5ILMA

H64a sperm whale myoglobin with a fe-chlorophenyl moiety
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
153
structure length
153
Chain Sequence
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKAGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Organometallic myoglobins: Formation of Fe-carbon bonds and distal pocket effects on aryl ligand conformations.
pubmed doi rcsb
source organism Physeter catodon
molecule tags Oxygen transport
molecule keywords Myoglobin
total genus 63
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 5ilmA00
1Y0WB 2H8DA 4C44A 3P5QA 1GCVB 1LFTA 5CNFA 3OK5A 1MBIA 3V2ZA 1Y7DB 1HSYA 3BOMB 4UZVA 5MBAA 1MOHA 3WCUC 1B0BA 3ECLA 1DXTB 4F6IA 1MLLA 1XCHA 1JZKA 2ZS1A 3AQ7A 2MGKA 4H2LB 1Y4GB 1XQ5A 3OVUC 1RQAB 5JDOE 6HBIA 1A6KA 4O2GA 5EE4D 4ESAA 1LFZA 1BABA 2GTLB 2D2MC 1J7WA 4H0BA 2H35B 4M4AA 1MNJA 2QFNA 3UH3A 1RTXA 3WCTC 4F68A 1DXDA 2ZT4A 5JGGA 1DO3A 5D5RA 2QSPA 3VRGB 2W72B 1I3DA 1G0BA 1VHBA 3GQRA 2IN4A 4WJGA 1O1NA 2ZFOD 3E5IA 1VXBA 1YG5B 1VXEA 2O58X 3GKVB 3ONZB 1MTIA 1DXVB 1J7SA 1BZ6A 1ABSA 2JHOA 1Y35A 107MA 3BJ3B 3A5BA 3WCTA 2ZS0C 2W6XA 3BCQA 2GKMA 1IWHB 1AJHA 1YEUA 1YZIB 3E4NA 4TWUA 1YFFA 2QMBB 1JDOA 1HBSB 3K8BA 2MB5A 5CN4A 1X9FD 1K1KB 1Y4GA 1O1PA 1A0ZA 1XXTB 1FHJA 1MNHA 1FSLA 3PT8B 3G46A 3BJ2A 1IBEB 1Y46A 5B84A 3S66B 2BMMA 2H35A 1NEJB 1NS9B 3D1AA 2ZSQA 4N7OA 1MWCA 3PELA 3E55A 3HF4A 4KMVA 5ILPA 2SPNA 5F2AA 1B86B 1O1MA 1J41B 5E6EB 1CLSB 2LH3A 2RI4A 3UH6A 5CHRA 3TM9A 1DXUA 3MOUA 2PEGB 3ARJA 2O5SX 1SI4B 4MQJA 3HEOA 2EVKA 1I3EA 1RPSA 3AQ6A 1MBOA 1YEOB 1A00A 3AT6A 1Y8IB 1KD2A 1MBNA 5JDOD 2FRIX 3D1KB 1MLGA 3KUOA 1HGCA 2Z6TA 3EDBA 1S6AA 1Y01B 3KMFC 2ZT2A 1YGDB 4MQHB 2XKGA 2ZSTA 1YE0B 2QSSB 1JWNA 2G3HA 1KR7A 104MA 2LH5A 2MGEA 3OO5A 4O35A 1Y8WA 1JY7B 2ZFOB 1EW6A 1CH5A 1MLOA 1COHB 1OFJA 2G0VA 2NX0A 3LR7A 2EKUA 2D2ND 2PEGA 2G11A 1A3OB 1R1XA 3LQDA 1X46A 3K9ZA 3ARLA 2AURA 2HHEB 2B7HA 3NMMA 1BZ1B 4F6GA 4PNJA 3D1KA 1G9VB 2ZS1D 1BZZB 2AUQA 3MN0A 1F65A 1NIHA 4HHBB 1YMAA 2QRWA 5E29A 1V9QA 4NK1A 3H58A 1OUUB 2NRMA 1FAWA 2QSPB 1S0HA 3M38A 1MBSA 1LFYB 1SDKA 3NL7A 3ODQB 1Y0AA 2VM0A 1Y4QA 1LH5A 1GDIA 4KN3A 2DN2B 2DN1B 1NZ5A 106MA 1NS6A 4FH6A 3D4XB 1LFVA 4HRTB 5EUIB 4MBNA 1NGKA 4MQGB 3E5OA 3EOKB 3U3EA 2HBCB 5HLXA 1UIWB 1S61A 3H57A 2GRZA 1PBXB 1URVA 1YENB 2DHBA 3WFUA 2FALA 4N7NA 5CHQA 3NMMB 2M6ZA 3D17A 1IOPA 1QXEA 4N8TA 2OHAA 1KFRA 2HBDA 2VLZA 1YVTA 2HHBB 2HBEA 3ZJSA 1MTKA 1N9HA 2BNLA 5HY8B 1NIHB 1Y4FA 3UHWA 108MA 1Y45B 2ZS0A 1B86A 4PQCA 1CQXA 2IG3A 1NWNA 1TU9A 2MGJA 3CY5A 1U7RA 2HCOA 1Y8KB 1LFVB 1L2KA 2EKTA 4HRTA 1WVPA 3G53A 3UHRA 1RPSB 1ABYB 1CH7A 1V4WA 2DN3A 3A59A 1H1XA 4L7YA 4F4OB 1V4UB 1YVQB 1MLJA 1V75B 1HDBA 1S5YA 2HBDB 2BW9M 2ZLUB 1OFKA 2D2NC 4ROLA 1XZ2A 3P5QB 3QQQA 1C40A 4HRRA 2MYDA 3S65A 3WHMB 1FDHA 1FN3B 2CMMA 1Y4FB 1Y7DA 1Y45A 2V1JA 1J3YA 1JZMA 1F5OA 2Z85A 1YHUD 1YHUC 1HDAB 1BIJB 5EU2A 3WCVB 1QSIB 3CY5B 3BJ1A 4MQKA 2G0ZA 2V1FA 4N7PB 1HBAA 1ABWA 1QI8B 1QPWA 2D5ZA 3OGBA 3QJCB 4MQCB 4ZVBA 1SPEA 1G0BB 1HBBA 2HZ3A 3OZUA 3UHEA 1YOIA 1AJ9A 3PI4A 1MBAA 3GKVA 1CG5B 1UC3A 2ZSPA 2ZLVA 4L2MA 2SPMA 2D2NB 2MGLA 4FH7A 3PI9A 5E29B 3LB2A 5IKSA 4O4TA 3HC9A 1YZIA 3AQ5A 3HRWB 1GZXA 3QJEB 5KERB 1Y4BB 1HBSA 1YHEB 3OZVA 3EU1A 1S5XB 1QSIA 2ZLXA 2W6VB 3R5IB 2VYWA 1Y4PB 3RGKA 3HYUA 1UIWA 1NPGA 2MYAA 4ODCB 1AZIA 2ZT1A 3NFEA 2V1IA 3EDAA 1HBBB 5E6EA 1NXFA 2AV3A 3GK9A 4M4BA 4NXAA 2MGAA 1VRFA 2GNVA 2W6WA 3NG6A 2ZLVB 2AUPA 1BBBA 1CMYB 3ZJQA 3PI3A 3ZJLA 1MOCA 1Y0DA 1YCBA 1XZ4A 3W4UA 110MA 3FS4B 1YFFB 1DWTA 2ZFOC 5D1VA 1XXTA 1GBUA 3HENA 3QM8A 1S5XA 1Y8KA 3ECXA 2ZLXB 5CNDA 1Y7CA 1VXGA 2OH8A 2ZLWB 2MBWA 3WCWA 2R80A 4IROB 1G08A 1MGNA 1Y83A 1J3FA 2G10A 1JEBA 3MYMA 1OUTA 1Y8HB 2HHDB 1Y85B 3B75A 4B4YA 3WFXA 1Y0DB 3GYSA 1Y22B 2HBSB 1IRCA 1DO1A 1RVWA 1W92A 1T1NB 2KSCA 4U8UD 2B7HB 1A3NA 3RJNB 1ECOA 1MBDA 3QJBB 2O5TX 1G09A 2D2MA 1CIOA 1HV4A 3CIUA 5CN5A 3DR9A 5HU6B 2Z6NA 2FAMA 2ZS0D 1QPWB 4NI1A 4C0NA 1MNIA 1C7BB 5ILEA 2ZSZA 1LFYA 1XZUB 4X0LB 1F63A 1OBMA 4OODA 4MU5A 5JOMA 1JY7A 2ZFOA 3UI0A 3G52A 1MKOA 1YIEA 1COHA 1OR6A 1Y85A 3TLDA 2GTLA 2H8FB 1LFLB 1X9FA 1GCVA 1LFTB 1HACB 1UVYA 3ED9A 1Y2ZA 1MYZA 5MBNA 1CP0A 1URYA 3MKBB 1JL7A 5JGGB 4F6DA 4FWYA 3QZZA 4XS0B 3GQRB 3DHRB 3QJBA 1HLMA 1MYIA 3G4QA 1DTIA 3MJUA 3UHTA 3WR1A 2VLYA 3UHZA 3G4RA 3WFWA 2PGHA 1HV4B 6HBWA 3O7NA 2NSRA 5CN7A 5AB8A 2O5OX 1GLIB 1JW8A 1HJTA 2GRFA 3WCWD 1THBB 1U7SA 1SHRA 2FRKX 4DWTA 4X0LA 3GQGB 1C7CB 1HBRB 4UIQA 3ZHWA 2R4XA 1JZLA 1MYJA 1MKOB 5SW7B 3PT8A 4WJG1 1YEQA 4UURA 2O5MX 1MYTA 3HXNB 1O16A 3BCQB 1CPWA 1HCOA 1BUWA 1PBXA 1V4XB 2DHBB 3HHBA 5E83B 3QQRA 1RSEA 1UX9A 1J3ZA 3D17B 1MLKA 1DUKA 4ESAB 3DHRA 1S5YB 1EBTA 2DXMA 3UHBA 2PGHB 1Y0TB 103MA 3SDHA 2GDMA 2ZLWA 3PELB 1MCYA 3ASEA 1HBHA 1O1KB 1XZVB 1WLAA 1Y31A 1LUEA 2ZLTA 5ILRA 2D60A 3VRFA 1LH7A 4FC3A 1CLSA 3NMLA 1M6CA 1BVDA 1FLPA 2VLXA 1Y8HA 1MLSA 1CBLA 2HCOB 4G1BA 3QM6A 3PI2A 5HLQA 1DXCA 1T1NA 1MYGA 1JP8A 3GOUA 1VWTA 2QSSA 2EF2A 2MHBB 4U8UC 4IT8A 2D5XB 2GRHA 1O1OB 2MGDA 1G09B 2BWHA 4KJTA 1YMCA 5CNEA 1HDSB 3M39A 5HU6A 2MGBA 2VRYA 4FWXA 1Y0TA 1DO4A 4N7OB 2XKHA 1YGDA 1Y4VA 1Y5JA 1Y5KB 4NI0B 1YE2B 2AV0A 1SDLB 1UMOA 4AVDA 1XY0B 1R1XB 3UHGA 1BVCA 1LA6B 3WFTA 1CG8A 3WCVA 3WCTD 1HRMA 1MNOA 1FDHG 3D7OB 1ECNA 2Z6SA 3HYUB 1Y2ZB 1A6GA 1CH1A 1A3OA 1OUUA 1R1YB 1FAWB 1YEOA 1SWMA 3DHTB 2Z8AA 1MTJA 1A0UB 1XZ7A 1RQ4A 3VAUA 4G51A 4PQBA 3ZJOA 1G0AA 1JF4A 2D2NA 4VHBA 3UHQA 1Y0WA 1IDRA 4MQGA 3M3BA 2MGFA 1MODA 1XYEB 2BKMA 1WMUA 1GZXB 3QJEA 3GDJB 1UX8A 1M6MA 3UHYA 2DN1A 4N7NB 1MYFA 1NZ4A 1GDLA 1YDZA 1RQAA 1HHOA 2HHBA 2HBEB 5EUIA 4M4AB 4MBAA 3WTGB 3ZJIA 3WCUA 4HSXA 1QSHA 1BZ0A 1OJ6A 4SDHA 3HHBB 5E83A 5HAVA 4IROA 3LR9A 1BZ1A 1EBCA 1QXEB 1YG5A 1VXDA 1JEBB 2QU0B 1OUTB 4F6FA 1UT0A 3ONZA 5EQMA 2D6CA 1ITHA 2HHDA 1YEVA 1RQ3B 1S69A 3WCPB 3WCTB 2MYEA 4FWZA 2R4WA 2LH1A 1S56A 1MOAA 1YEUB 1RVWB 1IWHA 4B3WA 3VRFB 1EWAA 1Y0AB 2QMBA 1Y09B 5HBIA 3GDJA 3A59B 2GTLD 1GBUB 3UHDA 5CNBA 3MJPA 2C0KA 3BJ2B 1BINA 4MAXA 5CN8A 2ZLUA 1NEJA 3D1AB 3QZXA 1QSHB 1Z8UB 3FH9B 2VEEA 1X3KA 1Y4RB 4GZGA 1LTWA 3IA3B 4TWVA 1G08B 1MWBA 3VREA 1DM1A 3ZJHA 4F6BA 3DUTB 1FSXB 1LFQA 2DC3A 5EOHA 5ILMA 3KMFA 3S1IA 1Q1FA 3QM9A 2VHBA 4HRRB 3WHMA 4F6JA 4TYXA 4MPMA 2AA1A 1CIKA 1HGBB 1NQPB 1YCAA 3AT6B 1NAZA 1D8UA 1KD2B 1MYHA 1CH2A 1A00B 1CBMA 5CNCA 1Y0CA 1MLHA 3PI8B 3PIAA 2MGCA 2ZT0A 4MQKB 1YHUA 3D7OA 3MBAA 3ZJPA 2NSSA 1GBVB 1HGCB 1MBCA 5C6EB 3HEPA 1DO7A 2OHBA 4NI1B 1JP6A 4YU3B 4YU4A 3SDNA 5CMVA 1YHRA 2ZT3A 1JF3A 1AJGA 2GTLC 4L7YB 4F4OA 1CH9A 1C7DA 1A4FB 3QM7A 1YIHA 1YHEA 4ROMB 5CN9A 4H2LA 5KDQB 2EVPA 1MYMA 1YEQB 1LFLA 1OR4A 3UHHA 5AZRA 1HBGA 1O1JB 4F69A 4ODCA 1V4XA 1YOHA 2AA1B 1NQPA 3A9MA 1Y4BA 4ILZA 2HHEA 3LQDB 2GNWA 3EU1B 1VXHA 3BJ3A 1SPGA 4QAUA 4HHBA 1GLIA 1LJWA 1MLQA 1CO8A 3OZWA 3W4UB 1Y31B 2ZLTB 2R1HA 3A5AA 1NZ2A 2V1KA 1NPFA 2ZS1B 2ZSXA 1RQ3A 1Y5FB 2R4ZA 2HBCA 4U8UA 1CP5A 1HCOB 3ZJRA 1HGAB 3UBVA 2W31A 2D2MD 3OJ1A 3UHKA 1PMBA 3GOUB 3VRGA 1J3ZB 1YGFA 2D5XA 2V1HA 3MJPB 4ZVAA 1CH3A 4DC7A 1HDSA 1YVTB 1J7SB 1DXVA 3UH5A 1NWIA 1J7WB 5HY8A 3TM3A 3MVCA 2G0RA 1Y7CB 2HZ1A 3FH9A 3GKTA 1Y4VB 1Y5JB 1Y5KA 2V1GA 2BLHA 1SI4A 4MQJB 3LB3A 2YRSA 2D60B 5JDOF 1LHSA 1M9PA 2VEBA 1J52A 1LFQB 4WCHD 1Y35B 2HBFA 2D2MB 1Y5FA 3S1JA 1GJNA 101MA 1Y22A 1HGAA 2MGMA 3UGZA 3HF4B 1DUOA 1ABYA 2XKIA 3K8BB 1O1MB 3PI8A 1V4UA 4NXCA 3OO5B 1YHUB 3IC0A 1G0AB 2MGIA 1IBEA 2R4YA 5C6EA 1Y46B 3ECZA 1XZ2B 1A01B 1HABB 1J40A 2H8FA 2SPOA 4H07A 3ZH0A 4YU4B 5B85A 1HACA 1DLYA 4NI0A 3PT7A 3ZJJA 1CQ2A 1IT3A 2YRSB 1YIHB 4AVEA 1K0YB 2RI4B 2G0XA 1G9VA 1DXUB 1X9FB 1ABWB 2RAOB 1O1LA 112MA 1LH6A 1O1JA 1NZ3A 2LHBA 4MQHA 4MQCA 5JDOC 1SDKB 3NL7B 3ODQA 3UGYA 1AJ9B 4G51B 4JYQA 4XDIA 5EYSA 3MYNA 1MLRA 1CG5A 1DKEB 102MA 3WR1B 7HBIA 2ZSYA 2LH2A 2Z6NB 1GDKA 3IC2B 2GL3A 1A01A 1VREA 2H8DB 1LJWB 1C7BA 1IRDB 3OO4A 1XYEA 2ZSNA 1DLWA 3BOMA 2R1HB 2ZS1C 2V1EA 5KERA 1UVXA 1H97A 2WY4A 3QJDB 1C7CA 3G4YA 2WTHA 1CO9A 1N9FA 1YMBA 111MA 1YIEB 2SPLA 1Y7ZB 3UHNA 2HBGA 1BZZA 5HLUA 2DXMB 2MYCA 1RTEA 1Y4PA 3WCUB 1LH1A 3O89A 1BUWB 1GDJA 1FCSA 2EB9A 1F5PA 1Y4RA 2FRJX 1HBHB 1O1KA 4MQIB 3GQPA 3M3AA 3VREB 3V2VA 3AQ9A 1Y4QB 2WTGA 2DN2A 1DKEA 4M4BB 3NG6B 5M3SA 3K3UA 3UH7A 3A0GA 1BZPA 1CMYA 4NK2A 3FS4A 3OO4B 1EMYA 1Y7GB 4FC3B 1Y09A 4OF9A 2BLIA 2VYZA 3UHVA 1VWTB 2DN3B 1NS6B 1UFJA 1A0ZB 1O1OA 5SW7A 1FHJB 3D4XA 1V75A 3LB1A 1JL6A 2HBFB 1GBVA 1J7YA 3HXNA 1LH3A 3ZOLA 1NS9A 2ZSOA 1UFPA 1C40B 1FN3A 1YENA 2ZS0B 1GCWA 2W72A 1C7DB 1J41A 4LPIA 4N8TB 5KDQA 1O1NB 1FSXA 1MNKA 1CG8B 1LH2A 1HDAA 2G0SA 2MGHA 3A0GB 2AUOA 3GYSB 2QFKA 1YE2A 3PI1A 1QI8A 1HGBA 3UHSA 1MZ0A 4PQ6A 3RJ6A 3AG0A 1MLNA 1A3NB 1V4WB 1YH9B 2G14A 3PIAB 5C6YA 1K1KA 2GLNA 1O1IB 2MGGA 3G4VA 3CIUB 1IT2A 3G4UA 5CN6A 3IXFA 2RAOA 2FRFA 1SPGB 4DC8A 4YU3A 1R1YA 1YHRB 3QM5A 3UBCA 1MOBA 3AQ8A 1A0UA 1J3YB 1XZ7B 1BJEA 3HRWA 1GCWB 4G1VA 3AT5A 2OH9A 3KUNA 2ZSSA 3SZKA 1DWRA 1HHOB 4N7PA 3S65B 2HZ2A 2G12A 3WTGA 1BZRA 4U8UB 2QLSB 3G4WA 2D5ZB 2OLPA 3MKBA 5EE4C 1ECDA 3NFEB 4NZIA 3QJDA 1YGFB 1Y8IA 3VHBA 3WCVC 4XS0A 1YH9A 1YDZB 1BIJA 3UHXA 3QMAA 2ZFBB 3R0GA 6HBWB 1BBBB 1N9XA 1VXFA 4BJAA 3QJCA 2XYKA 4MQIA 3GQPB 1MLFA 1S0HB 1DXTA 1YE0A 2O5LX 1RQ4B 1X9FC 4HSWA 1ECAA 3A5GA 3GQGA 1M9PB 1V5HA 1QXDB 3AT5B 1HBRA 1SHRB 4O4ZA 2QU0A 5EYJA 2O5BX 1Y8WB 3SZKB 3WCPA 3LHBA 1VXCA 1HBIA 2W6VA 3PI9B 3R5IA 1VXAA 2ZSRA 3EOKA 3LB4A 1TESA 2E2YA 1WMUB 1Y7GA 2MYBA 1HLBA 1MLMA 3DUTA 3S48C 1A9WE 1J7YB 1HABA 3ZJMA 4MXLA 3B75B 1BZ0B 3A2GA 1XZVA 2BLJM 4DWUA 1MLUA 5F0BA 1MWDA 1XZ5B 1K0YA 1QXDA 1Y0CB 1O1PB 3WI8A 1YEVB 5EETA 5KKKA 1V07A 4MXKA 105MA 1O1LB 3S66A 1XZ4B 4HBIA 5EV5A 3WCWB 3UHCA 5AZQA 2MHBA 3ARKA 4O1TA 3WCVD 2GKNA 2M6ZB 1A4FA 1YVQA 2ZWJA 4NS2A 4ROMA 3UHUA 1O1IA 1A6MA 3IC0B 1YOGA 1JPBA 2LH6A 3IC2A 1J40B 3ZJNA 1MDNA 109MA 4ROLB 1LHTA 1IRDA 2BK9A 2VYYA 3PT7B 4JACA 2W6YA 3BA2A 2HBSA 1DTMA 2R80B 5CNGA 1XY0A 1N9IA 1SDLA 3ORDA 1Y83B 1LA6A 1XQ5B 1XZ5A 2R50A 1JP9A 3ZOMA 1LFZB 2NRLA 1Y7ZA 1BABB 1A6NA 3BJ1B 3MJUB 2OIFA 4KMWA 1HBAB 2QLSA 1ASHA 1CH4A 2LH7A 3UHIA 2EB8A 1DWSA 3DHTA 2W72C 1THBA 2O5QX 1XZUA 2ZFBA 1A9WA 3WCUD 1HDBB 3GLNA 1GVHA 3WCWC
