2MB5A

Hydration in protein crystals. a neutron diffraction analysis of carbonmonoxymyoglobin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
153
Chain Sequence
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydration in Protein Crystals. A Neutron Diffraction Analysis of Carbonmonoxymyoglobin
pubmed rcsb
source organism Physeter catodon
molecule tags Oxygen storage
molecule keywords MYOGLOBIN
total genus 59
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1989-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 2mb5A00
5EETA 4G1BA 4F6JA 3DHTB 2GKMA 1A4FA 2H8DB 3QJEB 1Y4RA 1HBAB 5EE4C 1LFYB 1MYZA 3CY5A 3BOMB 1ECDA 4HHBA 3OO5B 2HZ1A 1SDLA 4N7PA 1BVCA 2OH8A 5E29B 1V07A 1DWTA 1GLIB 1ABWB 2G10A 2ZT3A 2MGDA 4YU3B 3UHQA 3HRWA 1RSEA 1BZZA 1F65A 1LJWB 1HBBB 1Y4RB 2OIFA 2G12A 1YGDB 2GTLC 4LPIA 2IG3A 1V4UA 2V1FA 3HF4A 1IT2A 3G4RA 2GTLB 1SPGA 3EU1A 1Y7DB 4MAXA 1ABYB 2V1IA 5MBAA 1S5YA 3GQPA 4DC8A 4M4BB 1HHOB 1MYIA 3ZJHA 1HLMA 2MYEA 1MNJA 2QMBB 4UZVA 1YEVA 3UGYA 2VYZA 1NZ2A 1BZ0A 3P5QA 1CH2A 1XQ5A 1DXVA 3QJBA 1DUKA 4XS0A 1AJ9B 2O5TX 2VYYA 2AV0A 3VRFA 3B75A 3BJ1B 1Y4FB 4MQGA 4G51B 1XZ5A 4MQJA 5CNBA 2G0RA 3A5AA 1J40B 1MBAA 1QSIA 1LFQA 5EV5A 4F6BA 2Z6TA 1YMCA 1URVA 1CG5A 2HHDB 1V75B 1BJEA 4F4OA 1YOHA 1A0ZA 4F68A 1OUUB 4NK2A 1GBUB 1UFPA 3NMLA 5B85A 4UURA 1X9FB 1YCAA 1VRFA 2W72B 2ZS0A 1XZ4A 4DWTA 2HBSB 3WCUD 1FLPA 3BOMA 1X9FD 1ABSA 3WCUB 3MJUA 1YGDA 5EOHA 1HDBA 3QZXA 4ODCB 3GQGA 3PELB 4FH7A 3WCWD 2MB5A 3GYSA 3QJCA 3ARLA 1COHA 1LFLA 1MYGA 1CO8A 1G08A 4ROMA 3HENA 1SDKB 3UH3A 2D60A 1S5YB 1J7SA 4IT8A 1GDKA 1O1NB 1YIEB 3QM7A 2ZS1B 1Y45B 2W6VB 3ODQB 1Y0TB 1YEQA 2GTLD 2O5BX 1SWMA 1Y5JB 2GL3A 3UHWA 1NS9B 2ZLXB 5D1VA 2HZ2A 5CHQA 3ORDA 3VRFB 3PI8A 1THBB 5CN4A 1VWTB 3UH7A 3NMMB 6HBIA 1FHJA 3WCTC 4O4TA 5EE4D 1SPEA 3UHKA 1YENA 4VHBA 3PT8B 2DHBB 3ECZA 2HHDA 1G08B 3GKVB 3WCPA 3MYNA 3IC0A 2O5SX 1Y46A 2RAOA 1WMUB 2HHEB 1YMAA 3QQQA 1YIEA 3FH9B 1QXEA 2ZT1A 3M39A 1GZXA 4NS2A 1XY0A 5CN5A 2OH9A 2QSSA 1JWNA 3HEOA 1LFLB 4PQCA 3WFUA 2MYBA 1UX8A 1CH7A 1O16A 2RI4B 1S5XB 3WCVA 1J3ZB 1KFRA 1Y83B 1R1XB 2HBEB 3BA2A 1XZ4B 4GZGA 2QFKA 5SW7A 4WJGA 4MQKB 3PIAB 1HBGA 2AUPA 1COHB 1DKEA 1MDNA 1NPFA 1DO4A 4MQGB 1O1LA 1HDAB 2EVPA 1RTXA 2BNLA 1Y7DA 3UHSA 2G0VA 1Y09B 1BZ6A 2V1EA 2R4XA 2R4ZA 1Y4BA 1VXBA 2DN1B 3IC0B 3S66A 1Y5JA 1RTEA 3BJ1A 5EUIB 2XKHA 3UHZA 2C0KA 3VREA 1RQ3A 4DWUA 1YHRA 1JEBB 3WCTA 2R80B 4HHBB 1JZKA 1MLSA 1CP0A 1CG8B 2PGHB 2ZSSA 1MLHA 111MA 4OODA 3ZOMA 1J7YB 1T1NA 3PT7A 2ZLWA 3OGBA 2WY4A 1LFTA 2H8FB 1Y0AB 3WCVC 1F5OA 3S48C 3WR1A 1IRCA 4FWYA 1S69A 2AUQA 3IXFA 1YH9A 1EMYA 1B86A 3IA3B 1FDHG 3PT8A 1ABWA 1O1JB 3ZH0A 4IROB 3HF4B 3ARJA 2Z6SA 1HACA 2RAOB 1Y4VB 4U8UB 2VRYA 4ROLA 1YEOB 3E5IA 1HGAB 1J7WB 1NEJA 2MGKA 1K1KB 2BK9A 3QM5A 106MA 1HCOA 1GDIA 1QXDA 3D1KB 1UT0A 2ZSPA 3GK9A 2Z85A 3A5BA 1O1JA 1VXEA 4UIQA 5D5RA 1LH3A 2G11A 1XZUB 3NFEB 5E29A 1X9FA 2DN1A 2FRKX 1V4XA 5CN8A 1Y2ZB 3WFXA 3HHBB 1RPSA 1J3YB 1A6NA 1GCWA 4ROMB 4L2MA 3GKTA 1JZMA 1QSHA 2GRFA 3UHEA 3E4NA 3UGZA 2IN4A 3O89A 1C7BB 2D2NB 1EWAA 3GQRB 2BMMA 3PI9B 2DXMA 4ROLB 3UHRA 5E6EA 3ZJQA 1ECOA 4F6IA 3R0GA 3SZKA 3HRWB 2MGAA 1CH5A 1FN3B 1KR7A 3ZJIA 1Y8WA 3UBCA 2MGJA 3LB1A 1Y5FA 2EKTA 2SPLA 110MA 1C40B 1R1YB 5KDQA 2R1HB 1IWHA 2V1GA 3AQ5A 4ODCA 5JGGB 1SHRB 4N7OB 1Y85B 2ZFOC 3VRGB 1A0ZB 1SI4B 2AA1A 1UC3A 3S65A 1YEUA 1Y01B 1QPWA 2BWHA 3M38A 1NQPA 4G1VA 1DO7A 1O1KB 4ZVAA 1XQ5B 1NIHB 1GCVB 3EU1B 3NFEA 2RI4A 4F6FA 5C6YA 1HDAA 1HBAA 1Y7GA 1UFJA 2Z6NA 4AVDA 1XY0B 5KKKA 1Y31B 2MYAA 3G4WA 3G52A 4H2LA 3A59B 3UHIA 4G51A 5KDQB 1FSXB 2G0SA 2G14A 108MA 1K0YA 2D2ND 2W6XA 2ZT0A 1CMYA 1V4WA 101MA 3MKBA 5CNDA 5CHRA 1A9WE 1YZIA 3ECLA 3H57A 2DXMB 2MGCA 2R80A 5E83B 3E5OA 5HLUA 1G09A 3E55A 2HBGA 5HBIA 3GDJA 3D7OB 1RQ3B 3QM8A 1J7YA 1Y46B 2WTHA 2LH7A 5EU2A 1FSXA 1BBBB 1NWIA 3LB4A 1YMBA 1Y0DB 1Y22B 3WCUC 2ZLWB 2M6ZA 1RPSB 1QXDB 1Y85A 2VEEA 3WFWA 3ZOLA 2O5MX 3MVCA 1ECAA 3U3EA 2HCOA 3FS4B 5CNEA 1Y7GB 1JP8A 2VHBA 3QM6A 4MQIA 1H97A 2LH1A 3D4XB 1S5XA 2DC3A 1YIHA 2ZSZA 107MA 2Z8AA 4FH6A 1MKOB 3PI4A 3ZJPA 4KJTA 1JL6A 1HBSA 1QSIB 2ZS1D 3DHRA 3WHMB 1CPWA 3EOKA 2EF2A 4DC7A 104MA 1OUTB 1OFKA 1CH4A 1JP9A 1LJWA 2ZFOB 2W72C 1Y7CA 1XZ7B 3OO4B 5JOMA 1FCSA 4B4YA 1S6AA 1MYTA 1GLIA 3BJ3B 2ZSTA 4YU4A 1JL7A 1CMYB 1HDSA 2SPMA 2ZSXA 1Y7ZB 1YCBA 1CG8A 7HBIA 1BABB 1X46A 2QSPB 3NL7B 3WTGB 4C0NA 3TLDA 3KUOA 1X3KA 1EBTA 5ILEA 3VAUA 1HJTA 5HU6A 2ZS0C 3PT7B 1GBUA 1V4WB 3AT5B 1CH3A 1CBLA 1DXTB 1NS6A 3OZUA 1H1XA 1PBXA 1MBCA 1MNOA 1J3YA 1VXGA 4L7YB 1RQ4A 1C7DB 1LA6A 4AVEA 2NRLA 1Y45A 2W6VA 2NRMA 1QI8A 2NSSA 1DXUA 3RJNB 1Y5FB 2ZSRA 1YFFA 3G4QA 1DO1A 3KMFC 1YIHB 2DN2A 2MGLA 3S66B 1U7SA 1Y4QB 3BCQA 2MHBB 3CIUA 2YRSB 1IDRA 1MTJA 3IC2B 1BZZB 2MGEA 1BIJA 1IBEB 2H35A 2XKGA 1N9IA 1DWRA 1XYEA 3OZWA 1JF3A 4JYQA 1Y7ZA 2V1JA 3D17A 1MOAA 1O1KA 1SDKA 5CNGA 3ZJMA 1GJNA 1MNKA 1QXEB 5HLQA 1NZ4A 3UH5A 3HXNB 3M3BA 3BJ2A 1K0YB 1UX9A 4U8UC 4H0BA 4BJAA 1Y0WB 3PI8B 4TYXA 2ZWJA 4N8TA 4NXCA 2HBDA 4M4AA 3ECXA 3DHRB 2HCOB 3K3UA 4MQHA 3D1AA 1A6MA 1MBDA 1MLUA 4O1TA 3V2ZA 1Y4PB 1MLRA 2ZFBA 3OO5A 5HLXA 1MLJA 4ESAB 3OVUC 1S0HA 4C44A 1LFYA 1VXAA 1NPGA 1CIOA 3A9MA 4H07A 1TU9A 1Z8UB 5JDOD 1OUUA 3G4YA 1ABYA 5AB8A 3O7NA 3CY5B 1NAZA 1Y0DA 1N9HA 1RVWB 1OBMA 3ZHWA 2ZFBB 1B0BA 2W6YA 1AJGA 1IRDB 1J3FA 1YE2A 1M6CA 2G3HA 2AUOA 3WCPB 4N7OA 4N7NB 3WI8A 1V4XB 1O1PB 1MLNA 2AURA 1UVXA 1LTWA 3OZVA 1EW6A 2B7HB 1FDHA 1A9WA 5EUIA 1G09B 4MXLA 1O1MB 1WLAA 3HEPA 4XDIA 1BZ1A 3WCVB 1JEBA 1JP6A 3ONZB 2WTGA 1IT3A 