7B 4NI1B 3FS4A 5SW7B 4MPMA 2PGHB 4O1TA 1ECOA 1LJWA 1BUWB 5HU6B 1WVPA 1NQPB 1TESA 2O58X 2D2NC 1IBEA 3GOUB 1IT2A 1OUUA 1A87A 4QAUA 1G09B 1A9WA 1Y7GA 1BVCA 3UHGA 1Y0TB 4O35A 1C7CB 1A3NB 1J7SB 1A4FB 1HSYA 1HV4B 1I7YA 1J7WA 1O1IA 2HBFB 1N9IA 3WCVA 1VWTB 2FRKX 3AT6B 2GDMA 1MOHA 1UC3A 1XZUA 1MLGA 4AE1A 5C6YA 3MKBA 5AB8A 1O1JA 3WR1A 3AQ6A 1MNKA 2MYDA 2HBFA 1Y01B 2MHBA 2V1HA 1C7BA 3HF4A 1HHTP 2EKUA 4HSWA 1MOCA 1DUOA 2FRJX 3VRGA 4IROA 3ZJMA 2IN4A 3V57B 3OK5A 4O4TA 4A8OA 3GDJA 3E55A 2R50A 3LB2A 1YFFA 2LH5A 3QM9A 3HYUB 2LH1A 1VXFA 3D17A 4AE0A 1UVIA 1Y4GB 6HBWA 3TM9A 1Y2ZB 2VMLB 3ZJHA 1GBUA 1RPSB 1LIAA 2HHDB 2ZFOB 4DC7A 3BRPB 4ERVA 5AZRA 1S5YA 1YMAA 1N9FA 5C6EA 2W72B 1MLFA 2SPOA 3P5QB 3UH7A 3BRPA 1MYMA 3UHYA 4H2LB 4NI0A 2HZ3A 4GXEA 1S5XA 1IDRA 3S1JA 1C40A 2WCRA 1Y7CB 2SPNA 1G08A 3NMMA 1RQ3A 1NAZA 1MBIA 1Y0AB 4MQCB 2W6YA 1Y5JA 3S65A 1G0AB 1YGDB 2AV0A 3D1AB 1Y8HB 2O5MX 4A8WA 3HXNB 3QZXA 1GCWB 1BZ0B 2D2MA 3S1IA 1LFYA 1X46A 1Y7ZB 1MDTA 4WJG1 4ETUA 1YIEA 5E6EB 1NIHB 1MBAA 4ZVAA 1YVQB 2AUPA 1V4UB 3EU1A 3WFXA 1JP9A 4B4YA 1OJ6A 4ZIZB 1YENB 4F6JA 2G14A 2ZS0C 4F6BA 1G08B 2ZSNA 2MBWA 1PBXB 1URYA 3PI1A 1XXTA 1B86A 1CPCB 1UVYA 1NS9A 1ABYA 2AA1A 1YOHA 1MLNA 2UUMX 2H8DA 111MA 3S66B 3DR9A 3CY5B 3G4RA 1GCVB 1LHSA 1YIEB 2ZS1B 4HRTB 5E6EA 1JBOA 3QJEA 2GTLC 1A00A 3E5IA 3AT5B 1EWAA 1VHBA 2ZSPA 3KMFA 1UVKA 2MGDA 4TMAB 4MQJA 1Y2ZA 3BJ3B 1Y8WA 2W31A 3QJDA 1BZZB 2FRIX 1O1OA 1HBBA 1HBRA 3GKTA 1O16A 1CH1A 1HDBB 2UUNB 3G53A 1CLSB 1KTPA 4FC3B 4U8UA 3UHQA 1C40B 1S6AA 3O2CB 2WTGA 2C7KB 1QSHA 1RQAB 1LA6A 2HBCB 3GLNA 4MXKA 1LH7A 3NG6B 1ASHA 2DN1B 3HEPA 4RMPA 1HRMA 3MOUA 1FN3A 1XY0A 1HA7B 3DBJB 1AJGA 4ESUA 3UHDA 4XS0A 1CH9A 3D1KB 1MTIA 5F2AA 1LIAB 4HRRB 3ONZB 3ZJQA 2WCQA 2D2NA 2ZSTA 2MGGA 4G51A 1YE0A 1HI8A 1ABWB 1Y7DA 2D2MC 2XKHA 1LA6B 2HBCA 1CG8A 2V1KA 1J3ZB 1JF4A 2QU0A 2D60A 1XXTB 4MBAA 4LM6B 1OFKA 3UHWA 1C7CA 1Y5FB 3FEWX 1OBMA 1X3KA 1YEOB 1IRDB 1YGFA 3QQRA 1SDKA 2G0ZA 1G0BB 1Y85B 1C7BB 3WFTA 1V75B 1Y0WB 2O5SX 1O1JB 1MZ0A 1GZXB 3MYMA 4BJAA 3WCWA 1YHUB 3PI8A 1NS9B 3ASEA 1XZ5A 1Y35B 4HSXA 2CMMA 2GRZA 1AJHA 1HGBB 1CIOA 2DN1A 3W4UB 5C6EB 2ZFOD 1SI4A 2HBSB 1HHOB 4MQIB 1MODA 2MB5A 1KR7A 3VHBA 2J96A 2ZT4A 1NZ5A 3WCWD 1MNIA 2BV8B 3KVSB 4TYXA 5KDQA 3ZJOA 103MA 1LFLA 2VJHA 3QM5A 1YVTA 1V5HA 2HBEB 2V1IA 3WTGA 4UIQA 1Y7ZA 1LFTA 4MBNA 1YE0B 3NL7A 2MYCA 5CNFA 4GY3A 1LH5A 2W6VB 3S65B 2OHBA 4ROLA 3KMFC 1MYFA 2GNWA 4M4AB 1KD2A 3VRFA 1GDLA 4FWXA 5CHQA 1G9VB 1YEQA 2X49A 1JZMA 1A01A 2G11A 2HBDB 1M6MA 3ARKA 2QSSA 3QMAA 2AA1B 1THBA 1Y8IB 4U8UD 3IC2A 1Y22A 1Y4RA 2Z6SA 2V1EA 1MBOA 3AT6A 4OF9A 1YHEA 1VWTA 3ECLA 1V07A 4F0TA 1PHNB 1BIJB 2OLPA 3UHSA 1U7RA 1MYGA 4F6IA 2D5XA 3R0GA 4JACA 4H0BA 1JL6A 4MQKA 1CH4A 1LTWA 2R4YA 3AG0A 2ZLXB 1A6MA 3KUOA 1YEQB 1RH1A 1Y83A 3E4NA 3ZH0A 3MJUA 2DN3A 1PBXA 3EU1B 1UMOA 1YE2A 1KTPB 2MGBA 1JBOB 1NS6B 1Y4VB 1HCOA 2PEGB 1HLBA 4H0MA 1Y46A 1LFZB 1O1PA 2ZLWB 2LH6A 2M6ZB 2GTLB 1JEBA 4YU4A 1R1XA 1GH0A 4FH6A 4NI0B 4FC3A 4U8UB 3H58A 1B0BA 4GY3B 3ODQA 1FDHA 1BBBB 1RVWA 5CN4A 1QI8B 2R4WA 1R1YA 3UHNA 1JF3A 1EYXB 4N7NA 1A6NA 5M3SA 1J41A 1GLIB 1X9FD 2X4AA 3QM6A 4XDIA 1UFPA 1Y4PA 4Q70B 2ZT2A 1G9VA 3UHIA 2R80A 3OO5B 1DO1A 3ECZA 3V2ZA 1MLHA 3WCUD 3MJPB 3D1KA 4NS2A 5JDOE 3K9ZA 4MU5A 1COHB 1K1KA 3DUTB 1FSXA 1HGBA 2NSRA 4X0LB 3O7NA 2UULD 4BS9A 3EOKB 3WHMA 4ESAB 2ZSXA 2O5LX 4KMVA 2D5XB 2AUOA 4WJGA 1J41B 1GLIA 5ILPA 2ZLTA 3MBAA 5HY8B 4F0TB 2UUND 1XZUB 3A2GA 4ERTA 3WCVB 1G0BA 2XKIA 1D8UA 2H8DB 2G12A 1DKEB 1LFVB 2MGLA 1YG5A 5B13G 3WCTA 3GIOA 1O1NB 1MLKA 1HI0P 4OODA 3NMLA 3BA2A 3D4XA 1SPGB 1Y8KA 1QXEA 1V75A 1FDHG 3OZVA 3OJ1A 2BLHA 2QMBA 1HBBB 1HACA 3NMMB 2MGJA 5CNGA 1YEOA 1LFZA 4ETTA 1BZPA 2WY4A 1J52A 1EW6A 3LB1A 1A9WE 1MBDA 2UULB 1BIJA 4B3WA 5FVBA 1DXTA 3GQGB 4F4OB 3GKVA 3DHTB 5HAVA 1M9PA 1ABSA 4DC8A 108MA 1YG5B 106MA 3OVUC 3BCQA 3WFWA 1HA7A 1YVQA 1YEVA 3A59A 3H57A 1DLYA 2Z85A 2JHOA 3ARJA 2HBEA 1JP6A 2GKNA 3M39A 3RGKA 1Y4FB 1FSXB 1CH2A 3FH9A 4H2LA 2RAOA 1NZ3A 4HRRA 4VHBA 2ZLUB 1ITHA 3MVCA 4FH7A 2Z6NB 1IRCA 2OH8A 1J3FA 1NIHA 1YHRA 2DKCA 1HI1A 2HBGA 1GDIA 1LFLB 2VJHB 1ABWA 1N9XA 3GQRB 1Y4QA 2GKMA 1NPFA 1HABB 3ZOMA 2VLYA 1S0HB 3AT5A 1JWNA 4MXLA 4ETVA 2MGFA 2PGHA 1HJTA 3MKBB 1NWNA 4M4BB 1HDSB 1Y31B 3IC0B 3PI2A 4MQGB 4U8UC 1CG5A 4PQCA 1Y83B 1YDZA 2NX0A 4KMWA 2QFNA 2VYYA 4SDHA 2C7JB 2D5ZB 1CG8B 1UX8A 5F0BA 1XZ7A 1Y45A 2GRHA 4LPIA 1LHTA 1Y0DB 2FRFA 4GZGA 1MLMA 1UIWB 3WCUB 1HCOB 1WMUB 2MHBB 1Y46B 1MWDA 3A9MA 4WCHD 3OGBA 1HGCB 1NGKA 1MOBA 4G1BA 1FAWA 2BLJM 3S66A 1CBMA 1F99B 3WCWC 4ODCA 2SPMA 3O18A 2GTLA 5HLQA 3HRWB 1YE2B 4MQKB 2GNVA 5JDOD 2NRMA 1HBSA 1BZ6A 2M6ZA 2ZFOC 1FAWB 2B7HB 3WCTB 3QZZA 3UBCA 3O18B 1VXHA 4TWUA 1Y8KB 1MWCA 1U7SA 3P5QA 5EU2A 2LHBA 2ZSQA 3PELB 2W6XA 5CNDA 3VREA 4UURA 1MYTA 3V57A 3DBJA 2H8FB 2HZ2A 2D6CA 3EOKA 3WHMB 1O1LA 3PIAA 1YVTB 3NG6A 1Y0CA 2ZT3A 1JW8A 1CQ2A 1SWMA 1Y0AA 1F65A 3A5GA 2MYAA 3PMDA 1FSLA 1B8DB 2QSPA 1K1KB 3VRFB 1A3NA 2ZLVB 2MYEA 3LQDB 3A0GA 2JLGA 1GCWA 5CN8A 3VRGB 1V4XB 1Y4QB 3FH9B 2QSSB 2G0SA 1BABA 1YEUB 1QPWB 1CO9A 4PO5B 3CIUB 4XXIA 1MYIA 2HCOA 5CNEA 1YFFB 1HBGA 1GDJA 1ECDA 2C7LB 3WI8A 101MA 1YMBA 4A8SA 2LH2A 1MBNA 5MBAA 2O5QX 1VRFA 2BLIA 1UVJA 2VMLA 4H0MB 1RPSA 1XZVB 4Z8KB 4DWTA 4L2MA 2JLFA 109MA 3M38A 1KN1A 1MKOA 1JEBB 4YU4B 1VXAA 2GRFA 1BJEA 2BMMA 1HGAB 1NEJA 3AQ5A 5AQDA 1DO4A 1KN1B 1MYJA 1V4WA 3DHTA 1MLSA 3OZUA 2ZS0D 2OIFA 1Y8WB 2C0KA 4O4ZA 2DN2B 5CN7A 3D7OA 2LH3A 1Y4VA 3QQQA 3PI3A 4MQHB 5E83B 3E5OA 4BJUA 2VHBA 3A5AA 1Y5JB 5ILEA 2Z6NA 1A0ZA 1H97A 1XZ2A 5E29B 1ABYB 2ZS0A 1THBB 1Y7CA 2UULC 1S69A 2V1GA 1O1MA 3GQPB 1OUUB 1IBEB 1HBHA 1B33B 4ROMA 3UHTA 3HENA 4M4AA 1I3DA 2VYZA 2ZSYA 3K3UA 3K8BB 3FS4B 1URVA 4F6DA 1XYEB 5CHRA 3PT8A 1HDSA 3O89A 4DWUA 2FALA 1COHA 104MA 1N9HA 2G0RA 2RAOB 1SDLA 5EOHA 4RMPB 1EMYA 3ORDA 3NUHB 1KD2B 1YGDA 1SPEA 1YOIA 3PMCA 5HU6A 1MOAA 1V9QA 1OR4A 2C7JA 1DXDA 4X0LA 1RQ3B 3ZJLA 3RJ6A 1LH3A 1WMUA 4YU3A 1A4FA 1HV4A 1QSIB 1LH2A 3BJ3A 1B86B 1CPCA 2HHEA 3BJ2A 3WCTC 1A0UA 1G09A 1A00B 3PT7A 1YMCA 2ZS1D 2BNLA 4ODCB 5AZQA 2ZT1A 4ZIZA 2H35B 2ZFBB 1HGCA 2ZS1C 4A8MP 4JYQA 5ILRA 1YEUA 4PQ6A 4A8KA 1MLRA 2E2YA 2XYKA 1MTKA 5EETA 1DXVA 1BZ1B 1YIHA 2ZT0A 1XG0C 4IROB 1F99A 2VRYA 1SHRB 3GYSB 4HHBB 3RJNB 1MLOA 1UVLA 5EYSA 1SGKA 3V2VA 4B02A 1Y4BB 4NI1A 4N7OB 1DWRA 3G4YA 4UZVA 4YJJB 2ZS0B 4LMXB 3HEOA 1XZ4A 3ED9A 1DTMA 1OR6A 5EV5A 1NQPA 1XZ5B 3PIAB 4FWYA 2IG3A 4N7PA 1YOGA 6HBIA 3WR1B 3LHBA 3BOMB 2VEBA 5JDOC 5MBNA 1NEJB 1Y0TA 2VJRB 1MBCA 5JOMA 1V4UA 2MGMA 1O1IB 1IT3A 1DXCA 3M3BA 2ZWJA 1J7YB 3MYNA 2MGHA 1LH1A 1J3YB 3GOUA 2RI4B 1XCHA 3WCVD 3UGZA 2QLSB 1FN3B 2ZLVA 2QMBB 1CMYA 3UGYA 1XYEA 2MGIA 3V58B 1HABA 1O1NA 2D60B 4IT8A 4L1EB 1X9FC 3GKVB 2VYWA 2W6VA 1JY7A 2D2ND 2MGCA 1Y35A 2Z8AA 1O1KA 4A8YA 1BABB 2UULH 1YZIA 1HDAB 1SI4B 2HBSA 4TWVA 4A8FA 3A5BA 110MA 4MQJB 1LFQA 1DXUA 1QXDB 2EB9A 3QJEB 1XDTT 3QJBA 1SPGA 2EF2A 3GQGA 3W4UA 2DC3A 3R5IB 1Y0WA 5B13A 1L2KA 1GBVA 3UHKA 3ZHWA 1MNOA 2ZLWA 2GLNA 2V8AB 3EDAA 2R1HB 2V1JA 3B75A 4O2GA 1SDKB 2W6WA 1GBUB 2HHDA 1WACA 1MBSA 1HBAB 1DM1A 3WCWB 1MDNA 4H07A 3VAUA 2WTHA 5D5RA 4ROLB 4PQBA 3EDBA 3L0FA 1TOXA 4L7YB 1BVDA 4YJJA 1GCVA 3VREB 1S56A 3NL7B 1Y5KA 1S0HA 4C0NA 1FLPA 2I88A 3PI9A 3D1AA 1M6CA 5KDQB 3R5IA 2D2NB 1W92A 3GQPA 3UH3A 2ZSSA 1PHNA 3G4WA 4MQIA 3M3AA 1DLWA 1K0YB 1RQ4B 2UUMA 3WCUA 1CPWA 1DTIA 2ZLUA 3ZJSA 3HC9A 2BK9A 3IC2B 3UHHA 2R80B 3OO5A 2G10A 1ON7A 1I7YB 1HLMA 1CIKA 3AQ8A 1ALLB 3UHEA 1PMBA 3G52A 3PT7B 2SPLA 1YHRB 5AQDM 2YRSB 5HLXA 3DUTA 1R1YB 4G51B 1CQXA 4F0UB 1Y45B 2HCOB 3BJ1B 1MNJA 3G46A 1JDOA 2Z6TA 1OFJA 1RTEA 2EB8A 2MGKA 1EBTA 3LQ9A 1J3ZA 1OUTB 1JY7B 1GVHA 1HDBA 2UUNA 5EYJA 2D5ZA 3CIUA 3WCPB 1JZLA 3QJCA 1BZ1A 2O5BX 1CG5B 2DKAA 3LB3A 3SDNA 1DDTA 2PEGA 4NZIA 5HY8A 4N8TA 2GL3A 5B85A 4AVDA 1HBAA 3OZWA 5EQMA 2DN3B 2EVPA 3AQ7A 4N6SB 1YHUA 3ODQB 3ONZA 3ZJIA 3HF4B 3A0GB 1VREA 1O1MB 1NS6A 4MAXA 4F6GA 3L0FB 2MGEA 1IOPA 1VXDA 4N7PB 2VLXA 3LB4A 2QU0B 1SHRA 1YHUD 3GYSA 1J40B 1T1NB 2BWHA 3BOMA 2HBDA 1Z8UB 3UHBA 4F4OA 