chains in the Genus database with same CATH superfamily
1Y0WB 2H8DA 4C44A 3P5QA 1GCVB 1LFTA 2BV8B 5CNFA 3GIOA 3OK5A 1MBIA 3V2ZA 1Y7DB 1HSYA 3BOMB 4UZVA 5MBAA 1MOHA 3WCUC 1B0BA 3ECLA 1DXTB 4F6IA 1MLLA 1XCHA 1JZKA 2ZS1A 3AQ7A 2MGKA 4H2LB 1Y4GB 1XQ5A 3OVUC 1RQAB 5JDOE 6HBIA 1A6KA 4O2GA 5EE4D 4ESAA 1LFZA 1BABA 2GTLB 2D2MC 1J7WA 4H0BA 2H35B 4M4AA 1MNJA 4A8SA 2QFNA 3UH3A 1RTXA 3WCTC 4F68A 1ON7A 1DXDA 2VJHA 2ZT4A 5JGGA 1DO3A 5D5RA 2QSPA 3VRGB 2W72B 1I3DA 1G0BA 1VHBA 3GQRA 2IN4A 4WJGA 1O1NA 2ZFOD 3E5IA 1VXBA 1YG5B 1VXEA 2O58X 3GKVB 3ONZB 1MTIA 1DXVB 1J7SA 1BZ6A 1ABSA 2JHOA 2JLFA 2DKCA 1Y35A 107MA 3BJ3B 2X49A 3A5BA 3WCTA 2ZS0C 2W6XA 3BCQA 2GKMA 1IWHB 1AJHA 1YEUA 1YZIB 3E4NA 4TWUA 1YFFA 2QMBB 1JDOA 1HBSB 3K8BA 2MB5A 5CN4A 1X9FD 1K1KB 1Y4GA 1O1PA 1A0ZA 1XXTB 1FHJA 2UUMA 1MNHA 5FVBA 1FSLA 3PT8B 4AE0A 3G46A 3BJ2A 1IBEB 1Y46A 5B84A 3S66B 2BMMA 2H35A 1NEJB 1NS9B 1UVLA 3D1AA 2ZSQA 2C7JB 4N7OA 1MWCA 3PELA 3E55A 3HF4A 4KMVA 5ILPA 2SPNA 5F2AA 1B86B 1HI0P 1ALLB 1O1MA 1J41B 1B8DB 5E6EB 1CLSB 2LH3A 4Z8KB 2RI4A 3UH6A 5CHRA 3TM9A 1KTPA 1DXUA 3MOUA 2PEGB 3ARJA 2O5SX 1SI4B 4MQJA 4A8KA 3HEOA 1EYXA 2EVKA 1I3EA 1RPSA 3AQ6A 1MBOA 1YEOB 1A00A 2C7LB 3AT6A 1Y8IB 1KD2A 1MBNA 5JDOD 2FRIX 3D1KB 1MLGA 3KUOA 1HGCA 2Z6TA 4ZIZA 3EDBA 4A8YA 3PMCA 1S6AA 1CPCA 1Y01B 4L1EA 3KMFC 2ZT2A 1YGDB 4MQHB 2XKGA 2ZSTA 1HI8A 1YE0B 5AQDM 2QSSB 1JWNA 2G3HA 1KR7A 3O2CA 104MA 2LH5A 2MGEA 3OO5A 4O35A 1Y8WA 1JY7B 2ZFOB 1EW6A 1CH5A 1MLOA 1COHB 1OFJA 4XXKA 2G0VA 2NX0A 3LR7A 2EKUA 2D2ND 2PEGA 1RH1A 2G11A 1A3OB 1R1XA 3LQDA 1X46A 3K9ZA 3ARLA 2AURA 2HHEB 2B7HA 3NMMA 1BZ1B 4F6GA 4PNJA 3D1KA 1G9VB 2ZS1D 1BZZB 2AUQA 3MN0A 1F65A 1NIHA 4GXEB 4HHBB 1YMAA 2QRWA 5E29A 1V9QA 4NK1A 3H58A 1OUUB 2NRMA 4A8QA 1FAWA 2QSPB 1S0HA 3M38A 1MBSA 1LFYB 1SDKA 3NL7A 3ODQB 1Y0AA 2VM0A 5AQDA 1Y4QA 2WCRA 1LH5A 1GDIA 4KN3A 2DN2B 2DN1B 1NZ5A 106MA 1NS6A 1JBOB 4FH6A 3D4XB 1LFVA 4HRTB 5EUIB 4MBNA 1NGKA 4MQGB 3E5OA 3EOKB 3U3EA 2HBCB 5HLXA 1UIWB 1S61A 3H57A 2GRZA 3L0FA 1WACA 1PBXB 1URVA 1YENB 2DHBA 3WFUA 2FALA 4N7NA 5CHQA 3NMMB 2M6ZA 3D17A 1IOPA 1QXEA 4N8TA 4PO5A 3RQRA 2OHAA 1KFRA 2HBDA 2VLZA 1YVTA 2HHBB 2HBEA 3ZJSA 1MTKA 1N9HA 2BNLA 5HY8B 1NIHB 2C7JA 1Y4FA 3UHWA 108MA 1Y45B 2ZS0A 1B86A 4PQCA 1CQXA 2IG3A 1NWNA 1TU9A 2MGJA 3CY5A 1U7RA 2HCOA 1Y8KB 1LFVB 1L2KA 2EKTA 4HRTA 2DKAA 1WVPA 3V58A 3G53A 3UHRA 1RPSB 1ABYB 1GH0B 1CH7A 1V4WA 2DN3A 3A59A 1H1XA 4L7YA 4F4OB 1COLA 1V4UB 1YVQB 1MLJA 1V75B 1HDBA 1S5YA 2HBDB 2BW9M 2ZLUB 1OFKA 2D2NC 4ROLA 1XZ2A 3P5QB 3QQQA 1C40A 4HRRA 2MYDA 3S65A 3WHMB 1FDHA 1FN3B 2CMMA 1Y4FB 1Y7DA 1Y45A 2V1JA 1J3YA 1JZMA 1F5OA 2Z85A 3O18A 1YHUD 1YHUC 1HDAB 1BIJB 5EU2A 3WCVB 1QSIB 3CY5B 3BJ1A 4MQKA 2G0ZA 2V1FA 4N7PB 1HBAA 1ABWA 1QI8B 1QPWA 2D5ZA 3OGBA 3KVSB 3QJCB 4MQCB 4ZVBA 1SPEA 1G0BB 1HBBA 2HZ3A 3OZUA 3UHEA 1YOIA 1AJ9A 3PI4A 1MBAA 3GKVA 1A87A 1CG5B 1UC3A 2ZSPA 2ZLVA 4L2MA 2SPMA 2D2NB 2MGLA 4FH7A 3PI9A 5E29B 3LB2A 5IKSA 4GY3B 4O4TA 3HC9A 1YZIA 3ZTAA 3AQ5A 3HRWB 4AE1A 1GZXA 3QJEB 5KERB 1Y4BB 1HBSA 3O18B 1YHEB 3OZVA 3EU1A 1S5XB 2VJTB 3FEWX 1QSIA 2ZLXA 2W6VB 3R5IB 2VYWA 1Y4PB 3RGKA 3HYUA 1UIWA 1NPGA 2MYAA 4ODCB 1AZIA 2ZT1A 3NFEA 2V1IA 3EDAA 1HBBB 5E6EA 1NXFA 2AV3A 3GK9A 1UVMA 4M4BA 4NXAA 1TOXA 2MGAA 1VRFA 2GNVA 2W6WA 3NG6A 1KN1B 2ZLVB 2AUPA 1BBBA 1CMYB 3ZJQA 3PI3A 3ZJLA 1MOCA 1Y0DA 1YCBA 1XZ4A 3W4UA 110MA 3FS4B 1YFFB 1DWTA 2ZFOC 3DBJB 5D1VA 1XXTA 1GBUA 2UUMB 3HENA 4F0UB 3QM8A 1S5XA 1Y8KA 4ZIZB 3ECXA 2ZLXB 5CNDA 1Y7CA 1VXGA 2OH8A 2ZLWB 2MBWA 2UUMX 3WCWA 2R80A 4IROB 1G08A 1MGNA 1Y83A 1J3FA 2G10A 1JEBA 3MYMA 1OUTA 1Y8HB 1SGKA 2HHDB 1Y85B 1KN1A 3B75A 4B4YA 3WFXA 1Y0DB 3GYSA 1Y22B 2HBSB 1IRCA 1DO1A 1RVWA 1W92A 1T1NB 2KSCA 4U8UD 2B7HB 1A3NA 3RJNB 1ECOA 1MBDA 3QJBB 2O5TX 1G09A 2D2MA 4RMPB 1CIOA 1HV4A 3CIUA 5CN5A 3DR9A 5HU6B 2Z6NA 2FAMA 2ZS0D 1QPWB 4NI1A 4C0NA 1MNIA 1C7BB 5ILEA 2ZSZA 4YJJB 1LFYA 3GUQA 1XZUB 4X0LB 1F63A 1OBMA 4OODA 4MU5A 5JOMA 1JY7A 2ZFOA 3UI0A 4BS9A 3G52A 1MKOA 1YIEA 1COHA 1OR6A 1Y85A 3TLDA 2GTLA 2H8FB 1LFLB 1X9FA 1GCVA 1LFTB 2BV8A 4A8OA 1HACB 2UULH 1UVYA 3ED9A 1Y2ZA 1MYZA 5MBNA 1CP0A 1URYA 3MKBB 1JL7A 2VJHB 5JGGB 4F6DA 4FWYA 3QZZA 4XS0B 3GQRB 3DHRB 3QJBA 1HLMA 1MYIA 3G4QA 1DTIA 3MJUA 3UHTA 3WR1A 2VLYA 4ETVA 3UHZA 3G4RA 3WFWA 2PGHA 1HV4B 6HBWA 3O7NA 2NSRA 5CN7A 5AB8A 2O5OX 1GLIB 1JW8A 1HJTA 2GRFA 3WCWD 1THBB 1U7SA 1SHRA 2FRKX 4DWTA 4X0LA 3GQGB 1C7CB 1HBRB 4UIQA 3ZHWA 2R4XA 4Q70A 1JZLA 1MYJA 1MKOB 5SW7B 3PT8A 4WJG1 1YEQA 4UURA 2J96A 1PHNA 1UVKA 1MYTA 2O5MX 1O16A 3HXNB 3BCQB 1CPWA 1HCOA 1BUWA 1PBXA 1V4XB 2DHBB 3HHBA 5E83B 3QQRA 1RSEA 1UX9A 1J3ZA 3D17B 1MLKA 1DUKA 4ESAB 3DHRA 1S5YB 5FVBM 1EBTA 2DXMA 3UHBA 2PGHB 1Y0TB 103MA 3SDHA 2GDMA 2ZLWA 3PELB 1MCYA 3ASEA 1HBHA 1O1KB 1XZVB 1WLAA 1Y31A 1LUEA 2ZLTA 5ILRA 2D60A 3VRFA 1LH7A 4FC3A 1CLSA 3NMLA 1M6CA 2VJRB 1BVDA 1HA7B 1FLPA 2VLXA 1Y8HA 1MLSA 1CBLA 2HCOB 4B02A 4G1BA 3QM6A 3PI2A 5HLQA 1DXCA 1T1NA 1MYGA 1JP8A 3GOUA 1VWTA 1B33A 2QSSA 2EF2A 3V57B 2MHBB 4U8UC 4IT8A 2D5XB 2GRHA 1O1OB 2VMLA 2MGDA 1G09B 2BWHA 4KJTA 4BJUA 1YMCA 5CNEA 1HDSB 3M39A 5HU6A 2MGBA 2VRYA 4FWXA 1Y0TA 1DO4A 4N7OB 2XKHA 1YGDA 4GY3A 1Y4VA 1Y5JA 1Y5KB 4NI0B 1YE2B 2AV0A 1F0LA 1SDLB 1UMOA 4AVDA 1XY0B 1R1XB 3UHGA 1BVCA 2VJRA 1LA6B 3WFTA 1LIAB 1CG8A 3WCVA 3WCTD 1HRMA 1MNOA 1FDHG 3D7OB 1ECNA 1HHTP 2Z6SA 3HYUB 1Y2ZB 1A6GA 1CH1A 1A3OA 1OUUA 1R1YB 1FAWB 1YEOA 1SWMA 3DHTB 2Z8AA 1MTJA 1A0UB 1XZ7A 1RQ4A 3VAUA 4G51A 3MWNA 1MDTA 2UULB 4PQBA 3ZJOA 1G0AA 1CPCB 1JF4A 2D2NA 4VHBA 3UHQA 1Y0WA 1UVIA 1IDRA 4MQGA 3M3BA 2MGFA 1MODA 1XYEB 2BKMA 1WMUA 1GZXB 3QJEA 3GDJB 1UX8A 1M6MA 3UHYA 2DN1A 4N7NB 1MYFA 1NZ4A 3VNCA 1GDLA 1YDZA 1RQAA 1HHOA 2HHBA 2HBEB 5EUIA 4M4AB 4MBAA 3WTGB 3ZJIA 3WCUA 4HSXA 1QSHA 1BZ0A 1OJ6A 4SDHA 3HHBB 5E83A 5HAVA 4IROA 2UULD 3LR9A 1BZ1A 1EBCA 1QXEB 1YG5A 4PO5B 1VXDA 1JEBB 2QU0B 1OUTB 4F6FA 1UT0A 3ONZA 5EQMA 2D6CA 1ITHA 2HHDA 1YEVA 4GXEA 1RQ3B 1S69A 3WCPB 3WCTB 2MYEA 4FWZA 2R4WA 2LH1A 1S56A 1MOAA 1YEUB 4N6SA 1RVWB 1IWHA 4B3WA 3VRFB 1EWAA 1Y0AB 2QMBA 1Y09B 3GDJA 5HBIA 3A59B 2GTLD 1GBUB 3UHDA 4F0UA 5CNBA 3MJPA 2C0KA 2X4AA 3BJ2B 1BINA 4MAXA 5CN8A 2ZLUA 1NEJA 3D1AB 3QZXA 1QSHB 1Z8UB 3FH9B 2VEEA 1X3KA 1Y4RB 4GZGA 1LTWA 1B33B 3IA3B 4TWVA 1G08B 1MWBA 3VREA 1UVJA 1DM1A 3ZJHA 4Z8KA 4F6BA 3DUTB 1FSXB 1LFQA 2DC3A 5EOHA 2C7KB 5ILMA 3KMFA 4XXIA 3S1IA 1Q1FA 3QM9A 2VHBA 4HRRB 3WHMA 1I7YA 4F6JA 4TMAB 4TYXA 4MPMA 2AA1A 1CIKA 1HGBB 1NQPB 1YCAA 3AT6B 3BRPA 1NAZA 1D8UA 1KD2B 1MYHA 1CH2A 1A00B 1CBMA 2C7LA 5CNCA 1Y0CA 1MLHA 3PI8B 3PIAA 2MGCA 2ZT0A 4MQKB 1YHUA 3D7OA 3MBAA 3ZJPA 2NSSA 1GBVB 1HGCB 1MBCA 5C6EB 3HEPA 1DO7A 2OHBA 4NI1B 1JP6A 4YU3B 4YU4A 3SDNA 5CMVA 1YHRA 2ZT3A 1JF3A 1AJGA 2GTLC 4L7YB 4F4OA 1CH9A 1C7DA 1A4FB 3O2CB 3QM7A 1YIHA 1YHEA 4ROMB 5CN9A 4H2LA 5KDQB 2EVPA 1MYMA 2V8AB 1YEQB 1LFLA 1OR4A 5B13A 3UHHA 5AZRA 1HBGA 1O1JB 4F69A 4ODCA 1V4XA 1YOHA 2AA1B 1NQPA 3A9MA 1Y4BA 4ILZA 2HHEA 3BRPB 3LQDB 4F0TA 2GNWA 3EU1B 4ERTA 1VXHA 3BJ3A 1SPGA 4QAUA 1NY9A 4HHBA 1GLIA 1LJWA 1MLQA 1CO8A 2DKDA 3OZWA 3W4UB 1Y31B 2ZLTB 2R1HA 2UUNA 3A5AA 1NZ2A 2V1KA 1NPFA 2ZS1B 2ZSXA 1JBOA 1RQ3A 1Y5FB 2R4ZA 2HBCA 4U8UA 1CP5A 1HCOB 3ZJRA 1HGAB 3UBVA 2W31A 2D2MD 3OJ1A 1QGWC 3UHKA 1PMBA 3GOUB 3VRGA 3DBJA 1J3ZB 1YGFA 4A8MP 2JLGA 2D5XA 2V1HA 3MJPB 4ZVAA 1CH3A 4DC7A 1HDSA 1YVTB 1J7SB 1DXVA 3UH5A 1DDTA 1NWIA 1J7WB 5HY8A 3TM3A 3MVCA 2G0RA 1KTPB 2WCQA 1Y7CB 2HZ1A 3FH9A 3GKTA 1XF6C 1Y4VB 1Y5JB 1Y5KA 2V1GA 2BLHA 1SI4A 4MQJB 3LB3A 2YRSA 2D60B 5JDOF 1LHSA 1M9PA 3NUHB 2VEBA 1J52A 1LFQB 1XG0C 4WCHD 1UVNA 1Y35B 2HBFA 2D2MB 1Y5FA 3S1JA 1GJNA 101MA 4L1EB 1Y22A 1HGAA 2MGMA 3UGZA 3HF4B 1DUOA 4A8FA 1ABYA 1GH0A 2XKIA 3K8BB 1O1MB 3PI8A 1V4UA 4NXCA 3OO5B 3LQ9A 1YHUB 3IC0A 1G0AB 2MGIA 1IBEA 2R4YA 5C6EA 1Y46B 3ECZA 1XZ2B 1A01B 1HABB 1J40A 2H8FA 2SPOA 4H07A 3ZH0A 4YU4B 5B85A 1HACA 1DLYA 4NI0A 3PT7A 3ZJJA 1CQ2A 1IT3A 2YRSB 1YIHB 1LIAA 4AVEA 1K0YB 2RI4B 4A8WA 2G0XA 1G9VA 1DXUB 1X9FB 1ABWB 2RAOB 1O1LA 112MA 4LM6B 1LH6A 1O1JA 3KVSA 1NZ3A 2LHBA 4MQHA 4MQCA 5JDOC 1SDKB 3NL7B 3ODQA 3UGYA 1AJ9B 4G51B 4JYQA 4XDIA 5EYSA 3MYNA 4Q70B 1MLRA 1CG5A 1DKEB 102MA 3WR1B 7HBIA 4ETTA 2ZSYA 2LH2A 2Z6NB 1GDKA 2YSKA 3IC2B 2GL3A 1A01A 1VREA 2H8DB 1LJWB 1C7BA 1IRDB 3OO4A 1XYEA 2ZSNA 1DLWA 3BOMA 2R1HB 2ZS1C 2V1EA 5KERA 1UVXA 1H97A 2WY4A 3QJDB 1C7CA 3G4YA 2WTHA 1CO9A 1N9FA 1YMBA 111MA 1YIEB 2SPLA 3PMDA 1Y7ZB 3UHNA 2HBGA 1BZZA 5HLUA 2DXMB 2MYCA 2I88A 1RTEA 1PHNB 1Y4PA 3WCUB 1LH1A 3O89A 5B13G 1BUWB 1GDJA 4HH0A 2UUND 1FCSA 2EB9A 1F5PA 1Y4RA 2FRJX 1HBHB 1O1KA 4MQIB 3GQPA 3M3AA 3VREB 3V2VA 3AQ9A 1Y4QB 2WTGA 2DN2A 1DKEA 4M4BB 3NG6B 5M3SA 1F99B 3K3UA 3UH7A 3A0GA 1BZPA 1CMYA 1I7YB 4NK2A 4N6SB 3FS4A 3OO4B 1EMYA 3L0FB 1Y7GB 4FC3B 