1GBVB 2YRSA 4MPMA 1MLFA 1ITHA 1Y22A 5E6EB 1XXTB 5KERA 3GLNA 3GKVA 1M9PA 4NXAA 3WHMA 1Y7CB 1M6MA 1S56A 1HBRA 3D7OA 3BJ2B 3ZJNA 1D8UA 3LQDA 1F63A 2ZLXA 2MHBA 1O1MA 2FAMA 2DN3A 1Y35B 1PBXB 1YE0A 3UHTA 2D2MC 4KN3A 3TM3A 3NL7A 1BZ0B 3RJ6A 1CBMA 3QZZA 1VREA 2ZLVB 4QAUA 2O5QX 4XS0B 5CN7A 5JGGA 1B86B 2LH2A 1Y8WB 3UH6A 1F5PA 1LFVB 1DM1A 1Y0CB 1YVTB 2CMMA 1DTIA 2D5XA 1HV4A 2HBFB 2GRZA 1FAWA 4FWZA 3W4UB 1FSLA 2G0XA 5SW7B 1CQ2A 1Y2ZA 2R4WA 5C6EA 1XXTA 1IRDA 1A3OB 2VLZA 4SDHA 2O5OX 2ZS1A 3RGKA 4JACA 1J41B 1CP5A 1LHTA 3KMFA 1CH9A 1LH5A 5EYSA 1XYEB 2GKNA 4HRTB 2DN3B 3LHBA 1Y83A 1WVPA 2NX0A 1C7BA 2JHOA 1A0UB 1Y31A 3UI0A 3S65B 1HCOB 103MA 1HRMA 1MOBA 4FWXA 3BJ3A 1VXHA 1VXDA 2AV3A 1HGCB 2PGHA 2FRIX 1LFZB 1BZPA 1YHUD 3EDBA 2VLXA 3DHTA 1GBVA 3ONZA 4F69A 1G0AB 2GRHA 1L2KA 1M9PB 2R50A 1YEQB 2GDMA 1GCWB 1DXDA 1A00B 3MN0A 3LR9A 3AQ8A 1YG5B 3ASEA 2MGGA 3K8BB 2FRJX 1XZ2B 3G53A 2E2YA 5ILMA 2QU0B 3GQRA 3D17B 2VEBA 4N8TB 4O4ZA 2HHEA 1NZ5A 2BKMA 4O2GA 2D5XB 1YDZB 3WR1B 1HABB 1RQAB 1QSHB 1MYFA 3HXNA 1U7RA 3QQRA 1NWNA 2LHBA 2HHBA 4MBNA 5CN9A 1V9QA 5KERB 3UHYA 3PI2A 1MBOA 2BW9M 5HY8B 1BABA 1YEVB 1DKEB 2LH3A 5EQMA 2MGFA 4HRTA 5C6EB 2QRWA 3EDAA 3GQGB 5ILRA 1DO3A 2QLSB 5MBNA 1OR4A 2D2NA 1G9VB 1J41A 2PEGA 5CNFA 2QMBA 3QJCB 1A6KA 1NZ3A 5CN6A 2D2MB 1KD2B 1N9FA 4NI0A 3LB3A 1Y4VA 2H35B 1MOCA 3H58A 1RQ4B 1G0BA 2ZSOA 2W72A 2ZS0B 3M3AA 2V1HA 2MYDA 1YEUB 1Y09A 1MBSA 3A0GA 1LFZA 1YHUB 1OR6A 3VREB 3P5QB 4HRRA 1DWSA 4WJG1 1MZ0A 3R5IA 1YENB 3LB2A 1Y4PA 4MQKA 1MODA 3PELA 1SHRA 1Q1FA 3UHHA 2D5ZB 4H2LB 2MGMA 1Y4FA 3HYUB 3LR7A 2KSCA 2ZSQA 5CNCA 3VRGA 1C7DA 2ZSNA 1RQAA 1C7CA 4YU4B 2HZ3A 109MA 1MWBA 2BLJM 4MQHB 1O1IB 1MLLA 4HSXA 3GOUA 1Y8KA 1YVTA 1MTIA 3UHUA 1Y8HA 5JDOE 3HYUA 1YOIA 2ZLTB 3MJPA 1LH6A 2DHBA 5M3SA 1YZIB 1FN3A 1HGBA 3WCTD 4MBAA 1O1IA 4N7NA 1A01B 1VXCA 2ZLVA 1MCYA 1WMUA 4F4OB 1Y0CA 102MA 3NG6A 2OHBA 1GZXB 1C40A 105MA 4PNJA 3LQDB 1G0AA 1TESA 1MYMA 2PEGB 1QPWB 3ZJLA 1YDZA 1GDJA 1HGCA 3B75B 2D2MA 1O1LB 1YEOA 1R1XA 2HBEA 2ZS0D 4X0LB 1HBHB 1JW8A 1YVQB 3AT6A 1XZVA 1DXCA 3PIAA 1A0UA 1BZ1B 1A3OA 3D1KA 1CH1A 3OO4A 2GNWA 1A00A 1V75A 2MGIA 3ZJRA 1XZ5B 1T1NB 1HV4B 1HSYA 3UHXA 1JY7B 3PI3A 1Y4GB 3AT5A 2EVKA 3DR9A 3G46A 3MBAA 5ILPA 3EOKB 2VM0A 1LFTB 2H8FA 1G9VA 1O1NA 1LUEA 1UVYA 2HBCA 4PQ6A 1V4UB 5E83A 1MYJA 5JDOC 1HBSB 1YFFB 2VYWA 3DUTB 1J3ZA 3NMMA 1Y8HB 2ZS1C 3OK5A 1YG5A 1UMOA 1LFVA 1HHOA 1HLBA 2ZT4A 4HSWA 1X9FC 3UHCA 1VXFA 1XZ2A 2H8DA 1CO9A 1XZ7A 1BIJB 3D1AB 2ZLUB 3WCWB 3R5IB 1VWTA 1J7WA 1NEJB 2W6WA 4KMVA 1UIWA 6HBWA 2SPNA 1DXTA 1NS6B 1OFJA 2HHBB 3ZJJA 2QU0A 1MLQA 1GDLA 1A01A 1MBIA 3KUNA 3ZJSA 1J40A 3QM9A 3AG0A 2O58X 2GNVA 2R1HA 1JPBA 1HBHA 2DN2B 2OLPA 1MTKA 4FC3A 4MQCB 1YGFA 3WCTB 1AZIA 1HGBB 1Y8KB 3OJ1A 3DUTA 1QI8B 1BUWA 1Y0AA 4WCHD 1HBRB 2D2NC 1YHUC 2ZFOD 4HRRB 4HBIA 1SI4A 1KD2A 1MBNA 2EB9A 2MGHA 2XKIA 1CLSA 2VLYA 3GQPB 1BVDA 1HBBA 2LH5A 4IROA 3K9ZA 1S61A 5JDOF 2ZFOA 1NGKA 1Y0TA 1HABA 1MLMA 3HC9A 1I3EA 3MKBB 2ZT2A 1DLWA 4B3WA 1V5HA 1LH2A 1EBCA 2G0ZA 1A6GA 3D4XA 1YOGA 2QLSA 4OF9A 3PI9A 1J52A 4ILZA 2BLHA 2W31A 1IBEA 2MYCA 1MKOA 1MNHA 3UBVA 1MNIA 2MGBA 1LFQB 1A3NB 3AT6B 1K1KA 2LH6A 1HGAA 4F6GA 2EKUA 5CMVA 2D6CA 5F2AA 2D5ZA 1MLGA 2HBSA 1Y5KA 2ZLUA 1HBIA 3WCWA 1MYHA 1JF4A 3GDJB 2M6ZB 3G4UA 5AZRA 3MYMA 1IWHB 1YVQA 1MLKA 2D2MD 1Y0WA 3MJPB 5HAVA 1HDSB 112MA 5EYJA 1Y4BB 3FS4A 2SPOA 3QJBB 3G4VA 1DXVB 1Y5KB 4MXKA 1XZUA 4NI1B 4MQIB 4O35A 2OHAA 3SZKB 2Z6NB 4ZVBA 2NSRA 3AQ9A 4M4BA 1AJ9A 1YHEA 3S1JA 3WCUA 1LH7A 3AQ6A 1RVWA 1LH1A 3S1IA 3UHGA 1NS9A 4MQJB 1NIHA 1HDBB 1URYA 3ZJOA 2EB8A 1JY7A 1CLSB 1OUTA 4TWVA 1I3DA 1JZLA 3QJDB 5IKSA 1LHSA 1MWCA 1O1PA 3A2GA 1IOPA 3GOUB 3UHVA 3WTGA 3WFTA 2B7HA 3W4UA 1DXUB 1O1OB 4L7YA 3K8BA 4MQCA 4F6DA 1Y4GA 2QFNA 1C7CB 2FALA 3WCWC 5HY8A 1DTMA 1LA6B 1YE0B 2GLNA 4MU5A 3A59A 3SDNA 1DUOA 3ARKA 1A3NA 3QMAA 1HACB 3IC2A 1YE2B 1MOHA 2HBFA 4PQBA 4N7PB 5F0BA 1SDLB 1PMBA 1J7SB 2O5LX 1AJHA 1CIKA 1VHBA 1BBBA 2AA1B 4FC3B 3TM9A 4YU3A 2ZSYA 1Y35A 1NQPB 5HU6B 1W92A 1ECNA 2FRFA 4NZIA 1YHRB 4KMWA 1G0BB 1Y8IB 4X0LA 2GTLA 1XCHA 5AZQA 4NK1A 3WCVD 3NG6B 1UIWB 3UHNA 3A0GB 3QJEA 1YHEB 3ODQA 2QSSB 4U8UD 3MJUB 3VHBA 1NXFA 2V1KA 3SDHA 1O1OA 2BLIA 2HBCB 1GVHA 4NI1A 5B84A 1GCVA 1MLOA 1SPGB 4NI0B 3FH9A 1FAWB 2R4YA 3UHBA 6HBWB 3AQ7A 1R1YA 3UHDA 2QSPA 1BINA 2ZLTA 3MOUA 2XYKA 1Y4QA 3BCQB 3CIUB 3QJDA 1JDOA 1CQXA 1XZVB 1MGNA 1DLYA 1YGFB 3GYSB 4TWUA 1OJ6A 1S0HB 1THBA 3HHBA 3A5GA 1BUWB 2D60B 1A4FB 1YH9B 2MBWA 1MWDA 1FHJB 3PI1A 1N9XA 1ASHA 3V2VA 2HBDB 4M4AB 4ESAA 1CG5B 1YHUA 4U8UA 1BZRA 3ED9A 1Y8IA
chains in the Genus database with same CATH superfamily
4A8SA 5EETA 4G1BA 3FEWX 4F6JA 3DHTB 2GKMA 1A4FA 2H8DB 3QJEB 1Y4RA 1HBAB 5EE4C 1LFYB 1MYZA 3CY5A 3BOMB 1ECDA 4HHBA 1PHNA 4PO5A 3OO5B 2HZ1A 1SDLA 4N7PA 1BVCA 2OH8A 5E29B 1V07A 1DWTA 1GLIB 1ABWB 2G10A 2ZT3A 2MGDA 4YU3B 3UHQA 1B8DA 3HRWA 1RSEA 1KN1A 1BZZA 1F65A 1LJWB 1HBBB 1Y4RB 2OIFA 2G12A 1YGDB 1I7YA 2GTLC 4LPIA 2IG3A 1V4UA 2V1FA 3HF4A 1IT2A 3G4RA 2GTLB 1SPGA 3EU1A 1Y7DB 1UVMA 4MAXA 1ABYB 2V1IA 5MBAA 1S5YA 2DKAA 3GQPA 4Z8KA 4DC8A 4M4BB 1HHOB 1MYIA 3ZJHA 1HLMA 2MYEA 1MNJA 2QMBB 1JBOA 1B8DB 4UZVA 1YEVA 3UGYA 2VYZA 1NZ2A 1BZ0A 3P5QA 1CH2A 1XQ5A 1DXVA 3QJBA 1CPCA 1SGKA 1DUKA 4XS0A 4Q70A 1AJ9B 2O5TX 2VYYA 2AV0A 3VRFA 3B75A 3BJ1B 1Y4FB 4MQGA 4G51B 1XZ5A 4MQJA 5CNBA 2G0RA 3A5AA 1J40B 1MBAA 1QSIA 1LFQA 5EV5A 4F6BA 1GH0B 2Z6TA 4XXIA 1YMCA 1URVA 1CG5A 2BV8A 4LM6B 2HHDB 1V75B 1BJEA 4F4OA 1YOHA 1A0ZA 4F68A 1OUUB 3PMCA 4NK2A 1GBUB 1UFPA 3NMLA 5B85A 4UURA 