1QI8A 5CN6A 1X9FB 3BCQB 1J7YA 2FAMA 2DHBA 1Y8HA 1NWIA 1AZIA 5EUIB 5B84A 1XQ5B 2HZ1A 3SDHA 1G0AA 2AURA 4L7YA 3DHRB 5FVBM 1MCYA 4NK2A 1LFYB 1LJWB 5IKSA 1ECNA 3WCUC 1QGWC 2MGAA 1MYZA 5SW7A 1DKEA 3LR7A 3SZKB 5KERB 1YH9A 1A3OB 4ESAA 1A01B 1A0UB 1IWHB 102MA 1QXEB 1Y09A 3HXNA 4YU3B 2ZLTB 3MJPA 1MLJA 3G4UA 1JPBA 3UHUA 1Y8IA 3ZJJA 1YZIB 2LH7A 1CMYB 1F0LA 2V1FA 3IA3B 3OO4A 4NK1A 3KUNA 3UHZA 1CIIA 1O1KB 1DXVB 1O1PB 3UHXA 3PI4A 4M4BA 5D1VA 4HBIA 5CN9A 1NY9A 1V4WB 4FWZA 1NPGA 1MTJA 3S48C 4KN3A 2H35A 2ZFBA 3UH6A 1LH6A 1F5OA 3V58A 4XXKA 1DXTB 2NRLA 1YIHB 6HBWB 1MLLA 1HBRB 3WCPA 105MA 2R1HA 3UHRA 1S61A 5EE4C 3PI9B 2G3HA 2ZFOA 3WTGB 1CH5A 2O5TX 2BV8A 3KVSA 2HHBA 2GTLD 3GDJB 1SDLB 3WCTD 1GH0B 1MGNA 2W72C 5EE4D 1BZRA 3O2CA 1Y4BA 1F5PA 2UULA 1UFJA 5CN5A 1UT0A 1XY0B 2R4ZA 3K8BA 3A59B 3HHBA 1JZKA 4GXEB 3B75B 2ZSRA 2AV3A 3ZJRA 1A3OA 1GDKA 3HRWA 5CMVA 1HBIA 1HHSA 2OH9A 1BUWA 3ZOLA 2BKMA 1YCBA 2ZLXA 2YRSA 1Y22B 1Y4RB 2QLSA 4A8QA 4LMSB 5JGGA 112MA 3SZKA 1J40A 1T1NA 1ALLA 3G4VA 4F6FA 2RI4A 1JP8A 1YH9B 2VEEA 1J3YA 1RTXA 4KJTA 3VNCA 1OUTA 1RQAA 1QSIA 1Y5FA 5EUIA 3UHVA 3QM8A 1DXUB 2EKTA 1EBCA 1VXBA 1WLAA 1CP0A 1J7WB 1J7SA 3D4XB 4N6SA 1GBVB 1CH3A 1VXEA 3OO4B 4Z8KA 1I3EA 107MA 2EVKA 4MQGA 1QPWA 3BJ2B 2DKDA 5ILMA 1LUEA 3QJBB 1GZXA 3ARLA 3ZTAA 1HGAA 1QXDA 1Y31A 3IC0A 4C44A 1AJ9A 1S5YB 1NXFA 1YCAA 3TM3A 2VM0A 2V8AA 2DN2A 1BZZA 4N7NB 3MWNA 1Y0CB 1S5XB 4NXCA 1YHUC 2YSKA 1AJ9B 1MWBA 3IXFA 1QSHB 2JL9A 3D17B 2AUQA 1CH7A 1Y4GA 1O1LB 1C7DA 1UVXA 1M9PB 1R1XB 4N8TB 2W72A 1XZ2B 5E29A 1CLSA 3PELA 3ZJNA 1Y4PB 4Q70A 1Y4FA 2BW9M 1LFTB 1UVMA 3QM7A 1MYHA 3U3EA 4HHBA 1X9FA 5KERA 5CNBA
chains in the Genus database with same CATH topology
1HBHB 3GQRA 2B7HA 1DWSA 1XZ4B 1Y7GB 1HBSB 3LR9A 3ZJPA 4F69A 3LQDA 1YEVB 4ZVBA 3NFEB 3UHCA 4PNJA 3BJ1A 5KKKA 2QSPB 3G4QA 4MQCA 1K0YA 1RQ4A 2R4XA 1A6GA 4XS0B 5E83A 1HDAA 1FHJA 2DXMB 1Y09B 3HHBB 1Y7DB 2D2MB 5HLUA 1Y0DA 1IWHA 1VXCA 1FCSA 3DHRA 3GK9A 3ECXA 1UIWA 3UI0A 2XKGA 3TLDA 1MLQA 1DO7A 1DWTA 1F63A 5HBIA 1CP5A 2DHBB 1IRDA 1YGFB 1ECAA 1Q1FA 1YENA 1DUKA 3AQ9A 1Y85A 3MN0A 3NFEA 1MKOB 1NZ2A 1XZ7B 1YHEB 3MJUB 3QJCB 3D7OB 1XZVA 2OHAA 2NSSA 1RSEA 2HHBB 1LFVA 1FHJB 1HACB 1TU9A 4G1VA 2G0VA 2ZS1A 2ZSOA 4HRTA 4MQHA 1C7DB 1LFQB 7HBIA 2HHEB 2MYBA 3UBVA 1JL7A 3PI8B 3QJDB 4ROMB 1H1XA 2O5OX 1CO8A 2VLZA 3HYUA 2D2MD 2H8FA 2ZSZA 1DO3A 1MLUA 3WFUA 3WCVC 1HHOA 3PT8B 1BINA 1CBLA 3UH5A 5JDOF 4N7OA 3CY5A 1GJNA 1A0ZB 1BBBA 1RVWB 1UX9A 1O1OB 4NXAA 1KFRA 1NZ4A 2KSCA 1A6KA 2G0XA 4F68A 1MNHA 1V4XA 1BZ0A 4ILZA 5CNCA 1Y5KB 4AVEA 2QRWA 1YDZB 1VXGA 2DXMA 2QFKA 5JGGB 1XQ5A 4NI1B 3FS4A 5SW7B 4MPMA 2PGHB 4O1TA 1ECOA 1LJWA 1BUWB 5HU6B 1WVPA 1NQPB 1TESA 2O58X 2D2NC 1IBEA 3GOUB 1IT2A 1OUUA 4QAUA 1G09B 1A9WA 1Y7GA 1BVCA 3UHGA 1Y0TB 4O35A 1C7CB 1A3NB 1J7SB 1A4FB 1HSYA 1HV4B 2HBFB 1J7WA 1O1IA 1N9IA 3WCVA 1VWTB 2FRKX 3AT6B 2GDMA 1MOHA 1UC3A 1XZUA 1MLGA 5C6YA 3MKBA 5AB8A 1O1JA 3WR1A 3AQ6A 1MNKA 2MYDA 2HBFA 1Y01B 2MHBA 2V1HA 1C7BA 3HF4A 2EKUA 4HSWA 1MOCA 1DUOA 2FRJX 3VRGA 4IROA 3ZJMA 2IN4A 3OK5A 4O4TA 3GDJA 3E55A 2R50A 3LB2A 1YFFA 2LH5A 3QM9A 3HYUB 2LH1A 1VXFA 3D17A 1Y4GB 6HBWA 3TM9A 1Y2ZB 3ZJHA 1GBUA 1RPSB 2HHDB 2ZFOB 4DC7A 5AZRA 1S5YA 1YMAA 1N9FA 5C6EA 2W72B 1MLFA 2SPOA 3P5QB 3UH7A 1MYMA 3UHYA 4H2LB 4NI0A 2HZ3A 1S5XA 1IDRA 3S1JA 1C40A 1Y7CB 2SPNA 1G08A 3NMMA 1RQ3A 1NAZA 1MBIA 1Y0AB 4MQCB 2W6YA 1Y5JA 3S65A 1G0AB 1YGDB 2AV0A 3D1AB 1Y8HB 2O5MX 3HXNB 3QZXA 1GCWB 1BZ0B 2D2MA 3S1IA 1LFYA 1X46A 1Y7ZB 4WJG1 1YIEA 5E6EB 1NIHB 1MBAA 4ZVAA 1YVQB 2AUPA 1V4UB 3EU1A 3WFXA 1JP9A 4B4YA 1OJ6A 1YENB 4F6JA 2G14A 2ZS0C 4F6BA 1G08B 2ZSNA 2MBWA 1PBXB 1URYA 3PI1A 1XXTA 1B86A 1UVYA 1NS9A 1ABYA 2AA1A 1YOHA 1MLNA 2H8DA 111MA 3S66B 3DR9A 3CY5B 3G4RA 1GCVB 1LHSA 1YIEB 2ZS1B 4HRTB 5E6EA 3QJEA 2GTLC 1A00A 3E5IA 3AT5B 1EWAA 1VHBA 2ZSPA 3KMFA 2MGDA 4MQJA 1Y2ZA 3BJ3B 1Y8WA 2W31A 3QJDA 1BZZB 2FRIX 1O1OA 1HBBA 1HBRA 3GKTA 1O16A 1CH1A 1HDBB 3G53A 1CLSB 4FC3B 4U8UA 3UHQA 1C40B 1S6AA 2WTGA 1QSHA 1RQAB 1LA6A 2HBCB 3GLNA 4MXKA 1LH7A 3NG6B 1ASHA 2DN1B 3HEPA 1HRMA 3MOUA 1FN3A 1XY0A 1AJGA 3UHDA 4XS0A 1CH9A 3D1KB 1MTIA 5F2AA 4HRRB 3ONZB 3ZJQA 2D2NA 2ZSTA 2MGGA 4G51A 1YE0A 1ABWB 1Y7DA 2D2MC 2XKHA 1LA6B 2HBCA 1CG8A 2V1KA 1J3ZB 1JF4A 2QU0A 2D60A 1XXTB 4MBAA 3UHWA 1OFKA 1C7CA 1Y5FB 1OBMA 1X3KA 1YEOB 1IRDB 1YGFA 3QQRA 1SDKA 2G0ZA 1G0BB 1Y85B 1C7BB 3WFTA 1V75B 1Y0WB 2O5SX 1O1JB 1MZ0A 1GZXB 3MYMA 4BJAA 3WCWA 1YHUB 3PI8A 1NS9B 3ASEA 1XZ5A 1Y35B 4HSXA 2CMMA 2GRZA 1AJHA 1HGBB 1CIOA 2DN1A 3W4UB 5C6EB 2ZFOD 1SI4A 2HBSB 1HHOB 4MQIB 1MODA 2MB5A 1KR7A 3VHBA 2ZT4A 1NZ5A 3WCWD 1MNIA 4TYXA 5KDQA 3ZJOA 103MA 1LFLA 3QM5A 1YVTA 1V5HA 2HBEB 2V1IA 3WTGA 4UIQA 1Y7ZA 1LFTA 4MBNA 1YE0B 3NL7A 2MYCA 5CNFA 1LH5A 2W6VB 3S65B 2OHBA 4ROLA 3KMFC 1MYFA 2GNWA 4M4AB 1KD2A 3VRFA 1GDLA 4FWXA 5CHQA 1G9VB 1YEQA 1JZMA 1A01A 2G11A 2HBDB 1M6MA 3ARKA 2QSSA 3QMAA 2AA1B 1THBA 1Y8IB 4U8UD 3IC2A 1Y22A 1Y4RA 2Z6SA 2V1EA 1MBOA 3AT6A 4OF9A 1YHEA 1VWTA 3ECLA 1V07A 1BIJB 2OLPA 3UHSA 1U7RA 1MYGA 4F6IA 2D5XA 3R0GA 4JACA 4H0BA 1JL6A 4MQKA 1CH4A 1LTWA 2R4YA 3AG0A 2ZLXB 1A6MA 3KUOA 1YEQB 3ZH0A 1Y83A 3E4NA 3MJUA 2DN3A 1PBXA 3EU1B 1UMOA 1YE2A 2MGBA 1NS6B 1Y4VB 1HCOA 2PEGB 1HLBA 1Y46A 1LFZB 1O1PA 2ZLWB 2LH6A 2M6ZB 2GTLB 1JEBA 4YU4A 1R1XA 4FH6A 4NI0B 4FC3A 4U8UB 3H58A 1B0BA 3ODQA 1FDHA 1BBBB 1RVWA 5CN4A 1QI8B 2R4WA 1R1YA 3UHNA 1JF3A 4N7NA 1A6NA 5M3SA 1J41A 1GLIB 1X9FD 3QM6A 4XDIA 1UFPA 1Y4PA 2ZT2A 1G9VA 3UHIA 2R80A 3OO5B 1DO1A 3ECZA 3V2ZA 1MLHA 3WCUD 3MJPB 3D1KA 4NS2A 5JDOE 3K9ZA 4MU5A 1COHB 1K1KA 3DUTB 1FSXA 1HGBA 2NSRA 4X0LB 3O7NA 3EOKB 3WHMA 4ESAB 2ZSXA 2O5LX 4KMVA 2D5XB 2AUOA 4WJGA 1J41B 1GLIA 5ILPA 2ZLTA 3MBAA 5HY8B 1XZUB 3A2GA 3WCVB 1G0BA 2XKIA 1D8UA 2H8DB 2G12A 1DKEB 1LFVB 2MGLA 1YG5A 3WCTA 1O1NB 1MLKA 4OODA 3NMLA 3BA2A 3D4XA 1SPGB 1Y8KA 1QXEA 1V75A 1FDHG 3OZVA 3OJ1A 2BLHA 2QMBA 1HBBB 1HACA 3NMMB 2MGJA 5CNGA 1YEOA 1LFZA 1BZPA 2WY4A 1J52A 1EW6A 3LB1A 1A9WE 1MBDA 4B3WA 1BIJA 4F4OB 1DXTA 3GQGB 3GKVA 3DHTB 5HAVA 1M9PA 1ABSA 4DC8A 108MA 1YG5B 106MA 3OVUC 3BCQA 3WFWA 1YVQA 1YEVA 3A59A 3H57A 1DLYA 2Z85A 2JHOA 3ARJA 2HBEA 1JP6A 3RGKA 2GKNA 3M39A 1Y4FB 1FSXB 1CH2A 3FH9A 4H2LA 2RAOA 1NZ3A 4HRRA 4VHBA 2ZLUB 1ITHA 3MVCA 4FH7A 2Z6NB 1IRCA 2OH8A 1J3FA 1NIHA 1YHRA 2HBGA 1GDIA 1LFLB 1ABWA 1N9XA 3GQRB 1Y4QA 2GKMA 1NPFA 1HABB 3ZOMA 2VLYA 1S0HB 3AT5A 1JWNA 4MXLA 2MGFA 2PGHA 1HJTA 3MKBB 1NWNA 4M4BB 1HDSB 1Y31B 3IC0B 3PI2A 4MQGB 4U8UC 1CG5A 4PQCA 1Y83B 1YDZA 2NX0A 4KMWA 2QFNA 2VYYA 4SDHA 2D5ZB 1CG8B 1UX8A 5F0BA 1XZ7A 1Y45A 2GRHA 4LPIA 1LHTA 1Y0DB 2FRFA 4GZGA 1MLMA 1UIWB 3WCUB 1HCOB 1WMUB 2MHBB 1Y46B 1MWDA 3A9MA 4WCHD 3OGBA 1HGCB 1NGKA 1MOBA 4G1BA 1FAWA 2BLJM 3S66A 1CBMA 3WCWC 4ODCA 2SPMA 2GTLA 5HLQA 3HRWB 1YE2B 4MQKB 2GNVA 5JDOD 2NRMA 1HBSA 1BZ6A 2M6ZA 2ZFOC 1FAWB 2B7HB 3WCTB 3QZZA 3UBCA 4TWUA 1VXHA 1Y8KB 1MWCA 1U7SA 3P5QA 5EU2A 2LHBA 2ZSQA 3PELB 2W6XA 5CNDA 3VREA 4UURA 1MYTA 2H8FB 2HZ2A 2D6CA 3EOKA 3WHMB 1O1LA 3PIAA 1YVTB 3NG6A 1Y0CA 2ZT3A 1JW8A 1CQ2A 1SWMA 1Y0AA 1F65A 3A5GA 2MYAA 1FSLA 2QSPA 1K1KB 3VRFB 1A3NA 2ZLVB 2MYEA 3LQDB 3A0GA 1GCWA 5CN8A 3VRGB 1V4XB 1Y4QB 3FH9B 2QSSB 2G0SA 1BABA 1YEUB 1QPWB 1CO9A 3CIUB 5CNEA 1MYIA 2HCOA 1YFFB 1HBGA 1GDJA 1ECDA 3WI8A 101MA 1YMBA 2LH2A 1MBNA 5MBAA 2O5QX 1VRFA 2BLIA 1RPSA 1XZVB 4DWTA 4L2MA 109MA 3M38A 1MKOA 1JEBB 4YU4B 1VXAA 2GRFA 1BJEA 2BMMA 1HGAB 1NEJA 3AQ5A 1DO4A 1MYJA 1V4WA 3DHTA 1MLSA 3OZUA 2ZS0D 2OIFA 1Y8WB 2C0KA 4O4ZA 2DN2B 5CN7A 3D7OA 2LH3A 1Y4VA 3QQQA 4MQHB 3PI3A 5E83B 3E5OA 2VHBA 3A5AA 1Y5JB 5ILEA 2Z6NA 1A0ZA 1H97A 1XZ2A 5E29B 1ABYB 2ZS0A 1THBB 1Y7CA 1S69A 2V1GA 1O1MA 3GQPB 1OUUB 1IBEB 1HBHA 4ROMA 3UHTA 3HENA 4M4AA 1I3DA 2VYZA 2ZSYA 3K3UA 3K8BB 3FS4B 1URVA 4F6DA 1XYEB 5CHRA 3PT8A 1HDSA 3O89A 4DWUA 2FALA 1COHA 104MA 1N9HA 2G0RA 2RAOB 1SDLA 5EOHA 1EMYA 3ORDA 1KD2B 1YGDA 1SPEA 1YOIA 5HU6A 1MOAA 1V9QA 1OR4A 1DXDA 4X0LA 1RQ3B 3ZJLA 3RJ6A 1LH3A 1WMUA 4YU3A 1A4FA 1HV4A 1QSIB 1LH2A 3BJ3A 1B86B 2HHEA 3BJ2A 3WCTC 1A0UA 1G09A 1A00B 3PT7A 1YMCA 