1Y09A 4OF9A 2BLIA 2VYZA 3UHVA 1VWTB 2DN3B 3V57A 1NS6B 1UFJA 1A0ZB 1O1OA 2VMLB 1FHJB 5SW7A 3D4XA 1V75A 3LB1A 1JL6A 2HBFB 4ERVA 1GBVA 1J7YA 3HXNA 1LH3A 3ZOLA 1NS9A 2ZSOA 1UFPA 1C40B 1FN3A 1YENA 2ZS0B 1GCWA 2W72A 1C7DB 1J41A 4LPIA 1B8DA 4N8TB 5KDQA 1O1NB 1FSXA 1MNKA 1CG8B 1LH2A 1HDAA 2G0SA 2MGHA 3A0GB 2AUOA 3GYSB 1CIIA 2QFKA 1YE2A 3PI1A 1QI8A 3V58B 1HGBA 3UHSA 1MZ0A 4HH1A 4PQ6A 2JL9A 3RJ6A 3AG0A 4F0TB 1MLNA 1A3NB 1V4WB 1YH9B 2G14A 3PIAB 5C6YA 1K1KA 2GLNA 1O1IB 2MGGA 3G4VA 3CIUB 1IT2A 3G4UA 4RMPA 5CN6A 3IXFA 2RAOA 2FRFA 1SPGB 4DC8A 4YU3A 1R1YA 1YHRB 3QM5A 3UBCA 1MOBA 2UUNB 3AQ8A 4YJJA 1A0UA 1J3YB 1XZ7B 1BJEA 3HRWA 1GCWB 4G1VA 3AT5A 2OH9A 3KUNA 2ZSSA 3SZKA 2VJTA 2V8AA 1DWRA 1HHOB 4N7PA 3S65B 2HZ2A 2G12A 3WTGA 1BZRA 4U8UB 2QLSB 3G4WA 2D5ZB 2OLPA 3MKBA 1EYXB 4LMSB 5EE4C 1ECDA 3NFEB 4NZIA 3QJDA 1YGFB 1Y8IA 3VHBA 3WCVC 4XS0A 1YH9A 1YDZB 1BIJA 3UHXA 1XDTT 3QMAA 2ZFBB 3R0GA 6HBWB 1BBBB 1N9XA 1VXFA 4BJAA 3QJCA 2XYKA 4MQIA 4ESUA 3GQPB 1MLFA 1S0HB 1DXTA 1YE0A 2O5LX 1RQ4B 1X9FC 4HSWA 1ECAA 3A5GA 3GQGA 1M9PB 1V5HA 1QXDB 1HI1A 3AT5B 1HBRA 1SHRB 4O4ZA 2QU0A 5EYJA 2O5BX 1Y8WB 3SZKB 1F99A 3WCPA 3LHBA 1VXCA 1HBIA 2W6VA 3PI9B 3R5IA 1VXAA 2ZSRA 3EOKA 3LB4A 1TESA 2E2YA 1WMUB 1Y7GA 2MYBA 1HLBA 1MLMA 3DUTA 3S48C 2C7KA 1A9WE 1J7YB 1HABA 3ZJMA 4MXLA 3B75B 1BZ0B 3A2GA 1XZVA 2BLJM 4DWUA 1HHSA 1MLUA 5F0BA 1MWDA 1HA7A 1XZ5B 1K0YA 1QXDA 1Y0CB 1O1PB 3WI8A 4H0MA 1YEVB 5EETA 5KKKA 1V07A 4MXKA 4LMXB 105MA 1O1LB 3S66A 1XZ4B 4HBIA 5EV5A 3WCWB 3UHCA 1ALLA 5AZQA 2MHBA 3ARKA 4O1TA 3WCVD 2GKNA 2M6ZB 1A4FA 1YVQA 2ZWJA 4NS2A 4ROMA 3UHUA 1O1IA 1A6MA 3IC0B 1YOGA 1JPBA 2LH6A 3IC2A 1J40B 3ZJNA 1MDNA 109MA 4ROLB 1LHTA 1IRDA 2BK9A 2VYYA 3PT7B 4JACA 2W6YA 3BA2A 2HBSA 1DTMA 2R80B 5CNGA 1XY0A 1N9IA 1SDLA 3ORDA 4ETUA 1Y83B 2UULC 1LA6A 1XQ5B 1XZ5A 2R50A 1JP9A 3ZOMA 1LFZB 2NRLA 1Y7ZA 4H0MB 1BABB 1A6NA 3BJ1B 3MJUB 2OIFA 4KMWA 1HBAB 2QLSA 1ASHA 1CH4A 2LH7A 1ON7B 3UHIA 2EB8A 1DWSA 3DHTA 2W72C 1THBA 2O5QX 1XZUA 2ZFBA 1A9WA 3WCUD 1HDBB 3GLNA 2UULA 1GVHA 3WCWC
chains in the Genus database with same CATH topology
1Y0WB 2H8DA 4C44A 3P5QA 1GCVB 1LFTA 5CNFA 3OK5A 1MBIA 3V2ZA 1Y7DB 1HSYA 3BOMB 4UZVA 5MBAA 1MOHA 3WCUC 1B0BA 3ECLA 1DXTB 4F6IA 1MLLA 1XCHA 1JZKA 2ZS1A 3AQ7A 2MGKA 4H2LB 1Y4GB 1XQ5A 3OVUC 1RQAB 5JDOE 6HBIA 1A6KA 4O2GA 5EE4D 4ESAA 1LFZA 1BABA 2GTLB 2D2MC 1J7WA 4H0BA 2H35B 4M4AA 1MNJA 2QFNA 3UH3A 1RTXA 3WCTC 4F68A 1DXDA 2ZT4A 5JGGA 1DO3A 5D5RA 2QSPA 3VRGB 2W72B 1I3DA 1G0BA 1VHBA 3GQRA 2IN4A 4WJGA 1O1NA 2ZFOD 3E5IA 1VXBA 1YG5B 1VXEA 2O58X 3GKVB 3ONZB 1MTIA 1DXVB 1J7SA 1BZ6A 1ABSA 2JHOA 1Y35A 107MA 3BJ3B 3A5BA 3WCTA 2ZS0C 2W6XA 3BCQA 2GKMA 1IWHB 1AJHA 1YEUA 1YZIB 3E4NA 4TWUA 1YFFA 2QMBB 1JDOA 1HBSB 3K8BA 2MB5A 5CN4A 1X9FD 1K1KB 1Y4GA 1O1PA 1A0ZA 1XXTB 1FHJA 1MNHA 1FSLA 3PT8B 3G46A 3BJ2A 1IBEB 1Y46A 5B84A 3S66B 2BMMA 2H35A 1NEJB 1NS9B 3D1AA 2ZSQA 4N7OA 1MWCA 3PELA 3E55A 3HF4A 4KMVA 5ILPA 2SPNA 5F2AA 1B86B 1O1MA 1J41B 5E6EB 1CLSB 2LH3A 2RI4A 3UH6A 5CHRA 3TM9A 1DXUA 3MOUA 2PEGB 3ARJA 2O5SX 1SI4B 4MQJA 3HEOA 2EVKA 1I3EA 1RPSA 3AQ6A 1MBOA 1YEOB 1A00A 3AT6A 1Y8IB 1KD2A 1MBNA 5JDOD 2FRIX 3D1KB 1MLGA 3KUOA 1HGCA 2Z6TA 3EDBA 1S6AA 1Y01B 3KMFC 2ZT2A 1YGDB 4MQHB 2XKGA 2ZSTA 1YE0B 2QSSB 1JWNA 2G3HA 1KR7A 104MA 2LH5A 2MGEA 3OO5A 4O35A 1Y8WA 1JY7B 2ZFOB 1EW6A 1CH5A 1MLOA 1COHB 1OFJA 2G0VA 2NX0A 3LR7A 2EKUA 2D2ND 2PEGA 2G11A 1A3OB 1R1XA 3LQDA 1X46A 3K9ZA 3ARLA 2AURA 2HHEB 2B7HA 3NMMA 1BZ1B 4F6GA 4PNJA 3D1KA 1G9VB 2ZS1D 1BZZB 2AUQA 3MN0A 1F65A 1NIHA 4HHBB 1YMAA 2QRWA 5E29A 1V9QA 4NK1A 3H58A 1OUUB 2NRMA 1FAWA 2QSPB 1S0HA 3M38A 1MBSA 1LFYB 1SDKA 3NL7A 3ODQB 1Y0AA 2VM0A 1Y4QA 1LH5A 1GDIA 4KN3A 2DN2B 2DN1B 1NZ5A 106MA 1NS6A 4FH6A 3D4XB 1LFVA 4HRTB 5EUIB 4MBNA 1NGKA 4MQGB 3E5OA 3EOKB 3U3EA 2HBCB 5HLXA 1UIWB 1S61A 3H57A 2GRZA 1PBXB 1URVA 1YENB 2DHBA 3WFUA 2FALA 4N7NA 5CHQA 3NMMB 2M6ZA 3D17A 1IOPA 1QXEA 4N8TA 2OHAA 1KFRA 2HBDA 2VLZA 1YVTA 2HHBB 2HBEA 3ZJSA 1MTKA 1N9HA 2BNLA 5HY8B 1NIHB 1Y4FA 3UHWA 108MA 1Y45B 2ZS0A 1B86A 4PQCA 1CQXA 2IG3A 1NWNA 1TU9A 2MGJA 3CY5A 1U7RA 2HCOA 1Y8KB 1LFVB 1L2KA 2EKTA 4HRTA 1WVPA 3G53A 3UHRA 1RPSB 1ABYB 1CH7A 1V4WA 2DN3A 3A59A 1H1XA 4L7YA 4F4OB 1V4UB 1YVQB 1MLJA 1V75B 1HDBA 1S5YA 2HBDB 2BW9M 2ZLUB 1OFKA 2D2NC 4ROLA 1XZ2A 3P5QB 3QQQA 1C40A 4HRRA 2MYDA 3S65A 3WHMB 1FDHA 1FN3B 2CMMA 1Y4FB 1Y7DA 1Y45A 2V1JA 1J3YA 1JZMA 1F5OA 2Z85A 1YHUD 1YHUC 1HDAB 1BIJB 5EU2A 3WCVB 1QSIB 3CY5B 3BJ1A 4MQKA 2G0ZA 2V1FA 4N7PB 1HBAA 1ABWA 1QI8B 1QPWA 2D5ZA 3OGBA 3QJCB 4MQCB 4ZVBA 1SPEA 1G0BB 1HBBA 2HZ3A 3OZUA 3UHEA 1YOIA 1AJ9A 3PI4A 1MBAA 3GKVA 1CG5B 1UC3A 2ZSPA 2ZLVA 4L2MA 2SPMA 2D2NB 2MGLA 4FH7A 3PI9A 5E29B 3LB2A 5IKSA 4O4TA 3HC9A 1YZIA 3AQ5A 3HRWB 1GZXA 3QJEB 5KERB 1Y4BB 1HBSA 1YHEB 3OZVA 3EU1A 1S5XB 1QSIA 2ZLXA 2W6VB 3R5IB 2VYWA 1Y4PB 3RGKA 3HYUA 1UIWA 1NPGA 2MYAA 4ODCB 1AZIA 2ZT1A 3NFEA 2V1IA 3EDAA 1HBBB 5E6EA 1NXFA 2AV3A 3GK9A 4M4BA 4NXAA 2MGAA 1VRFA 2GNVA 2W6WA 3NG6A 2ZLVB 2AUPA 1BBBA 1CMYB 3ZJQA 3PI3A 3ZJLA 1MOCA 1Y0DA 1YCBA 1XZ4A 3W4UA 110MA 3FS4B 1YFFB 1DWTA 2ZFOC 5D1VA 1XXTA 1GBUA 3HENA 3QM8A 1S5XA 1Y8KA 3ECXA 2ZLXB 5CNDA 1Y7CA 1VXGA 2OH8A 2ZLWB 2MBWA 3WCWA 2R80A 4IROB 1G08A 1MGNA 1Y83A 1J3FA 2G10A 1JEBA 3MYMA 1OUTA 1Y8HB 2HHDB 1Y85B 3B75A 4B4YA 3WFXA 1Y0DB 3GYSA 1Y22B 2HBSB 1IRCA 1DO1A 1RVWA 1W92A 1T1NB 2KSCA 4U8UD 2B7HB 1A3NA 3RJNB 1ECOA 1MBDA 3QJBB 2O5TX 1G09A 2D2MA 1CIOA 1HV4A 3CIUA 5CN5A 3DR9A 5HU6B 2Z6NA 2FAMA 2ZS0D 1QPWB 4NI1A 4C0NA 1MNIA 1C7BB 5ILEA 2ZSZA 1LFYA 1XZUB 4X0LB 1F63A 1OBMA 4OODA 4MU5A 5JOMA 1JY7A 2ZFOA 3UI0A 3G52A 1MKOA 1YIEA 1COHA 1OR6A 1Y85A 3TLDA 2GTLA 2H8FB 1LFLB 1X9FA 1GCVA 1LFTB 1HACB 1UVYA 3ED9A 1Y2ZA 1MYZA 5MBNA 1CP0A 1URYA 3MKBB 1JL7A 5JGGB 4F6DA 4FWYA 3QZZA 4XS0B 3GQRB 3DHRB 3QJBA 1HLMA 1MYIA 3G4QA 1DTIA 3MJUA 3UHTA 3WR1A 2VLYA 3UHZA 3G4RA 3WFWA 2PGHA 1HV4B 6HBWA 3O7NA 2NSRA 5CN7A 5AB8A 2O5OX 1GLIB 1JW8A 1HJTA 2GRFA 3WCWD 1THBB 1U7SA 1SHRA 2FRKX 4DWTA 4X0LA 3GQGB 1C7CB 1HBRB 4UIQA 3ZHWA 2R4XA 1JZLA 1MYJA 1MKOB 5SW7B 3PT8A 4WJG1 1YEQA 4UURA 2O5MX 1MYTA 3HXNB 1O16A 3BCQB 1CPWA 1HCOA 1BUWA 1PBXA 1V4XB 2DHBB 3HHBA 5E83B 3QQRA 1RSEA 1UX9A 1J3ZA 3D17B 1MLKA 1DUKA 4ESAB 3DHRA 1S5YB 1EBTA 2DXMA 3UHBA 2PGHB 1Y0TB 103MA 3SDHA 2GDMA 2ZLWA 3PELB 1MCYA 3ASEA 1HBHA 1O1KB 1XZVB 1WLAA 1Y31A 1LUEA 2ZLTA 5ILRA 2D60A 3VRFA 1LH7A 4FC3A 1CLSA 3NMLA 1M6CA 1BVDA 1FLPA 2VLXA 1Y8HA 1MLSA 1CBLA 2HCOB 4G1BA 3QM6A 3PI2A 5HLQA 1DXCA 1T1NA 1MYGA 1JP8A 3GOUA 1VWTA 2QSSA 2EF2A 2MHBB 4U8UC 4IT8A 2D5XB 2GRHA 1O1OB 2MGDA 1G09B 2BWHA 4KJTA 1YMCA 5CNEA 1HDSB 3M39A 5HU6A 2MGBA 2VRYA 4FWXA 1Y0TA 1DO4A 4N7OB 2XKHA 1YGDA 1Y4VA 1Y5JA 1Y5KB 4NI0B 1YE2B 2AV0A 1SDLB 1UMOA 4AVDA 1XY0B 1R1XB 3UHGA 1BVCA 1LA6B 3WFTA 1CG8A 3WCVA 3WCTD 1HRMA 1MNOA 1FDHG 3D7OB 1ECNA 2Z6SA 3HYUB 1Y2ZB 1A6GA 1CH1A 1A3OA 1OUUA 1R1YB 1FAWB 1YEOA 1SWMA 3DHTB 2Z8AA 1MTJA 1A0UB 1XZ7A 1RQ4A 3VAUA 4G51A 4PQBA 3ZJOA 1G0AA 1JF4A 2D2NA 4VHBA 3UHQA 1Y0WA 1IDRA 4MQGA 3M3BA 2MGFA 1MODA 1XYEB 2BKMA 1WMUA 1GZXB 3QJEA 3GDJB 1UX8A 1M6MA 3UHYA 2DN1A 4N7NB 1MYFA 1NZ4A 1GDLA 1YDZA 1RQAA 1HHOA 2HHBA 2HBEB 5EUIA 4M4AB 4MBAA 3WTGB 3ZJIA 3WCUA 4HSXA 1QSHA 1BZ0A 1OJ6A 4SDHA 3HHBB 5E83A 5HAVA 4IROA 3LR9A 1BZ1A 1EBCA 1QXEB 1YG5A 1VXDA 1JEBB 2QU0B 1OUTB 4F6FA 1UT0A 3ONZA 5EQMA 2D6CA 1ITHA 2HHDA 1YEVA 1RQ3B 1S69A 3WCPB 3WCTB 2MYEA 4FWZA 2R4WA 2LH1A 1S56A 1MOAA 1YEUB 1RVWB 1IWHA 4B3WA 3VRFB 1EWAA 1Y0AB 2QMBA 1Y09B 5HBIA 3GDJA 3A59B 2GTLD 1GBUB 3UHDA 5CNBA 3MJPA 2C0KA 3BJ2B 1BINA 4MAXA 5CN8A 2ZLUA 1NEJA 3D1AB 3QZXA 1QSHB 1Z8UB 3FH9B 2VEEA 1X3KA 1Y4RB 4GZGA 1LTWA 3IA3B 4TWVA 1G08B 1MWBA 3VREA 1DM1A 3ZJHA 4F6BA 3DUTB 1FSXB 1LFQA 2DC3A 5EOHA 5ILMA 3KMFA 3S1IA 1Q1FA 3QM9A 2VHBA 4HRRB 3WHMA 4F6JA 4TYXA 4MPMA 2AA1A 1CIKA 1HGBB 1NQPB 1YCAA 3AT6B 1NAZA 1D8UA 1KD2B 1MYHA 1CH2A 1A00B 1CBMA 5CNCA 1Y0CA 1MLHA 3PI8B 3PIAA 2MGCA 2ZT0A 4MQKB 1YHUA 3D7OA 3MBAA 3ZJPA 2NSSA 1GBVB 1HGCB 1MBCA 5C6EB 3HEPA 1DO7A 2OHBA 4NI1B 1JP6A 4YU3B 4YU4A 3SDNA 5CMVA 1YHRA 2ZT3A 1JF3A 1AJGA 2GTLC 4L7YB 4F4OA 1CH9A 1C7DA 1A4FB 3QM7A 1YIHA 1YHEA 4ROMB 5CN9A 4H2LA 5KDQB 2EVPA 1MYMA 1YEQB 1LFLA 1OR4A 3UHHA 5AZRA 1HBGA 1O1JB 4F69A 4ODCA 1V4XA 1YOHA 2AA1B 1NQPA 3A9MA 1Y4BA 4ILZA 2HHEA 3LQDB 2GNWA 3EU1B 1VXHA 3BJ3A 1SPGA 4QAUA 4HHBA 1GLIA 1LJWA 1MLQA 1CO8A 3OZWA 3W4UB 1Y31B 2ZLTB 2R1HA 3A5AA 1NZ2A 2V1KA 1NPFA 2ZS1B 2ZSXA 1RQ3A 1Y5FB 2R4ZA 2HBCA 4U8UA 1CP5A 1HCOB 3ZJRA 1HGAB 3UBVA 2W31A 2D2MD 3OJ1A 3UHKA 1PMBA 3GOUB 3VRGA 1J3ZB 1YGFA 2D5XA 2V1HA 3MJPB 4ZVAA 1CH3A 4DC7A 1HDSA 1YVTB 1J7SB 1DXVA 3UH5A 1NWIA 1J7WB 5HY8A 3TM3A 3MVCA 2G0RA 1Y7CB 2HZ1A 3FH9A 3GKTA 1Y4VB 1Y5JB 1Y5KA 2V1GA 2BLHA 1SI4A 4MQJB 3LB3A 2YRSA 2D60B 5JDOF 1LHSA 1M9PA 2VEBA 1J52A 1LFQB 4WCHD 1Y35B 2HBFA 2D2MB 1Y5FA 3S1JA 1GJNA 101MA 1Y22A 1HGAA 2MGMA 3UGZA 3HF4B 1DUOA 1ABYA 2XKIA 3K8BB 1O1MB 3PI8A 1V4UA 4NXCA 3OO5B 1YHUB 3IC0A 1G0AB 2MGIA 1IBEA 2R4YA 5C6EA 1Y46B 3ECZA 1XZ2B 1A01B 1HABB 1J40A 2H8FA 2SPOA 4H07A 3ZH0A 4YU4B 5B85A 1HACA 1DLYA 4NI0A 3PT7A 3ZJJA 1CQ2A 1IT3A 2YRSB 1YIHB 4AVEA 1K0YB 2RI4B 2G0XA 1G9VA 1DXUB 1X9FB 1ABWB 2RAOB 1O1LA 112MA 1LH6A 1O1JA 1NZ3A 2LHBA 4MQHA 4MQCA 5JDOC 1SDKB 3NL7B 3ODQA 3UGYA 1AJ9B 4G51B 4JYQA 4XDIA 5EYSA 3MYNA 1MLRA 1CG5A 1DKEB 102MA 3WR1B 7HBIA 2ZSYA 2LH2A 2Z6NB 1GDKA 3IC2B 2GL3A 1A01A 1VREA 2H8DB 1LJWB 1C7BA 1IRDB 3OO4A 1XYEA 2ZSNA 1DLWA 3BOMA 2R1HB 2ZS1C 2V1EA 5KERA 