1X9FB 2WCRA 1YCAA 1VRFA 2W72B 2ZS0A 1XZ4A 4DWTA 2HBSB 3WCUD 1FLPA 3BOMA 1X9FD 1ABSA 3WCUB 3MJUA 1YGDA 5EOHA 1HDBA 3QZXA 4ODCB 3GQGA 3PELB 4FH7A 3WCWD 2MB5A 3GYSA 3QJCA 3ARLA 1COHA 1LFLA 1MYGA 1CO8A 1UVJA 1G08A 4ROMA 3HENA 1SDKB 3UH3A 2D60A 1S5YB 1J7SA 4IT8A 1GDKA 1O1NB 1YIEB 1JBOB 3QM7A 2ZS1B 1Y45B 2W6VB 3ODQB 2JLGA 1Y0TB 1YEQA 2GTLD 2O5BX 1SWMA 1Y5JB 2GL3A 3UHWA 1NS9B 2ZLXB 4ZIZA 3O18B 5D1VA 2HZ2A 5CHQA 3ORDA 4ESUA 1WACA 3VRFB 3PI8A 1ON7A 1THBB 4F0TA 5CN4A 2VJRA 1VWTB 3UH7A 3NMMB 6HBIA 1FHJA 3WCTC 4O4TA 5EE4D 1SPEA 1NY9A 3UHKA 1YENA 4VHBA 3PT8B 2DHBB 3ECZA 2HHDA 1G08B 3GKVB 3WCPA 3MYNA 3IC0A 2O5SX 1Y46A 2RAOA 1WMUB 1LIAA 2HHEB 1YMAA 3QQQA 1YIEA 3FH9B 1QXEA 2ZT1A 3M39A 1GZXA 4NS2A 1XY0A 5CN5A 2OH9A 2QSSA 1JWNA 3HEOA 1LFLB 4LMSB 4PQCA 3WFUA 2MYBA 1UX8A 1CH7A 1O16A 2RI4B 1S5XB 3WCVA 1J3ZB 1KFRA 1Y83B 1R1XB 2HBEB 3BA2A 1XZ4B 4GZGA 2QFKA 5SW7A 4WJGA 4MQKB 3PIAB 1HBGA 2AUPA 1COHB 1DKEA 1MDNA 1NPFA 1DO4A 4L1EA 4MQGB 1O1LA 1HDAB 2EVPA 1B33A 1RTXA 5B13A 2BNLA 1Y7DA 3UHSA 2G0VA 1Y09B 1BZ6A 2UUMB 2V1EA 2R4XA 2R4ZA 1Y4BA 1VXBA 2DN1B 3IC0B 3S66A 1Y5JA 1RTEA 3BJ1A 5EUIB 2XKHA 1TOXA 2UULC 3UHZA 2C0KA 3VREA 1RQ3A 4DWUA 1YHRA 4F0UB 1JEBB 2UUNB 3LQ9A 2I88A 3WCTA 2R80B 4HHBB 1JZKA 1MLSA 1CP0A 1CG8B 2PGHB 2ZSSA 1MLHA 111MA 1LIAB 4OODA 3ZOMA 1J7YB 1T1NA 3PT7A 2ZLWA 3OGBA 2DKDA 2WY4A 1LFTA 2H8FB 1Y0AB 1EYXA 3WCVC 1F5OA 3S48C 3WR1A 1IRCA 4FWYA 1S69A 2AUQA 3IXFA 1YH9A 1EMYA 2DKCA 1B86A 3IA3B 1FDHG 3PT8A 1ABWA 1O1JB 3ZH0A 4IROB 3HF4B 3ARJA 2Z6SA 1HACA 2RAOB 1Y4VB 4U8UB 2VRYA 4ROLA 1YEOB 3E5IA 1HGAB 1J7WB 1NEJA 2MGKA 1K1KB 2BK9A 3QM5A 106MA 1HCOA 2C7JB 1GDIA 1QXDA 3D1KB 1UT0A 2ZSPA 3GK9A 2Z85A 3A5BA 1O1JA 1VXEA 4UIQA 5D5RA 1LH3A 2G11A 1XZUB 3NFEB 4HH1A 5E29A 1X9FA 1HHTP 2DN1A 2FRKX 1V4XA 5CN8A 1Y2ZB 3WFXA 4GXEB 3HHBB 1RPSA 4N6SB 1J3YB 2V8AA 1A6NA 1GCWA 4ROMB 4L2MA 3GKTA 1JZMA 1QSHA 2GRFA 3UHEA 3E4NA 3UGZA 2IN4A 3O89A 1C7BB 2D2NB 1EWAA 3GQRB 2BMMA 3PI9B 4ETUA 2DXMA 4ROLB 3UHRA 5E6EA 3ZJQA 1ECOA 4F6IA 3R0GA 3SZKA 3HRWB 2MGAA 1CH5A 1FN3B 1KR7A 3ZJIA 1Y8WA 3UBCA 2MGJA 3LB1A 1Y5FA 3O2CA 2EKTA 2SPLA 110MA 4BS9A 1C40B 1R1YB 5KDQA 2R1HB 1IWHA 2V1GA 3AQ5A 4ODCA 5AQDA 5JGGB 1SHRB 4N7OB 1Y85B 2ZFOC 3VRGB 1A0ZB 1SI4B 2AA1A 1UC3A 3S65A 1A87A 1YEUA 1Y01B 1QPWA 2BWHA 3M38A 1NQPA 4G1VA 1DO7A 1O1KB 3DBJA 4ZVAA 1XQ5B 1NIHB 1GCVB 3EU1B 3NFEA 2RI4A 4ETVA 4F6FA 5C6YA 1HDAA 1HBAA 1Y7GA 4A8MP 1UFJA 2Z6NA 4AVDA 1XY0B 5KKKA 1Y31B 2MYAA 3G4WA 3G52A 4H2LA 3A59B 3UHIA 4G51A 4ERVA 5KDQB 1FSXB 2G0SA 2G14A 108MA 1K0YA 2D2ND 2W6XA 2ZT0A 1CMYA 1V4WA 101MA 3MKBA 5CNDA 5CHRA 1A9WE 1YZIA 3ECLA 3H57A 2DXMB 2MGCA 2R80A 5E83B 2UULA 3E5OA 5HLUA 1G09A 3E55A 2HBGA 5HBIA 3GDJA 3D7OB 1RQ3B 3QM8A 1J7YA 1Y46B 2WTHA 2LH7A 5EU2A 1FSXA 2JL9A 1BBBB 4YJJB 5FVBM 1NWIA 3LB4A 1YMBA 2VJTA 1Y0DB 1Y22B 3WCUC 2ZLWB 2M6ZA 1RPSB 1QXDB 1Y85A 2VEEA 3WFWA 3ZOLA 2O5MX 3L0FA 3MVCA 1ECAA 3U3EA 2HCOA 3FS4B 5CNEA 1CPCB 1Y7GB 1JP8A 2VHBA 3QM6A 4MQIA 1H97A 2LH1A 3D4XB 1S5XA 2DC3A 1YIHA 2ZSZA 107MA 2Z8AA 4FH6A 1MKOB 3PI4A 3ZJPA 4KJTA 1JL6A 1HBSA 1QSIB 2ZS1D 3DHRA 3WHMB 1CPWA 3GIOA 3EOKA 2EF2A 4DC7A 2X49A 104MA 1OUTB 1OFKA 1CH4A 1JP9A 1LJWA 1KN1B 2ZFOB 2W72C 1Y7CA 1XZ7B 3OO4B 5JOMA 1FCSA 4B4YA 1S6AA 1MYTA 1GLIA 3BJ3B 2ZSTA 4YU4A 1JL7A 1CMYB 1HDSA 2SPMA 2ZSXA 1Y7ZB 1YCBA 1CG8A 7HBIA 1BABB 1X46A 2QSPB 3NL7B 3WTGB 4C0NA 1ON7B 3TLDA 3KUOA 1X3KA 1EBTA 5ILEA 3VAUA 1HJTA 5HU6A 2ZS0C 3PT7B 1GBUA 1V4WB 1HI1A 3AT5B 1CH3A 1CBLA 1DXTB 1NS6A 3OZUA 1EYXB 1H1XA 1PBXA 1MBCA 1MNOA 1J3YA 2V8AB 1VXGA 4L7YB 1RQ4A 1C7DB 1LA6A 3BRPA 4AVEA 2NRLA 1Y45A 2W6VA 2NRMA 1QI8A 2NSSA 1DXUA 3RJNB 1Y5FB 3O2CB 2ZSRA 1KTPA 1YFFA 3G4QA 1DO1A 3KMFC 1YIHB 2DN2A 1HI0P 4GY3B 2MGLA 3S66B 4A8FA 1U7SA 1Y4QB 3BCQA 2MHBB 3CIUA 2YRSB 1IDRA 4Q70B 1MTJA 3IC2B 1BZZB 2MGEA 4XXKA 1BIJA 1IBEB 3GUQA 2H35A 2XKGA 1N9IA 1DWRA 1XYEA 1KTPB 3OZWA 1JF3A 4JYQA 1Y7ZA 2V1JA 3D17A 2UULB 1MOAA 1O1KA 3DBJB 1SDKA 5CNGA 3ZJMA 1GJNA 1MNKA 4BJUA 1QXEB 5HLQA 1NZ4A 3UH5A 3HXNB 3M3BA 3BJ2A 1K0YB 2C7KB 1UX9A 4U8UC 1F99A 4H0BA 4BJAA 1Y0WB 3PI8B 4TYXA 2ZWJA 4N8TA 4NXCA 2HBDA 4M4AA 3ECXA 3DHRB 2HCOB 3K3UA 4MQHA 3D1AA 3V58B 1A6MA 3O18A 1MBDA 1MLUA 2UUNA 4O1TA 3V2ZA 1Y4PB 1MLRA 2ZFBA 3OO5A 5HLXA 1MLJA 4ESAB 3NUHB 3OVUC 1S0HA 4C44A 1UVIA 1LFYA 1VXAA 1NPGA 1CIOA 1DDTA 4LMXB 3A9MA 4H07A 3KVSB 1TU9A 1Z8UB 5JDOD 1OUUA 2UUND 3G4YA 1ABYA 5AB8A 3O7NA 3CY5B 1NAZA 1Y0DA 1N9HA 1RVWB 1OBMA 3ZHWA 2ZFBB 1B0BA 2W6YA 1AJGA 1IRDB 1J3FA 1YE2A 1M6CA 2G3HA 3L0FB 2AUOA 3WCPB 4N7OA 4N7NB 3WI8A 1V4XB 3V57A 1O1PB 1MLNA 2AURA 1UVXA 1LTWA 1HA7A 3OZVA 1EW6A 2B7HB 1FDHA 1A9WA 5EUIA 1G09B 4MXLA 1O1MB 1WLAA 3HEPA 4XDIA 1BZ1A 3WCVB 1JEBA 1HHSA 1JP6A 2UUMA 3ONZB 2WTGA 1IT3A 1GBVB 2YRSA 4ETTA 4MPMA 1MLFA 1ITHA 1Y22A 5E6EB 3V57B 1XXTB 5KERA 3GLNA 3GKVA 1M9PA 4NXAA 3WHMA 1Y7CB 1M6MA 4A8KA 1S56A 1HBRA 3D7OA 2VJHA 3BJ2B 3ZJNA 1D8UA 3LQDA 1F63A 2ZLXA 2MHBA 1O1MA 2FAMA 2DN3A 1Y35B 1PBXB 1YE0A 3UHTA 2D2MC 4KN3A 3TM3A 3NL7A 1BZ0B 3RJ6A 1CBMA 3QZZA 1VREA 2ZLVB 4QAUA 2O5QX 4XS0B 5CN7A 5JGGA 1B86B 2LH2A 1Y8WB 3UH6A 1F5PA 1LFVB 1DM1A 1Y0CB 1YVTB 2CMMA 1DTIA 2D5XA 1HV4A 2HBFB 2GRZA 1FAWA 4FWZA 3W4UB 1FSLA 2G0XA 5SW7B 1CQ2A 1Y2ZA 2R4WA 5C6EA 1XXTA 1IRDA 1A3OB 2VLZA 4SDHA 2O5OX 2ZS1A 3RGKA 4JACA 1J41B 1CP5A 1LHTA 3KMFA 1CH9A 1LH5A 5EYSA 1XYEB 2GKNA 4HRTB 2DN3B 3LHBA 1Y83A 1WVPA 2NX0A 1C7BA 2JHOA 1A0UB 1Y31A 3UI0A 3S65B 1HCOB 103MA 1HRMA 1MOBA 4FWXA 3BJ3A 1VXHA 1VXDA 2AV3A 1HGCB 2PGHA 2FRIX 1LFZB 2YSKA 1BZPA 1YHUD 3EDBA 2VLXA 3DHTA 1GBVA 