2ZS1D 2BNLA 4ODCB 5AZQA 2ZT1A 2H35B 2ZFBB 1HGCA 2ZS1C 4JYQA 5ILRA 1YEUA 4PQ6A 1MLRA 2E2YA 2XYKA 1MTKA 5EETA 1DXVA 1BZ1B 1YIHA 2ZT0A 4IROB 2VRYA 1SHRB 3GYSB 4HHBB 3RJNB 1MLOA 5EYSA 3V2VA 1Y4BB 4NI1A 4N7OB 1DWRA 3G4YA 4UZVA 2ZS0B 3HEOA 1XZ4A 3ED9A 1DTMA 1OR6A 5EV5A 1NQPA 1XZ5B 3PIAB 4FWYA 2IG3A 4N7PA 1YOGA 6HBIA 3WR1B 3LHBA 3BOMB 2VEBA 5JDOC 5MBNA 1NEJB 1Y0TA 1MBCA 5JOMA 1V4UA 2MGMA 1O1IB 1IT3A 1DXCA 3M3BA 2ZWJA 1J7YB 3MYNA 2MGHA 1LH1A 1J3YB 3GOUA 2RI4B 1XCHA 3WCVD 3UGZA 2QLSB 1FN3B 2ZLVA 2QMBB 1CMYA 3UGYA 1XYEA 2MGIA 1HABA 1O1NA 2D60B 4IT8A 1X9FC 3GKVB 2VYWA 2W6VA 1JY7A 2D2ND 2MGCA 1Y35A 2Z8AA 1O1KA 1BABB 1YZIA 1HDAB 1SI4B 2HBSA 4TWVA 3A5BA 110MA 4MQJB 1LFQA 1DXUA 1QXDB 2EB9A 3QJEB 3QJBA 1SPGA 2EF2A 3GQGA 3W4UA 2DC3A 3R5IB 1Y0WA 1L2KA 1GBVA 3UHKA 3ZHWA 1MNOA 2ZLWA 2GLNA 3EDAA 2R1HB 2V1JA 3B75A 4O2GA 1SDKB 2W6WA 1GBUB 2HHDA 1MBSA 1HBAB 1DM1A 3WCWB 1MDNA 4H07A 3VAUA 2WTHA 5D5RA 4ROLB 4PQBA 3EDBA 4L7YB 1BVDA 1GCVA 3VREB 1S56A 3NL7B 1Y5KA 1S0HA 4C0NA 1FLPA 3PI9A 3D1AA 1M6CA 5KDQB 3R5IA 2D2NB 1W92A 3GQPA 3UH3A 2ZSSA 3G4WA 4MQIA 3M3AA 1DLWA 1K0YB 1RQ4B 3WCUA 1CPWA 1DTIA 2ZLUA 3ZJSA 3HC9A 2BK9A 3IC2B 3UHHA 2R80B 3OO5A 2G10A 1HLMA 1CIKA 3AQ8A 3UHEA 1PMBA 3G52A 3PT7B 2SPLA 1YHRB 2YRSB 5HLXA 3DUTA 1R1YB 4G51B 1CQXA 1Y45B 2HCOB 3BJ1B 1MNJA 3G46A 1JDOA 2Z6TA 1OFJA 1RTEA 2EB8A 2MGKA 1EBTA 1J3ZA 1OUTB 1JY7B 1GVHA 1HDBA 5EYJA 2D5ZA 3CIUA 3WCPB 1JZLA 3QJCA 1BZ1A 2O5BX 1CG5B 3LB3A 3SDNA 2PEGA 4NZIA 5HY8A 4N8TA 2GL3A 5B85A 4AVDA 1HBAA 3OZWA 5EQMA 2DN3B 2EVPA 3AQ7A 1YHUA 3ODQB 3ONZA 3ZJIA 3HF4B 3A0GB 1VREA 1O1MB 1NS6A 4MAXA 4F6GA 2MGEA 1IOPA 1VXDA 4N7PB 2VLXA 3LB4A 2QU0B 1SHRA 1YHUD 3GYSA 1J40B 1T1NB 2BWHA 3BOMA 2HBDA 1Z8UB 3UHBA 4F4OA 1QI8A 5CN6A 1X9FB 3BCQB 1J7YA 2FAMA 2DHBA 1Y8HA 1NWIA 1AZIA 5EUIB 5B84A 1XQ5B 2HZ1A 3SDHA 1G0AA 2AURA 4L7YA 3DHRB 1MCYA 4NK2A 1LFYB 1LJWB 5IKSA 1ECNA 3WCUC 2MGAA 1MYZA 5SW7A 1DKEA 3LR7A 3SZKB 5KERB 1YH9A 1A3OB 4ESAA 1A01B 1A0UB 1IWHB 102MA 1QXEB 1Y09A 3HXNA 4YU3B 2ZLTB 3MJPA 1MLJA 3G4UA 1JPBA 3UHUA 1Y8IA 3ZJJA 1YZIB 2LH7A 1CMYB 2V1FA 3IA3B 3OO4A 4NK1A 3KUNA 3UHZA 1O1KB 1DXVB 1O1PB 3UHXA 3PI4A 4M4BA 5D1VA 4HBIA 5CN9A 1V4WB 4FWZA 1NPGA 1MTJA 3S48C 4KN3A 2H35A 2ZFBA 3UH6A 1LH6A 1F5OA 1DXTB 2NRLA 1YIHB 6HBWB 1MLLA 1HBRB 3WCPA 105MA 2R1HA 3UHRA 1S61A 5EE4C 3PI9B 2G3HA 2ZFOA 3WTGB 1CH5A 2O5TX 2HHBA 2GTLD 3GDJB 1SDLB 3WCTD 2W72C 1MGNA 5EE4D 1BZRA 1Y4BA 1F5PA 1UFJA 5CN5A 1UT0A 1XY0B 2R4ZA 3K8BA 3A59B 3HHBA 1JZKA 3B75B 2ZSRA 2AV3A 3ZJRA 1A3OA 1GDKA 3HRWA 5CMVA 1HBIA 2OH9A 1BUWA 3ZOLA 2BKMA 1YCBA 2ZLXA 2YRSA 1Y22B 1Y4RB 2QLSA 5JGGA 112MA 3SZKA 1J40A 1T1NA 3G4VA 4F6FA 2RI4A 1JP8A 1YH9B 2VEEA 1J3YA 1RTXA 4KJTA 1OUTA 1RQAA 1QSIA 1Y5FA 5EUIA 3UHVA 3QM8A 1DXUB 2EKTA 1EBCA 1VXBA 1WLAA 1CP0A 1J7WB 1J7SA 3D4XB 1GBVB 1CH3A 1VXEA 3OO4B 1I3EA 107MA 2EVKA 4MQGA 1QPWA 3BJ2B 5ILMA 1LUEA 3QJBB 1GZXA 3ARLA 1HGAA 1QXDA 1Y31A 3IC0A 4C44A 1AJ9A 1S5YB 1NXFA 1YCAA 3TM3A 2VM0A 2DN2A 1BZZA 4N7NB 1Y0CB 1S5XB 4NXCA 1YHUC 1AJ9B 1MWBA 3IXFA 1QSHB 3D17B 2AUQA 1CH7A 1Y4GA 1O1LB 1C7DA 1UVXA 1M9PB 1R1XB 4N8TB 2W72A 1XZ2B 5E29A 1CLSA 3PELA 3ZJNA 1Y4PB 1Y4FA 2BW9M 1LFTB 3QM7A 1MYHA 3U3EA 4HHBA 1X9FA 5KERA 5CNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HBH B;  3GQR A;  2B7H A;  1DWS A;  1XZ4 B;  1Y7G B;  1HBS B;  3LR9 A;  3ZJP A;  4F69 A;  3LQD A;  1YEV B;  4ZVB A;  3NFE B;  3UHC A;  4PNJ A;  3BJ1 A;  5KKK A;  2QSP B;  3G4Q A;  4MQC A;  1K0Y A;  1RQ4 A;  2R4X A;  1A6G A;  4XS0 B;  5E83 A;  1HDA A;  1FHJ A;  2DXM B;  1Y09 B;  3HHB B;  1Y7D B;  2D2M B;  5HLU A;  1Y0D A;  1IWH A;  1VXC A;  1FCS A;  3DHR A;  3GK9 A;  3ECX A;  1UIW A;  3UI0 A;  2XKG A;  3TLD A;  1MLQ A;  1DO7 A;  1DWT A;  1F63 A;  5HBI A;  1CP5 A;  2DHB B;  1IRD A;  1YGF B;  1ECA A;  1Q1F A;  1YEN A;  1DUK A;  3AQ9 A;  1Y85 A;  3MN0 A;  3NFE A;  1MKO B;  1NZ2 A;  1XZ7 B;  1YHE B;  3MJU B;  3QJC B;  3D7O B;  1XZV A;  2OHA A;  2NSS A;  1RSE A;  2HHB B;  1LFV A;  1FHJ B;  1HAC B;  1TU9 A;  4G1V A;  2G0V A;  2ZS1 A;  2ZSO A;  4HRT A;  4MQH A;  1C7D B;  1LFQ B;  7HBI A;  2HHE B;  2MYB A;  3UBV A;  1JL7 A;  3PI8 B;  3QJD B;  4ROM B;  1H1X A;  2O5O X;  1CO8 A;  2VLZ A;  3HYU A;  2D2M D;  2H8F A;  2ZSZ A;  1DO3 A;  1MLU A;  3WFU A;  3WCV C;  1HHO A;  3PT8 B;  1BIN A;  1CBL A;  3UH5 A;  5JDO F;  4N7O A;  3CY5 A;  1GJN A;  1A0Z B;  1BBB A;  1RVW B;  1UX9 A;  1O1O B;  4NXA A;  1KFR A;  1NZ4 A;  2KSC A;  1A6K A;  2G0X A;  4F68 A;  1MNH A;  1V4X A;  1BZ0 A;  4ILZ A;  5CNC A;  1Y5K B;  4AVE A;  2QRW A;  1YDZ B;  1VXG A;  2DXM A;  2QFK A;  5JGG B;  1XQ5 A;  4NI1 B;  3FS4 A;  5SW7 B;  4MPM A;  2PGH B;  4O1T A;  1ECO A;  1LJW A;  1BUW B;  5HU6 B;  1WVP A;  1NQP B;  1TES A;  2O58 X;  2D2N C;  1IBE A;  3GOU B;  1IT2 A;  1OUU A;  4QAU A;  1G09 B;  1A9W A;  1Y7G A;  1BVC A;  3UHG A;  1Y0T B;  4O35 A;  1C7C B;  1A3N B;  1J7S B;  1A4F B;  1HSY A;  1HV4 B;  2HBF B;  1J7W A;  1O1I A;  1N9I A;  3WCV A;  1VWT B;  2FRK X;  3AT6 B;  2GDM A;  1MOH A;  1UC3 A;  1XZU A;  1MLG A;  5C6Y A;  3MKB A;  5AB8 A;  1O1J A;  3WR1 A;  3AQ6 A;  1MNK A;  2MYD A;  2HBF A;  1Y01 B;  2MHB A;  2V1H A;  1C7B A;  3HF4 A;  2EKU A;  4HSW A;  1MOC A;  1DUO A;  2FRJ X;  3VRG A;  4IRO A;  3ZJM A;  2IN4 A;  3OK5 A;  4O4T A;  3GDJ A;  3E55 A;  2R50 A;  3LB2 A;  1YFF A;  2LH5 A;  3QM9 A;  3HYU B;  2LH1 A;  1VXF A;  3D17 A;  1Y4G B;  6HBW A;  3TM9 A;  1Y2Z B;  3ZJH A;  1GBU A;  1RPS B;  2HHD B;  2ZFO B;  4DC7 A;  5AZR A;  1S5Y A;  1YMA A;  1N9F A;  5C6E A;  2W72 B;  1MLF A;  2SPO A;  3P5Q B;  3UH7 A;  1MYM A;  3UHY A;  4H2L B;  4NI0 A;  2HZ3 A;  1S5X A;  1IDR A;  3S1J A;  1C40 A;  1Y7C B;  2SPN A;  1G08 A;  3NMM A;  1RQ3 A;  1NAZ A;  1MBI A;  1Y0A B;  4MQC B;  2W6Y A;  1Y5J A;  3S65 A;  1G0A B;  1YGD B;  2AV0 A;  3D1A B;  1Y8H B;  2O5M X;  3HXN B;  3QZX A;  1GCW B;  1BZ0 B;  2D2M A;  3S1I A;  1LFY A;  1X46 A;  1Y7Z B;  4WJG 1;  1YIE A;  5E6E B;  1NIH B;  1MBA A;  4ZVA A;  1YVQ B;  2AUP A;  1V4U B;  3EU1 A;  3WFX A;  1JP9 A;  4B4Y A;  1OJ6 A;  1YEN B;  4F6J A;  2G14 A;  2ZS0 C;  4F6B A;  1G08 B;  2ZSN A;  2MBW A;  1PBX B;  1URY A;  3PI1 A;  1XXT A;  1B86 A;  1UVY A;  1NS9 A;  1ABY A;  2AA1 A;  1YOH A;  1MLN A;  2H8D A;  111M A;  3S66 B;  3DR9 A;  3CY5 B;  3G4R A;  1GCV B;  1LHS A;  1YIE B;  2ZS1 B;  4HRT B;  5E6E A;  3QJE A;  2GTL C;  1A00 A;  3E5I A;  3AT5 B;  1EWA A;  1VHB A;  2ZSP A;  3KMF A;  2MGD A;  4MQJ A;  1Y2Z A;  3BJ3 B;  1Y8W A;  2W31 A;  3QJD A;  1BZZ B;  2FRI X;  1O1O A;  1HBB A;  1HBR A;  3GKT A;  1O16 A;  1CH1 A;  1HDB B;  3G53 A;  1CLS B;  4FC3 B;  4U8U A;  3UHQ A;  1C40 B;  1S6A A;  2WTG A;  1QSH A;  1RQA B;  1LA6 A;  2HBC B;  3GLN A;  4MXK A;  1LH7 A;  3NG6 B;  1ASH A;  2DN1 B;  3HEP A;  1HRM A;  3MOU A;  1FN3 A;  1XY0 A;  1AJG A;  3UHD A;  4XS0 A;  1CH9 A;  3D1K B;  1MTI A;  5F2A A;  4HRR B;  3ONZ B;  3ZJQ A;  2D2N A;  2ZST A;  2MGG A;  4G51 A;  1YE0 A;  1ABW B;  1Y7D A;  2D2M C;  2XKH A;  1LA6 B;  2HBC A;  1CG8 A;  2V1K A;  1J3Z B;  1JF4 A;  2QU0 A;  2D60 A;  1XXT B;  4MBA A;  3UHW A;  1OFK A;  1C7C A;  1Y5F B;  1OBM A;  1X3K A;  1YEO B;  1IRD B;  1YGF A;  3QQR A;  1SDK A;  2G0Z A;  1G0B B;  1Y85 B;  1C7B B;  3WFT A;  1V75 B;  1Y0W B;  2O5S X;  1O1J B;  1MZ0 A;  1GZX B;  3MYM A;  4BJA A;  3WCW A;  1YHU B;  3PI8 A;  1NS9 B;  3ASE A;  1XZ5 A;  1Y35 B;  4HSX A;  2CMM A;  2GRZ A;  1AJH A;  1HGB B;  1CIO A;  2DN1 A;  3W4U B;  5C6E B;  2ZFO D;  1SI4 A;  2HBS B;  1HHO B;  4MQI B;  1MOD A;  2MB5 A;  1KR7 A;  3VHB A;  2ZT4 A;  1NZ5 A;  3WCW D;  1MNI A;  4TYX A;  5KDQ A;  3ZJO A;  103M A;  1LFL A;  3QM5 A;  1YVT A;  1V5H A;  2HBE B;  2V1I A;  3WTG A;  4UIQ A;  1Y7Z A;  1LFT A;  4MBN A;  1YE0 B;  3NL7 A;  2MYC A;  5CNF A;  1LH5 A;  2W6V B;  3S65 B;  2OHB A;  4ROL A;  3KMF C;  1MYF A;  2GNW A;  4M4A B;  1KD2 A;  3VRF A;  1GDL A;  4FWX A;  5CHQ A;  1G9V B;  1YEQ A;  1JZM A;  1A01 A;  2G11 A;  2HBD B;  1M6M A;  