1UVXA 1H97A 2WY4A 3QJDB 1C7CA 3G4YA 2WTHA 1CO9A 1N9FA 1YMBA 111MA 1YIEB 2SPLA 1Y7ZB 3UHNA 2HBGA 1BZZA 5HLUA 2DXMB 2MYCA 1RTEA 1Y4PA 3WCUB 1LH1A 3O89A 1BUWB 1GDJA 1FCSA 2EB9A 1F5PA 1Y4RA 2FRJX 1HBHB 1O1KA 4MQIB 3GQPA 3M3AA 3VREB 3V2VA 3AQ9A 1Y4QB 2WTGA 2DN2A 1DKEA 4M4BB 3NG6B 5M3SA 3K3UA 3UH7A 3A0GA 1BZPA 1CMYA 4NK2A 3FS4A 3OO4B 1EMYA 1Y7GB 4FC3B 1Y09A 4OF9A 2BLIA 2VYZA 3UHVA 1VWTB 2DN3B 1NS6B 1UFJA 1A0ZB 1O1OA 5SW7A 1FHJB 3D4XA 1V75A 3LB1A 1JL6A 2HBFB 1GBVA 1J7YA 3HXNA 1LH3A 3ZOLA 1NS9A 2ZSOA 1UFPA 1C40B 1FN3A 1YENA 2ZS0B 1GCWA 2W72A 1C7DB 1J41A 4LPIA 4N8TB 5KDQA 1O1NB 1FSXA 1MNKA 1CG8B 1LH2A 1HDAA 2G0SA 2MGHA 3A0GB 2AUOA 3GYSB 2QFKA 1YE2A 3PI1A 1QI8A 1HGBA 3UHSA 1MZ0A 4PQ6A 3RJ6A 3AG0A 1MLNA 1A3NB 1V4WB 1YH9B 2G14A 3PIAB 5C6YA 1K1KA 2GLNA 1O1IB 2MGGA 3G4VA 3CIUB 1IT2A 3G4UA 5CN6A 3IXFA 2RAOA 2FRFA 1SPGB 4DC8A 4YU3A 1R1YA 1YHRB 3QM5A 3UBCA 1MOBA 3AQ8A 1A0UA 1J3YB 1XZ7B 1BJEA 3HRWA 1GCWB 4G1VA 3AT5A 2OH9A 3KUNA 2ZSSA 3SZKA 1DWRA 1HHOB 4N7PA 3S65B 2HZ2A 2G12A 3WTGA 1BZRA 4U8UB 2QLSB 3G4WA 2D5ZB 2OLPA 3MKBA 5EE4C 1ECDA 3NFEB 4NZIA 3QJDA 1YGFB 1Y8IA 3VHBA 3WCVC 4XS0A 1YH9A 1YDZB 1BIJA 3UHXA 3QMAA 2ZFBB 3R0GA 6HBWB 1BBBB 1N9XA 1VXFA 4BJAA 3QJCA 2XYKA 4MQIA 3GQPB 1MLFA 1S0HB 1DXTA 1YE0A 2O5LX 1RQ4B 1X9FC 4HSWA 1ECAA 3A5GA 3GQGA 1M9PB 1V5HA 1QXDB 3AT5B 1HBRA 1SHRB 4O4ZA 2QU0A 5EYJA 2O5BX 1Y8WB 3SZKB 3WCPA 3LHBA 1VXCA 1HBIA 2W6VA 3PI9B 3R5IA 1VXAA 2ZSRA 3EOKA 3LB4A 1TESA 2E2YA 1WMUB 1Y7GA 2MYBA 1HLBA 1MLMA 3DUTA 3S48C 1A9WE 1J7YB 1HABA 3ZJMA 4MXLA 3B75B 1BZ0B 3A2GA 1XZVA 2BLJM 4DWUA 1MLUA 5F0BA 1MWDA 1XZ5B 1K0YA 1QXDA 1Y0CB 1O1PB 3WI8A 1YEVB 5EETA 5KKKA 1V07A 4MXKA 105MA 1O1LB 3S66A 1XZ4B 4HBIA 5EV5A 3WCWB 3UHCA 5AZQA 2MHBA 3ARKA 4O1TA 3WCVD 2GKNA 2M6ZB 1A4FA 1YVQA 2ZWJA 4NS2A 4ROMA 3UHUA 1O1IA 1A6MA 3IC0B 1YOGA 1JPBA 2LH6A 3IC2A 1J40B 3ZJNA 1MDNA 109MA 4ROLB 1LHTA 1IRDA 2BK9A 2VYYA 3PT7B 4JACA 2W6YA 3BA2A 2HBSA 1DTMA 2R80B 5CNGA 1XY0A 1N9IA 1SDLA 3ORDA 1Y83B 1LA6A 1XQ5B 1XZ5A 2R50A 1JP9A 3ZOMA 1LFZB 2NRLA 1Y7ZA 1BABB 1A6NA 3BJ1B 3MJUB 2OIFA 4KMWA 1HBAB 2QLSA 1ASHA 1CH4A 2LH7A 3UHIA 2EB8A 1DWSA 3DHTA 2W72C 1THBA 2O5QX 1XZUA 2ZFBA 1A9WA 3WCUD 1HDBB 3GLNA 1GVHA 3WCWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0W B;  2H8D A;  4C44 A;  3P5Q A;  1GCV B;  1LFT A;  5CNF A;  3OK5 A;  1MBI A;  3V2Z A;  1Y7D B;  1HSY A;  3BOM B;  4UZV A;  5MBA A;  1MOH A;  3WCU C;  1B0B A;  3ECL A;  1DXT B;  4F6I A;  1MLL A;  1XCH A;  1JZK A;  2ZS1 A;  3AQ7 A;  2MGK A;  4H2L B;  1Y4G B;  1XQ5 A;  3OVU C;  1RQA B;  5JDO E;  6HBI A;  1A6K A;  4O2G A;  5EE4 D;  4ESA A;  1LFZ A;  1BAB A;  2GTL B;  2D2M C;  1J7W A;  4H0B A;  2H35 B;  4M4A A;  1MNJ A;  2QFN A;  3UH3 A;  1RTX A;  3WCT C;  4F68 A;  1DXD A;  2ZT4 A;  5JGG A;  1DO3 A;  5D5R A;  2QSP A;  3VRG B;  2W72 B;  1I3D A;  1G0B A;  1VHB A;  3GQR A;  2IN4 A;  4WJG A;  1O1N A;  2ZFO D;  3E5I A;  1VXB A;  1YG5 B;  1VXE A;  2O58 X;  3GKV B;  3ONZ B;  1MTI A;  1DXV B;  1J7S A;  1BZ6 A;  1ABS A;  2JHO A;  1Y35 A;  107M A;  3BJ3 B;  3A5B A;  3WCT A;  2ZS0 C;  2W6X A;  3BCQ A;  2GKM A;  1IWH B;  1AJH A;  1YEU A;  1YZI B;  3E4N A;  4TWU A;  1YFF A;  2QMB B;  1JDO A;  1HBS B;  3K8B A;  2MB5 A;  5CN4 A;  1X9F D;  1K1K B;  1Y4G A;  1O1P A;  1A0Z A;  1XXT B;  1FHJ A;  1MNH A;  1FSL A;  3PT8 B;  3G46 A;  3BJ2 A;  1IBE B;  1Y46 A;  5B84 A;  3S66 B;  2BMM A;  2H35 A;  1NEJ B;  1NS9 B;  3D1A A;  2ZSQ A;  4N7O A;  1MWC A;  3PEL A;  3E55 A;  3HF4 A;  4KMV A;  5ILP A;  2SPN A;  5F2A A;  1B86 B;  1O1M A;  1J41 B;  5E6E B;  1CLS B;  2LH3 A;  2RI4 A;  3UH6 A;  5CHR A;  3TM9 A;  1DXU A;  3MOU A;  2PEG B;  3ARJ A;  2O5S X;  1SI4 B;  4MQJ A;  3HEO A;  2EVK A;  1I3E A;  1RPS A;  3AQ6 A;  1MBO A;  1YEO B;  1A00 A;  3AT6 A;  1Y8I B;  1KD2 A;  1MBN A;  5JDO D;  2FRI X;  3D1K B;  1MLG A;  3KUO A;  1HGC A;  2Z6T A;  3EDB A;  1S6A A;  1Y01 B;  3KMF C;  2ZT2 A;  1YGD B;  4MQH B;  2XKG A;  2ZST A;  1YE0 B;  2QSS B;  1JWN A;  2G3H A;  1KR7 A;  104M A;  2LH5 A;  2MGE A;  3OO5 A;  4O35 A;  1Y8W A;  1JY7 B;  2ZFO B;  1EW6 A;  1CH5 A;  1MLO A;  1COH B;  1OFJ A;  2G0V A;  2NX0 A;  3LR7 A;  2EKU A;  2D2N D;  2PEG A;  2G11 A;  1A3O B;  1R1X A;  3LQD A;  1X46 A;  3K9Z A;  3ARL A;  2AUR A;  2HHE B;  2B7H A;  3NMM A;  1BZ1 B;  4F6G A;  4PNJ A;  3D1K A;  1G9V B;  2ZS1 D;  1BZZ B;  2AUQ A;  3MN0 A;  1F65 A;  1NIH A;  4HHB B;  1YMA A;  2QRW A;  5E29 A;  1V9Q A;  4NK1 A;  3H58 A;  1OUU B;  2NRM A;  1FAW A;  2QSP B;  1S0H A;  3M38 A;  1MBS A;  1LFY B;  1SDK A;  3NL7 A;  3ODQ B;  1Y0A A;  2VM0 A;  1Y4Q A;  1LH5 A;  1GDI A;  4KN3 A;  2DN2 B;  2DN1 B;  1NZ5 A;  106M A;  1NS6 A;  4FH6 A;  3D4X B;  1LFV A;  4HRT B;  5EUI B;  4MBN A;  1NGK A;  4MQG B;  3E5O A;  3EOK B;  3U3E A;  2HBC B;  5HLX A;  1UIW B;  1S61 A;  3H57 A;  2GRZ A;  1PBX B;  1URV A;  1YEN B;  2DHB A;  3WFU A;  2FAL A;  4N7N A;  5CHQ A;  3NMM B;  2M6Z A;  3D17 A;  1IOP A;  1QXE A;  4N8T A;  2OHA A;  1KFR A;  2HBD A;  2VLZ A;  1YVT A;  2HHB B;  2HBE A;  3ZJS A;  1MTK A;  1N9H A;  2BNL A;  5HY8 B;  1NIH B;  1Y4F A;  3UHW A;  108M A;  1Y45 B;  2ZS0 A;  1B86 A;  4PQC A;  1CQX A;  2IG3 A;  1NWN A;  1TU9 A;  2MGJ A;  3CY5 A;  1U7R A;  2HCO A;  1Y8K B;  1LFV B;  1L2K A;  2EKT A;  4HRT A;  1WVP A;  3G53 A;  3UHR A;  1RPS B;  1ABY B;  1CH7 A;  1V4W A;  2DN3 A;  3A59 A;  1H1X A;  4L7Y A;  4F4O B;  1V4U B;  1YVQ B;  1MLJ A;  1V75 B;  1HDB A;  1S5Y A;  2HBD B;  2BW9 M;  2ZLU B;  1OFK A;  2D2N C;  4ROL A;  1XZ2 A;  3P5Q B;  3QQQ A;  1C40 A;  4HRR A;  2MYD A;  3S65 A;  3WHM B;  1FDH A;  1FN3 B;  2CMM A;  1Y4F B;  1Y7D A;  1Y45 A;  2V1J A;  1J3Y A;  1JZM A;  1F5O A;  2Z85 A;  1YHU D;  1YHU C;  1HDA B;  1BIJ B;  5EU2 A;  3WCV B;  1QSI B;  3CY5 B;  3BJ1 A;  4MQK A;  2G0Z A;  2V1F A;  4N7P B;  1HBA A;  1ABW A;  1QI8 B;  1QPW A;  2D5Z A;  3OGB A;  3QJC B;  4MQC B;  4ZVB A;  1SPE A;  1G0B B;  1HBB A;  2HZ3 A;  3OZU A;  3UHE A;  1YOI A;  1AJ9 A;  3PI4 A;  1MBA A;  3GKV A;  1CG5 B;  1UC3 A;  2ZSP A;  2ZLV A;  4L2M A;  2SPM A;  2D2N B;  2MGL A;  4FH7 A;  3PI9 A;  5E29 B;  3LB2 A;  5IKS A;  4O4T A;  3HC9 A;  1YZI A;  3AQ5 A;  3HRW B;  1GZX A;  3QJE B;  5KER B;  1Y4B B;  1HBS A;  1YHE B;  3OZV A;  3EU1 A;  1S5X B;  1QSI A;  2ZLX A;  2W6V B;  3R5I B;  2VYW A;  1Y4P B;  3RGK A;  3HYU A;  1UIW A;  1NPG A;  2MYA A;  4ODC B;  1AZI A;  2ZT1 A;  3NFE A;  2V1I A;  3EDA A;  1HBB B;  5E6E A;  1NXF A;  2AV3 A;  3GK9 A;  4M4B A;  4NXA A;  2MGA A;  1VRF A;  2GNV A;  2W6W A;  3NG6 A;  2ZLV B;  2AUP A;  1BBB A;  1CMY B;  3ZJQ A;  3PI3 A;  3ZJL A;  1MOC A;  1Y0D A;  1YCB A;  1XZ4 A;  3W4U A;  110M A;  3FS4 B;  1YFF B;  1DWT A;  2ZFO C;  5D1V A;  1XXT A;  1GBU A;  3HEN A;  3QM8 A;  1S5X A;  1Y8K A;  3ECX A;  2ZLX B;  5CND A;  1Y7C A;  1VXG A;  2OH8 A;  2ZLW B;  2MBW A;  3WCW A;  2R80 A;  4IRO B;  1G08 A;  1MGN A;  1Y83 A;  1J3F A;  2G10 A;  1JEB A;  3MYM A;  1OUT A;  1Y8H B;  2HHD B;  1Y85 B;  3B75 A;  4B4Y A;  3WFX A;  1Y0D B;  3GYS A;  1Y22 B;  2HBS B;  1IRC A;  1DO1 A;  1RVW A;  1W92 A;  1T1N B;  2KSC A;  4U8U D;  2B7H B;  1A3N A;  3RJN B;  1ECO A;  1MBD A;  3QJB B;  2O5T X;  1G09 A;  2D2M A;  1CIO A;  1HV4 A;  3CIU A;  5CN5 A;  3DR9 A;  5HU6 B;  2Z6N A;  2FAM A;  2ZS0 D;  1QPW B;  4NI1 A;  4C0N A;  1MNI A;  1C7B B;  5ILE A;  2ZSZ A;  1LFY A;  1XZU B;  4X0L B;  1F63 A;  1OBM A;  4OOD A;  4MU5 A;  5JOM A;  1JY7 A;  2ZFO A;  3UI0 A;  3G52 A;  1MKO A;  1YIE A;  1COH A;  1OR6 A;  1Y85 A;  3TLD A;  2GTL A;  2H8F B;  1LFL B;  1X9F A;  1GCV A;  1LFT B;  1HAC B;  1UVY A;  3ED9 A;  1Y2Z A;  1MYZ A;  5MBN A;  1CP0 A;  1URY A;  3MKB B;  1JL7 A;  5JGG B;  4F6D A;  4FWY A;  3QZZ A;  4XS0 B;  3GQR B;  3DHR B;  3QJB A;  1HLM A;  1MYI A;  3G4Q A;  1DTI A;  3MJU A;  3UHT A;  3WR1 A;  2VLY A;  3UHZ A;  3G4R A;  3WFW A;  2PGH A;  1HV4 B;  6HBW A;  3O7N A;  2NSR A;  5CN7 A;  5AB8 A;  2O5O X;  1GLI B;  1JW8 A;  1HJT A;  2GRF A;  3WCW D;  1THB B;  1U7S A;  1SHR A;  2FRK X;  4DWT A;  4X0L A;  3GQG B;  1C7C B;  1HBR B;  4UIQ A;  3ZHW A;  2R4X A;  1JZL A;  1MYJ A;  1MKO B;  5SW7 B;  3PT8 A;  4WJG 1;  1YEQ A;  4UUR A;  2O5M X;  1MYT A;  3HXN B;  1O16 A;  3BCQ B;  1CPW A;  1HCO A;  1BUW A;  1PBX A;  1V4X B;  2DHB B;  3HHB A;  5E83 B;  3QQR A;  1RSE A;  1UX9 A;  1J3Z A;  3D17 B;  1MLK A;  1DUK A;  4ESA B;  3DHR A;  1S5Y B;  1EBT A;  2DXM A;  3UHB A;  2PGH B;  1Y0T B;  103M A;  3SDH A;  2GDM A;  2ZLW A;  3PEL B;  1MCY A;  3ASE A;  1HBH A;  1O1K B;  1XZV B;  1WLA A;  1Y31 A;  1LUE A;  2ZLT A;  5ILR A;  2D60 A;  3VRF A;  1LH7 A;  4FC3 A;  1CLS A;  3NML A;  1M6C A;  1BVD A;  1FLP A;  2VLX A;  1Y8H A;  1MLS A;  1CBL A;  2HCO B;  4G1B A;  3QM6 A;  3PI2 A;  5HLQ A;  1DXC A;  1T1N A;  1MYG A;  1JP8 A;  3GOU A;  1VWT A;  2QSS A;  2EF2 A;  2MHB B;  4U8U C;  4IT8 A;  2D5X B;  2GRH A;  1O1O B;  2MGD A;  1G09 B;  2BWH A;  4KJT A;  1YMC A;  5CNE A;  1HDS B;  3M39 A;  5HU6 A;  2MGB A;  2VRY A;  4FWX A;  1Y0T A;  1DO4 A;  4N7O B;  2XKH A;  1YGD A;  1Y4V A;  1Y5J A;  1Y5K B;  4NI0 B;  1YE2 B;  2AV0 A;  1SDL B;  1UMO A;  4AVD A;  1XY0 B;  1R1X B;  3UHG A;  1BVC A;  1LA6 B;  3WFT A;  1CG8 A;  3WCV A;  3WCT D;  1HRM A;  1MNO A;  1FDH G;  3D7O B;  1ECN A;  2Z6S A;  3HYU B;  1Y2Z B;  1A6G A;  1CH1 A;  1A3O A;  1OUU A;  1R1Y B;  1FAW B;  1YEO A;  1SWM A;  