3ONZA 4F69A 1G0AB 2GRHA 1L2KA 1M9PB 2R50A 1YEQB 2GDMA 1GCWB 1DXDA 1A00B 3MN0A 3LR9A 3AQ8A 1YG5B 3ASEA 2MGGA 3K8BB 1COLA 2FRJX 1XZ2B 4AE0A 3G53A 2E2YA 5ILMA 2QU0B 3GQRA 3D17B 2VEBA 4N8TB 4O4ZA 2HHEA 1NZ5A 2BKMA 4O2GA 2D5XB 1YDZB 3WR1B 1HABB 1RQAB 1QSHB 1MYFA 3HXNA 1U7RA 1QGWC 3QQRA 1NWNA 2LHBA 2HHBA 4MBNA 5CN9A 1V9QA 5KERB 3UHYA 3PI2A 1MBOA 2BW9M 5HY8B 1BABA 1YEVB 1DKEB 2LH3A 5EQMA 2MGFA 4HRTA 5C6EB 2QRWA 3EDAA 3GQGB 5ILRA 1DO3A 2QLSB 5MBNA 1OR4A 2D2NA 1G9VB 1J41A 2PEGA 5CNFA 1HA7B 2QMBA 3QJCB 1I7YB 1A6KA 1PHNB 1NZ3A 4ERTA 5CN6A 2D2MB 1KD2B 1N9FA 4NI0A 3LB3A 1Y4VA 2H35B 1MOCA 3H58A 1RQ4B 1G0BA 2ZSOA 2W72A 2ZS0B 3M3AA 2V1HA 2MYDA 1YEUB 1Y09A 1MBSA 4A8WA 3A0GA 1LFZA 1YHUB 1OR6A 3VREB 3ZTAA 3P5QB 4HRRA 1DWSA 4WJG1 1MZ0A 1F99B 3R5IA 2C7LA 1YENB 3LB2A 1Y4PA 4MQKA 1MODA 3PELA 1SHRA 1Q1FA 4H0MB 3UHHA 2D5ZB 4H2LB 2MGMA 1RH1A 1Y4FA 3HYUB 3LR7A 4A8OA 2KSCA 2ZSQA 5CNCA 3VRGA 1C7DA 2ZSNA 1RQAA 1C7CA 1UVNA 4YU4B 2HZ3A 1UVLA 109MA 1MWBA 2BLJM 4MQHB 2VJHB 1O1IB 1MLLA 4HSXA 3GOUA 1Y8KA 1YVTA 1MTIA 3UHUA 1Y8HA 5JDOE 3HYUA 1YOIA 2ZLTB 3RQRA 3MJPA 1LH6A 2DHBA 5M3SA 1ALLA 1YZIB 1FN3A 1HGBA 3WCTD 1XF6C 4MBAA 1O1IA 4N7NA 1A01B 1VXCA 2ZLVA 2VMLA 1MCYA 1WMUA 4PO5B 4F4OB 1Y0CA 102MA 3NG6A 2OHBA 2UULH 1GZXB 5B13G 1C40A 105MA 4PNJA 4H0MA 3LQDB 1G0AA 1TESA 1MYMA 2PEGB 1QPWB 3ZJLA 1YDZA 1GDJA 1HGCA 3B75B 2D2MA 1O1LB 1YEOA 1R1XA 2HBEA 2ZS0D 4X0LB 1HBHB 1JW8A 1YVQB 3AT6A 2UUMX 1XZVA 1DXCA 3PIAA 1A0UA 1BZ1B 1A3OA 3D1KA 1CH1A 3OO4A 2GNWA 1A00A 1V75A 2X4AA 2MGIA 3MWNA 3VNCA 3ZJRA 1XZ5B 1T1NB 1HV4B 1HSYA 3UHXA 1JY7B 3PI3A 1Y4GB 3AT5A 1GH0A 2EVKA 3DR9A 3G46A 3MBAA 5ILPA 3EOKB 2VM0A 1LFTB 2H8FA 1G9VA 1O1NA 4RMPA 1LUEA 1UVYA 2HBCA 4PQ6A 1V4UB 5E83A 1MYJA 5JDOC 1HBSB 1YFFB 2VYWA 3DUTB 1J3ZA 3NMMA 1Y8HB 2C7LB 2ZS1C 2C7KA 3OK5A 1YG5A 1UMOA 1LFVA 1HHOA 1HLBA 2ZT4A 4HSWA 5AQDM 1X9FC 3UHCA 1VXFA 1HI8A 1XZ2A 2H8DA 1CO9A 1XZ7A 1BIJB 3D1AB 2ZLUB 3WCWB 3R5IB 1VWTA 1J7WA 1NEJB 2W6WA 4KMVA 1UIWA 6HBWA 2SPNA 1DXTA 1NS6B 1OFJA 2HHBB 3ZJJA 2QU0A 1MLQA 2VMLB 1GDLA 1A01A 1MBIA 3KUNA 3ZJSA 1J40A 3QM9A 3AG0A 2O58X 2GNVA 2R1HA 1JPBA 1HBHA 2DN2B 2OLPA 1MTKA 4FC3A 2BV8B 4MQCB 1YGFA 3WCTB 1UVKA 1AZIA 1HGBB 1Y8KB 3OJ1A 3DUTA 1QI8B 1BUWA 1Y0AA 4WCHD 1HBRB 2D2NC 1YHUC 2ZFOD 4HRRB 4HBIA 1CIIA 1SI4A 1KD2A 1MBNA 2EB9A 2MGHA 2XKIA 1CLSA 2VLYA 3GQPB 4Z8KB 1BVDA 1HBBA 2LH5A 4RMPB 4IROA 3K9ZA 1S61A 5JDOF 2ZFOA 1NGKA 1Y0TA 1HABA 1MLMA 3HC9A 1I3EA 3MKBB 2ZT2A 5FVBA 1DLWA 4B3WA 1V5HA 1LH2A 1EBCA 2G0ZA 1A6GA 3D4XA 1YOGA 2QLSA 4OF9A 3PI9A 1J52A 4ILZA 2BLHA 2W31A 1IBEA 2MYCA 1MKOA 1MNHA 3UBVA 1MDTA 4HH0A 1MNIA 2MGBA 1LFQB 1A3NB 3AT6B 4B02A 1K1KA 2LH6A 1HGAA 4F6GA 2EKUA 5CMVA 2D6CA 5F2AA 2D5ZA 1MLGA 2HBSA 1Y5KA 2ZLUA 1HBIA 3WCWA 3PMDA 1MYHA 1JF4A 3GDJB 4ZIZB 2M6ZB 3G4UA 5AZRA 3MYMA 1B33B 1IWHB 1YVQA 1MLKA 2D2MD 1Y0WA 3MJPB 5HAVA 1HDSB 112MA 5EYJA 1Y4BB 3FS4A 1XG0C 2SPOA 3QJBB 3G4VA 1DXVB 1Y5KB 4MXKA 1XZUA 4NI1B 4MQIB 4O35A 2OHAA 2VJTB 3SZKB 2Z6NB 4ZVBA 2NSRA 3AQ9A 4M4BA 1AJ9A 2WCQA 1XDTT 1YHEA 3S1JA 3WCUA 2C7JA 1LH7A 3AQ6A 1RVWA 1LH1A 3S1IA 3UHGA 4A8YA 1NS9A 4MQJB 1NIHA 1HDBB 1URYA 3ZJOA 2EB8A 1JY7A 1CLSB 4F0UA 1OUTA 4TWVA 1I3DA 1JZLA 3QJDB 5IKSA 1LHSA 1MWCA 2VJRB 1O1PA 3A2GA 1IOPA 4GXEA 3GOUB 3UHVA 3WTGA 3WFTA 2B7HA 3W4UA 1DXUB 4TMAB 1O1OB 4L7YA 3K8BA 4MQCA 4F6DA 1Y4GA 2QFNA 1C7CB 2FALA 3WCWC 5HY8A 1DTMA 1F0LA 1LA6B 1YE0B 2GLNA 4MU5A 4L1EB 3A59A 3SDNA 1DUOA 3ARKA 1A3NA 2JLFA 3QMAA 1HACB 3IC2A 1YE2B 1MOHA 2HBFA 2J96A 4PQBA 4N7PB 5F0BA 1SDLB 1ALLB 1PMBA 1J7SB 2O5LX 1AJHA 1CIKA 1VHBA 1BBBA 2AA1B 4YJJA 4FC3B 3TM9A 4YU3A 2ZSYA 1Y35A 1NQPB 5HU6B 1W92A 1ECNA 2FRFA 4NZIA 1YHRB 4KMWA 1G0BB 1Y8IB 4X0LA 2GTLA 3BRPB 1XCHA 5AZQA 4NK1A 3WCVD 3NG6B 1UIWB 3UHNA 3A0GB 3QJEA 1YHEB 3ODQA 2QSSB 4U8UD 3MJUB 3VHBA 4GY3A 1NXFA 2V1KA 3SDHA 1O1OA 2BLIA 2HBCB 1GVHA 4NI1A 5B84A 1GCVA 1MLOA 1SPGB 4NI0B 3FH9A 1FAWB 2R4YA 3UHBA 6HBWB 3AQ7A 1R1YA 3UHDA 2QSPA 1BINA 2ZLTA 3MOUA 2XYKA 1Y4QA 3BCQB 3CIUB 3QJDA 1JDOA 1CQXA 1XZVB 1MGNA 1DLYA 1YGFB 3GYSB 4TWUA 1OJ6A 1S0HB 1THBA 4F0TB 3HHBA 4N6SA 3A5GA 1BUWB 2D60B 1A4FB 1YH9B 2MBWA 1MWDA 1FHJB 3KVSA 2UULD 3PI1A 3V58A 1N9XA 1ASHA 3V2VA 2HBDB 4M4AB 4ESAA 1CG5B 1YHUA 4A8QA 4U8UA 1BZRA 3ED9A 1Y8IA 4AE1A
chains in the Genus database with same CATH topology
5EETA 4G1BA 4F6JA 3DHTB 2GKMA 1A4FA 2H8DB 3QJEB 1Y4RA 1HBAB 5EE4C 1LFYB 1MYZA 3CY5A 3BOMB 1ECDA 4HHBA 3OO5B 2HZ1A 1SDLA 4N7PA 1BVCA 2OH8A 5E29B 1V07A 1DWTA 1GLIB 1ABWB 2G10A 2ZT3A 2MGDA 4YU3B 3UHQA 3HRWA 1RSEA 1BZZA 1F65A 1LJWB 1HBBB 1Y4RB 2OIFA 2G12A 1YGDB 2GTLC 4LPIA 2IG3A 1V4UA 2V1FA 3HF4A 1IT2A 3G4RA 2GTLB 1SPGA 3EU1A 1Y7DB 4MAXA 1ABYB 2V1IA 5MBAA 1S5YA 3GQPA 4DC8A 4M4BB 1HHOB 1MYIA 3ZJHA 1HLMA 2MYEA 1MNJA 2QMBB 4UZVA 1YEVA 3UGYA 2VYZA 1NZ2A 1BZ0A 3P5QA 1CH2A 1XQ5A 1DXVA 3QJBA 1DUKA 4XS0A 1AJ9B 2O5TX 2VYYA 2AV0A 3VRFA 3B75A 3BJ1B 1Y4FB 4MQGA 4G51B 1XZ5A 4MQJA 5CNBA 2G0RA 3A5AA 1J40B 1MBAA 1QSIA 1LFQA 5EV5A 4F6BA 2Z6TA 1YMCA 1URVA 1CG5A 2HHDB 1V75B 1BJEA 4F4OA 1YOHA 1A0ZA 4F68A 1OUUB 4NK2A 1GBUB 1UFPA 3NMLA 5B85A 4UURA 1X9FB 1YCAA 1VRFA 2W72B 2ZS0A 1XZ4A 4DWTA 2HBSB 3WCUD 1FLPA 3BOMA 1X9FD 1ABSA 3WCUB 3MJUA 1YGDA 5EOHA 1HDBA 3QZXA 4ODCB 3GQGA 3PELB 4FH7A 3WCWD 2MB5A 3GYSA 3QJCA 3ARLA 1COHA 1LFLA 1MYGA 1CO8A 1G08A 4ROMA 3HENA 1SDKB 3UH3A 2D60A 1S5YB 1J7SA 4IT8A 1GDKA 1O1NB 1YIEB 3QM7A 2ZS1B 1Y45B 2W6VB 3ODQB 1Y0TB 1YEQA 2GTLD 2O5BX 1SWMA 1Y5JB 2GL3A 3UHWA 1NS9B 2ZLXB 5D1VA 2HZ2A 5CHQA 3ORDA 3VRFB 3PI8A 1THBB 5CN4A 1VWTB 3UH7A 