3ARK A;  2QSS A;  3QMA A;  2AA1 B;  1THB A;  1Y8I B;  4U8U D;  3IC2 A;  1Y22 A;  1Y4R A;  2Z6S A;  2V1E A;  1MBO A;  3AT6 A;  4OF9 A;  1YHE A;  1VWT A;  3ECL A;  1V07 A;  1BIJ B;  2OLP A;  3UHS A;  1U7R A;  1MYG A;  4F6I A;  2D5X A;  3R0G A;  4JAC A;  4H0B A;  1JL6 A;  4MQK A;  1CH4 A;  1LTW A;  2R4Y A;  3AG0 A;  2ZLX B;  1A6M A;  3KUO A;  1YEQ B;  3ZH0 A;  1Y83 A;  3E4N A;  3MJU A;  2DN3 A;  1PBX A;  3EU1 B;  1UMO A;  1YE2 A;  2MGB A;  1NS6 B;  1Y4V B;  1HCO A;  2PEG B;  1HLB A;  1Y46 A;  1LFZ B;  1O1P A;  2ZLW B;  2LH6 A;  2M6Z B;  2GTL B;  1JEB A;  4YU4 A;  1R1X A;  4FH6 A;  4NI0 B;  4FC3 A;  4U8U B;  3H58 A;  1B0B A;  3ODQ A;  1FDH A;  1BBB B;  1RVW A;  5CN4 A;  1QI8 B;  2R4W A;  1R1Y A;  3UHN A;  1JF3 A;  4N7N A;  1A6N A;  5M3S A;  1J41 A;  1GLI B;  1X9F D;  3QM6 A;  4XDI A;  1UFP A;  1Y4P A;  2ZT2 A;  1G9V A;  3UHI A;  2R80 A;  3OO5 B;  1DO1 A;  3ECZ A;  3V2Z A;  1MLH A;  3WCU D;  3MJP B;  3D1K A;  4NS2 A;  5JDO E;  3K9Z A;  4MU5 A;  1COH B;  1K1K A;  3DUT B;  1FSX A;  1HGB A;  2NSR A;  4X0L B;  3O7N A;  3EOK B;  3WHM A;  4ESA B;  2ZSX A;  2O5L X;  4KMV A;  2D5X B;  2AUO A;  4WJG A;  1J41 B;  1GLI A;  5ILP A;  2ZLT A;  3MBA A;  5HY8 B;  1XZU B;  3A2G A;  3WCV B;  1G0B A;  2XKI A;  1D8U A;  2H8D B;  2G12 A;  1DKE B;  1LFV B;  2MGL A;  1YG5 A;  3WCT A;  1O1N B;  1MLK A;  4OOD A;  3NML A;  3BA2 A;  3D4X A;  1SPG B;  1Y8K A;  1QXE A;  1V75 A;  1FDH G;  3OZV A;  3OJ1 A;  2BLH A;  2QMB A;  1HBB B;  1HAC A;  3NMM B;  2MGJ A;  5CNG A;  1YEO A;  1LFZ A;  1BZP A;  2WY4 A;  1J52 A;  1EW6 A;  3LB1 A;  1A9W E;  1MBD A;  4B3W A;  1BIJ A;  4F4O B;  1DXT A;  3GQG B;  3GKV A;  3DHT B;  5HAV A;  1M9P A;  1ABS A;  4DC8 A;  108M A;  1YG5 B;  106M A;  3OVU C;  3BCQ A;  3WFW A;  1YVQ A;  1YEV A;  3A59 A;  3H57 A;  1DLY A;  2Z85 A;  2JHO A;  3ARJ A;  2HBE A;  1JP6 A;  3RGK A;  2GKN A;  3M39 A;  1Y4F B;  1FSX B;  1CH2 A;  3FH9 A;  4H2L A;  2RAO A;  1NZ3 A;  4HRR A;  4VHB A;  2ZLU B;  1ITH A;  3MVC A;  4FH7 A;  2Z6N B;  1IRC A;  2OH8 A;  1J3F A;  1NIH A;  1YHR A;  2HBG A;  1GDI A;  1LFL B;  1ABW A;  1N9X A;  3GQR B;  1Y4Q A;  2GKM A;  1NPF A;  1HAB B;  3ZOM A;  2VLY A;  1S0H B;  3AT5 A;  1JWN A;  4MXL A;  2MGF A;  2PGH A;  1HJT A;  3MKB B;  1NWN A;  4M4B B;  1HDS B;  1Y31 B;  3IC0 B;  3PI2 A;  4MQG B;  4U8U C;  1CG5 A;  4PQC A;  1Y83 B;  1YDZ A;  2NX0 A;  4KMW A;  2QFN A;  2VYY A;  4SDH A;  2D5Z B;  1CG8 B;  1UX8 A;  5F0B A;  1XZ7 A;  1Y45 A;  2GRH A;  4LPI A;  1LHT A;  1Y0D B;  2FRF A;  4GZG A;  1MLM A;  1UIW B;  3WCU B;  1HCO B;  1WMU B;  2MHB B;  1Y46 B;  1MWD A;  3A9M A;  4WCH D;  3OGB A;  1HGC B;  1NGK A;  1MOB A;  4G1B A;  1FAW A;  2BLJ M;  3S66 A;  1CBM A;  3WCW C;  4ODC A;  2SPM A;  2GTL A;  5HLQ A;  3HRW B;  1YE2 B;  4MQK B;  2GNV A;  5JDO D;  2NRM A;  1HBS A;  1BZ6 A;  2M6Z A;  2ZFO C;  1FAW B;  2B7H B;  3WCT B;  3QZZ A;  3UBC A;  4TWU A;  1VXH A;  1Y8K B;  1MWC A;  1U7S A;  3P5Q A;  5EU2 A;  2LHB A;  2ZSQ A;  3PEL B;  2W6X A;  5CND A;  3VRE A;  4UUR A;  1MYT A;  2H8F B;  2HZ2 A;  2D6C A;  3EOK A;  3WHM B;  1O1L A;  3PIA A;  1YVT B;  3NG6 A;  1Y0C A;  2ZT3 A;  1JW8 A;  1CQ2 A;  1SWM A;  1Y0A A;  1F65 A;  3A5G A;  2MYA A;  1FSL A;  2QSP A;  1K1K B;  3VRF B;  1A3N A;  2ZLV B;  2MYE A;  3LQD B;  3A0G A;  1GCW A;  5CN8 A;  3VRG B;  1V4X B;  1Y4Q B;  3FH9 B;  2QSS B;  2G0S A;  1BAB A;  1YEU B;  1QPW B;  1CO9 A;  3CIU B;  5CNE A;  1MYI A;  2HCO A;  1YFF B;  1HBG A;  1GDJ A;  1ECD A;  3WI8 A;  101M A;  1YMB A;  2LH2 A;  1MBN A;  5MBA A;  2O5Q X;  1VRF A;  2BLI A;  1RPS A;  1XZV B;  4DWT A;  4L2M A;  109M A;  3M38 A;  1MKO A;  1JEB B;  4YU4 B;  1VXA A;  2GRF A;  1BJE A;  2BMM A;  1HGA B;  1NEJ A;  3AQ5 A;  1DO4 A;  1MYJ A;  1V4W A;  3DHT A;  1MLS A;  3OZU A;  2ZS0 D;  2OIF A;  1Y8W B;  2C0K A;  4O4Z A;  2DN2 B;  5CN7 A;  3D7O A;  2LH3 A;  1Y4V A;  3QQQ A;  4MQH B;  3PI3 A;  5E83 B;  3E5O A;  2VHB A;  3A5A A;  1Y5J B;  5ILE A;  2Z6N A;  1A0Z A;  1H97 A;  1XZ2 A;  5E29 B;  1ABY B;  2ZS0 A;  1THB B;  1Y7C A;  1S69 A;  2V1G A;  1O1M A;  3GQP B;  1OUU B;  1IBE B;  1HBH A;  4ROM A;  3UHT A;  3HEN A;  4M4A A;  1I3D A;  2VYZ A;  2ZSY A;  3K3U A;  3K8B B;  3FS4 B;  1URV A;  4F6D A;  1XYE B;  5CHR A;  3PT8 A;  1HDS A;  3O89 A;  4DWU A;  2FAL A;  1COH A;  104M A;  1N9H A;  2G0R A;  2RAO B;  1SDL A;  5EOH A;  1EMY A;  3ORD A;  1KD2 B;  1YGD A;  1SPE A;  1YOI A;  5HU6 A;  1MOA A;  1V9Q A;  1OR4 A;  1DXD A;  4X0L A;  1RQ3 B;  3ZJL A;  3RJ6 A;  1LH3 A;  1WMU A;  4YU3 A;  1A4F A;  1HV4 A;  1QSI B;  1LH2 A;  3BJ3 A;  1B86 B;  2HHE A;  3BJ2 A;  3WCT C;  1A0U A;  1G09 A;  1A00 B;  3PT7 A;  1YMC A;  2ZS1 D;  2BNL A;  4ODC B;  5AZQ A;  2ZT1 A;  2H35 B;  2ZFB B;  1HGC A;  2ZS1 C;  4JYQ A;  5ILR A;  1YEU A;  4PQ6 A;  1MLR A;  2E2Y A;  2XYK A;  1MTK A;  5EET A;  1DXV A;  1BZ1 B;  1YIH A;  2ZT0 A;  4IRO B;  2VRY A;  1SHR B;  3GYS B;  4HHB B;  3RJN B;  1MLO A;  5EYS A;  3V2V A;  1Y4B B;  4NI1 A;  4N7O B;  1DWR A;  3G4Y A;  4UZV A;  2ZS0 B;  3HEO A;  1XZ4 A;  3ED9 A;  1DTM A;  1OR6 A;  5EV5 A;  1NQP A;  1XZ5 B;  3PIA B;  4FWY A;  2IG3 A;  4N7P A;  1YOG A;  6HBI A;  3WR1 B;  3LHB A;  3BOM B;  2VEB A;  5JDO C;  5MBN A;  1NEJ B;  1Y0T A;  1MBC A;  5JOM A;  1V4U A;  2MGM A;  1O1I B;  1IT3 A;  1DXC A;  3M3B A;  2ZWJ A;  1J7Y B;  3MYN A;  2MGH A;  1LH1 A;  1J3Y B;  3GOU A;  2RI4 B;  1XCH A;  3WCV D;  3UGZ A;  2QLS B;  1FN3 B;  2ZLV A;  2QMB B;  1CMY A;  3UGY A;  1XYE A;  2MGI A;  1HAB A;  1O1N A;  2D60 B;  4IT8 A;  1X9F C;  3GKV B;  2VYW A;  2W6V A;  1JY7 A;  2D2N D;  2MGC A;  1Y35 A;  2Z8A A;  1O1K A;  1BAB B;  1YZI A;  1HDA B;  1SI4 B;  2HBS A;  4TWV A;  3A5B A;  110M A;  4MQJ B;  1LFQ A;  1DXU A;  1QXD B;  2EB9 A;  3QJE B;  3QJB A;  1SPG A;  2EF2 A;  3GQG A;  3W4U A;  2DC3 A;  3R5I B;  1Y0W A;  1L2K A;  1GBV A;  3UHK A;  3ZHW A;  1MNO A;  2ZLW A;  2GLN A;  3EDA A;  2R1H B;  2V1J A;  3B75 A;  4O2G A;  1SDK B;  2W6W A;  1GBU B;  2HHD A;  1MBS A;  1HBA B;  1DM1 A;  3WCW B;  1MDN A;  4H07 A;  3VAU A;  2WTH A;  5D5R A;  4ROL B;  4PQB A;  3EDB A;  4L7Y B;  1BVD A;  1GCV A;  3VRE B;  1S56 A;  3NL7 B;  1Y5K A;  1S0H A;  4C0N A;  1FLP A;  3PI9 A;  3D1A A;  1M6C A;  5KDQ B;  3R5I A;  2D2N B;  1W92 A;  3GQP A;  3UH3 A;  2ZSS A;  3G4W A;  4MQI A;  3M3A A;  1DLW A;  1K0Y B;  1RQ4 B;  3WCU A;  1CPW A;  1DTI A;  2ZLU A;  3ZJS A;  3HC9 A;  2BK9 A;  3IC2 B;  3UHH A;  2R80 B;  3OO5 A;  2G10 A;  1HLM A;  1CIK A;  3AQ8 A;  3UHE A;  1PMB A;  3G52 A;  3PT7 B;  2SPL A;  1YHR B;  2YRS B;  5HLX A;  3DUT A;  1R1Y B;  4G51 B;  1CQX A;  1Y45 B;  2HCO B;  3BJ1 B;  1MNJ A;  3G46 A;  1JDO A;  2Z6T A;  1OFJ A;  1RTE A;  2EB8 A;  2MGK A;  1EBT A;  1J3Z A;  1OUT B;  1JY7 B;  1GVH A;  1HDB A;  5EYJ A;  2D5Z A;  3CIU A;  3WCP B;  1JZL A;  3QJC A;  1BZ1 A;  2O5B X;  1CG5 B;  3LB3 A;  3SDN A;  2PEG A;  4NZI A;  5HY8 A;  4N8T A;  2GL3 A;  5B85 A;  4AVD A;  1HBA A;  3OZW A;  5EQM A;  2DN3 B;  2EVP A;  3AQ7 A;  1YHU A;  3ODQ B;  3ONZ A;  3ZJI A;  3HF4 B;  3A0G B;  1VRE A;  1O1M B;  1NS6 A;  4MAX A;  4F6G A;  2MGE A;  1IOP A;  1VXD A;  4N7P B;  2VLX A;  3LB4 A;  2QU0 B;  1SHR A;  1YHU D;  3GYS A;  1J40 B;  1T1N B;  2BWH A;  3BOM A;  2HBD A;  1Z8U B;  3UHB A;  4F4O A;  1QI8 A;  5CN6 A;  1X9F B;  3BCQ B;  1J7Y A;  2FAM A;  2DHB A;  1Y8H A;  1NWI A;  1AZI A;  5EUI B;  5B84 A;  1XQ5 B;  2HZ1 A;  3SDH A;  1G0A A;  2AUR A;  4L7Y A;  3DHR B;  1MCY A;  4NK2 A;  1LFY B;  1LJW B;  5IKS A;  1ECN A;  3WCU C;  2MGA A;  1MYZ A;  5SW7 A;  1DKE A;  3LR7 A;  3SZK B;  5KER B;  1YH9 A;  1A3O B;  4ESA A;  1A01 B;  1A0U B;  1IWH B;  102M A;  1QXE B;  1Y09 A;  3HXN A;  4YU3 B;  2ZLT B;  3MJP A;  1MLJ A;  3G4U A;  1JPB A;  3UHU A;  1Y8I A;  3ZJJ A;  1YZI B;  2LH7 A;  1CMY B;  2V1F A;  3IA3 B;  3OO4 A;  4NK1 A;  3KUN A;  3UHZ A;  1O1K B;  1DXV B;  1O1P B;  3UHX A;  3PI4 A;  4M4B A;  5D1V A;  4HBI A;  5CN9 A;  1V4W