3DHT B;  2Z8A A;  1MTJ A;  1A0U B;  1XZ7 A;  1RQ4 A;  3VAU A;  4G51 A;  4PQB A;  3ZJO A;  1G0A A;  1JF4 A;  2D2N A;  4VHB A;  3UHQ A;  1Y0W A;  1IDR A;  4MQG A;  3M3B A;  2MGF A;  1MOD A;  1XYE B;  2BKM A;  1WMU A;  1GZX B;  3QJE A;  3GDJ B;  1UX8 A;  1M6M A;  3UHY A;  2DN1 A;  4N7N B;  1MYF A;  1NZ4 A;  1GDL A;  1YDZ A;  1RQA A;  1HHO A;  2HHB A;  2HBE B;  5EUI A;  4M4A B;  4MBA A;  3WTG B;  3ZJI A;  3WCU A;  4HSX A;  1QSH A;  1BZ0 A;  1OJ6 A;  4SDH A;  3HHB B;  5E83 A;  5HAV A;  4IRO A;  3LR9 A;  1BZ1 A;  1EBC A;  1QXE B;  1YG5 A;  1VXD A;  1JEB B;  2QU0 B;  1OUT B;  4F6F A;  1UT0 A;  3ONZ A;  5EQM A;  2D6C A;  1ITH A;  2HHD A;  1YEV A;  1RQ3 B;  1S69 A;  3WCP B;  3WCT B;  2MYE A;  4FWZ A;  2R4W A;  2LH1 A;  1S56 A;  1MOA A;  1YEU B;  1RVW B;  1IWH A;  4B3W A;  3VRF B;  1EWA A;  1Y0A B;  2QMB A;  1Y09 B;  5HBI A;  3GDJ A;  3A59 B;  2GTL D;  1GBU B;  3UHD A;  5CNB A;  3MJP A;  2C0K A;  3BJ2 B;  1BIN A;  4MAX A;  5CN8 A;  2ZLU A;  1NEJ A;  3D1A B;  3QZX A;  1QSH B;  1Z8U B;  3FH9 B;  2VEE A;  1X3K A;  1Y4R B;  4GZG A;  1LTW A;  3IA3 B;  4TWV A;  1G08 B;  1MWB A;  3VRE A;  1DM1 A;  3ZJH A;  4F6B A;  3DUT B;  1FSX B;  1LFQ A;  2DC3 A;  5EOH A;  5ILM A;  3KMF A;  3S1I A;  1Q1F A;  3QM9 A;  2VHB A;  4HRR B;  3WHM A;  4F6J A;  4TYX A;  4MPM A;  2AA1 A;  1CIK A;  1HGB B;  1NQP B;  1YCA A;  3AT6 B;  1NAZ A;  1D8U A;  1KD2 B;  1MYH A;  1CH2 A;  1A00 B;  1CBM A;  5CNC A;  1Y0C A;  1MLH A;  3PI8 B;  3PIA A;  2MGC A;  2ZT0 A;  4MQK B;  1YHU A;  3D7O A;  3MBA A;  3ZJP A;  2NSS A;  1GBV B;  1HGC B;  1MBC A;  5C6E B;  3HEP A;  1DO7 A;  2OHB A;  4NI1 B;  1JP6 A;  4YU3 B;  4YU4 A;  3SDN A;  5CMV A;  1YHR A;  2ZT3 A;  1JF3 A;  1AJG A;  2GTL C;  4L7Y B;  4F4O A;  1CH9 A;  1C7D A;  1A4F B;  3QM7 A;  1YIH A;  1YHE A;  4ROM B;  5CN9 A;  4H2L A;  5KDQ B;  2EVP A;  1MYM A;  1YEQ B;  1LFL A;  1OR4 A;  3UHH A;  5AZR A;  1HBG A;  1O1J B;  4F69 A;  4ODC A;  1V4X A;  1YOH A;  2AA1 B;  1NQP A;  3A9M A;  1Y4B A;  4ILZ A;  2HHE A;  3LQD B;  2GNW A;  3EU1 B;  1VXH A;  3BJ3 A;  1SPG A;  4QAU A;  4HHB A;  1GLI A;  1LJW A;  1MLQ A;  1CO8 A;  3OZW A;  3W4U B;  1Y31 B;  2ZLT B;  2R1H A;  3A5A A;  1NZ2 A;  2V1K A;  1NPF A;  2ZS1 B;  2ZSX A;  1RQ3 A;  1Y5F B;  2R4Z A;  2HBC A;  4U8U A;  1CP5 A;  1HCO B;  3ZJR A;  1HGA B;  3UBV A;  2W31 A;  2D2M D;  3OJ1 A;  3UHK A;  1PMB A;  3GOU B;  3VRG A;  1J3Z B;  1YGF A;  2D5X A;  2V1H A;  3MJP B;  4ZVA A;  1CH3 A;  4DC7 A;  1HDS A;  1YVT B;  1J7S B;  1DXV A;  3UH5 A;  1NWI A;  1J7W B;  5HY8 A;  3TM3 A;  3MVC A;  2G0R A;  1Y7C B;  2HZ1 A;  3FH9 A;  3GKT A;  1Y4V B;  1Y5J B;  1Y5K A;  2V1G A;  2BLH A;  1SI4 A;  4MQJ B;  3LB3 A;  2YRS A;  2D60 B;  5JDO F;  1LHS A;  1M9P A;  2VEB A;  1J52 A;  1LFQ B;  4WCH D;  1Y35 B;  2HBF A;  2D2M B;  1Y5F A;  3S1J A;  1GJN A;  101M A;  1Y22 A;  1HGA A;  2MGM A;  3UGZ A;  3HF4 B;  1DUO A;  1ABY A;  2XKI A;  3K8B B;  1O1M B;  3PI8 A;  1V4U A;  4NXC A;  3OO5 B;  1YHU B;  3IC0 A;  1G0A B;  2MGI A;  1IBE A;  2R4Y A;  5C6E A;  1Y46 B;  3ECZ A;  1XZ2 B;  1A01 B;  1HAB B;  1J40 A;  2H8F A;  2SPO A;  4H07 A;  3ZH0 A;  4YU4 B;  5B85 A;  1HAC A;  1DLY A;  4NI0 A;  3PT7 A;  3ZJJ A;  1CQ2 A;  1IT3 A;  2YRS B;  1YIH B;  4AVE A;  1K0Y B;  2RI4 B;  2G0X A;  1G9V A;  1DXU B;  1X9F B;  1ABW B;  2RAO B;  1O1L A;  112M A;  1LH6 A;  1O1J A;  1NZ3 A;  2LHB A;  4MQH A;  4MQC A;  5JDO C;  1SDK B;  3NL7 B;  3ODQ A;  3UGY A;  1AJ9 B;  4G51 B;  4JYQ A;  4XDI A;  5EYS A;  3MYN A;  1MLR A;  1CG5 A;  1DKE B;  102M A;  3WR1 B;  7HBI A;  2ZSY A;  2LH2 A;  2Z6N B;  1GDK A;  3IC2 B;  2GL3 A;  1A01 A;  1VRE A;  2H8D B;  1LJW B;  1C7B A;  1IRD B;  3OO4 A;  1XYE A;  2ZSN A;  1DLW A;  3BOM A;  2R1H B;  2ZS1 C;  2V1E A;  5KER A;  1UVX A;  1H97 A;  2WY4 A;  3QJD B;  1C7C A;  3G4Y A;  2WTH A;  1CO9 A;  1N9F A;  1YMB A;  111M A;  1YIE B;  2SPL A;  1Y7Z B;  3UHN A;  2HBG A;  1BZZ A;  5HLU A;  2DXM B;  2MYC A;  1RTE A;  1Y4P A;  3WCU B;  1LH1 A;  3O89 A;  1BUW B;  1GDJ A;  1FCS A;  2EB9 A;  1F5P A;  1Y4R A;  2FRJ X;  1HBH B;  1O1K A;  4MQI B;  3GQP A;  3M3A A;  3VRE B;  3V2V A;  3AQ9 A;  1Y4Q B;  2WTG A;  2DN2 A;  1DKE A;  4M4B B;  3NG6 B;  5M3S A;  3K3U A;  3UH7 A;  3A0G A;  1BZP A;  1CMY A;  4NK2 A;  3FS4 A;  3OO4 B;  1EMY A;  1Y7G B;  4FC3 B;  1Y09 A;  4OF9 A;  2BLI A;  2VYZ A;  3UHV A;  1VWT B;  2DN3 B;  1NS6 B;  1UFJ A;  1A0Z B;  1O1O A;  5SW7 A;  1FHJ B;  3D4X A;  1V75 A;  3LB1 A;  1JL6 A;  2HBF B;  1GBV A;  1J7Y A;  3HXN A;  1LH3 A;  3ZOL A;  1NS9 A;  2ZSO A;  1UFP A;  1C40 B;  1FN3 A;  1YEN A;  2ZS0 B;  1GCW A;  2W72 A;  1C7D B;  1J41 A;  4LPI A;  4N8T B;  5KDQ A;  1O1N B;  1FSX A;  1MNK A;  1CG8 B;  1LH2 A;  1HDA A;  2G0S A;  2MGH A;  3A0G B;  2AUO A;  3GYS B;  2QFK A;  1YE2 A;  3PI1 A;  1QI8 A;  1HGB A;  3UHS A;  1MZ0 A;  4PQ6 A;  3RJ6 A;  3AG0 A;  1MLN A;  1A3N B;  1V4W B;  1YH9 B;  2G14 A;  3PIA B;  5C6Y A;  1K1K A;  2GLN A;  1O1I B;  2MGG A;  3G4V A;  3CIU B;  1IT2 A;  3G4U A;  5CN6 A;  3IXF A;  2RAO A;  2FRF A;  1SPG B;  4DC8 A;  4YU3 A;  1R1Y A;  1YHR B;  3QM5 A;  3UBC A;  1MOB A;  3AQ8 A;  1A0U A;  1J3Y B;  1XZ7 B;  1BJE A;  3HRW A;  1GCW B;  4G1V A;  3AT5 A;  2OH9 A;  3KUN A;  2ZSS A;  3SZK A;  1DWR A;  1HHO B;  4N7P A;  3S65 B;  2HZ2 A;  2G12 A;  3WTG A;  1BZR A;  4U8U B;  2QLS B;  3G4W A;  2D5Z B;  2OLP A;  3MKB A;  5EE4 C;  1ECD A;  3NFE B;  4NZI A;  3QJD A;  1YGF B;  1Y8I A;  3VHB A;  3WCV C;  4XS0 A;  1YH9 A;  1YDZ B;  1BIJ A;  3UHX A;  3QMA A;  2ZFB B;  3R0G A;  6HBW B;  1BBB B;  1N9X A;  1VXF A;  4BJA A;  3QJC A;  2XYK A;  4MQI A;  3GQP B;  1MLF A;  1S0H B;  1DXT A;  1YE0 A;  2O5L X;  1RQ4 B;  1X9F C;  4HSW A;  1ECA A;  3A5G A;  3GQG A;  1M9P B;  1V5H A;  1QXD B;  3AT5 B;  1HBR A;  1SHR B;  4O4Z A;  2QU0 A;  5EYJ A;  2O5B X;  1Y8W B;  3SZK B;  3WCP A;  3LHB A;  1VXC A;  1HBI A;  2W6V A;  3PI9 B;  3R5I A;  1VXA A;  2ZSR A;  3EOK A;  3LB4 A;  1TES A;  2E2Y A;  1WMU B;  1Y7G A;  2MYB A;  1HLB A;  1MLM A;  3DUT A;  3S48 C;  1A9W E;  1J7Y B;  1HAB A;  3ZJM A;  4MXL A;  3B75 B;  1BZ0 B;  3A2G A;  1XZV A;  2BLJ M;  4DWU A;  1MLU A;  5F0B A;  1MWD A;  1XZ5 B;  1K0Y A;  1QXD A;  1Y0C B;  1O1P B;  3WI8 A;  1YEV B;  5EET A;  5KKK A;  1V07 A;  4MXK A;  105M A;  1O1L B;  3S66 A;  1XZ4 B;  4HBI A;  5EV5 A;  3WCW B;  3UHC A;  5AZQ A;  2MHB A;  3ARK A;  4O1T A;  3WCV D;  2GKN A;  2M6Z B;  1A4F A;  1YVQ A;  2ZWJ A;  4NS2 A;  4ROM A;  3UHU A;  1O1I A;  1A6M A;  3IC0 B;  1YOG A;  1JPB A;  2LH6 A;  3IC2 A;  1J40 B;  3ZJN A;  1MDN A;  109M A;  4ROL B;  1LHT A;  1IRD A;  2BK9 A;  2VYY A;  3PT7 B;  4JAC A;  2W6Y A;  3BA2 A;  2HBS A;  1DTM A;  2R80 B;  5CNG A;  1XY0 A;  1N9I A;  1SDL A;  3ORD A;  1Y83 B;  1LA6 A;  1XQ5 B;  1XZ5 A;  2R50 A;  1JP9 A;  3ZOM A;  1LFZ B;  2NRL A;  1Y7Z A;  1BAB B;  1A6N A;  3BJ1 B;  3MJU B;  2OIF A;  4KMW A;  1HBA B;  2QLS A;  1ASH A;  1CH4 A;  2LH7 A;  3UHI A;  2EB8 A;  1DWS A;  3DHT A;  2W72 C;  1THB A;  2O5Q X;  1XZU A;  2ZFB A;  1A9W A;  3WCU D;  1HDB B;  3GLN A;  1GVH A;  3WCW C; 
#chains in the Genus database with same CATH topology
 1Y0W B;  2H8D A;  4C44 A;  3P5Q A;  1GCV B;  1LFT A;  2BV8 B;  5CNF A;  3GIO A;  3OK5 A;  1MBI A;  3V2Z A;  1Y7D B;  1HSY A;  3BOM B;  4UZV A;  5MBA A;  1MOH A;  3WCU C;  1B0B A;  3ECL A;  1DXT B;  4F6I A;  1MLL A;  1XCH A;  1JZK A;  2ZS1 A;  3AQ7 A;  2MGK A;  4H2L B;  1Y4G B;  1XQ5 A;  3OVU C;  1RQA B;  5JDO E;  6HBI A;  1A6K A;  4O2G A;  5EE4 D;  4ESA A;  1LFZ A;  1BAB A;  2GTL B;  2D2M C;  1J7W A;  4H0B A;  2H35 B;  4M4A A;  1MNJ A;  4A8S A;  2QFN A;  3UH3 A;  1RTX A;  3WCT C;  4F68 A;  1ON7 A;  1DXD A;  2VJH A;  2ZT4 A;  5JGG A;  1DO3 A;  5D5R A;  2QSP A;  3VRG B;  2W72 B;  1I3D A;  1G0B A;  1VHB A;  3GQR A;  2IN4 A;  4WJG A;  1O1N A;  2ZFO D;  3E5I A;  1VXB A;  1YG5 B;  1VXE A;  2O58 X;  3GKV B;  3ONZ B;  1MTI A;  1DXV B;  1J7S A;  1BZ6 A;  1ABS A;  2JHO A;  2JLF A;  2DKC A;  1Y35 A;  107M A;  3BJ3 B;  2X49 A;  3A5B A;  3WCT A;  2ZS0 C;  2W6X A;  3BCQ A;  2GKM A;  1IWH B;  1AJH A;  1YEU A;  1YZI B;  3E4N A;  4TWU A;  1YFF A;  2QMB B;  1JDO A;  1HBS B;  3K8B A;  2MB5 A;  5CN4 A;  1X9F D;  1K1K B;  1Y4G A;  1O1P A;  1A0Z A;  1XXT B;  1FHJ A;  2UUM A;  1MNH A;  5FVB A;  1FSL A;  3PT8 B;  4AE0 A;  3G46 A;  3BJ2 A;  1IBE B;  1Y46 A;  5B84 A;  3S66 B;  2BMM A;  2H35 A;  1NEJ B;  1NS9 B;  1UVL A;  3D1A A;  2ZSQ A;  2C7J B;  4N7O A;  1MWC A;  3PEL A;  3E55 A;  3HF4 A;  4KMV A;  5ILP A;  2SPN A;  5F2A A;  1B86 B;  1HI0 P;  1ALL B;  1O1M A;  1J41 B;  1B8D B;  5E6E B;  1CLS B;  2LH3 A;  4Z8K B;  2RI4 A;  3UH6 A;  5CHR A;  3TM9 A;  1KTP A;  1DXU A;  3MOU A;  2PEG B;  3ARJ A;  2O5S X;  1SI4 B;  4MQJ A;  4A8K A;  3HEO A;  1EYX A;  2EVK A;  1I3E A;  1RPS A;  3AQ6 A;  1MBO A;  1YEO B;  1A00 A;  2C7L B;  3AT6 A;  1Y8I B;  1KD2 A;  1MBN A;  5JDO D;  2FRI X;  3D1K B;  1MLG A;  3KUO A;  1HGC A;  2Z6T A;  4ZIZ A;  3EDB A;  4A8Y A;  3PMC A;  1S6A A;  1CPC A;  1Y01 B;  4L1E A;  3KMF C;  2ZT2 A;  1YGD B;  4MQH B;  2XKG A;  2ZST A;  1HI8 A;  1YE0 B;  5AQD M;  2QSS B;  1JWN A;  2G3H A;  1KR7 A;  3O2C A;  104M A;  2LH5 A;  2MGE A;  3OO5 A;  4O35 A;  1Y8W A;  1JY7 B;  2ZFO B;  1EW6 A;  1CH5 A;  1MLO A;  1COH B;  1OFJ A;  4XXK A;  2G0V A;  2NX0 A;  3LR7 A;  2EKU A;  