3NMMB 6HBIA 1FHJA 3WCTC 4O4TA 5EE4D 1SPEA 3UHKA 1YENA 4VHBA 3PT8B 2DHBB 3ECZA 2HHDA 1G08B 3GKVB 3WCPA 3MYNA 3IC0A 2O5SX 1Y46A 2RAOA 1WMUB 2HHEB 1YMAA 3QQQA 1YIEA 3FH9B 1QXEA 2ZT1A 3M39A 1GZXA 4NS2A 1XY0A 5CN5A 2OH9A 2QSSA 1JWNA 3HEOA 1LFLB 4PQCA 3WFUA 2MYBA 1UX8A 1CH7A 1O16A 2RI4B 1S5XB 3WCVA 1J3ZB 1KFRA 1Y83B 1R1XB 2HBEB 3BA2A 1XZ4B 4GZGA 2QFKA 5SW7A 4WJGA 4MQKB 3PIAB 1HBGA 2AUPA 1COHB 1DKEA 1MDNA 1NPFA 1DO4A 4MQGB 1O1LA 1HDAB 2EVPA 1RTXA 2BNLA 1Y7DA 3UHSA 2G0VA 1Y09B 1BZ6A 2V1EA 2R4XA 2R4ZA 1Y4BA 1VXBA 2DN1B 3IC0B 3S66A 1Y5JA 1RTEA 3BJ1A 5EUIB 2XKHA 3UHZA 2C0KA 3VREA 1RQ3A 4DWUA 1YHRA 1JEBB 3WCTA 2R80B 4HHBB 1JZKA 1MLSA 1CP0A 1CG8B 2PGHB 2ZSSA 1MLHA 111MA 4OODA 3ZOMA 1J7YB 1T1NA 3PT7A 2ZLWA 3OGBA 2WY4A 1LFTA 2H8FB 1Y0AB 3WCVC 1F5OA 3S48C 3WR1A 1IRCA 4FWYA 1S69A 2AUQA 3IXFA 1YH9A 1EMYA 1B86A 3IA3B 1FDHG 3PT8A 1ABWA 1O1JB 3ZH0A 4IROB 3HF4B 3ARJA 2Z6SA 1HACA 2RAOB 1Y4VB 4U8UB 2VRYA 4ROLA 1YEOB 3E5IA 1HGAB 1J7WB 1NEJA 2MGKA 1K1KB 2BK9A 3QM5A 106MA 1HCOA 1GDIA 1QXDA 3D1KB 1UT0A 2ZSPA 3GK9A 2Z85A 3A5BA 1O1JA 1VXEA 4UIQA 5D5RA 1LH3A 2G11A 1XZUB 3NFEB 5E29A 1X9FA 2DN1A 2FRKX 1V4XA 5CN8A 1Y2ZB 3WFXA 3HHBB 1RPSA 1J3YB 1A6NA 1GCWA 4ROMB 4L2MA 3GKTA 1JZMA 1QSHA 2GRFA 3UHEA 3E4NA 3UGZA 2IN4A 3O89A 1C7BB 2D2NB 1EWAA 3GQRB 2BMMA 3PI9B 2DXMA 4ROLB 3UHRA 5E6EA 3ZJQA 1ECOA 4F6IA 3R0GA 3SZKA 3HRWB 2MGAA 1CH5A 1FN3B 1KR7A 3ZJIA 1Y8WA 3UBCA 2MGJA 3LB1A 1Y5FA 2EKTA 2SPLA 110MA 1C40B 1R1YB 5KDQA 2R1HB 1IWHA 2V1GA 3AQ5A 4ODCA 5JGGB 1SHRB 4N7OB 1Y85B 2ZFOC 3VRGB 1A0ZB 1SI4B 2AA1A 1UC3A 3S65A 1YEUA 1Y01B 1QPWA 2BWHA 3M38A 1NQPA 4G1VA 1DO7A 1O1KB 4ZVAA 1XQ5B 1NIHB 1GCVB 3EU1B 3NFEA 2RI4A 4F6FA 5C6YA 1HDAA 1HBAA 1Y7GA 1UFJA 2Z6NA 4AVDA 1XY0B 5KKKA 1Y31B 2MYAA 3G4WA 3G52A 4H2LA 3A59B 3UHIA 4G51A 5KDQB 1FSXB 2G0SA 2G14A 108MA 1K0YA 2D2ND 2W6XA 2ZT0A 1CMYA 1V4WA 101MA 3MKBA 5CNDA 5CHRA 1A9WE 1YZIA 3ECLA 3H57A 2DXMB 2MGCA 2R80A 5E83B 3E5OA 5HLUA 1G09A 3E55A 2HBGA 5HBIA 3GDJA 3D7OB 1RQ3B 3QM8A 1J7YA 1Y46B 2WTHA 2LH7A 5EU2A 1FSXA 1BBBB 1NWIA 3LB4A 1YMBA 1Y0DB 1Y22B 3WCUC 2ZLWB 2M6ZA 1RPSB 1QXDB 1Y85A 2VEEA 3WFWA 3ZOLA 2O5MX 3MVCA 1ECAA 3U3EA 2HCOA 3FS4B 5CNEA 1Y7GB 1JP8A 2VHBA 3QM6A 4MQIA 1H97A 2LH1A 3D4XB 1S5XA 2DC3A 1YIHA 2ZSZA 107MA 2Z8AA 4FH6A 1MKOB 3PI4A 3ZJPA 4KJTA 1JL6A 1HBSA 1QSIB 2ZS1D 3DHRA 3WHMB 1CPWA 3EOKA 2EF2A 4DC7A 104MA 1OUTB 1OFKA 1CH4A 1JP9A 1LJWA 2ZFOB 2W72C 1Y7CA 1XZ7B 3OO4B 5JOMA 1FCSA 4B4YA 1S6AA 1MYTA 1GLIA 3BJ3B 2ZSTA 4YU4A 1JL7A 1CMYB 1HDSA 2SPMA 2ZSXA 1Y7ZB 1YCBA 1CG8A 7HBIA 1BABB 1X46A 2QSPB 3NL7B 3WTGB 4C0NA 3TLDA 3KUOA 1X3KA 1EBTA 5ILEA 3VAUA 1HJTA 5HU6A 2ZS0C 3PT7B 1GBUA 1V4WB 3AT5B 1CH3A 1CBLA 1DXTB 1NS6A 3OZUA 1H1XA 1PBXA 1MBCA 1MNOA 1J3YA 1VXGA 4L7YB 1RQ4A 1C7DB 1LA6A 4AVEA 2NRLA 1Y45A 2W6VA 2NRMA 1QI8A 2NSSA 1DXUA 3RJNB 1Y5FB 2ZSRA 1YFFA 3G4QA 1DO1A 3KMFC 1YIHB 2DN2A 2MGLA 3S66B 1U7SA 1Y4QB 3BCQA 2MHBB 3CIUA 2YRSB 1IDRA 1MTJA 3IC2B 1BZZB 2MGEA 1BIJA 1IBEB 2H35A 2XKGA 1N9IA 1DWRA 1XYEA 3OZWA 1JF3A 4JYQA 1Y7ZA 2V1JA 3D17A 1MOAA 1O1KA 1SDKA 5CNGA 3ZJMA 1GJNA 1MNKA 1QXEB 5HLQA 1NZ4A 3UH5A 3HXNB 3M3BA 3BJ2A 1K0YB 1UX9A 4U8UC 4H0BA 4BJAA 1Y0WB 3PI8B 4TYXA 2ZWJA 4N8TA 4NXCA 2HBDA 4M4AA 3ECXA 3DHRB 2HCOB 3K3UA 4MQHA 3D1AA 1A6MA 1MBDA 1MLUA 4O1TA 3V2ZA 1Y4PB 1MLRA 2ZFBA 3OO5A 5HLXA 1MLJA 4ESAB 3OVUC 1S0HA 4C44A 1LFYA 1VXAA 1NPGA 1CIOA 3A9MA 4H07A 1TU9A 1Z8UB 5JDOD 1OUUA 3G4YA 1ABYA 5AB8A 3O7NA 3CY5B 1NAZA 1Y0DA 1N9HA 1RVWB 1OBMA 3ZHWA 2ZFBB 1B0BA 2W6YA 1AJGA 1IRDB 1J3FA 1YE2A 1M6CA 2G3HA 2AUOA 3WCPB 4N7OA 4N7NB 3WI8A 1V4XB 1O1PB 1MLNA 2AURA 1UVXA 1LTWA 3OZVA 1EW6A 2B7HB 1FDHA 1A9WA 5EUIA 1G09B 4MXLA 1O1MB 1WLAA 3HEPA 4XDIA 1BZ1A 3WCVB 1JEBA 1JP6A 3ONZB 2WTGA 1IT3A 1GBVB 2YRSA 4MPMA 1MLFA 1ITHA 1Y22A 5E6EB 1XXTB 5KERA 3GLNA 3GKVA 1M9PA 4NXAA 3WHMA 1Y7CB 1M6MA 1S56A 1HBRA 3D7OA 3BJ2B 3ZJNA 1D8UA 3LQDA 1F63A 2ZLXA 2MHBA 1O1MA 2FAMA 2DN3A 1Y35B 1PBXB 1YE0A 3UHTA 2D2MC 4KN3A 3TM3A 3NL7A 1BZ0B 3RJ6A 1CBMA 3QZZA 1VREA 2ZLVB 4QAUA 2O5QX 4XS0B 5CN7A 5JGGA 1B86B 2LH2A 1Y8WB 3UH6A 1F5PA 1LFVB 1DM1A 1Y0CB 1YVTB 2CMMA 1DTIA 2D5XA 1HV4A 2HBFB 2GRZA 1FAWA 4FWZA 3W4UB 1FSLA 2G0XA 5SW7B 1CQ2A 1Y2ZA 2R4WA 5C6EA 1XXTA 1IRDA 1A3OB 2VLZA 4SDHA 2O5OX 2ZS1A 3RGKA 4JACA 1J41B 1CP5A 1LHTA 3KMFA 1CH9A 1LH5A 5EYSA 1XYEB 2GKNA 4HRTB 2DN3B 3LHBA 1Y83A 1WVPA 2NX0A 1C7BA 2JHOA 1A0UB 1Y31A 3UI0A 3S65B 1HCOB 103MA 1HRMA 1MOBA 4FWXA 3BJ3A 1VXHA 1VXDA 2AV3A 1HGCB 2PGHA 2FRIX 1LFZB 1BZPA 1YHUD 3EDBA 2VLXA 3DHTA 1GBVA 3ONZA 4F69A 1G0AB 2GRHA 1L2KA 1M9PB 2R50A 1YEQB 2GDMA 1GCWB 1DXDA 1A00B 3MN0A 3LR9A 3AQ8A 1YG5B 3ASEA 2MGGA 3K8BB 2FRJX 1XZ2B 3G53A 2E2YA 5ILMA 2QU0B 3GQRA 3D17B 2VEBA 4N8TB 4O4ZA 2HHEA 1NZ5A 2BKMA 4O2GA 2D5XB 1YDZB 3WR1B 1HABB 1RQAB 1QSHB 1MYFA 3HXNA 1U7RA 3QQRA 1NWNA 2LHBA 2HHBA 4MBNA 5CN9A 1V9QA 5KERB 3UHYA 3PI2A 1MBOA 2BW9M 5HY8B 1BABA 1YEVB 1DKEB 2LH3A 5EQMA 2MGFA 4HRTA 5C6EB 2QRWA 3EDAA 3GQGB 5ILRA 1DO3A 2QLSB 5MBNA 1OR4A 2D2NA 1G9VB 1J41A 2PEGA 5CNFA 2QMBA 3QJCB 1A6KA 1NZ3A 5CN6A 2D2MB 1KD2B 1N9FA 4NI0A 3LB3A 1Y4VA 2H35B 1MOCA 3H58A 1RQ4B 1G0BA 2ZSOA 2W72A 2ZS0B 3M3AA 2V1HA 2MYDA 1YEUB 1Y09A 1MBSA 3A0GA 1LFZA 1YHUB 1OR6A 3VREB 3P5QB 4HRRA 1DWSA 4WJG1 1MZ0A 3R5IA 1YENB 3LB2A 1Y4PA 4MQKA 1MODA 3PELA 1SHRA 1Q1FA 3UHHA 2D5ZB 4H2LB 2MGMA 1Y4FA 3HYUB 3LR7A 2KSCA 2ZSQA 5CNCA 3VRGA 1C7DA 2ZSNA 1RQAA 1C7CA 4YU4B 2HZ3A 109MA 1MWBA 2BLJM 4MQHB 1O1IB 1MLLA 4HSXA 3GOUA 1Y8KA 1YVTA 1MTIA 3UHUA 1Y8HA 5JDOE 3HYUA 1YOIA 2ZLTB 3MJPA 1LH6A 2DHBA 5M3SA 1YZIB 