B;  4FWZ A;  1NPG A;  1MTJ A;  3S48 C;  4KN3 A;  2H35 A;  2ZFB A;  3UH6 A;  1LH6 A;  1F5O A;  1DXT B;  2NRL A;  1YIH B;  6HBW B;  1MLL A;  1HBR B;  3WCP A;  105M A;  2R1H A;  3UHR A;  1S61 A;  5EE4 C;  3PI9 B;  2G3H A;  2ZFO A;  3WTG B;  1CH5 A;  2O5T X;  2HHB A;  2GTL D;  3GDJ B;  1SDL B;  3WCT D;  2W72 C;  1MGN A;  5EE4 D;  1BZR A;  1Y4B A;  1F5P A;  1UFJ A;  5CN5 A;  1UT0 A;  1XY0 B;  2R4Z A;  3K8B A;  3A59 B;  3HHB A;  1JZK A;  3B75 B;  2ZSR A;  2AV3 A;  3ZJR A;  1A3O A;  1GDK A;  3HRW A;  5CMV A;  1HBI A;  2OH9 A;  1BUW A;  3ZOL A;  2BKM A;  1YCB A;  2ZLX A;  2YRS A;  1Y22 B;  1Y4R B;  2QLS A;  5JGG A;  112M A;  3SZK A;  1J40 A;  1T1N A;  3G4V A;  4F6F A;  2RI4 A;  1JP8 A;  1YH9 B;  2VEE A;  1J3Y A;  1RTX A;  4KJT A;  1OUT A;  1RQA A;  1QSI A;  1Y5F A;  5EUI A;  3UHV A;  3QM8 A;  1DXU B;  2EKT A;  1EBC A;  1VXB A;  1WLA A;  1CP0 A;  1J7W B;  1J7S A;  3D4X B;  1GBV B;  1CH3 A;  1VXE A;  3OO4 B;  1I3E A;  107M A;  2EVK A;  4MQG A;  1QPW A;  3BJ2 B;  5ILM A;  1LUE A;  3QJB B;  1GZX A;  3ARL A;  1HGA A;  1QXD A;  1Y31 A;  3IC0 A;  4C44 A;  1AJ9 A;  1S5Y B;  1NXF A;  1YCA A;  3TM3 A;  2VM0 A;  2DN2 A;  1BZZ A;  4N7N B;  1Y0C B;  1S5X B;  4NXC A;  1YHU C;  1AJ9 B;  1MWB A;  3IXF A;  1QSH B;  3D17 B;  2AUQ A;  1CH7 A;  1Y4G A;  1O1L B;  1C7D A;  1UVX A;  1M9P B;  1R1X B;  4N8T B;  2W72 A;  1XZ2 B;  5E29 A;  1CLS A;  3PEL A;  3ZJN A;  1Y4P B;  1Y4F A;  2BW9 M;  1LFT B;  3QM7 A;  1MYH A;  3U3E A;  4HHB A;  1X9F A;  5KER A;  5CNB A; 
#chains in the Genus database with same CATH topology
 1HBH B;  3GQR A;  2B7H A;  1DWS A;  1XZ4 B;  1Y7G B;  1HBS B;  3LR9 A;  3ZJP A;  4F69 A;  3LQD A;  1YEV B;  4F0U A;  4ZVB A;  3NFE B;  3UHC A;  4PNJ A;  3BJ1 A;  5KKK A;  1B8D A;  2QSP B;  3G4Q A;  4MQC A;  2VJR A;  1K0Y A;  1RQ4 A;  2UUM B;  2R4X A;  1A6G A;  4XS0 B;  5E83 A;  1HDA A;  1FHJ A;  2DXM B;  2VJT B;  1Y09 B;  3HHB B;  1Y7D B;  2D2M B;  3RQR A;  5HLU A;  1Y0D A;  1IWH A;  1VXC A;  1FCS A;  3DHR A;  3GK9 A;  3ECX A;  1UIW A;  3UI0 A;  2XKG A;  3TLD A;  1MLQ A;  1DO7 A;  1DWT A;  4L1E A;  1F63 A;  5HBI A;  1CP5 A;  2DHB B;  1IRD A;  1YGF B;  1ECA A;  1Q1F A;  1YEN A;  1DUK A;  3AQ9 A;  1Y85 A;  3MN0 A;  4PO5 A;  3NFE A;  1MKO B;  1NZ2 A;  1XZ7 B;  1YHE B;  3MJU B;  3QJC B;  3D7O B;  1XZV A;  2OHA A;  2NSS A;  1RSE A;  2HHB B;  1LFV A;  1FHJ B;  1HAC B;  1TU9 A;  4G1V A;  2G0V A;  2ZS1 A;  2ZSO A;  4HRT A;  2C7L A;  4MQH A;  4HH1 A;  1C7D B;  1LFQ B;  7HBI A;  2HHE B;  2MYB A;  3UBV A;  1JL7 A;  1XF6 C;  3PI8 B;  3QJD B;  1B33 A;  4ROM B;  1H1X A;  2O5O X;  1CO8 A;  3GUQ A;  2VLZ A;  3HYU A;  2D2M D;  2H8F A;  2ZSZ A;  1DO3 A;  1MLU A;  3WFU A;  3WCV C;  1HHO A;  3PT8 B;  1BIN A;  1CBL A;  1COL A;  3UH5 A;  5JDO F;  4N7O A;  3CY5 A;  1GJN A;  1A0Z B;  4HH0 A;  1BBB A;  1RVW B;  2C7K A;  1UX9 A;  1O1O B;  4NXA A;  1KFR A;  1UVN A;  1NZ4 A;  2KSC A;  1A6K A;  2G0X A;  4F68 A;  1MNH A;  1V4X A;  1BZ0 A;  4ILZ A;  5CNC A;  1Y5K B;  4AVE A;  2QRW A;  1YDZ B;  1VXG A;  2DXM A;  2VJT A;  2QFK A;  5JGG B;  1EYX A;  1XQ5 A;  1ON7 B;  4NI1 B;  3FS4 A;  5SW7 B;  4MPM A;  2PGH B;  4O1T A;  1ECO A;  1LJW A;  1BUW B;  5HU6 B;  1WVP A;  1NQP B;  1TES A;  2O58 X;  2D2N C;  1IBE A;  3GOU B;  1IT2 A;  1OUU A;  1A87 A;  4QAU A;  1G09 B;  1A9W A;  1Y7G A;  1BVC A;  3UHG A;  1Y0T B;  4O35 A;  1C7C B;  1A3N B;  1J7S B;  1A4F B;  1HSY A;  1HV4 B;  1I7Y A;  1J7W A;  1O1I A;  2HBF B;  1N9I A;  3WCV A;  1VWT B;  2FRK X;  3AT6 B;  2GDM A;  1MOH A;  1UC3 A;  1XZU A;  1MLG A;  4AE1 A;  5C6Y A;  3MKB A;  5AB8 A;  1O1J A;  3WR1 A;  3AQ6 A;  1MNK A;  2MYD A;  2HBF A;  1Y01 B;  2MHB A;  2V1H A;  1C7B A;  3HF4 A;  1HHT P;  2EKU A;  4HSW A;  1MOC A;  1DUO A;  2FRJ X;  3VRG A;  4IRO A;  3ZJM A;  2IN4 A;  3V57 B;  3OK5 A;  4O4T A;  4A8O A;  3GDJ A;  3E55 A;  2R50 A;  3LB2 A;  1YFF A;  2LH5 A;  3QM9 A;  3HYU B;  2LH1 A;  1VXF A;  3D17 A;  4AE0 A;  1UVI A;  1Y4G B;  6HBW A;  3TM9 A;  1Y2Z B;  2VML B;  3ZJH A;  1GBU A;  1RPS B;  1LIA A;  2HHD B;  2ZFO B;  4DC7 A;  3BRP B;  4ERV A;  5AZR A;  1S5Y A;  1YMA A;  1N9F A;  5C6E A;  2W72 B;  1MLF A;  2SPO A;  3P5Q B;  3UH7 A;  3BRP A;  1MYM A;  3UHY A;  4H2L B;  4NI0 A;  2HZ3 A;  4GXE A;  1S5X A;  1IDR A;  3S1J A;  1C40 A;  2WCR A;  1Y7C B;  2SPN A;  1G08 A;  3NMM A;  1RQ3 A;  1NAZ A;  1MBI A;  1Y0A B;  4MQC B;  2W6Y A;  1Y5J A;  3S65 A;  1G0A B;  1YGD B;  2AV0 A;  3D1A B;  1Y8H B;  2O5M X;  4A8W A;  3HXN B;  3QZX A;  1GCW B;  1BZ0 B;  2D2M A;  3S1I A;  1LFY A;  1X46 A;  1Y7Z B;  1MDT A;  4WJG 1;  4ETU A;  1YIE A;  5E6E B;  1NIH B;  1MBA A;  4ZVA A;  1YVQ B;  2AUP A;  1V4U B;  3EU1 A;  3WFX A;  1JP9 A;  4B4Y A;  1OJ6 A;  4ZIZ B;  1YEN B;  4F6J A;  2G14 A;  2ZS0 C;  4F6B A;  1G08 B;  2ZSN A;  2MBW A;  1PBX B;  1URY A;  3PI1 A;  1XXT A;  1B86 A;  1CPC B;  1UVY A;  1NS9 A;  1ABY A;  2AA1 A;  1YOH A;  1MLN A;  2UUM X;  2H8D A;  111M A;  3S66 B;  3DR9 A;  3CY5 B;  3G4R A;  1GCV B;  1LHS A;  1YIE B;  2ZS1 B;  4HRT B;  5E6E A;  1JBO A;  3QJE A;  2GTL C;  1A00 A;  3E5I A;  3AT5 B;  1EWA A;  1VHB A;  2ZSP A;  3KMF A;  1UVK A;  2MGD A;  4TMA B;  4MQJ A;  1Y2Z A;  3BJ3 B;  1Y8W A;  2W31 A;  3QJD A;  1BZZ B;  2FRI X;  1O1O A;  1HBB A;  1HBR A;  3GKT A;  1O16 A;  1CH1 A;  1HDB B;  2UUN B;  3G53 A;  1CLS B;  1KTP A;  4FC3 B;  4U8U A;  3UHQ A;  1C40 B;  1S6A A;  3O2C B;  2WTG A;  2C7K B;  1QSH A;  1RQA B;  1LA6 A;  2HBC B;  3GLN A;  4MXK A;  1LH7 A;  3NG6 B;  1ASH A;  2DN1 B;  3HEP A;  4RMP A;  1HRM A;  3MOU A;  1FN3 A;  1XY0 A;  1HA7 B;  3DBJ B;  1AJG A;  4ESU A;  3UHD A;  4XS0 A;  1CH9 A;  3D1K B;  1MTI A;  5F2A A;  1LIA B;  4HRR B;  3ONZ B;  3ZJQ A;  2WCQ A;  2D2N A;  2ZST A;  2MGG A;  4G51 A;  1YE0 A;  1HI8 A;  1ABW B;  1Y7D A;  2D2M C;  2XKH A;  1LA6 B;  2HBC A;  1CG8 A;  2V1K A;  1J3Z B;  1JF4 A;  2QU0 A;  2D60 A;  1XXT B;  4MBA A;  4LM6 B;  1OFK A;  3UHW A;  1C7C A;  1Y5F B;  3FEW X;  1OBM A;  1X3K A;  1YEO B;  1IRD B;  1YGF A;  3QQR A;  1SDK A;  2G0Z A;  1G0B B;  1Y85 B;  1C7B B;  3WFT A;  1V75 B;  1Y0W B;  2O5S X;  1O1J B;  1MZ0 A;  1GZX B;  3MYM A;  4BJA A;  3WCW A;  1YHU B;  3PI8 A;  1NS9 B;  3ASE A;  1XZ5 A;  1Y35 B;  4HSX A;  2CMM A;  2GRZ A;  1AJH A;  1HGB B;  1CIO A;  2DN1 A;  3W4U B;  5C6E B;  2ZFO D;  1SI4 A;  2HBS B;  1HHO B;  4MQI B;  1MOD A;  2MB5 A;  1KR7 A;  3VHB A;  2J96 A;  2ZT4 A;  1NZ5 A;  3WCW D;  1MNI A;  2BV8 B;  3KVS B;  4TYX A;  5KDQ A;  3ZJO A;  103M A;  1LFL A;  2VJH A;  3QM5 A;  1YVT A;  1V5H A;  2HBE B;  2V1I A;  3WTG A;  4UIQ A;  1Y7Z A;  1LFT A;  4MBN A;  1YE0 B;  3NL7 A;  2MYC A;  5CNF A;  4GY3 A;  1LH5 A;  2W6V B;  3S65 B;  2OHB A;  4ROL A;  3KMF C;  1MYF A;  2GNW A;  4M4A B;  1KD2 A;  3VRF A;  1GDL A;  4FWX A;  5CHQ A;  1G9V B;  1YEQ A;  2X49 A;  1JZM A;  1A01 A;  2G11 A;  2HBD B;  1M6M A;  3ARK A;  2QSS A;  3QMA A;  2AA1 B;  1THB A;  1Y8I B;  4U8U D;  3IC2 A;  1Y22 A;  1Y4R A;  2Z6S A;  2V1E A;  1MBO A;  3AT6 A;  4OF9 A;  1YHE A;  1VWT A;  3ECL A;  1V07 A;  4F0T A;  1PHN B;  1BIJ B;  2OLP A;  3UHS A;  1U7R A;  1MYG A;  4F6I A;  2D5X A;  3R0G A;  4JAC A;  4H0B A;  1JL6 A;  4MQK A;  1CH4 A;  1LTW A;  2R4Y A;  3AG0 A;  2ZLX B;  1A6M A;  3KUO A;  1YEQ B;  1RH1 A;  1Y83 A;  3E4N A;  3ZH0 A;  3MJU A;  2DN3 A;  1PBX A;  3EU1 B;  1UMO A;  1YE2 A;  1KTP B;  2MGB A;  1JBO B;  1NS6 B;  1Y4V B;  1HCO A;  2PEG B;  1HLB A;  4H0M A;  1Y46 A;  1LFZ B;  1O1P A;  2ZLW B;  2LH6 A;  2M6Z B;  2GTL B;  1JEB A;  4YU4 A;  1R1X A;  1GH0 A;  4FH6 A;  4NI0 B;  4FC3 A;  4U8U B;  3H58 A;  1B0B A;  4GY3 B;  3ODQ A;  1FDH A;  1BBB B;  1RVW A;  5CN4 A;  1QI8 B;  2R4W A;  1R1Y A;  3UHN A;  1JF3 A;  1EYX B;  4N7N A;  1A6N A;  5M3S A;  1J41 A;  1GLI B;  1X9F D;  2X4A A;  3QM6 A;  4XDI A;  1UFP A;  1Y4P A;  4Q70 B;  2ZT2 A;  1G9V A;  3UHI A;  2R80 A;  3OO5 B;  1DO1 A;  3ECZ A;  3V2Z A;  1MLH A;  3WCU D;  3MJP B;  3D1K