2D2N D;  2PEG A;  1RH1 A;  2G11 A;  1A3O B;  1R1X A;  3LQD A;  1X46 A;  3K9Z A;  3ARL A;  2AUR A;  2HHE B;  2B7H A;  3NMM A;  1BZ1 B;  4F6G A;  4PNJ A;  3D1K A;  1G9V B;  2ZS1 D;  1BZZ B;  2AUQ A;  3MN0 A;  1F65 A;  1NIH A;  4GXE B;  4HHB B;  1YMA A;  2QRW A;  5E29 A;  1V9Q A;  4NK1 A;  3H58 A;  1OUU B;  2NRM A;  4A8Q A;  1FAW A;  2QSP B;  1S0H A;  3M38 A;  1MBS A;  1LFY B;  1SDK A;  3NL7 A;  3ODQ B;  1Y0A A;  2VM0 A;  5AQD A;  1Y4Q A;  2WCR A;  1LH5 A;  1GDI A;  4KN3 A;  2DN2 B;  2DN1 B;  1NZ5 A;  106M A;  1NS6 A;  1JBO B;  4FH6 A;  3D4X B;  1LFV A;  4HRT B;  5EUI B;  4MBN A;  1NGK A;  4MQG B;  3E5O A;  3EOK B;  3U3E A;  2HBC B;  5HLX A;  1UIW B;  1S61 A;  3H57 A;  2GRZ A;  3L0F A;  1WAC A;  1PBX B;  1URV A;  1YEN B;  2DHB A;  3WFU A;  2FAL A;  4N7N A;  5CHQ A;  3NMM B;  2M6Z A;  3D17 A;  1IOP A;  1QXE A;  4N8T A;  4PO5 A;  3RQR A;  2OHA A;  1KFR A;  2HBD A;  2VLZ A;  1YVT A;  2HHB B;  2HBE A;  3ZJS A;  1MTK A;  1N9H A;  2BNL A;  5HY8 B;  1NIH B;  2C7J A;  1Y4F A;  3UHW A;  108M A;  1Y45 B;  2ZS0 A;  1B86 A;  4PQC A;  1CQX A;  2IG3 A;  1NWN A;  1TU9 A;  2MGJ A;  3CY5 A;  1U7R A;  2HCO A;  1Y8K B;  1LFV B;  1L2K A;  2EKT A;  4HRT A;  2DKA A;  1WVP A;  3V58 A;  3G53 A;  3UHR A;  1RPS B;  1ABY B;  1GH0 B;  1CH7 A;  1V4W A;  2DN3 A;  3A59 A;  1H1X A;  4L7Y A;  4F4O B;  1COL A;  1V4U B;  1YVQ B;  1MLJ A;  1V75 B;  1HDB A;  1S5Y A;  2HBD B;  2BW9 M;  2ZLU B;  1OFK A;  2D2N C;  4ROL A;  1XZ2 A;  3P5Q B;  3QQQ A;  1C40 A;  4HRR A;  2MYD A;  3S65 A;  3WHM B;  1FDH A;  1FN3 B;  2CMM A;  1Y4F B;  1Y7D A;  1Y45 A;  2V1J A;  1J3Y A;  1JZM A;  1F5O A;  2Z85 A;  3O18 A;  1YHU D;  1YHU C;  1HDA B;  1BIJ B;  5EU2 A;  3WCV B;  1QSI B;  3CY5 B;  3BJ1 A;  4MQK A;  2G0Z A;  2V1F A;  4N7P B;  1HBA A;  1ABW A;  1QI8 B;  1QPW A;  2D5Z A;  3OGB A;  3KVS B;  3QJC B;  4MQC B;  4ZVB A;  1SPE A;  1G0B B;  1HBB A;  2HZ3 A;  3OZU A;  3UHE A;  1YOI A;  1AJ9 A;  3PI4 A;  1MBA A;  3GKV A;  1A87 A;  1CG5 B;  1UC3 A;  2ZSP A;  2ZLV A;  4L2M A;  2SPM A;  2D2N B;  2MGL A;  4FH7 A;  3PI9 A;  5E29 B;  3LB2 A;  5IKS A;  4GY3 B;  4O4T A;  3HC9 A;  1YZI A;  3ZTA A;  3AQ5 A;  3HRW B;  4AE1 A;  1GZX A;  3QJE B;  5KER B;  1Y4B B;  1HBS A;  3O18 B;  1YHE B;  3OZV A;  3EU1 A;  1S5X B;  2VJT B;  3FEW X;  1QSI A;  2ZLX A;  2W6V B;  3R5I B;  2VYW A;  1Y4P B;  3RGK A;  3HYU A;  1UIW A;  1NPG A;  2MYA A;  4ODC B;  1AZI A;  2ZT1 A;  3NFE A;  2V1I A;  3EDA A;  1HBB B;  5E6E A;  1NXF A;  2AV3 A;  3GK9 A;  1UVM A;  4M4B A;  4NXA A;  1TOX A;  2MGA A;  1VRF A;  2GNV A;  2W6W A;  3NG6 A;  1KN1 B;  2ZLV B;  2AUP A;  1BBB A;  1CMY B;  3ZJQ A;  3PI3 A;  3ZJL A;  1MOC A;  1Y0D A;  1YCB A;  1XZ4 A;  3W4U A;  110M A;  3FS4 B;  1YFF B;  1DWT A;  2ZFO C;  3DBJ B;  5D1V A;  1XXT A;  1GBU A;  2UUM B;  3HEN A;  4F0U B;  3QM8 A;  1S5X A;  1Y8K A;  4ZIZ B;  3ECX A;  2ZLX B;  5CND A;  1Y7C A;  1VXG A;  2OH8 A;  2ZLW B;  2MBW A;  2UUM X;  3WCW A;  2R80 A;  4IRO B;  1G08 A;  1MGN A;  1Y83 A;  1J3F A;  2G10 A;  1JEB A;  3MYM A;  1OUT A;  1Y8H B;  1SGK A;  2HHD B;  1Y85 B;  1KN1 A;  3B75 A;  4B4Y A;  3WFX A;  1Y0D B;  3GYS A;  1Y22 B;  2HBS B;  1IRC A;  1DO1 A;  1RVW A;  1W92 A;  1T1N B;  2KSC A;  4U8U D;  2B7H B;  1A3N A;  3RJN B;  1ECO A;  1MBD A;  3QJB B;  2O5T X;  1G09 A;  2D2M A;  4RMP B;  1CIO A;  1HV4 A;  3CIU A;  5CN5 A;  3DR9 A;  5HU6 B;  2Z6N A;  2FAM A;  2ZS0 D;  1QPW B;  4NI1 A;  4C0N A;  1MNI A;  1C7B B;  5ILE A;  2ZSZ A;  4YJJ B;  1LFY A;  3GUQ A;  1XZU B;  4X0L B;  1F63 A;  1OBM A;  4OOD A;  4MU5 A;  5JOM A;  1JY7 A;  2ZFO A;  3UI0 A;  4BS9 A;  3G52 A;  1MKO A;  1YIE A;  1COH A;  1OR6 A;  1Y85 A;  3TLD A;  2GTL A;  2H8F B;  1LFL B;  1X9F A;  1GCV A;  1LFT B;  2BV8 A;  4A8O A;  1HAC B;  2UUL H;  1UVY A;  3ED9 A;  1Y2Z A;  1MYZ A;  5MBN A;  1CP0 A;  1URY A;  3MKB B;  1JL7 A;  2VJH B;  5JGG B;  4F6D A;  4FWY A;  3QZZ A;  4XS0 B;  3GQR B;  3DHR B;  3QJB A;  1HLM A;  1MYI A;  3G4Q A;  1DTI A;  3MJU A;  3UHT A;  3WR1 A;  2VLY A;  4ETV A;  3UHZ A;  3G4R A;  3WFW A;  2PGH A;  1HV4 B;  6HBW A;  3O7N A;  2NSR A;  5CN7 A;  5AB8 A;  2O5O X;  1GLI B;  1JW8 A;  1HJT A;  2GRF A;  3WCW D;  1THB B;  1U7S A;  1SHR A;  2FRK X;  4DWT A;  4X0L A;  3GQG B;  1C7C B;  1HBR B;  4UIQ A;  3ZHW A;  2R4X A;  4Q70 A;  1JZL A;  1MYJ A;  1MKO B;  5SW7 B;  3PT8 A;  4WJG 1;  1YEQ A;  4UUR A;  2J96 A;  1PHN A;  1UVK A;  1MYT A;  2O5M X;  1O16 A;  3HXN B;  3BCQ B;  1CPW A;  1HCO A;  1BUW A;  1PBX A;  1V4X B;  2DHB B;  3HHB A;  5E83 B;  3QQR A;  1RSE A;  1UX9 A;  1J3Z A;  3D17 B;  1MLK A;  1DUK A;  4ESA B;  3DHR A;  1S5Y B;  5FVB M;  1EBT A;  2DXM A;  3UHB A;  2PGH B;  1Y0T B;  103M A;  3SDH A;  2GDM A;  2ZLW A;  3PEL B;  1MCY A;  3ASE A;  1HBH A;  1O1K B;  1XZV B;  1WLA A;  1Y31 A;  1LUE A;  2ZLT A;  5ILR A;  2D60 A;  3VRF A;  1LH7 A;  4FC3 A;  1CLS A;  3NML A;  1M6C A;  2VJR B;  1BVD A;  1HA7 B;  1FLP A;  2VLX A;  1Y8H A;  1MLS A;  1CBL A;  2HCO B;  4B02 A;  4G1B A;  3QM6 A;  3PI2 A;  5HLQ A;  1DXC A;  1T1N A;  1MYG A;  1JP8 A;  3GOU A;  1VWT A;  1B33 A;  2QSS A;  2EF2 A;  3V57 B;  2MHB B;  4U8U C;  4IT8 A;  2D5X B;  2GRH A;  1O1O B;  2VML A;  2MGD A;  1G09 B;  2BWH A;  4KJT A;  4BJU A;  1YMC A;  5CNE A;  1HDS B;  3M39 A;  5HU6 A;  2MGB A;  2VRY A;  4FWX A;  1Y0T A;  1DO4 A;  4N7O B;  2XKH A;  1YGD A;  4GY3 A;  1Y4V A;  1Y5J A;  1Y5K B;  4NI0 B;  1YE2 B;  2AV0 A;  1F0L A;  1SDL B;  1UMO A;  4AVD A;  1XY0 B;  1R1X B;  3UHG A;  1BVC A;  2VJR A;  1LA6 B;  3WFT A;  1LIA B;  1CG8 A;  3WCV A;  3WCT D;  1HRM A;  1MNO A;  1FDH G;  3D7O B;  1ECN A;  1HHT P;  2Z6S A;  3HYU B;  1Y2Z B;  1A6G A;  1CH1 A;  1A3O A;  1OUU A;  1R1Y B;  1FAW B;  1YEO A;  1SWM A;  3DHT B;  2Z8A A;  1MTJ A;  1A0U B;  1XZ7 A;  1RQ4 A;  3VAU A;  4G51 A;  3MWN A;  1MDT A;  2UUL B;  4PQB A;  3ZJO A;  1G0A A;  1CPC B;  1JF4 A;  2D2N A;  4VHB A;  3UHQ A;  1Y0W A;  1UVI A;  1IDR A;  4MQG A;  3M3B A;  2MGF A;  1MOD A;  1XYE B;  2BKM A;  1WMU A;  1GZX B;  3QJE A;  3GDJ B;  1UX8 A;  1M6M A;  3UHY A;  2DN1 A;  4N7N B;  1MYF A;  1NZ4 A;  3VNC A;  1GDL A;  1YDZ A;  1RQA A;  1HHO A;  2HHB A;  2HBE B;  5EUI A;  4M4A B;  4MBA A;  3WTG B;  3ZJI A;  3WCU A;  4HSX A;  1QSH A;  1BZ0 A;  1OJ6 A;  4SDH A;  3HHB B;  5E83 A;  5HAV A;  4IRO A;  2UUL D;  3LR9 A;  1BZ1 A;  1EBC A;  1QXE B;  1YG5 A;  4PO5 B;  1VXD A;  1JEB B;  2QU0 B;  1OUT B;  4F6F A;  1UT0 A;  3ONZ A;  5EQM A;  2D6C A;  1ITH A;  2HHD A;  1YEV A;  4GXE A;  1RQ3 B;  1S69 A;  3WCP B;  3WCT B;  2MYE A;  4FWZ A;  2R4W A;  2LH1 A;  1S56 A;  1MOA A;  1YEU B;  4N6S A;  1RVW B;  1IWH A;  4B3W A;  3VRF B;  1EWA A;  1Y0A B;  2QMB A;  1Y09 B;  3GDJ A;  5HBI A;  3A59 B;  2GTL D;  1GBU B;  3UHD A;  4F0U A;  5CNB A;  3MJP A;  2C0K A;  2X4A A;  3BJ2 B;  1BIN A;  4MAX A;  5CN8 A;  2ZLU A;  1NEJ A;  3D1A B;  3QZX A;  1QSH B;  1Z8U B;  3FH9 B;  2VEE A;  1X3K A;  1Y4R B;  4GZG A;  1LTW A;  1B33 B;  3IA3 B;  4TWV A;  1G08 B;  1MWB A;  3VRE A;  1UVJ A;  1DM1 A;  3ZJH A;  4Z8K A;  4F6B A;  3DUT B;  1FSX B;  1LFQ A;  2DC3 A;  5EOH A;  2C7K B;  5ILM A;  3KMF A;  4XXI A;  3S1I A;  1Q1F A;  3QM9 A;  2VHB A;  4HRR B;  3WHM A;  1I7Y A;  4F6J A;  4TMA B;  4TYX A;  4MPM A;  2AA1 A;  1CIK A;  1HGB B;  1NQP B;  1YCA A;  3AT6 B;  3BRP A;  1NAZ A;  1D8U A;  1KD2 B;  1MYH A;  1CH2 A;  1A00 B;  1CBM A;  2C7L A;  5CNC A;  1Y0C A;  1MLH A;  3PI8 B;  3PIA A;  2MGC A;  2ZT0 A;  4MQK B;  1YHU A;  3D7O A;  3MBA A;  3ZJP A;  2NSS A;  1GBV B;  1HGC B;  1MBC A;  5C6E B;  3HEP A;  1DO7 A;  2OHB A;  4NI1 B;  1JP6 A;  4YU3 B;  4YU4 A;  3SDN A;  5CMV A;  1YHR A;  2ZT3 A;  1JF3 A;  1AJG A;  2GTL C;  4L7Y B;  4F4O A;  1CH9 A;  1C7D A;  1A4F B;  3O2C B;  3QM7 A;  1YIH A;  1YHE A;  4ROM B;  5CN9 A;  4H2L A;  5KDQ B;  2EVP A;  1MYM A;  2V8A B;  1YEQ B;  1LFL A;  1OR4 A;  5B13 A;  3UHH A;  5AZR A;  1HBG A;  1O1J B;  4F69 A;  4ODC A;  1V4X A;  1YOH A;  2AA1 B;  1NQP A;  3A9M A;  1Y4B A;  4ILZ A;  2HHE A;  3BRP B;  3LQD B;  4F0T A;  2GNW A;  3EU1 B;  4ERT A;  1VXH A;  3BJ3 A;  1SPG A;  4QAU A;  1NY9 A;  4HHB A;  1GLI A;  1LJW A;  1MLQ A;  1CO8 A;  2DKD A;  3OZW A;  3W4U B;  1Y31 B;  2ZLT B;  2R1H A;  2UUN A;  3A5A A;  1NZ2 A;  2V1K A;  1NPF A;  2ZS1 B;  2ZSX A;  1JBO A;  1RQ3 A;  1Y5F B;  2R4Z A;  2HBC A;  4U8U A;  1CP5 A;  1HCO B;  3ZJR A;  1HGA B;  3UBV A;  2W31 A;  2D2M D;  3OJ1 A;  1QGW C;  3UHK A;  1PMB A;  3GOU B;  3VRG A;  3DBJ A;  1J3Z B;  1YGF A;  4A8M P;  2JLG A;  2D5X A;  2V1H A;  3MJP B;  4ZVA A;  1CH3 A;  4DC7 A;  1HDS A;  1YVT B;  1J7S B;  1DXV A;  3UH5 A;  1DDT A;  1NWI A;  1J7W B;  5HY8 A;  3TM3 A;  3MVC A;  2G0R A;  1KTP B;  2WCQ A;  1Y7C B;  2HZ1 A;  3FH9 A;  3GKT A;  1XF6 C;  1Y4V B;  1Y5J B;  1Y5K A;  2V1G A;  2BLH A;  1SI4 A;  4MQJ B;  3LB3 A;  2YRS A;  2D60 B;  5JDO F;  1LHS A;  1M9P A;  3NUH B;  2VEB A;  1J52 A;  1LFQ B;  1XG0 C;  4WCH D;  1UVN A;  1Y35 B;  2HBF A;  2D2M B;  1Y5F A;  3S1J A;  1GJN A;  101M A;  4L1E B;  1Y22 A;  1HGA A;  2MGM A;  3UGZ A;  3HF4 B;  1DUO A;  4A8F A;  1ABY A;  1GH0 A;  2XKI A;  3K8B B;  1O1M B;  3PI8 A;  1V4U A;  4NXC A;  3OO5 B;  3LQ9 A;  1YHU B;  3IC0 A;  1G0A B;  2MGI A;  1IBE A;  2R4Y A;  5C6E A;  1Y46 B;  3ECZ A;  1XZ2 B;  1A01 B;  1HAB B;  1J40 A;  2H8F A;  2SPO A;  4H07 A;  3ZH0 A;  