1FN3A 1HGBA 3WCTD 4MBAA 1O1IA 4N7NA 1A01B 1VXCA 2ZLVA 1MCYA 1WMUA 4F4OB 1Y0CA 102MA 3NG6A 2OHBA 1GZXB 1C40A 105MA 4PNJA 3LQDB 1G0AA 1TESA 1MYMA 2PEGB 1QPWB 3ZJLA 1YDZA 1GDJA 1HGCA 3B75B 2D2MA 1O1LB 1YEOA 1R1XA 2HBEA 2ZS0D 4X0LB 1HBHB 1JW8A 1YVQB 3AT6A 1XZVA 1DXCA 3PIAA 1A0UA 1BZ1B 1A3OA 3D1KA 1CH1A 3OO4A 2GNWA 1A00A 1V75A 2MGIA 3ZJRA 1XZ5B 1T1NB 1HV4B 1HSYA 3UHXA 1JY7B 3PI3A 1Y4GB 3AT5A 2EVKA 3DR9A 3G46A 3MBAA 5ILPA 3EOKB 2VM0A 1LFTB 2H8FA 1G9VA 1O1NA 1LUEA 1UVYA 2HBCA 4PQ6A 1V4UB 5E83A 1MYJA 5JDOC 1HBSB 1YFFB 2VYWA 3DUTB 1J3ZA 3NMMA 1Y8HB 2ZS1C 3OK5A 1YG5A 1UMOA 1LFVA 1HHOA 1HLBA 2ZT4A 4HSWA 1X9FC 3UHCA 1VXFA 1XZ2A 2H8DA 1CO9A 1XZ7A 1BIJB 3D1AB 2ZLUB 3WCWB 3R5IB 1VWTA 1J7WA 1NEJB 2W6WA 4KMVA 1UIWA 6HBWA 2SPNA 1DXTA 1NS6B 1OFJA 2HHBB 3ZJJA 2QU0A 1MLQA 1GDLA 1A01A 1MBIA 3KUNA 3ZJSA 1J40A 3QM9A 3AG0A 2O58X 2GNVA 2R1HA 1JPBA 1HBHA 2DN2B 2OLPA 1MTKA 4FC3A 4MQCB 1YGFA 3WCTB 1AZIA 1HGBB 1Y8KB 3OJ1A 3DUTA 1QI8B 1BUWA 1Y0AA 4WCHD 1HBRB 2D2NC 1YHUC 2ZFOD 4HRRB 4HBIA 1SI4A 1KD2A 1MBNA 2EB9A 2MGHA 2XKIA 1CLSA 2VLYA 3GQPB 1BVDA 1HBBA 2LH5A 4IROA 3K9ZA 1S61A 5JDOF 2ZFOA 1NGKA 1Y0TA 1HABA 1MLMA 3HC9A 1I3EA 3MKBB 2ZT2A 1DLWA 4B3WA 1V5HA 1LH2A 1EBCA 2G0ZA 1A6GA 3D4XA 1YOGA 2QLSA 4OF9A 3PI9A 1J52A 4ILZA 2BLHA 2W31A 1IBEA 2MYCA 1MKOA 1MNHA 3UBVA 1MNIA 2MGBA 1LFQB 1A3NB 3AT6B 1K1KA 2LH6A 1HGAA 4F6GA 2EKUA 5CMVA 2D6CA 5F2AA 2D5ZA 1MLGA 2HBSA 1Y5KA 2ZLUA 1HBIA 3WCWA 1MYHA 1JF4A 3GDJB 2M6ZB 3G4UA 5AZRA 3MYMA 1IWHB 1YVQA 1MLKA 2D2MD 1Y0WA 3MJPB 5HAVA 1HDSB 112MA 5EYJA 1Y4BB 3FS4A 2SPOA 3QJBB 3G4VA 1DXVB 1Y5KB 4MXKA 1XZUA 4NI1B 4MQIB 4O35A 2OHAA 3SZKB 2Z6NB 4ZVBA 2NSRA 3AQ9A 4M4BA 1AJ9A 1YHEA 3S1JA 3WCUA 1LH7A 3AQ6A 1RVWA 1LH1A 3S1IA 3UHGA 1NS9A 4MQJB 1NIHA 1HDBB 1URYA 3ZJOA 2EB8A 1JY7A 1CLSB 1OUTA 4TWVA 1I3DA 1JZLA 3QJDB 5IKSA 1LHSA 1MWCA 1O1PA 3A2GA 1IOPA 3GOUB 3UHVA 3WTGA 3WFTA 2B7HA 3W4UA 1DXUB 1O1OB 4L7YA 3K8BA 4MQCA 4F6DA 1Y4GA 2QFNA 1C7CB 2FALA 3WCWC 5HY8A 1DTMA 1LA6B 1YE0B 2GLNA 4MU5A 3A59A 3SDNA 1DUOA 3ARKA 1A3NA 3QMAA 1HACB 3IC2A 1YE2B 1MOHA 2HBFA 4PQBA 4N7PB 5F0BA 1SDLB 1PMBA 1J7SB 2O5LX 1AJHA 1CIKA 1VHBA 1BBBA 2AA1B 4FC3B 3TM9A 4YU3A 2ZSYA 1Y35A 1NQPB 5HU6B 1W92A 1ECNA 2FRFA 4NZIA 1YHRB 4KMWA 1G0BB 1Y8IB 4X0LA 2GTLA 1XCHA 5AZQA 4NK1A 3WCVD 3NG6B 1UIWB 3UHNA 3A0GB 3QJEA 1YHEB 3ODQA 2QSSB 4U8UD 3MJUB 3VHBA 1NXFA 2V1KA 3SDHA 1O1OA 2BLIA 2HBCB 1GVHA 4NI1A 5B84A 1GCVA 1MLOA 1SPGB 4NI0B 3FH9A 1FAWB 2R4YA 3UHBA 6HBWB 3AQ7A 1R1YA 3UHDA 2QSPA 1BINA 2ZLTA 3MOUA 2XYKA 1Y4QA 3BCQB 3CIUB 3QJDA 1JDOA 1CQXA 1XZVB 1MGNA 1DLYA 1YGFB 3GYSB 4TWUA 1OJ6A 1S0HB 1THBA 3HHBA 3A5GA 1BUWB 2D60B 1A4FB 1YH9B 2MBWA 1MWDA 1FHJB 3PI1A 1N9XA 1ASHA 3V2VA 2HBDB 4M4AB 4ESAA 1CG5B 1YHUA 4U8UA 1BZRA 3ED9A 1Y8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EET A;  4G1B A;  4F6J A;  3DHT B;  2GKM A;  1A4F A;  2H8D B;  3QJE B;  1Y4R A;  1HBA B;  5EE4 C;  1LFY B;  1MYZ A;  3CY5 A;  3BOM B;  1ECD A;  4HHB A;  3OO5 B;  2HZ1 A;  1SDL A;  4N7P A;  1BVC A;  2OH8 A;  5E29 B;  1V07 A;  1DWT A;  1GLI B;  1ABW B;  2G10 A;  2ZT3 A;  2MGD A;  4YU3 B;  3UHQ A;  3HRW A;  1RSE A;  1BZZ A;  1F65 A;  1LJW B;  1HBB B;  1Y4R B;  2OIF A;  2G12 A;  1YGD B;  2GTL C;  4LPI A;  2IG3 A;  1V4U A;  2V1F A;  3HF4 A;  1IT2 A;  3G4R A;  2GTL B;  1SPG A;  3EU1 A;  1Y7D B;  4MAX A;  1ABY B;  2V1I A;  5MBA A;  1S5Y A;  3GQP A;  4DC8 A;  4M4B B;  1HHO B;  1MYI A;  3ZJH A;  1HLM A;  2MYE A;  1MNJ A;  2QMB B;  4UZV A;  1YEV A;  3UGY A;  2VYZ A;  1NZ2 A;  1BZ0 A;  3P5Q A;  1CH2 A;  1XQ5 A;  1DXV A;  3QJB A;  1DUK A;  4XS0 A;  1AJ9 B;  2O5T X;  2VYY A;  2AV0 A;  3VRF A;  3B75 A;  3BJ1 B;  1Y4F B;  4MQG A;  4G51 B;  1XZ5 A;  4MQJ A;  5CNB A;  2G0R A;  3A5A A;  1J40 B;  1MBA A;  1QSI A;  1LFQ A;  5EV5 A;  4F6B A;  2Z6T A;  1YMC A;  1URV A;  1CG5 A;  2HHD B;  1V75 B;  1BJE A;  4F4O A;  1YOH A;  1A0Z A;  4F68 A;  1OUU B;  4NK2 A;  1GBU B;  1UFP A;  3NML A;  5B85 A;  4UUR A;  1X9F B;  1YCA A;  1VRF A;  2W72 B;  2ZS0 A;  1XZ4 A;  4DWT A;  2HBS B;  3WCU D;  1FLP A;  3BOM A;  1X9F D;  1ABS A;  3WCU B;  3MJU A;  1YGD A;  5EOH A;  1HDB A;  3QZX A;  4ODC B;  3GQG A;  3PEL B;  4FH7 A;  3WCW D;  2MB5 A;  3GYS A;  3QJC A;  3ARL A;  1COH A;  1LFL A;  1MYG A;  1CO8 A;  1G08 A;  4ROM A;  3HEN A;  1SDK B;  3UH3 A;  2D60 A;  1S5Y B;  1J7S A;  4IT8 A;  1GDK A;  1O1N B;  1YIE B;  3QM7 A;  2ZS1 B;  1Y45 B;  2W6V B;  3ODQ B;  1Y0T B;  1YEQ A;  2GTL D;  2O5B X;  1SWM A;  1Y5J B;  2GL3 A;  3UHW A;  1NS9 B;  2ZLX B;  5D1V A;  2HZ2 A;  5CHQ A;  3ORD A;  3VRF B;  3PI8 A;  1THB B;  5CN4 A;  1VWT B;  3UH7 A;  3NMM B;  6HBI A;  1FHJ A;  3WCT C;  4O4T A;  5EE4 D;  1SPE A;  3UHK A;  1YEN A;  4VHB A;  3PT8 B;  2DHB B;  3ECZ A;  2HHD A;  1G08 B;  3GKV B;  3WCP A;  3MYN A;  3IC0 A;  2O5S X;  1Y46 A;  2RAO A;  1WMU B;  2HHE B;  1YMA A;  3QQQ A;  1YIE A;  3FH9 B;  1QXE A;  2ZT1 A;  3M39 A;  1GZX A;  4NS2 A;  1XY0 A;  5CN5 A;  2OH9 A;  2QSS A;  1JWN A;  3HEO A;  1LFL B;  4PQC A;  3WFU A;  2MYB A;  1UX8 A;  1CH7 A;  1O16 A;  2RI4 B;  1S5X B;  3WCV A;  1J3Z B;  1KFR A;  1Y83 B;  1R1X B;  2HBE B;  3BA2 A;  1XZ4 B;  4GZG A;  2QFK A;  5SW7 A;  4WJG A;  4MQK B;  3PIA B;  1HBG A;  2AUP A;  1COH B;  1DKE A;  1MDN A;  1NPF A;  1DO4 A;  4MQG B;  1O1L A;  1HDA B;  2EVP A;  1RTX A;  2BNL A;  1Y7D A;  3UHS A;  2G0V A;  1Y09 B;  1BZ6 A;  2V1E A;  2R4X A;  2R4Z A;  1Y4B A;  1VXB A;  2DN1 B;  3IC0 B;  3S66 A;  1Y5J A;  1RTE A;  3BJ1 A;  5EUI B;  