A;  4NS2 A;  5JDO E;  3K9Z A;  4MU5 A;  1COH B;  1K1K A;  3DUT B;  1FSX A;  1HGB A;  2NSR A;  4X0L B;  3O7N A;  2UUL D;  4BS9 A;  3EOK B;  3WHM A;  4ESA B;  2ZSX A;  2O5L X;  4KMV A;  2D5X B;  2AUO A;  4WJG A;  1J41 B;  1GLI A;  5ILP A;  2ZLT A;  3MBA A;  5HY8 B;  4F0T B;  2UUN D;  1XZU B;  3A2G A;  4ERT A;  3WCV B;  1G0B A;  2XKI A;  1D8U A;  2H8D B;  2G12 A;  1DKE B;  1LFV B;  2MGL A;  1YG5 A;  5B13 G;  3WCT A;  3GIO A;  1O1N B;  1MLK A;  1HI0 P;  4OOD A;  3NML A;  3BA2 A;  3D4X A;  1SPG B;  1Y8K A;  1QXE A;  1V75 A;  1FDH G;  3OZV A;  3OJ1 A;  2BLH A;  2QMB A;  1HBB B;  1HAC A;  3NMM B;  2MGJ A;  5CNG A;  1YEO A;  1LFZ A;  4ETT A;  1BZP A;  2WY4 A;  1J52 A;  1EW6 A;  3LB1 A;  1A9W E;  1MBD A;  2UUL B;  1BIJ A;  4B3W A;  5FVB A;  1DXT A;  3GQG B;  4F4O B;  3GKV A;  3DHT B;  5HAV A;  1M9P A;  1ABS A;  4DC8 A;  108M A;  1YG5 B;  106M A;  3OVU C;  3BCQ A;  3WFW A;  1HA7 A;  1YVQ A;  1YEV A;  3A59 A;  3H57 A;  1DLY A;  2Z85 A;  2JHO A;  3ARJ A;  2HBE A;  1JP6 A;  2GKN A;  3M39 A;  3RGK A;  1Y4F B;  1FSX B;  1CH2 A;  3FH9 A;  4H2L A;  2RAO A;  1NZ3 A;  4HRR A;  4VHB A;  2ZLU B;  1ITH A;  3MVC A;  4FH7 A;  2Z6N B;  1IRC A;  2OH8 A;  1J3F A;  1NIH A;  1YHR A;  2DKC A;  1HI1 A;  2HBG A;  1GDI A;  1LFL B;  2VJH B;  1ABW A;  1N9X A;  3GQR B;  1Y4Q A;  2GKM A;  1NPF A;  1HAB B;  3ZOM A;  2VLY A;  1S0H B;  3AT5 A;  1JWN A;  4MXL A;  4ETV A;  2MGF A;  2PGH A;  1HJT A;  3MKB B;  1NWN A;  4M4B B;  1HDS B;  1Y31 B;  3IC0 B;  3PI2 A;  4MQG B;  4U8U C;  1CG5 A;  4PQC A;  1Y83 B;  1YDZ A;  2NX0 A;  4KMW A;  2QFN A;  2VYY A;  4SDH A;  2C7J B;  2D5Z B;  1CG8 B;  1UX8 A;  5F0B A;  1XZ7 A;  1Y45 A;  2GRH A;  4LPI A;  1LHT A;  1Y0D B;  2FRF A;  4GZG A;  1MLM A;  1UIW B;  3WCU B;  1HCO B;  1WMU B;  2MHB B;  1Y46 B;  1MWD A;  3A9M A;  4WCH D;  3OGB A;  1HGC B;  1NGK A;  1MOB A;  4G1B A;  1FAW A;  2BLJ M;  3S66 A;  1CBM A;  1F99 B;  3WCW C;  4ODC A;  2SPM A;  3O18 A;  2GTL A;  5HLQ A;  3HRW B;  1YE2 B;  4MQK B;  2GNV A;  5JDO D;  2NRM A;  1HBS A;  1BZ6 A;  2M6Z A;  2ZFO C;  1FAW B;  2B7H B;  3WCT B;  3QZZ A;  3UBC A;  3O18 B;  1VXH A;  4TWU A;  1Y8K B;  1MWC A;  1U7S A;  3P5Q A;  5EU2 A;  2LHB A;  2ZSQ A;  3PEL B;  2W6X A;  5CND A;  3VRE A;  4UUR A;  1MYT A;  3V57 A;  3DBJ A;  2H8F B;  2HZ2 A;  2D6C A;  3EOK A;  3WHM B;  1O1L A;  3PIA A;  1YVT B;  3NG6 A;  1Y0C A;  2ZT3 A;  1JW8 A;  1CQ2 A;  1SWM A;  1Y0A A;  1F65 A;  3A5G A;  2MYA A;  3PMD A;  1FSL A;  1B8D B;  2QSP A;  1K1K B;  3VRF B;  1A3N A;  2ZLV B;  2MYE A;  3LQD B;  3A0G A;  2JLG A;  1GCW A;  5CN8 A;  3VRG B;  1V4X B;  1Y4Q B;  3FH9 B;  2QSS B;  2G0S A;  1BAB A;  1YEU B;  1QPW B;  1CO9 A;  4PO5 B;  3CIU B;  4XXI A;  1MYI A;  2HCO A;  5CNE A;  1YFF B;  1HBG A;  1GDJ A;  1ECD A;  2C7L B;  3WI8 A;  101M A;  1YMB A;  4A8S A;  2LH2 A;  1MBN A;  5MBA A;  2O5Q X;  1VRF A;  2BLI A;  1UVJ A;  2VML A;  4H0M B;  1RPS A;  1XZV B;  4Z8K B;  4DWT A;  4L2M A;  2JLF A;  109M A;  3M38 A;  1KN1 A;  1MKO A;  1JEB B;  4YU4 B;  1VXA A;  2GRF A;  1BJE A;  2BMM A;  1HGA B;  1NEJ A;  3AQ5 A;  5AQD A;  1DO4 A;  1KN1 B;  1MYJ A;  1V4W A;  3DHT A;  1MLS A;  3OZU A;  2ZS0 D;  2OIF A;  1Y8W B;  2C0K A;  4O4Z A;  2DN2 B;  5CN7 A;  3D7O A;  2LH3 A;  1Y4V A;  3QQQ A;  3PI3 A;  4MQH B;  5E83 B;  3E5O A;  4BJU A;  2VHB A;  3A5A A;  1Y5J B;  5ILE A;  2Z6N A;  1A0Z A;  1H97 A;  1XZ2 A;  5E29 B;  1ABY B;  2ZS0 A;  1THB B;  1Y7C A;  2UUL C;  1S69 A;  2V1G A;  1O1M A;  3GQP B;  1OUU B;  1IBE B;  1HBH A;  1B33 B;  4ROM A;  3UHT A;  3HEN A;  4M4A A;  1I3D A;  2VYZ A;  2ZSY A;  3K3U A;  3K8B B;  3FS4 B;  1URV A;  4F6D A;  1XYE B;  5CHR A;  3PT8 A;  1HDS A;  3O89 A;  4DWU A;  2FAL A;  1COH A;  104M A;  1N9H A;  2G0R A;  2RAO B;  1SDL A;  5EOH A;  4RMP B;  1EMY A;  3ORD A;  3NUH B;  1KD2 B;  1YGD A;  1SPE A;  1YOI A;  3PMC A;  5HU6 A;  1MOA A;  1V9Q A;  1OR4 A;  2C7J A;  1DXD A;  4X0L A;  1RQ3 B;  3ZJL A;  3RJ6 A;  1LH3 A;  1WMU A;  4YU3 A;  1A4F A;  1HV4 A;  1QSI B;  1LH2 A;  3BJ3 A;  1B86 B;  1CPC A;  2HHE A;  3BJ2 A;  3WCT C;  1A0U A;  1G09 A;  1A00 B;  3PT7 A;  1YMC A;  2ZS1 D;  2BNL A;  4ODC B;  5AZQ A;  2ZT1 A;  4ZIZ A;  2H35 B;  2ZFB B;  1HGC A;  2ZS1 C;  4A8M P;  4JYQ A;  5ILR A;  1YEU A;  4PQ6 A;  4A8K A;  1MLR A;  2E2Y A;  2XYK A;  1MTK A;  5EET A;  1DXV A;  1BZ1 B;  1YIH A;  2ZT0 A;  1XG0 C;  4IRO B;  1F99 A;  2VRY A;  1SHR B;  3GYS B;  4HHB B;  3RJN B;  1MLO A;  1UVL A;  5EYS A;  1SGK A;  3V2V A;  4B02 A;  1Y4B B;  4NI1 A;  4N7O B;  1DWR A;  3G4Y A;  4UZV A;  4YJJ B;  2ZS0 B;  4LMX B;  3HEO A;  1XZ4 A;  3ED9 A;  1DTM A;  1OR6 A;  5EV5 A;  1NQP A;  1XZ5 B;  3PIA B;  4FWY A;  2IG3 A;  4N7P A;  1YOG A;  6HBI A;  3WR1 B;  3LHB A;  3BOM B;  2VEB A;  5JDO C;  5MBN A;  1NEJ B;  1Y0T A;  2VJR B;  1MBC A;  5JOM A;  1V4U A;  2MGM A;  1O1I B;  1IT3 A;  1DXC A;  3M3B A;  2ZWJ A;  1J7Y B;  3MYN A;  2MGH A;  1LH1 A;  1J3Y B;  3GOU A;  2RI4 B;  1XCH A;  3WCV D;  3UGZ A;  2QLS B;  1FN3 B;  2ZLV A;  2QMB B;  1CMY A;  3UGY A;  1XYE A;  2MGI A;  3V58 B;  1HAB A;  1O1N A;  2D60 B;  4IT8 A;  4L1E B;  1X9F C;  3GKV B;  2VYW A;  2W6V A;  1JY7 A;  2D2N D;  2MGC A;  1Y35 A;  2Z8A A;  1O1K A;  4A8Y A;  1BAB B;  2UUL H;  1YZI A;  1HDA B;  1SI4 B;  2HBS A;  4TWV A;  4A8F A;  3A5B A;  110M A;  4MQJ B;  1LFQ A;  1DXU A;  1QXD B;  2EB9 A;  3QJE B;  1XDT T;  3QJB A;  1SPG A;  2EF2 A;  3GQG A;  3W4U A;  2DC3 A;  3R5I B;  1Y0W A;  5B13 A;  1L2K A;  1GBV A;  3UHK A;  3ZHW A;  1MNO A;  2ZLW A;  2GLN A;  2V8A B;  3EDA A;  2R1H B;  2V1J A;  3B75 A;  4O2G A;  1SDK B;  2W6W A;  1GBU B;  2HHD A;  1WAC A;  1MBS A;  1HBA B;  1DM1 A;  3WCW B;  1MDN A;  4H07 A;  3VAU A;  2WTH A;  5D5R A;  4ROL B;  4PQB A;  3EDB A;  3L0F A;  1TOX A;  4L7Y B;  1BVD A;  4YJJ A;  1GCV A;  3VRE B;  1S56 A;  3NL7 B;  1Y5K A;  1S0H A;  4C0N A;  1FLP A;  2I88 A;  3PI9 A;  3D1A A;  1M6C A;  5KDQ B;  3R5I A;  2D2N B;  1W92 A;  3GQP A;  3UH3 A;  2ZSS A;  1PHN A;  3G4W A;  4MQI A;  3M3A A;  1DLW A;  1K0Y B;  1RQ4 B;  2UUM A;  3WCU A;  1CPW A;  1DTI A;  2ZLU A;  3ZJS A;  3HC9 A;  2BK9 A;  3IC2 B;  3UHH A;  2R80 B;  3OO5 A;  2G10 A;  1ON7 A;  1I7Y B;  1HLM A;  1CIK A;  3AQ8 A;  1ALL B;  3UHE A;  1PMB A;  3G52 A;  3PT7 B;  2SPL A;  1YHR B;  5AQD M;  2YRS B;  5HLX A;  3DUT A;  1R1Y B;  4G51 B;  1CQX A;  4F0U B;  1Y45 B;  2HCO B;  3BJ1 B;  1MNJ A;  3G46 A;  1JDO A;  2Z6T A;  1OFJ A;  1RTE A;  2EB8 A;  2MGK A;  1EBT A;  3LQ9 A;  1J3Z A;  1OUT B;  1JY7 B;  1GVH A;  1HDB A;  2UUN A;  5EYJ A;  2D5Z A;  3CIU A;  3WCP B;  1JZL A;  3QJC A;  1BZ1 A;  2O5B X;  1CG5 B;  2DKA A;  3LB3 A;  3SDN A;  1DDT A;  2PEG A;  4NZI A;  5HY8 A;  4N8T A;  2GL3 A;  5B85 A;  4AVD A;  1HBA A;  3OZW A;  5EQM A;  2DN3 B;  2EVP A;  3AQ7 A;  4N6S B;  1YHU A;  3ODQ B;  3ONZ A;  3ZJI A;  3HF4 B;  3A0G B;  1VRE A;  1O1M B;  1NS6 A;  4MAX A;  4F6G A;  3L0F B;  2MGE A;  1IOP A;  1VXD A;  4N7P B;  2VLX A;  3LB4 A;  2QU0 B;  1SHR A;  1YHU D;  3GYS A;  1J40 B;  1T1N B;  2BWH A;  3BOM A;  2HBD A;  1Z8U B;  3UHB A;  4F4O A;  1QI8 A;  5CN6 A;  1X9F B;  3BCQ B;  1J7Y A;  2FAM A;  2DHB A;  1Y8H A;  1NWI A;  1AZI A;  5EUI B;  5B84 A;  1XQ5 B;  2HZ1 A;  3SDH A;  1G0A A;  2AUR A;  4L7Y A;  3DHR B;  5FVB M;  1MCY A;  4NK2 A;  1LFY B;  1LJW B;  5IKS A;  1ECN A;  3WCU C;  1QGW C;  2MGA A;  1MYZ A;  5SW7 A;  1DKE A;  3LR7 A;  3SZK B;  5KER B;  1YH9 A;  1A3O B;  4ESA A;  1A01 B;  1A0U B;  1IWH B;  102M A;  1QXE B;  1Y09 A;  3HXN A;  4YU3 B;  2ZLT B;  3MJP A;  1MLJ A;  3G4U A;  1JPB A;  3UHU A;  1Y8I A;  3ZJJ A;  1YZI B;  2LH7 A;  1CMY B;  1F0L A;  2V1F A;  3IA3 B;  3OO4 A;  4NK1 A;  3KUN A;  3UHZ A;  1CII A;  1O1K B;  1DXV B;  1O1P B;  3UHX A;  3PI4 A;  4M4B A;  5D1V A;  4HBI A;  5CN9 A;  1NY9 A;  1V4W B;  4FWZ A;  1NPG A;  1MTJ A;  3S48 C;  4KN3 A;  2H35 A;  2ZFB A;  3UH6 A;  1LH6 A;  1F5O A;  3V58 A;  4XXK A;  1DXT B;  2NRL A;  