4YU4 B;  5B85 A;  1HAC A;  1DLY A;  4NI0 A;  3PT7 A;  3ZJJ A;  1CQ2 A;  1IT3 A;  2YRS B;  1YIH B;  1LIA A;  4AVE A;  1K0Y B;  2RI4 B;  4A8W A;  2G0X A;  1G9V A;  1DXU B;  1X9F B;  1ABW B;  2RAO B;  1O1L A;  112M A;  4LM6 B;  1LH6 A;  1O1J A;  3KVS A;  1NZ3 A;  2LHB A;  4MQH A;  4MQC A;  5JDO C;  1SDK B;  3NL7 B;  3ODQ A;  3UGY A;  1AJ9 B;  4G51 B;  4JYQ A;  4XDI A;  5EYS A;  3MYN A;  4Q70 B;  1MLR A;  1CG5 A;  1DKE B;  102M A;  3WR1 B;  7HBI A;  4ETT A;  2ZSY A;  2LH2 A;  2Z6N B;  1GDK A;  2YSK A;  3IC2 B;  2GL3 A;  1A01 A;  1VRE A;  2H8D B;  1LJW B;  1C7B A;  1IRD B;  3OO4 A;  1XYE A;  2ZSN A;  1DLW A;  3BOM A;  2R1H B;  2ZS1 C;  2V1E A;  5KER A;  1UVX A;  1H97 A;  2WY4 A;  3QJD B;  1C7C A;  3G4Y A;  2WTH A;  1CO9 A;  1N9F A;  1YMB A;  111M A;  1YIE B;  2SPL A;  3PMD A;  1Y7Z B;  3UHN A;  2HBG A;  1BZZ A;  5HLU A;  2DXM B;  2MYC A;  2I88 A;  1RTE A;  1PHN B;  1Y4P A;  3WCU B;  1LH1 A;  3O89 A;  5B13 G;  1BUW B;  1GDJ A;  4HH0 A;  2UUN D;  1FCS A;  2EB9 A;  1F5P A;  1Y4R A;  2FRJ X;  1HBH B;  1O1K A;  4MQI B;  3GQP A;  3M3A A;  3VRE B;  3V2V A;  3AQ9 A;  1Y4Q B;  2WTG A;  2DN2 A;  1DKE A;  4M4B B;  3NG6 B;  5M3S A;  1F99 B;  3K3U A;  3UH7 A;  3A0G A;  1BZP A;  1CMY A;  1I7Y B;  4NK2 A;  4N6S B;  3FS4 A;  3OO4 B;  1EMY A;  3L0F B;  1Y7G B;  4FC3 B;  1Y09 A;  4OF9 A;  2BLI A;  2VYZ A;  3UHV A;  1VWT B;  2DN3 B;  3V57 A;  1NS6 B;  1UFJ A;  1A0Z B;  1O1O A;  2VML B;  1FHJ B;  5SW7 A;  3D4X A;  1V75 A;  3LB1 A;  1JL6 A;  2HBF B;  4ERV A;  1GBV A;  1J7Y A;  3HXN A;  1LH3 A;  3ZOL A;  1NS9 A;  2ZSO A;  1UFP A;  1C40 B;  1FN3 A;  1YEN A;  2ZS0 B;  1GCW A;  2W72 A;  1C7D B;  1J41 A;  4LPI A;  1B8D A;  4N8T B;  5KDQ A;  1O1N B;  1FSX A;  1MNK A;  1CG8 B;  1LH2 A;  1HDA A;  2G0S A;  2MGH A;  3A0G B;  2AUO A;  3GYS B;  1CII A;  2QFK A;  1YE2 A;  3PI1 A;  1QI8 A;  3V58 B;  1HGB A;  3UHS A;  1MZ0 A;  4HH1 A;  4PQ6 A;  2JL9 A;  3RJ6 A;  3AG0 A;  4F0T B;  1MLN A;  1A3N B;  1V4W B;  1YH9 B;  2G14 A;  3PIA B;  5C6Y A;  1K1K A;  2GLN A;  1O1I B;  2MGG A;  3G4V A;  3CIU B;  1IT2 A;  3G4U A;  4RMP A;  5CN6 A;  3IXF A;  2RAO A;  2FRF A;  1SPG B;  4DC8 A;  4YU3 A;  1R1Y A;  1YHR B;  3QM5 A;  3UBC A;  1MOB A;  2UUN B;  3AQ8 A;  4YJJ A;  1A0U A;  1J3Y B;  1XZ7 B;  1BJE A;  3HRW A;  1GCW B;  4G1V A;  3AT5 A;  2OH9 A;  3KUN A;  2ZSS A;  3SZK A;  2VJT A;  2V8A A;  1DWR A;  1HHO B;  4N7P A;  3S65 B;  2HZ2 A;  2G12 A;  3WTG A;  1BZR A;  4U8U B;  2QLS B;  3G4W A;  2D5Z B;  2OLP A;  3MKB A;  1EYX B;  4LMS B;  5EE4 C;  1ECD A;  3NFE B;  4NZI A;  3QJD A;  1YGF B;  1Y8I A;  3VHB A;  3WCV C;  4XS0 A;  1YH9 A;  1YDZ B;  1BIJ A;  3UHX A;  1XDT T;  3QMA A;  2ZFB B;  3R0G A;  6HBW B;  1BBB B;  1N9X A;  1VXF A;  4BJA A;  3QJC A;  2XYK A;  4MQI A;  4ESU A;  3GQP B;  1MLF A;  1S0H B;  1DXT A;  1YE0 A;  2O5L X;  1RQ4 B;  1X9F C;  4HSW A;  1ECA A;  3A5G A;  3GQG A;  1M9P B;  1V5H A;  1QXD B;  1HI1 A;  3AT5 B;  1HBR A;  1SHR B;  4O4Z A;  2QU0 A;  5EYJ A;  2O5B X;  1Y8W B;  3SZK B;  1F99 A;  3WCP A;  3LHB A;  1VXC A;  1HBI A;  2W6V A;  3PI9 B;  3R5I A;  1VXA A;  2ZSR A;  3EOK A;  3LB4 A;  1TES A;  2E2Y A;  1WMU B;  1Y7G A;  2MYB A;  1HLB A;  1MLM A;  3DUT A;  3S48 C;  2C7K A;  1A9W E;  1J7Y B;  1HAB A;  3ZJM A;  4MXL A;  3B75 B;  1BZ0 B;  3A2G A;  1XZV A;  2BLJ M;  4DWU A;  1HHS A;  1MLU A;  5F0B A;  1MWD A;  1HA7 A;  1XZ5 B;  1K0Y A;  1QXD A;  1Y0C B;  1O1P B;  3WI8 A;  4H0M A;  1YEV B;  5EET A;  5KKK A;  1V07 A;  4MXK A;  4LMX B;  105M A;  1O1L B;  3S66 A;  1XZ4 B;  4HBI A;  5EV5 A;  3WCW B;  3UHC A;  1ALL A;  5AZQ A;  2MHB A;  3ARK A;  4O1T A;  3WCV D;  2GKN A;  2M6Z B;  1A4F A;  1YVQ A;  2ZWJ A;  4NS2 A;  4ROM A;  3UHU A;  1O1I A;  1A6M A;  3IC0 B;  1YOG A;  1JPB A;  2LH6 A;  3IC2 A;  1J40 B;  3ZJN A;  1MDN A;  109M A;  4ROL B;  1LHT A;  1IRD A;  2BK9 A;  2VYY A;  3PT7 B;  4JAC A;  2W6Y A;  3BA2 A;  2HBS A;  1DTM A;  2R80 B;  5CNG A;  1XY0 A;  1N9I A;  1SDL A;  3ORD A;  4ETU A;  1Y83 B;  2UUL C;  1LA6 A;  1XQ5 B;  1XZ5 A;  2R50 A;  1JP9 A;  3ZOM A;  1LFZ B;  2NRL A;  1Y7Z A;  4H0M B;  1BAB B;  1A6N A;  3BJ1 B;  3MJU B;  2OIF A;  4KMW A;  1HBA B;  2QLS A;  1ASH A;  1CH4 A;  2LH7 A;  1ON7 B;  3UHI A;  2EB8 A;  1DWS A;  3DHT A;  2W72 C;  1THB A;  2O5Q X;  1XZU A;  2ZFB A;  1A9W A;  3WCU D;  1HDB B;  3GLN A;  2UUL A;  1GVH A;  3WCW C; 
#chains in the Genus database with same CATH homology
 1Y0W B;  2H8D A;  4C44 A;  3P5Q A;  1GCV B;  1LFT A;  5CNF A;  3OK5 A;  1MBI A;  3V2Z A;  1Y7D B;  1HSY A;  3BOM B;  4UZV A;  5MBA A;  1MOH A;  3WCU C;  1B0B A;  3ECL A;  1DXT B;  4F6I A;  1MLL A;  1XCH A;  1JZK A;  2ZS1 A;  3AQ7 A;  2MGK A;  4H2L B;  1Y4G B;  1XQ5 A;  3OVU C;  1RQA B;  5JDO E;  6HBI A;  1A6K A;  4O2G A;  5EE4 D;  4ESA A;  1LFZ A;  1BAB A;  2GTL B;  2D2M C;  1J7W A;  4H0B A;  2H35 B;  4M4A A;  1MNJ A;  2QFN A;  3UH3 A;  1RTX A;  3WCT C;  4F68 A;  1DXD A;  2ZT4 A;  5JGG A;  1DO3 A;  5D5R A;  2QSP A;  3VRG B;  2W72 B;  1I3D A;  1G0B A;  1VHB A;  3GQR A;  2IN4 A;  4WJG A;  1O1N A;  2ZFO D;  3E5I A;  1VXB A;  1YG5 B;  1VXE A;  2O58 X;  3GKV B;  3ONZ B;  1MTI A;  1DXV B;  1J7S A;  1BZ6 A;  1ABS A;  2JHO A;  1Y35 A;  107M A;  3BJ3 B;  3A5B A;  3WCT A;  2ZS0 C;  2W6X A;  3BCQ A;  2GKM A;  1IWH B;  1AJH A;  1YEU A;  1YZI B;  3E4N A;  4TWU A;  1YFF A;  2QMB B;  1JDO A;  1HBS B;  3K8B A;  2MB5 A;  5CN4 A;  1X9F D;  1K1K B;  1Y4G A;  1O1P A;  1A0Z A;  1XXT B;  1FHJ A;  1MNH A;  1FSL A;  3PT8 B;  3G46 A;  3BJ2 A;  1IBE B;  1Y46 A;  5B84 A;  3S66 B;  2BMM A;  2H35 A;  1NEJ B;  1NS9 B;  3D1A A;  2ZSQ A;  4N7O A;  1MWC A;  3PEL A;  3E55 A;  3HF4 A;  4KMV A;  5ILP A;  2SPN A;  5F2A A;  1B86 B;  1O1M A;  1J41 B;  5E6E B;  1CLS B;  2LH3 A;  2RI4 A;  3UH6 A;  5CHR A;  3TM9 A;  1DXU A;  3MOU A;  2PEG B;  3ARJ A;  2O5S X;  1SI4 B;  4MQJ A;  3HEO A;  2EVK A;  1I3E A;  1RPS A;  3AQ6 A;  1MBO A;  1YEO B;  1A00 A;  3AT6 A;  1Y8I B;  1KD2 A;  1MBN A;  5JDO D;  2FRI X;  3D1K B;  1MLG A;  3KUO A;  1HGC A;  2Z6T A;  3EDB A;  1S6A A;  1Y01 B;  3KMF C;  2ZT2 A;  1YGD B;  4MQH B;  2XKG A;  2ZST A;  1YE0 B;  2QSS B;  1JWN A;  2G3H A;  1KR7 A;  104M A;  2LH5 A;  2MGE A;  3OO5 A;  4O35 A;  1Y8W A;  1JY7 B;  2ZFO B;  1EW6 A;  1CH5 A;  1MLO A;  1COH B;  1OFJ A;  2G0V A;  2NX0 A;  3LR7 A;  2EKU A;  2D2N D;  2PEG A;  2G11 A;  1A3O B;  1R1X A;  3LQD A;  1X46 A;  3K9Z A;  3ARL A;  2AUR A;  2HHE B;  2B7H A;  3NMM A;  1BZ1 B;  4F6G A;  4PNJ A;  3D1K A;  1G9V B;  2ZS1 D;  1BZZ B;  2AUQ A;  3MN0 A;  1F65 A;  1NIH A;  4HHB B;  1YMA A;  2QRW A;  5E29 A;  1V9Q A;  4NK1 A;  3H58 A;  1OUU B;  2NRM A;  1FAW A;  2QSP B;  1S0H A;  3M38 A;  1MBS A;  1LFY B;  1SDK A;  3NL7 A;  3ODQ B;  1Y0A A;  2VM0 A;  1Y4Q A;  1LH5 A;  1GDI A;  4KN3 A;  2DN2 B;  2DN1 B;  1NZ5 A;  106M A;  1NS6 A;  4FH6 A;  3D4X B;  1LFV A;  4HRT B;  5EUI B;  4MBN A;  1NGK A;  4MQG B;  3E5O A;  3EOK B;  3U3E A;  2HBC B;  5HLX A;  1UIW B;  1S61 A;  3H57 A;  2GRZ A;  1PBX B;  1URV A;  1YEN B;  2DHB A;  3WFU A;  2FAL A;  4N7N A;  5CHQ A;  3NMM B;  2M6Z A;  3D17 A;  1IOP A;  1QXE A;  4N8T A;  2OHA A;  1KFR A;  2HBD A;  2VLZ A;  1YVT A;  2HHB B;  2HBE A;  3ZJS A;  1MTK A;  1N9H A;  2BNL A;  5HY8 B;  1NIH B;  1Y4F A;  3UHW A;  108M A;  1Y45 B;  2ZS0 A;  1B86 A;  4PQC A;  1CQX A;  2IG3 A;  1NWN A;  1TU9 A;  2MGJ A;  3CY5 A;  1U7R A;  2HCO A;  1Y8K B;  1LFV B;  1L2K A;  2EKT A;  4HRT A;  1WVP A;  3G53 A;  3UHR A;  1RPS B;  1ABY B;  1CH7 A;  1V4W A;  2DN3 A;  3A59 A;  1H1X A;  4L7Y A;  4F4O B;  1V4U B;  1YVQ B;  1MLJ A;  1V75 B;  1HDB A;  1S5Y A;  2HBD B;  2BW9 M;  2ZLU B;  1OFK A;  2D2N C;  4ROL A;  1XZ2 A;  3P5Q B;  3QQQ A;  1C40 A;  4HRR A;  2MYD A;  3S65 A;  3WHM B;  1FDH A;  1FN3 B;  2CMM A;  1Y4F B;  1Y7D A;  1Y45 A;  2V1J A;  1J3Y A;  1JZM A;  1F5O A;  2Z85 A;  1YHU D;  1YHU C;  1HDA B;  1BIJ B;  5EU2 A;  3WCV B;  1QSI B;  3CY5 B;  3BJ1 A;  4MQK A;  2G0Z A;  2V1F A;  4N7P B;  1HBA A;  1ABW A;  1QI8 B;  1QPW A;  2D5Z A;  3OGB A;  3QJC B;  4MQC B;  4ZVB A;  1SPE A;  1G0B B;  1HBB A;  2HZ3 A;  3OZU A;  3UHE A;  1YOI A;  1AJ9 A;  3PI4 A;  1MBA A;  3GKV A;  1CG5 B;  1UC3 A;  2ZSP A;  2ZLV A;  4L2M A;  2SPM A;  2D2N B;  2MGL A;  4FH7 A;  3PI9 A;  5E29 B;  3LB2 A;  5IKS A;  4O4T A;  3HC9 A;  1YZI A;  3AQ5 A;  3HRW B;  1GZX A;  3QJE B;  5KER B;  1Y4B B;  1HBS A;  1YHE B;  3OZV A;  3EU1 A;  1S5X B;  1QSI A;  2ZLX A;  2W6V B;  3R5I B;  2VYW A;  1Y4P B;  3RGK A;  3HYU A;  1UIW A;  1NPG A;  2MYA A;  4ODC B;  1AZI A;  2ZT1 A;  3NFE A;  2V1I A;  3EDA A;  1HBB B;  5E6E A;  1NXF A;  2AV3 A;  3GK9 A;  4M4B A;  4NXA A;  2MGA A;  1VRF A;  2GNV A;  2W6W A;  3NG6 A;  2ZLV B;  2AUP A;  1BBB A;  1CMY B;  3ZJQ A;  3PI3 A;  3ZJL A;  1MOC A;  1Y0D A;  1YCB A;  1XZ4 A;  3W4U A;  110M A;  3FS4 B;  1YFF B;  1DWT A;  2ZFO C;  5D1V A;  1XXT A;  1GBU A;  3HEN A;  3QM8 A;  1S5X A;  1Y8K A;  3ECX A;  2ZLX B;  5CND A;  1Y7C A;  1VXG A;  2OH8 A;  2ZLW B;  2MBW A;  3WCW A;  2R80 A;  4IRO B;  1G08 A;  1MGN A;  1Y83 A;  1J3F A;  2G10 A;  1JEB A;  3MYM A;  1OUT A;  1Y8H B;  2HHD B;  1Y85 B;  3B75 A;  4B4Y A;  3WFX A;  1Y0D B;  3GYS A;  1Y22 B;  2HBS B;  1IRC A;  1DO1 A;  1RVW A;  1W92 A;  1T1N B;  2KSC A;  4U8U D;  2B7H B;  1A3N A;  3RJN B;  1ECO A;  1MBD A;  3QJB