2XKH A;  3UHZ A;  2C0K A;  3VRE A;  1RQ3 A;  4DWU A;  1YHR A;  1JEB B;  3WCT A;  2R80 B;  4HHB B;  1JZK A;  1MLS A;  1CP0 A;  1CG8 B;  2PGH B;  2ZSS A;  1MLH A;  111M A;  4OOD A;  3ZOM A;  1J7Y B;  1T1N A;  3PT7 A;  2ZLW A;  3OGB A;  2WY4 A;  1LFT A;  2H8F B;  1Y0A B;  3WCV C;  1F5O A;  3S48 C;  3WR1 A;  1IRC A;  4FWY A;  1S69 A;  2AUQ A;  3IXF A;  1YH9 A;  1EMY A;  1B86 A;  3IA3 B;  1FDH G;  3PT8 A;  1ABW A;  1O1J B;  3ZH0 A;  4IRO B;  3HF4 B;  3ARJ A;  2Z6S A;  1HAC A;  2RAO B;  1Y4V B;  4U8U B;  2VRY A;  4ROL A;  1YEO B;  3E5I A;  1HGA B;  1J7W B;  1NEJ A;  2MGK A;  1K1K B;  2BK9 A;  3QM5 A;  106M A;  1HCO A;  1GDI A;  1QXD A;  3D1K B;  1UT0 A;  2ZSP A;  3GK9 A;  2Z85 A;  3A5B A;  1O1J A;  1VXE A;  4UIQ A;  5D5R A;  1LH3 A;  2G11 A;  1XZU B;  3NFE B;  5E29 A;  1X9F A;  2DN1 A;  2FRK X;  1V4X A;  5CN8 A;  1Y2Z B;  3WFX A;  3HHB B;  1RPS A;  1J3Y B;  1A6N A;  1GCW A;  4ROM B;  4L2M A;  3GKT A;  1JZM A;  1QSH A;  2GRF A;  3UHE A;  3E4N A;  3UGZ A;  2IN4 A;  3O89 A;  1C7B B;  2D2N B;  1EWA A;  3GQR B;  2BMM A;  3PI9 B;  2DXM A;  4ROL B;  3UHR A;  5E6E A;  3ZJQ A;  1ECO A;  4F6I A;  3R0G A;  3SZK A;  3HRW B;  2MGA A;  1CH5 A;  1FN3 B;  1KR7 A;  3ZJI A;  1Y8W A;  3UBC A;  2MGJ A;  3LB1 A;  1Y5F A;  2EKT A;  2SPL A;  110M A;  1C40 B;  1R1Y B;  5KDQ A;  2R1H B;  1IWH A;  2V1G A;  3AQ5 A;  4ODC A;  5JGG B;  1SHR B;  4N7O B;  1Y85 B;  2ZFO C;  3VRG B;  1A0Z B;  1SI4 B;  2AA1 A;  1UC3 A;  3S65 A;  1YEU A;  1Y01 B;  1QPW A;  2BWH A;  3M38 A;  1NQP A;  4G1V A;  1DO7 A;  1O1K B;  4ZVA A;  1XQ5 B;  1NIH B;  1GCV B;  3EU1 B;  3NFE A;  2RI4 A;  4F6F A;  5C6Y A;  1HDA A;  1HBA A;  1Y7G A;  1UFJ A;  2Z6N A;  4AVD A;  1XY0 B;  5KKK A;  1Y31 B;  2MYA A;  3G4W A;  3G52 A;  4H2L A;  3A59 B;  3UHI A;  4G51 A;  5KDQ B;  1FSX B;  2G0S A;  2G14 A;  108M A;  1K0Y A;  2D2N D;  2W6X A;  2ZT0 A;  1CMY A;  1V4W A;  101M A;  3MKB A;  5CND A;  5CHR A;  1A9W E;  1YZI A;  3ECL A;  3H57 A;  2DXM B;  2MGC A;  2R80 A;  5E83 B;  3E5O A;  5HLU A;  1G09 A;  3E55 A;  2HBG A;  5HBI A;  3GDJ A;  3D7O B;  1RQ3 B;  3QM8 A;  1J7Y A;  1Y46 B;  2WTH A;  2LH7 A;  5EU2 A;  1FSX A;  1BBB B;  1NWI A;  3LB4 A;  1YMB A;  1Y0D B;  1Y22 B;  3WCU C;  2ZLW B;  2M6Z A;  1RPS B;  1QXD B;  1Y85 A;  2VEE A;  3WFW A;  3ZOL A;  2O5M X;  3MVC A;  1ECA A;  3U3E A;  2HCO A;  3FS4 B;  5CNE A;  1Y7G B;  1JP8 A;  2VHB A;  3QM6 A;  4MQI A;  1H97 A;  2LH1 A;  3D4X B;  1S5X A;  2DC3 A;  1YIH A;  2ZSZ A;  107M A;  2Z8A A;  4FH6 A;  1MKO B;  3PI4 A;  3ZJP A;  4KJT A;  1JL6 A;  1HBS A;  1QSI B;  2ZS1 D;  3DHR A;  3WHM B;  1CPW A;  3EOK A;  2EF2 A;  4DC7 A;  104M A;  1OUT B;  1OFK A;  1CH4 A;  1JP9 A;  1LJW A;  2ZFO B;  2W72 C;  1Y7C A;  1XZ7 B;  3OO4 B;  5JOM A;  1FCS A;  4B4Y A;  1S6A A;  1MYT A;  1GLI A;  3BJ3 B;  2ZST A;  4YU4 A;  1JL7 A;  1CMY B;  1HDS A;  2SPM A;  2ZSX A;  1Y7Z B;  1YCB A;  1CG8 A;  7HBI A;  1BAB B;  1X46 A;  2QSP B;  3NL7 B;  3WTG B;  4C0N A;  3TLD A;  3KUO A;  1X3K A;  1EBT A;  5ILE A;  3VAU A;  1HJT A;  5HU6 A;  2ZS0 C;  3PT7 B;  1GBU A;  1V4W B;  3AT5 B;  1CH3 A;  1CBL A;  1DXT B;  1NS6 A;  3OZU A;  1H1X A;  1PBX A;  1MBC A;  1MNO A;  1J3Y A;  1VXG A;  4L7Y B;  1RQ4 A;  1C7D B;  1LA6 A;  4AVE A;  2NRL A;  1Y45 A;  2W6V A;  2NRM A;  1QI8 A;  2NSS A;  1DXU A;  3RJN B;  1Y5F B;  2ZSR A;  1YFF A;  3G4Q A;  1DO1 A;  3KMF C;  1YIH B;  2DN2 A;  2MGL A;  3S66 B;  1U7S A;  1Y4Q B;  3BCQ A;  2MHB B;  3CIU A;  2YRS B;  1IDR A;  1MTJ A;  3IC2 B;  1BZZ B;  2MGE A;  1BIJ A;  1IBE B;  2H35 A;  2XKG A;  1N9I A;  1DWR A;  1XYE A;  3OZW A;  1JF3 A;  4JYQ A;  1Y7Z A;  2V1J A;  3D17 A;  1MOA A;  1O1K A;  1SDK A;  5CNG A;  3ZJM A;  1GJN A;  1MNK A;  1QXE B;  5HLQ A;  1NZ4 A;  3UH5 A;  3HXN B;  3M3B A;  3BJ2 A;  1K0Y B;  1UX9 A;  4U8U C;  4H0B A;  4BJA A;  1Y0W B;  3PI8 B;  4TYX A;  2ZWJ A;  4N8T A;  4NXC A;  2HBD A;  4M4A A;  3ECX A;  3DHR B;  2HCO B;  3K3U A;  4MQH A;  3D1A A;  1A6M A;  1MBD A;  1MLU A;  4O1T A;  3V2Z A;  1Y4P B;  1MLR A;  2ZFB A;  3OO5 A;  5HLX A;  1MLJ A;  4ESA B;  3OVU C;  1S0H A;  4C44 A;  1LFY A;  1VXA A;  1NPG A;  1CIO A;  3A9M A;  4H07 A;  1TU9 A;  1Z8U B;  5JDO D;  1OUU A;  3G4Y A;  1ABY A;  5AB8 A;  3O7N A;  3CY5 B;  1NAZ A;  1Y0D A;  1N9H A;  1RVW B;  1OBM A;  3ZHW A;  2ZFB B;  1B0B A;  2W6Y A;  1AJG A;  1IRD B;  1J3F A;  1YE2 A;  1M6C A;  2G3H A;  2AUO A;  3WCP B;  4N7O A;  4N7N B;  3WI8 A;  1V4X B;  1O1P B;  1MLN A;  2AUR A;  1UVX A;  1LTW A;  3OZV A;  1EW6 A;  2B7H B;  1FDH A;  1A9W A;  5EUI A;  1G09 B;  4MXL A;  1O1M B;  1WLA A;  3HEP A;  4XDI A;  1BZ1 A;  3WCV B;  1JEB A;  1JP6 A;  3ONZ B;  2WTG A;  1IT3 A;  1GBV B;  2YRS A;  4MPM A;  1MLF A;  1ITH A;  1Y22 A;  5E6E B;  1XXT B;  5KER A;  3GLN A;  3GKV A;  1M9P A;  4NXA A;  3WHM A;  1Y7C B;  1M6M A;  1S56 A;  1HBR A;  3D7O A;  3BJ2 B;  3ZJN A;  1D8U A;  3LQD A;  1F63 A;  2ZLX A;  2MHB A;  1O1M A;  2FAM A;  2DN3 A;  1Y35 B;  1PBX B;  1YE0 A;  3UHT A;  2D2M C;  4KN3 A;  3TM3 A;  3NL7 A;  1BZ0 B;  3RJ6 A;  1CBM A;  3QZZ A;  1VRE A;  2ZLV B;  4QAU A;  2O5Q X;  4XS0 B;  5CN7 A;  5JGG A;  1B86 B;  2LH2 A;  1Y8W B;  3UH6 A;  1F5P A;  1LFV B;  1DM1 A;  1Y0C B;  1YVT B;  2CMM A;  1DTI A;  2D5X A;  1HV4 A;  2HBF B;  2GRZ A;  1FAW A;  4FWZ A;  3W4U B;  1FSL A;  2G0X A;  5SW7 B;  1CQ2 A;  1Y2Z A;  2R4W A;  5C6E A;  1XXT A;  1IRD A;  1A3O B;  2VLZ A;  4SDH A;  2O5O X;  2ZS1 A;  3RGK A;  4JAC A;  1J41 B;  1CP5 A;  