1YIH B;  6HBW B;  1MLL A;  1HBR B;  3WCP A;  105M A;  2R1H A;  3UHR A;  1S61 A;  5EE4 C;  3PI9 B;  2G3H A;  2ZFO A;  3WTG B;  1CH5 A;  2O5T X;  2BV8 A;  3KVS A;  2HHB A;  2GTL D;  3GDJ B;  1SDL B;  3WCT D;  1GH0 B;  1MGN A;  2W72 C;  5EE4 D;  1BZR A;  3O2C A;  1Y4B A;  1F5P A;  2UUL A;  1UFJ A;  5CN5 A;  1UT0 A;  1XY0 B;  2R4Z A;  3K8B A;  3A59 B;  3HHB A;  1JZK A;  4GXE B;  3B75 B;  2ZSR A;  2AV3 A;  3ZJR A;  1A3O A;  1GDK A;  3HRW A;  5CMV A;  1HBI A;  1HHS A;  2OH9 A;  1BUW A;  3ZOL A;  2BKM A;  1YCB A;  2ZLX A;  2YRS A;  1Y22 B;  1Y4R B;  2QLS A;  4A8Q A;  4LMS B;  5JGG A;  112M A;  3SZK A;  1J40 A;  1T1N A;  1ALL A;  3G4V A;  4F6F A;  2RI4 A;  1JP8 A;  1YH9 B;  2VEE A;  1J3Y A;  1RTX A;  4KJT A;  3VNC A;  1OUT A;  1RQA A;  1QSI A;  1Y5F A;  5EUI A;  3UHV A;  3QM8 A;  1DXU B;  2EKT A;  1EBC A;  1VXB A;  1WLA A;  1CP0 A;  1J7W B;  1J7S A;  3D4X B;  4N6S A;  1GBV B;  1CH3 A;  1VXE A;  3OO4 B;  4Z8K A;  1I3E A;  107M A;  2EVK A;  4MQG A;  1QPW A;  3BJ2 B;  2DKD A;  5ILM A;  1LUE A;  3QJB B;  1GZX A;  3ARL A;  3ZTA A;  1HGA A;  1QXD A;  1Y31 A;  3IC0 A;  4C44 A;  1AJ9 A;  1S5Y B;  1NXF A;  1YCA A;  3TM3 A;  2VM0 A;  2V8A A;  2DN2 A;  1BZZ A;  4N7N B;  3MWN A;  1Y0C B;  1S5X B;  4NXC A;  1YHU C;  2YSK A;  1AJ9 B;  1MWB A;  3IXF A;  1QSH B;  2JL9 A;  3D17 B;  2AUQ A;  1CH7 A;  1Y4G A;  1O1L B;  1C7D A;  1UVX A;  1M9P B;  1R1X B;  4N8T B;  2W72 A;  1XZ2 B;  5E29 A;  1CLS A;  3PEL A;  3ZJN A;  1Y4P B;  4Q70 A;  1Y4F A;  2BW9 M;  1LFT B;  1UVM A;  3QM7 A;  1MYH A;  3U3E A;  4HHB A;  1X9F A;  5KER A;  5CNB A; 
#chains in the Genus database with same CATH homology
 1HBH B;  3GQR A;  2B7H A;  1DWS A;  1XZ4 B;  1Y7G B;  1HBS B;  3LR9 A;  3ZJP A;  4F69 A;  3LQD A;  1YEV B;  4ZVB A;  3NFE B;  3UHC A;  4PNJ A;  3BJ1 A;  5KKK A;  2QSP B;  3G4Q A;  4MQC A;  1K0Y A;  1RQ4 A;  2R4X A;  1A6G A;  4XS0 B;  5E83 A;  1HDA A;  1FHJ A;  2DXM B;  1Y09 B;  3HHB B;  1Y7D B;  2D2M B;  5HLU A;  1Y0D A;  1IWH A;  1VXC A;  1FCS A;  3DHR A;  3GK9 A;  3ECX A;  1UIW A;  3UI0 A;  2XKG A;  3TLD A;  1MLQ A;  1DO7 A;  1DWT A;  1F63 A;  5HBI A;  1CP5 A;  2DHB B;  1IRD A;  1YGF B;  1ECA A;  1Q1F A;  1YEN A;  1DUK A;  3AQ9 A;  1Y85 A;  3MN0 A;  3NFE A;  1MKO B;  1NZ2 A;  1XZ7 B;  1YHE B;  3MJU B;  3QJC B;  3D7O B;  1XZV A;  2OHA A;  2NSS A;  1RSE A;  2HHB B;  1LFV A;  1FHJ B;  1HAC B;  1TU9 A;  4G1V A;  2G0V A;  2ZS1 A;  2ZSO A;  4HRT A;  4MQH A;  1C7D B;  1LFQ B;  7HBI A;  2HHE B;  2MYB A;  3UBV A;  1JL7 A;  3PI8 B;  3QJD B;  4ROM B;  1H1X A;  2O5O X;  1CO8 A;  2VLZ A;  3HYU A;  2D2M D;  2H8F A;  2ZSZ A;  1DO3 A;  1MLU A;  3WFU A;  3WCV C;  1HHO A;  3PT8 B;  1BIN A;  1CBL A;  3UH5 A;  5JDO F;  4N7O A;  3CY5 A;  1GJN A;  1A0Z B;  1BBB A;  1RVW B;  1UX9 A;  1O1O B;  4NXA A;  1KFR A;  1NZ4 A;  2KSC A;  1A6K A;  2G0X A;  4F68 A;  1MNH A;  1V4X A;  1BZ0 A;  4ILZ A;  5CNC A;  1Y5K B;  4AVE A;  2QRW A;  1YDZ B;  1VXG A;  2DXM A;  2QFK A;  5JGG B;  1XQ5 A;  4NI1 B;  3FS4 A;  5SW7 B;  4MPM A;  2PGH B;  4O1T A;  1ECO A;  1LJW A;  1BUW B;  5HU6 B;  1WVP A;  1NQP B;  1TES A;  2O58 X;  2D2N C;  1IBE A;  3GOU B;  1IT2 A;  1OUU A;  4QAU A;  1G09 B;  1A9W A;  1Y7G A;  1BVC A;  3UHG A;  1Y0T B;  4O35 A;  1C7C B;  1A3N B;  1J7S B;  1A4F B;  1HSY A;  1HV4 B;  2HBF B;  1J7W A;  1O1I A;  1N9I A;  3WCV A;  1VWT B;  2FRK X;  3AT6 B;  2GDM A;  1MOH A;  1UC3 A;  1XZU A;  1MLG A;  5C6Y A;  3MKB A;  5AB8 A;  1O1J A;  3WR1 A;  3AQ6 A;  1MNK A;  2MYD A;  2HBF A;  1Y01 B;  2MHB A;  2V1H A;  1C7B A;  3HF4 A;  2EKU A;  4HSW A;  1MOC A;  1DUO A;  2FRJ X;  3VRG A;  4IRO A;  3ZJM A;  2IN4 A;  3OK5 A;  4O4T A;  3GDJ A;  3E55 A;  2R50 A;  3LB2 A;  1YFF A;  2LH5 A;  3QM9 A;  3HYU B;  2LH1 A;  1VXF A;  3D17 A;  1Y4G B;  6HBW A;  3TM9 A;  1Y2Z B;  3ZJH A;  1GBU A;  1RPS B;  2HHD B;  2ZFO B;  4DC7 A;  5AZR A;  1S5Y A;  1YMA A;  1N9F A;  5C6E A;  2W72 B;  1MLF A;  2SPO A;  3P5Q B;  3UH7 A;  1MYM A;  3UHY A;  4H2L B;  4NI0 A;  2HZ3 A;  1S5X A;  1IDR A;  3S1J A;  1C40 A;  1Y7C B;  2SPN A;  1G08 A;  3NMM A;  1RQ3 A;  1NAZ A;  1MBI A;  1Y0A B;  4MQC B;  2W6Y A;  1Y5J A;  3S65 A;  1G0A B;  1YGD B;  2AV0 A;  3D1A B;  1Y8H B;  2O5M X;  3HXN B;  3QZX A;  1GCW B;  1BZ0 B;  2D2M A;  3S1I A;  1LFY A;  1X46 A;  1Y7Z B;  4WJG 1;  1YIE A;  5E6E B;  1NIH B;  1MBA A;  4ZVA A;  1YVQ B;  2AUP A;  1V4U B;  3EU1 A;  3WFX A;  1JP9 A;  4B4Y A;  1OJ6 A;  1YEN B;  4F6J A;  2G14 A;  2ZS0 C;  4F6B A;  1G08 B;  2ZSN A;  2MBW A;  1PBX B;  1URY A;  3PI1 A;  1XXT A;  1B86 A;  1UVY A;  1NS9 A;  1ABY A;  2AA1 A;  1YOH A;  1MLN A;  2H8D A;  111M A;  3S66 B;  3DR9 A;  3CY5 B;  3G4R A;  1GCV B;  1LHS A;  1YIE B;  2ZS1 B;  4HRT B;  5E6E A;  3QJE A;  2GTL C;  1A00 A;  3E5I A;  3AT5 B;  1EWA A;  1VHB A;  2ZSP A;  3KMF A;  2MGD A;  4MQJ A;  1Y2Z A;  3BJ3 B;  1Y8W A;  2W31 A;  3QJD A;  1BZZ B;  2FRI X;  1O1O A;  1HBB A;  1HBR A;  3GKT A;  1O16 A;  1CH1 A;  1HDB B;  3G53 A;  1CLS B;  4FC3 B;  4U8U A;  3UHQ A;  1C40 B;  1S6A A;  2WTG A;  1QSH A;  1RQA B;  1LA6 A;  2HBC B;  3GLN A;  4MXK A;  1LH7 A;  3NG6 B;  1ASH A;  2DN1 B;  3HEP A;  1HRM A;  3MOU A;  1FN3 A;  1XY0 A;  1AJG A;  3UHD A;  4XS0 A;  1CH9 A;  3D1K B;  1MTI A;  5F2A A;  4HRR B;  3ONZ B;  3ZJQ A;  2D2N A;  2ZST A;  2MGG A;  4G51 A;  1YE0 A;  1ABW B;  1Y7D A;  2D2M C;  2XKH A;  1LA6 B;  2HBC A;  1CG8 A;  2V1K A;  1J3Z B;  1JF4 A;  2QU0 A;  2D60 A;  1XXT B;  4MBA A;  3UHW A;  1OFK A;  1C7C A;  1Y5F B;  1OBM A;  1X3K A;  1YEO B;  1IRD B;  1YGF A;  3QQR A;  1SDK A;  2G0Z A;  1G0B B;  1Y85 B;  1C7B B;  3WFT A;  1V75 B;  1Y0W B;  2O5S X;  1O1J B;  1MZ0 A;  1GZX B;  3MYM A;  4BJA A;  3WCW A;  1YHU B;  3PI8 A;  1NS9 B;  3ASE A;  1XZ5 A;  1Y35 B;  4HSX A;  2CMM A;  2GRZ A;  1AJH A;  1HGB B;  1CIO A;  2DN1 A;  3W4U B;  5C6E B;  2ZFO D;  1SI4 A;  2HBS B;  1HHO B;  4MQI B;  1MOD A;  2MB5 A;  1KR7 A;  3VHB A;  2ZT4 A;  1NZ5 A;  3WCW D;  1MNI A;  4TYX A;  5KDQ A;  3ZJO A;  103M A;  1LFL A;  3QM5 A;  1YVT A;  1V5H A;  2HBE B;  2V1I A;  3WTG A;  4UIQ A;  1Y7Z A;  1LFT A;  4MBN A;  1YE0 B;  3NL7 A;  2MYC A;  5CNF A;  1LH5 A;  2W6V B;  3S65 B;  2OHB A;  4ROL A;  3KMF C;  1MYF A;  2GNW A;  4M4A B;  1KD2 A;  3VRF A;  1GDL A;  4FWX A;  5CHQ A;  1G9V B;  1YEQ A;  1JZM A;  1A01 A;  2G11 A;  2HBD B;  1M6M A;  3ARK A;  2QSS A;  3QMA A;  2AA1 B;  1THB A;  1Y8I B;  4U8U D;  3IC2 A;  1Y22 A;  1Y4R A;  2Z6S A;  2V1E A;  1MBO A;  3AT6 A;  4OF9 A;  1YHE A;  1VWT A;  3ECL A;  1V07 A;  1BIJ B;  2OLP A;  3UHS A;  1U7R A;  1MYG A;  4F6I A;  2D5X A;  3R0G A;  4JAC A;  4H0B A;  1JL6 A;  4MQK A;  1CH4 A;  1LTW A;  2R4Y A;  3AG0 A;  2ZLX B;  1A6M A;  3KUO A;  1YEQ B;  3ZH0 A;  1Y83 A;  3E4N A;  3MJU A;  2DN3 A;  1PBX A;  3EU1 B;  1UMO A;  1YE2 A;  2MGB A;  1NS6 B;  1Y4V B;  1HCO A;  2PEG B;  1HLB A;  1Y46 A;  1LFZ B;  1O1P A;  2ZLW B;  2LH6 A;  2M6Z B;  2GTL B;  1JEB A;  4YU4 A;  1R1X A;  4FH6 A;  4NI0 B;  4FC3 A;  4U8U B;  3H58 A;  1B0B A;  3ODQ A;  1FDH A;  1BBB B;  1RVW A;  5CN4 A;  1QI8 B;  2R4W A;  1R1Y A;  3UHN A;  1JF3 A;  4N7N A;  1A6N A;  5M3S A;  1J41 A;  1GLI B;  1X9F D;  3QM6 A;  4XDI A;  1UFP A;  1Y4P A;  2ZT2 A;  1G9V A;  3UHI A;  2R80 A;  3OO5 B;  1DO1 A;  3ECZ A;  3V2Z A;  1MLH A;  3WCU D;  3MJP B;  3D1K A;  4NS2 A;  5JDO E;  3K9Z A;  4MU5 A;  1COH B;  1K1K A;  3DUT B;  1FSX A;  1HGB A;  2NSR A;  4X0L B;  3O7N A;  3EOK B;  3WHM A;  4ESA B;  2ZSX A;  2O5L X;  4KMV A;  2D5X B;  2AUO A;  4WJG A;  1J41 B;  1GLI A;  5ILP A;  2ZLT A;  3MBA A;  5HY8 B;  1XZU B;  3A2G A;  3WCV B;  1G0B A;  2XKI A;  1D8U A;  2H8D B;  2G12 A;  1DKE B;  1LFV B;  2MGL A;  1YG5 A;  3WCT A;  1O1N B;  1MLK A;  4OOD A;  3NML A;  3BA2 A;  3D4X A;  1SPG B;  1Y8K A;  1QXE A;  1V75 A;  1FDH G;  3OZV A;  3OJ1 A;  2BLH A;  2QMB A;  1HBB B;  1HAC A;  3NMM B;  2MGJ A;  5CNG A;  1YEO A;  1LFZ A;  1BZP A;  2WY4 A;  1J52 A;  