B;  2O5T X;  1G09 A;  2D2M A;  1CIO A;  1HV4 A;  3CIU A;  5CN5 A;  3DR9 A;  5HU6 B;  2Z6N A;  2FAM A;  2ZS0 D;  1QPW B;  4NI1 A;  4C0N A;  1MNI A;  1C7B B;  5ILE A;  2ZSZ A;  1LFY A;  1XZU B;  4X0L B;  1F63 A;  1OBM A;  4OOD A;  4MU5 A;  5JOM A;  1JY7 A;  2ZFO A;  3UI0 A;  3G52 A;  1MKO A;  1YIE A;  1COH A;  1OR6 A;  1Y85 A;  3TLD A;  2GTL A;  2H8F B;  1LFL B;  1X9F A;  1GCV A;  1LFT B;  1HAC B;  1UVY A;  3ED9 A;  1Y2Z A;  1MYZ A;  5MBN A;  1CP0 A;  1URY A;  3MKB B;  1JL7 A;  5JGG B;  4F6D A;  4FWY A;  3QZZ A;  4XS0 B;  3GQR B;  3DHR B;  3QJB A;  1HLM A;  1MYI A;  3G4Q A;  1DTI A;  3MJU A;  3UHT A;  3WR1 A;  2VLY A;  3UHZ A;  3G4R A;  3WFW A;  2PGH A;  1HV4 B;  6HBW A;  3O7N A;  2NSR A;  5CN7 A;  5AB8 A;  2O5O X;  1GLI B;  1JW8 A;  1HJT A;  2GRF A;  3WCW D;  1THB B;  1U7S A;  1SHR A;  2FRK X;  4DWT A;  4X0L A;  3GQG B;  1C7C B;  1HBR B;  4UIQ A;  3ZHW A;  2R4X A;  1JZL A;  1MYJ A;  1MKO B;  5SW7 B;  3PT8 A;  4WJG 1;  1YEQ A;  4UUR A;  2O5M X;  1MYT A;  3HXN B;  1O16 A;  3BCQ B;  1CPW A;  1HCO A;  1BUW A;  1PBX A;  1V4X B;  2DHB B;  3HHB A;  5E83 B;  3QQR A;  1RSE A;  1UX9 A;  1J3Z A;  3D17 B;  1MLK A;  1DUK A;  4ESA B;  3DHR A;  1S5Y B;  1EBT A;  2DXM A;  3UHB A;  2PGH B;  1Y0T B;  103M A;  3SDH A;  2GDM A;  2ZLW A;  3PEL B;  1MCY A;  3ASE A;  1HBH A;  1O1K B;  1XZV B;  1WLA A;  1Y31 A;  1LUE A;  2ZLT A;  5ILR A;  2D60 A;  3VRF A;  1LH7 A;  4FC3 A;  1CLS A;  3NML A;  1M6C A;  1BVD A;  1FLP A;  2VLX A;  1Y8H A;  1MLS A;  1CBL A;  2HCO B;  4G1B A;  3QM6 A;  3PI2 A;  5HLQ A;  1DXC A;  1T1N A;  1MYG A;  1JP8 A;  3GOU A;  1VWT A;  2QSS A;  2EF2 A;  2MHB B;  4U8U C;  4IT8 A;  2D5X B;  2GRH A;  1O1O B;  2MGD A;  1G09 B;  2BWH A;  4KJT A;  1YMC A;  5CNE A;  1HDS B;  3M39 A;  5HU6 A;  2MGB A;  2VRY A;  4FWX A;  1Y0T A;  1DO4 A;  4N7O B;  2XKH A;  1YGD A;  1Y4V A;  1Y5J A;  1Y5K B;  4NI0 B;  1YE2 B;  2AV0 A;  1SDL B;  1UMO A;  4AVD A;  1XY0 B;  1R1X B;  3UHG A;  1BVC A;  1LA6 B;  3WFT A;  1CG8 A;  3WCV A;  3WCT D;  1HRM A;  1MNO A;  1FDH G;  3D7O B;  1ECN A;  2Z6S A;  3HYU B;  1Y2Z B;  1A6G A;  1CH1 A;  1A3O A;  1OUU A;  1R1Y B;  1FAW B;  1YEO A;  1SWM A;  3DHT B;  2Z8A A;  1MTJ A;  1A0U B;  1XZ7 A;  1RQ4 A;  3VAU A;  4G51 A;  4PQB A;  3ZJO A;  1G0A A;  1JF4 A;  2D2N A;  4VHB A;  3UHQ A;  1Y0W A;  1IDR A;  4MQG A;  3M3B A;  2MGF A;  1MOD A;  1XYE B;  2BKM A;  1WMU A;  1GZX B;  3QJE A;  3GDJ B;  1UX8 A;  1M6M A;  3UHY A;  2DN1 A;  4N7N B;  1MYF A;  1NZ4 A;  1GDL A;  1YDZ A;  1RQA A;  1HHO A;  2HHB A;  2HBE B;  5EUI A;  4M4A B;  4MBA A;  3WTG B;  3ZJI A;  3WCU A;  4HSX A;  1QSH A;  1BZ0 A;  1OJ6 A;  4SDH A;  3HHB B;  5E83 A;  5HAV A;  4IRO A;  3LR9 A;  1BZ1 A;  1EBC A;  1QXE B;  1YG5 A;  1VXD A;  1JEB B;  2QU0 B;  1OUT B;  4F6F A;  1UT0 A;  3ONZ A;  5EQM A;  2D6C A;  1ITH A;  2HHD A;  1YEV A;  1RQ3 B;  1S69 A;  3WCP B;  3WCT B;  2MYE A;  4FWZ A;  2R4W A;  2LH1 A;  1S56 A;  1MOA A;  1YEU B;  1RVW B;  1IWH A;  4B3W A;  3VRF B;  1EWA A;  1Y0A B;  2QMB A;  1Y09 B;  5HBI A;  3GDJ A;  3A59 B;  2GTL D;  1GBU B;  3UHD A;  5CNB A;  3MJP A;  2C0K A;  3BJ2 B;  1BIN A;  4MAX A;  5CN8 A;  2ZLU A;  1NEJ A;  3D1A B;  3QZX A;  1QSH B;  1Z8U B;  3FH9 B;  2VEE A;  1X3K A;  1Y4R B;  4GZG A;  1LTW A;  3IA3 B;  4TWV A;  1G08 B;  1MWB A;  3VRE A;  1DM1 A;  3ZJH A;  4F6B A;  3DUT B;  1FSX B;  1LFQ A;  2DC3 A;  5EOH A;  5ILM A;  3KMF A;  3S1I A;  1Q1F A;  3QM9 A;  2VHB A;  4HRR B;  3WHM A;  4F6J A;  4TYX A;  4MPM A;  2AA1 A;  1CIK A;  1HGB B;  1NQP B;  1YCA A;  3AT6 B;  1NAZ A;  1D8U A;  1KD2 B;  1MYH A;  1CH2 A;  1A00 B;  1CBM A;  5CNC A;  1Y0C A;  1MLH A;  3PI8 B;  3PIA A;  2MGC A;  2ZT0 A;  4MQK B;  1YHU A;  3D7O A;  3MBA A;  3ZJP A;  2NSS A;  1GBV B;  1HGC B;  1MBC A;  5C6E B;  3HEP A;  1DO7 A;  2OHB A;  4NI1 B;  1JP6 A;  4YU3 B;  4YU4 A;  3SDN A;  5CMV A;  1YHR A;  2ZT3 A;  1JF3 A;  1AJG A;  2GTL C;  4L7Y B;  4F4O A;  1CH9 A;  1C7D A;  1A4F B;  3QM7 A;  1YIH A;  1YHE A;  4ROM B;  5CN9 A;  4H2L A;  5KDQ B;  2EVP A;  1MYM A;  1YEQ B;  1LFL A;  1OR4 A;  3UHH A;  5AZR A;  1HBG A;  1O1J B;  4F69 A;  4ODC A;  1V4X A;  1YOH A;  2AA1 B;  1NQP A;  3A9M A;  1Y4B A;  4ILZ A;  2HHE A;  3LQD B;  2GNW A;  3EU1 B;  1VXH A;  3BJ3 A;  1SPG A;  4QAU A;  4HHB A;  1GLI A;  1LJW A;  1MLQ A;  1CO8 A;  3OZW A;  3W4U B;  1Y31 B;  2ZLT B;  2R1H A;  3A5A A;  1NZ2 A;  2V1K A;  1NPF A;  2ZS1 B;  2ZSX A;  1RQ3 A;  1Y5F B;  2R4Z A;  2HBC A;  4U8U A;  1CP5 A;  1HCO B;  3ZJR A;  1HGA B;  3UBV A;  2W31 A;  2D2M D;  3OJ1 A;  3UHK A;  1PMB A;  3GOU B;  3VRG A;  1J3Z B;  1YGF A;  2D5X A;  2V1H A;  3MJP B;  4ZVA A;  1CH3 A;  4DC7 A;  1HDS A;  1YVT B;  1J7S B;  1DXV A;  3UH5 A;  1NWI A;  1J7W B;  5HY8 A;  3TM3 A;  3MVC A;  2G0R A;  1Y7C B;  2HZ1 A;  3FH9 A;  3GKT A;  1Y4V B;  1Y5J B;  1Y5K A;  2V1G A;  2BLH A;  1SI4 A;  4MQJ B;  3LB3 A;  2YRS A;  2D60 B;  5JDO F;  1LHS A;  1M9P A;  2VEB A;  1J52 A;  1LFQ B;  4WCH D;  1Y35 B;  2HBF A;  2D2M B;  1Y5F A;  3S1J A;  1GJN A;  101M A;  1Y22 A;  1HGA A;  2MGM A;  3UGZ A;  3HF4 B;  1DUO A;  1ABY A;  2XKI A;  3K8B B;  1O1M B;  3PI8 A;  1V4U A;  4NXC A;  3OO5 B;  1YHU B;  3IC0 A;  1G0A B;  2MGI A;  1IBE A;  2R4Y A;  5C6E A;  1Y46 B;  3ECZ A;  1XZ2 B;  1A01 B;  1HAB B;  1J40 A;  2H8F A;  2SPO A;  4H07 A;  3ZH0 A;  4YU4 B;  5B85 A;  1HAC A;  1DLY A;  4NI0 A;  3PT7 A;  3ZJJ A;  1CQ2 A;  1IT3 A;  2YRS B;  1YIH B;  4AVE A;  1K0Y B;  2RI4 B;  2G0X A;  1G9V A;  1DXU B;  1X9F B;  1ABW B;  2RAO B;  1O1L A;  112M A;  1LH6 A;  1O1J A;  1NZ3 A;  2LHB A;  4MQH A;  4MQC A;  5JDO C;  1SDK B;  3NL7 B;  3ODQ A;  3UGY A;  1AJ9 B;  4G51 B;  4JYQ A;  4XDI A;  5EYS A;  3MYN A;  1MLR A;  1CG5 A;  1DKE B;  102M A;  3WR1 B;  7HBI A;  2ZSY A;  2LH2 A;  2Z6N B;  1GDK A;  3IC2 B;  2GL3 A;  1A01 A;  1VRE A;  2H8D B;  1LJW B;  1C7B A;  1IRD B;  3OO4 A;  1XYE A;  2ZSN A;  1DLW A;  3BOM A;  2R1H B;  2ZS1 C;  2V1E A;  5KER A;  1UVX A;  1H97 A;  2WY4 A;  3QJD B;  1C7C A;  3G4Y A;  2WTH A;  1CO9 A;  1N9F A;  1YMB A;  111M A;  1YIE B;  2SPL A;  1Y7Z B;  3UHN A;  2HBG A;  1BZZ A;  5HLU A;  2DXM B;  2MYC A;  1RTE A;  1Y4P A;  3WCU B;  1LH1 A;  3O89 A;  1BUW B;  1GDJ A;  1FCS A;  2EB9 A;  1F5P A;  1Y4R A;  2FRJ X;  1HBH B;  1O1K A;  4MQI B;  3GQP A;  3M3A A;  3VRE B;  3V2V A;  3AQ9 A;  1Y4Q B;  2WTG A;  2DN2 A;  1DKE A;  4M4B B;  3NG6 B;  5M3S A;  3K3U A;  3UH7 A;  3A0G A;  1BZP A;  1CMY A;  4NK2 A;  3FS4 A;  3OO4 B;  1EMY A;  1Y7G B;  4FC3 B;  1Y09 A;  4OF9 A;  2BLI A;  2VYZ A;  3UHV A;  1VWT B;  2DN3 B;  1NS6 B;  1UFJ A;  1A0Z B;  1O1O A;  5SW7 A;  1FHJ B;  3D4X A;  1V75 A;  3LB1 A;  1JL6 A;  2HBF B;  1GBV A;  1J7Y A;  3HXN A;  1LH3 A;  3ZOL A;  1NS9 A;  2ZSO A;  1UFP A;  1C40 B;  1FN3 A;  1YEN A;  2ZS0 B;  1GCW A;  2W72 A;  1C7D B;  1J41 A;  4LPI A;  4N8T B;  5KDQ A;  1O1N B;  1FSX A;  1MNK A;  1CG8 B;  1LH2 A;  1HDA A;  2G0S A;  2MGH A;  3A0G B;  2AUO A;  3GYS B;  2QFK A;  1YE2 A;  3PI1 A;  1QI8 A;  1HGB A;  3UHS A;  1MZ0 A;  4PQ6 A;  3RJ6 A;  3AG0 A;  1MLN A;  1A3N B;  1V4W B;  1YH9 B;  2G14 A;  3PIA B;  5C6Y A;  1K1K A;  2GLN A;  1O1I B;  2MGG A;  3G4V A;  3CIU B;  1IT2 A;  3G4U A;  5CN6 A;  3IXF A;  2RAO A;  2FRF A;  1SPG B;  4DC8 A;  4YU3 A;  1R1Y A;  1YHR B;  3QM5 A;  3UBC A;  1MOB A;  3AQ8 A;  1A0U A;  1J3Y B;  1XZ7 B;  1BJE A;  3HRW A;  1GCW B;  4G1V A;  3AT5 A;  2OH9 A;  3KUN A;  2ZSS A;  3SZK A;  1DWR A;  1HHO B;  4N7P A;  3S65 B;  2HZ2 A;  2G12 A;  3WTG A;  1BZR A;  4U8U B;  2QLS B;  3G4W A;  2D5Z B;  2OLP A;  3MKB A;  5EE4 C;  1ECD A;  3NFE B;  4NZI A;  3QJD A;  1YGF B;  1Y8I A;  3VHB A;  3WCV C;  4XS0 A;  1YH9 A;  1YDZ B;  1BIJ A;  3UHX A;  3QMA A;  2ZFB B;  3R0G A;  6HBW B;  1BBB B;  1N9X A;  1VXF A;  4BJA A;  3QJC A;  2XYK A;  4MQI A;  3GQP B;  1MLF A;  1S0H B;  1DXT A;  1YE0 A;  2O5L X;  1RQ4 B;  1X9F C;  4HSW A;  1ECA A;  3A5G A;  3GQG A;  1M9P B;  1V5H A;  1QXD B;  3AT5 B;  1HBR A;  1SHR B;  4O4Z A;  2QU0 A;  5EYJ A;  2O5B X;  1Y8W B;  3SZK B;  3WCP A;  3LHB A;  1VXC A;  1HBI A;  2W6V A;  3PI9 B;  3R5I A;  1VXA A;  2ZSR A;  3EOK A;  3LB4 A;  1TES A;  2E2Y A;  1WMU B;  1Y7G A;  2MYB A;  1HLB A;  1MLM A;  3DUT A;  3S48 C;  1A9W E;  1J7Y B;  1HAB A;  3ZJM A;  4MXL A;  3B75 B;  1BZ0 B;  3A2G A;  1XZV A;  2BLJ M;  4DWU A;  1MLU A;  5F0B A;  1MWD A;  1XZ5 B;  1K0Y A;  1QXD A;  1Y0C B;  1O1P B;  3WI8 A;  1YEV B;  5EET A;  5KKK A;  1V07 A;  4MXK A;  105M A;  1O1L B;  3S66 A;  1XZ4 B;  4HBI A;  5EV5 A;  3WCW B;  3UHC A;  5AZQ A;  2MHB A;  3ARK A;  4O1T A;  3WCV D;  2GKN A;  2M6Z B;  1A4F A;  1YVQ A;  2ZWJ A;  4NS2 A;  4ROM A;  3UHU A;  1O1I A;  1A6M A;  3IC0 B;  1YOG A;  1JPB A;  2LH6 A;  3IC2 A;  1J40 B;  3ZJN A;  1MDN A;  109M A;  4ROL B;  1LHT A;  1IRD A;  2BK9 A;  2VYY A;  3PT7 B;  4JAC A;  2W6Y A;  3BA2 A;  2HBS A;  1DTM A;  2R80 B;  5CNG A;  1XY0 A;  1N9I A;  1SDL A;  3ORD A;  1Y83 B;  1LA6 A;  1XQ5 B;  1XZ5 A;  2R50 A;  1JP9 A;  3ZOM A;  1LFZ B;  2NRL A;  1Y7Z A;  1BAB B;  1A6N A;  3BJ1 B;  3MJU B;  2OIF A;  4KMW A;  1HBA B;  2QLS A;  1ASH A;  1CH4 A;  2LH7 A;  3UHI A;  2EB8 A;  1DWS A;  3DHT A;  2W72 C;  1THB A;  2O5Q X;  1XZU A;  2ZFB A;  1A9W A;  3WCU D;  1HDB B;  3GLN A;  1GVH A;  3WCW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...