1EW6 A;  3LB1 A;  1A9W E;  1MBD A;  4B3W A;  1BIJ A;  4F4O B;  1DXT A;  3GQG B;  3GKV A;  3DHT B;  5HAV A;  1M9P A;  1ABS A;  4DC8 A;  108M A;  1YG5 B;  106M A;  3OVU C;  3BCQ A;  3WFW A;  1YVQ A;  1YEV A;  3A59 A;  3H57 A;  1DLY A;  2Z85 A;  2JHO A;  3ARJ A;  2HBE A;  1JP6 A;  3RGK A;  2GKN A;  3M39 A;  1Y4F B;  1FSX B;  1CH2 A;  3FH9 A;  4H2L A;  2RAO A;  1NZ3 A;  4HRR A;  4VHB A;  2ZLU B;  1ITH A;  3MVC A;  4FH7 A;  2Z6N B;  1IRC A;  2OH8 A;  1J3F A;  1NIH A;  1YHR A;  2HBG A;  1GDI A;  1LFL B;  1ABW A;  1N9X A;  3GQR B;  1Y4Q A;  2GKM A;  1NPF A;  1HAB B;  3ZOM A;  2VLY A;  1S0H B;  3AT5 A;  1JWN A;  4MXL A;  2MGF A;  2PGH A;  1HJT A;  3MKB B;  1NWN A;  4M4B B;  1HDS B;  1Y31 B;  3IC0 B;  3PI2 A;  4MQG B;  4U8U C;  1CG5 A;  4PQC A;  1Y83 B;  1YDZ A;  2NX0 A;  4KMW A;  2QFN A;  2VYY A;  4SDH A;  2D5Z B;  1CG8 B;  1UX8 A;  5F0B A;  1XZ7 A;  1Y45 A;  2GRH A;  4LPI A;  1LHT A;  1Y0D B;  2FRF A;  4GZG A;  1MLM A;  1UIW B;  3WCU B;  1HCO B;  1WMU B;  2MHB B;  1Y46 B;  1MWD A;  3A9M A;  4WCH D;  3OGB A;  1HGC B;  1NGK A;  1MOB A;  4G1B A;  1FAW A;  2BLJ M;  3S66 A;  1CBM A;  3WCW C;  4ODC A;  2SPM A;  2GTL A;  5HLQ A;  3HRW B;  1YE2 B;  4MQK B;  2GNV A;  5JDO D;  2NRM A;  1HBS A;  1BZ6 A;  2M6Z A;  2ZFO C;  1FAW B;  2B7H B;  3WCT B;  3QZZ A;  3UBC A;  4TWU A;  1VXH A;  1Y8K B;  1MWC A;  1U7S A;  3P5Q A;  5EU2 A;  2LHB A;  2ZSQ A;  3PEL B;  2W6X A;  5CND A;  3VRE A;  4UUR A;  1MYT A;  2H8F B;  2HZ2 A;  2D6C A;  3EOK A;  3WHM B;  1O1L A;  3PIA A;  1YVT B;  3NG6 A;  1Y0C A;  2ZT3 A;  1JW8 A;  1CQ2 A;  1SWM A;  1Y0A A;  1F65 A;  3A5G A;  2MYA A;  1FSL A;  2QSP A;  1K1K B;  3VRF B;  1A3N A;  2ZLV B;  2MYE A;  3LQD B;  3A0G A;  1GCW A;  5CN8 A;  3VRG B;  1V4X B;  1Y4Q B;  3FH9 B;  2QSS B;  2G0S A;  1BAB A;  1YEU B;  1QPW B;  1CO9 A;  3CIU B;  5CNE A;  1MYI A;  2HCO A;  1YFF B;  1HBG A;  1GDJ A;  1ECD A;  3WI8 A;  101M A;  1YMB A;  2LH2 A;  1MBN A;  5MBA A;  2O5Q X;  1VRF A;  2BLI A;  1RPS A;  1XZV B;  4DWT A;  4L2M A;  109M A;  3M38 A;  1MKO A;  1JEB B;  4YU4 B;  1VXA A;  2GRF A;  1BJE A;  2BMM A;  1HGA B;  1NEJ A;  3AQ5 A;  1DO4 A;  1MYJ A;  1V4W A;  3DHT A;  1MLS A;  3OZU A;  2ZS0 D;  2OIF A;  1Y8W B;  2C0K A;  4O4Z A;  2DN2 B;  5CN7 A;  3D7O A;  2LH3 A;  1Y4V A;  3QQQ A;  4MQH B;  3PI3 A;  5E83 B;  3E5O A;  2VHB A;  3A5A A;  1Y5J B;  5ILE A;  2Z6N A;  1A0Z A;  1H97 A;  1XZ2 A;  5E29 B;  1ABY B;  2ZS0 A;  1THB B;  1Y7C A;  1S69 A;  2V1G A;  1O1M A;  3GQP B;  1OUU B;  1IBE B;  1HBH A;  4ROM A;  3UHT A;  3HEN A;  4M4A A;  1I3D A;  2VYZ A;  2ZSY A;  3K3U A;  3K8B B;  3FS4 B;  1URV A;  4F6D A;  1XYE B;  5CHR A;  3PT8 A;  1HDS A;  3O89 A;  4DWU A;  2FAL A;  1COH A;  104M A;  1N9H A;  2G0R A;  2RAO B;  1SDL A;  5EOH A;  1EMY A;  3ORD A;  1KD2 B;  1YGD A;  1SPE A;  1YOI A;  5HU6 A;  1MOA A;  1V9Q A;  1OR4 A;  1DXD A;  4X0L A;  1RQ3 B;  3ZJL A;  3RJ6 A;  1LH3 A;  1WMU A;  4YU3 A;  1A4F A;  1HV4 A;  1QSI B;  1LH2 A;  3BJ3 A;  1B86 B;  2HHE A;  3BJ2 A;  3WCT C;  1A0U A;  1G09 A;  1A00 B;  3PT7 A;  1YMC A;  2ZS1 D;  2BNL A;  4ODC B;  5AZQ A;  2ZT1 A;  2H35 B;  2ZFB B;  1HGC A;  2ZS1 C;  4JYQ A;  5ILR A;  1YEU A;  4PQ6 A;  1MLR A;  2E2Y A;  2XYK A;  1MTK A;  5EET A;  1DXV A;  1BZ1 B;  1YIH A;  2ZT0 A;  4IRO B;  2VRY A;  1SHR B;  3GYS B;  4HHB B;  3RJN B;  1MLO A;  5EYS A;  3V2V A;  1Y4B B;  4NI1 A;  4N7O B;  1DWR A;  3G4Y A;  4UZV A;  2ZS0 B;  3HEO A;  1XZ4 A;  3ED9 A;  1DTM A;  1OR6 A;  5EV5 A;  1NQP A;  1XZ5 B;  3PIA B;  4FWY A;  2IG3 A;  4N7P A;  1YOG A;  6HBI A;  3WR1 B;  3LHB A;  3BOM B;  2VEB A;  5JDO C;  5MBN A;  1NEJ B;  1Y0T A;  1MBC A;  5JOM A;  1V4U A;  2MGM A;  1O1I B;  1IT3 A;  1DXC A;  3M3B A;  2ZWJ A;  1J7Y B;  3MYN A;  2MGH A;  1LH1 A;  1J3Y B;  3GOU A;  2RI4 B;  1XCH A;  3WCV D;  3UGZ A;  2QLS B;  1FN3 B;  2ZLV A;  2QMB B;  1CMY A;  3UGY A;  1XYE A;  2MGI A;  1HAB A;  1O1N A;  2D60 B;  4IT8 A;  1X9F C;  3GKV B;  2VYW A;  2W6V A;  1JY7 A;  2D2N D;  2MGC A;  1Y35 A;  2Z8A A;  1O1K A;  1BAB B;  1YZI A;  1HDA B;  1SI4 B;  2HBS A;  4TWV A;  3A5B A;  110M A;  4MQJ B;  1LFQ A;  1DXU A;  1QXD B;  2EB9 A;  3QJE B;  3QJB A;  1SPG A;  2EF2 A;  3GQG A;  3W4U A;  2DC3 A;  3R5I B;  1Y0W A;  1L2K A;  1GBV A;  3UHK A;  3ZHW A;  1MNO A;  2ZLW A;  2GLN A;  3EDA A;  2R1H B;  2V1J A;  3B75 A;  4O2G A;  1SDK B;  2W6W A;  1GBU B;  2HHD A;  1MBS A;  1HBA B;  1DM1 A;  3WCW B;  1MDN A;  4H07 A;  3VAU A;  2WTH A;  5D5R A;  4ROL B;  4PQB A;  3EDB A;  4L7Y B;  1BVD A;  1GCV A;  3VRE B;  1S56 A;  3NL7 B;  1Y5K A;  1S0H A;  4C0N A;  1FLP A;  3PI9 A;  3D1A A;  1M6C A;  5KDQ B;  3R5I A;  2D2N B;  1W92 A;  3GQP A;  3UH3 A;  2ZSS A;  3G4W A;  4MQI A;  3M3A A;  1DLW A;  1K0Y B;  1RQ4 B;  3WCU A;  1CPW A;  1DTI A;  2ZLU A;  3ZJS A;  3HC9 A;  2BK9 A;  3IC2 B;  3UHH A;  2R80 B;  3OO5 A;  2G10 A;  1HLM A;  1CIK A;  3AQ8 A;  3UHE A;  1PMB A;  3G52 A;  3PT7 B;  2SPL A;  1YHR B;  2YRS B;  5HLX A;  3DUT A;  1R1Y B;  4G51 B;  1CQX A;  1Y45 B;  2HCO B;  3BJ1 B;  1MNJ A;  3G46 A;  1JDO A;  2Z6T A;  1OFJ A;  1RTE A;  2EB8 A;  2MGK A;  1EBT A;  1J3Z A;  1OUT B;  1JY7 B;  1GVH A;  1HDB A;  5EYJ A;  2D5Z A;  3CIU A;  3WCP B;  1JZL A;  3QJC A;  1BZ1 A;  2O5B X;  1CG5 B;  3LB3 A;  3SDN A;  2PEG A;  4NZI A;  5HY8 A;  4N8T A;  2GL3 A;  5B85 A;  4AVD A;  1HBA A;  3OZW A;  5EQM A;  2DN3 B;  2EVP A;  3AQ7 A;  1YHU A;  3ODQ B;  3ONZ A;  3ZJI A;  3HF4 B;  3A0G B;  1VRE A;  1O1M B;  1NS6 A;  4MAX A;  4F6G A;  2MGE A;  1IOP A;  1VXD A;  4N7P B;  2VLX A;  3LB4 A;  2QU0 B;  1SHR A;  1YHU D;  3GYS A;  1J40 B;  1T1N B;  2BWH A;  3BOM A;  2HBD A;  1Z8U B;  3UHB A;  4F4O A;  1QI8 A;  5CN6 A;  1X9F B;  3BCQ B;  1J7Y A;  2FAM A;  2DHB A;  1Y8H A;  1NWI A;  1AZI A;  5EUI B;  5B84 A;  1XQ5 B;  2HZ1 A;  3SDH A;  1G0A A;  2AUR A;  4L7Y A;  3DHR B;  1MCY A;  4NK2 A;  1LFY B;  1LJW B;  5IKS A;  1ECN A;  3WCU C;  2MGA A;  1MYZ A;  5SW7 A;  1DKE A;  3LR7 A;  3SZK B;  5KER B;  1YH9 A;  1A3O B;  4ESA A;  1A01 B;  1A0U B;  1IWH B;  102M A;  1QXE B;  1Y09 A;  3HXN A;  4YU3 B;  2ZLT B;  3MJP A;  1MLJ A;  3G4U A;  1JPB A;  3UHU A;  1Y8I A;  3ZJJ A;  1YZI B;  2LH7 A;  1CMY B;  2V1F A;  3IA3 B;  3OO4 A;  4NK1 A;  3KUN A;  3UHZ A;  1O1K B;  1DXV B;  1O1P B;  3UHX A;  3PI4 A;  4M4B A;  5D1V A;  4HBI A;  5CN9 A;  1V4W B;  4FWZ A;  1NPG A;  1MTJ A;  3S48 C;  4KN3 A;  2H35 A;  2ZFB A;  3UH6 A;  1LH6 A;  1F5O A;  1DXT B;  2NRL A;  1YIH B;  6HBW B;  1MLL A;  1HBR B;  3WCP A;  105M A;  2R1H A;  3UHR A;  1S61 A;  5EE4 C;  3PI9 B;  2G3H A;  2ZFO A;  3WTG B;  1CH5 A;  2O5T X;  2HHB A;  2GTL D;  3GDJ B;  1SDL B;  3WCT D;  2W72 C;  1MGN A;  5EE4 D;  1BZR A;  1Y4B A;  1F5P A;  1UFJ A;  5CN5 A;  1UT0 A;  1XY0 B;  2R4Z A;  3K8B A;  3A59 B;  3HHB A;  1JZK A;  3B75 B;  2ZSR A;  2AV3 A;  3ZJR A;  1A3O A;  1GDK A;  3HRW A;  5CMV A;  1HBI A;  2OH9 A;  1BUW A;  3ZOL A;  2BKM A;  1YCB A;  2ZLX A;  2YRS A;  1Y22 B;  1Y4R B;  2QLS A;  5JGG A;  112M A;  3SZK A;  1J40 A;  1T1N A;  3G4V A;  4F6F A;  2RI4 A;  1JP8 A;  1YH9 B;  2VEE A;  1J3Y A;  1RTX A;  4KJT A;  1OUT A;  1RQA A;  1QSI A;  1Y5F A;  5EUI A;  3UHV A;  3QM8 A;  1DXU B;  2EKT A;  1EBC A;  1VXB A;  1WLA A;  1CP0 A;  1J7W B;  1J7S A;  3D4X B;  1GBV B;  1CH3 A;  1VXE A;  3OO4 B;  1I3E A;  107M A;  2EVK A;  4MQG A;  1QPW A;  3BJ2 B;  5ILM A;  1LUE A;  3QJB B;  1GZX A;  3ARL A;  1HGA A;  1QXD A;  1Y31 A;  3IC0 A;  4C44 A;  1AJ9 A;  1S5Y B;  1NXF A;  1YCA A;  3TM3 A;  2VM0 A;  2DN2 A;  1BZZ A;  4N7N B;  1Y0C B;  1S5X B;  4NXC A;  1YHU C;  1AJ9 B;  1MWB A;  3IXF A;  1QSH B;  3D17 B;  2AUQ A;  1CH7 A;  1Y4G A;  1O1L B;  1C7D A;  1UVX A;  1M9P B;  1R1X B;  4N8T B;  2W72 A;  1XZ2 B;  5E29 A;  1CLS A;  3PEL A;  3ZJN A;  1Y4P B;  1Y4F A;  2BW9 M;  1LFT B;  3QM7 A;  1MYH A;  3U3E A;  4HHB A;  1X9F A;  5KER A;  5CNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...