1LHT A;  3KMF A;  1CH9 A;  1LH5 A;  5EYS A;  1XYE B;  2GKN A;  4HRT B;  2DN3 B;  3LHB A;  1Y83 A;  1WVP A;  2NX0 A;  1C7B A;  2JHO A;  1A0U B;  1Y31 A;  3UI0 A;  3S65 B;  1HCO B;  103M A;  1HRM A;  1MOB A;  4FWX A;  3BJ3 A;  1VXH A;  1VXD A;  2AV3 A;  1HGC B;  2PGH A;  2FRI X;  1LFZ B;  1BZP A;  1YHU D;  3EDB A;  2VLX A;  3DHT A;  1GBV A;  3ONZ A;  4F69 A;  1G0A B;  2GRH A;  1L2K A;  1M9P B;  2R50 A;  1YEQ B;  2GDM A;  1GCW B;  1DXD A;  1A00 B;  3MN0 A;  3LR9 A;  3AQ8 A;  1YG5 B;  3ASE A;  2MGG A;  3K8B B;  2FRJ X;  1XZ2 B;  3G53 A;  2E2Y A;  5ILM A;  2QU0 B;  3GQR A;  3D17 B;  2VEB A;  4N8T B;  4O4Z A;  2HHE A;  1NZ5 A;  2BKM A;  4O2G A;  2D5X B;  1YDZ B;  3WR1 B;  1HAB B;  1RQA B;  1QSH B;  1MYF A;  3HXN A;  1U7R A;  3QQR A;  1NWN A;  2LHB A;  2HHB A;  4MBN A;  5CN9 A;  1V9Q A;  5KER B;  3UHY A;  3PI2 A;  1MBO A;  2BW9 M;  5HY8 B;  1BAB A;  1YEV B;  1DKE B;  2LH3 A;  5EQM A;  2MGF A;  4HRT A;  5C6E B;  2QRW A;  3EDA A;  3GQG B;  5ILR A;  1DO3 A;  2QLS B;  5MBN A;  1OR4 A;  2D2N A;  1G9V B;  1J41 A;  2PEG A;  5CNF A;  2QMB A;  3QJC B;  1A6K A;  1NZ3 A;  5CN6 A;  2D2M B;  1KD2 B;  1N9F A;  4NI0 A;  3LB3 A;  1Y4V A;  2H35 B;  1MOC A;  3H58 A;  1RQ4 B;  1G0B A;  2ZSO A;  2W72 A;  2ZS0 B;  3M3A A;  2V1H A;  2MYD A;  1YEU B;  1Y09 A;  1MBS A;  3A0G A;  1LFZ A;  1YHU B;  1OR6 A;  3VRE B;  3P5Q B;  4HRR A;  1DWS A;  4WJG 1;  1MZ0 A;  3R5I A;  1YEN B;  3LB2 A;  1Y4P A;  4MQK A;  1MOD A;  3PEL A;  1SHR A;  1Q1F A;  3UHH A;  2D5Z B;  4H2L B;  2MGM A;  1Y4F A;  3HYU B;  3LR7 A;  2KSC A;  2ZSQ A;  5CNC A;  3VRG A;  1C7D A;  2ZSN A;  1RQA A;  1C7C A;  4YU4 B;  2HZ3 A;  109M A;  1MWB A;  2BLJ M;  4MQH B;  1O1I B;  1MLL A;  4HSX A;  3GOU A;  1Y8K A;  1YVT A;  1MTI A;  3UHU A;  1Y8H A;  5JDO E;  3HYU A;  1YOI A;  2ZLT B;  3MJP A;  1LH6 A;  2DHB A;  5M3S A;  1YZI B;  1FN3 A;  1HGB A;  3WCT D;  4MBA A;  1O1I A;  4N7N A;  1A01 B;  1VXC A;  2ZLV A;  1MCY A;  1WMU A;  4F4O B;  1Y0C A;  102M A;  3NG6 A;  2OHB A;  1GZX B;  1C40 A;  105M A;  4PNJ A;  3LQD B;  1G0A A;  1TES A;  1MYM A;  2PEG B;  1QPW B;  3ZJL A;  1YDZ A;  1GDJ A;  1HGC A;  3B75 B;  2D2M A;  1O1L B;  1YEO A;  1R1X A;  2HBE A;  2ZS0 D;  4X0L B;  1HBH B;  1JW8 A;  1YVQ B;  3AT6 A;  1XZV A;  1DXC A;  3PIA A;  1A0U A;  1BZ1 B;  1A3O A;  3D1K A;  1CH1 A;  3OO4 A;  2GNW A;  1A00 A;  1V75 A;  2MGI A;  3ZJR A;  1XZ5 B;  1T1N B;  1HV4 B;  1HSY A;  3UHX A;  1JY7 B;  3PI3 A;  1Y4G B;  3AT5 A;  2EVK A;  3DR9 A;  3G46 A;  3MBA A;  5ILP A;  3EOK B;  2VM0 A;  1LFT B;  2H8F A;  1G9V A;  1O1N A;  1LUE A;  1UVY A;  2HBC A;  4PQ6 A;  1V4U B;  5E83 A;  1MYJ A;  5JDO C;  1HBS B;  1YFF B;  2VYW A;  3DUT B;  1J3Z A;  3NMM A;  1Y8H B;  2ZS1 C;  3OK5 A;  1YG5 A;  1UMO A;  1LFV A;  1HHO A;  1HLB A;  2ZT4 A;  4HSW A;  1X9F C;  3UHC A;  1VXF A;  1XZ2 A;  2H8D A;  1CO9 A;  1XZ7 A;  1BIJ B;  3D1A B;  2ZLU B;  3WCW B;  3R5I B;  1VWT A;  1J7W A;  1NEJ B;  2W6W A;  4KMV A;  1UIW A;  6HBW A;  2SPN A;  1DXT A;  1NS6 B;  1OFJ A;  2HHB B;  3ZJJ A;  2QU0 A;  1MLQ A;  1GDL A;  1A01 A;  1MBI A;  3KUN A;  3ZJS A;  1J40 A;  3QM9 A;  3AG0 A;  2O58 X;  2GNV A;  2R1H A;  1JPB A;  1HBH A;  2DN2 B;  2OLP A;  1MTK A;  4FC3 A;  4MQC B;  1YGF A;  3WCT B;  1AZI A;  1HGB B;  1Y8K B;  3OJ1 A;  3DUT A;  1QI8 B;  1BUW A;  1Y0A A;  4WCH D;  1HBR B;  2D2N C;  1YHU C;  2ZFO D;  4HRR B;  4HBI A;  1SI4 A;  1KD2 A;  1MBN A;  2EB9 A;  2MGH A;  2XKI A;  1CLS A;  2VLY A;  3GQP B;  1BVD A;  1HBB A;  2LH5 A;  4IRO A;  3K9Z A;  1S61 A;  5JDO F;  2ZFO A;  1NGK A;  1Y0T A;  1HAB A;  1MLM A;  3HC9 A;  1I3E A;  3MKB B;  2ZT2 A;  1DLW A;  4B3W A;  1V5H A;  1LH2 A;  1EBC A;  2G0Z A;  1A6G A;  3D4X A;  1YOG A;  2QLS A;  4OF9 A;  3PI9 A;  1J52 A;  4ILZ A;  2BLH A;  2W31 A;  1IBE A;  2MYC A;  1MKO A;  1MNH A;  3UBV A;  1MNI A;  2MGB A;  1LFQ B;  1A3N B;  3AT6 B;  1K1K A;  2LH6 A;  1HGA A;  4F6G A;  2EKU A;  5CMV A;  2D6C A;  5F2A A;  2D5Z A;  1MLG A;  2HBS A;  1Y5K A;  2ZLU A;  1HBI A;  3WCW A;  1MYH A;  1JF4 A;  3GDJ B;  2M6Z B;  3G4U A;  5AZR A;  3MYM A;  1IWH B;  1YVQ A;  1MLK A;  2D2M D;  1Y0W A;  3MJP B;  5HAV A;  1HDS B;  112M A;  5EYJ A;  1Y4B B;  3FS4 A;  2SPO A;  3QJB B;  3G4V A;  1DXV B;  1Y5K B;  4MXK A;  1XZU A;  4NI1 B;  4MQI B;  4O35 A;  2OHA A;  3SZK B;  2Z6N B;  4ZVB A;  2NSR A;  3AQ9 A;  4M4B A;  1AJ9 A;  1YHE A;  3S1J A;  3WCU A;  1LH7 A;  3AQ6 A;  1RVW A;  1LH1 A;  3S1I A;  3UHG A;  1NS9 A;  4MQJ B;  1NIH A;  1HDB B;  1URY A;  3ZJO A;  2EB8 A;  1JY7 A;  1CLS B;  1OUT A;  4TWV A;  1I3D A;  1JZL A;  3QJD B;  5IKS A;  1LHS A;  1MWC A;  1O1P A;  3A2G A;  1IOP A;  3GOU B;  3UHV A;  3WTG A;  3WFT A;  2B7H A;  3W4U A;  1DXU B;  1O1O B;  4L7Y A;  3K8B A;  4MQC A;  4F6D A;  1Y4G A;  2QFN A;  1C7C B;  2FAL A;  3WCW C;  5HY8 A;  1DTM A;  1LA6 B;  1YE0 B;  2GLN A;  4MU5 A;  3A59 A;  3SDN A;  1DUO A;  3ARK A;  1A3N A;  3QMA A;  1HAC B;  3IC2 A;  1YE2 B;  1MOH A;  2HBF A;  4PQB A;  4N7P B;  5F0B A;  1SDL B;  1PMB A;  1J7S B;  2O5L X;  1AJH A;  1CIK A;  1VHB A;  1BBB A;  2AA1 B;  4FC3 B;  3TM9 A;  4YU3 A;  2ZSY A;  1Y35 A;  1NQP B;  5HU6 B;  1W92 A;  1ECN A;  2FRF A;  4NZI A;  1YHR B;  4KMW A;  1G0B B;  1Y8I B;  4X0L A;  2GTL A;  1XCH A;  5AZQ A;  4NK1 A;  3WCV D;  3NG6 B;  1UIW B;  3UHN A;  3A0G B;  3QJE A;  1YHE B;  3ODQ A;  2QSS B;  4U8U D;  3MJU B;  3VHB A;  1NXF A;  2V1K A;  3SDH A;  1O1O A;  2BLI A;  2HBC B;  1GVH A;  4NI1 A;  5B84 A;  1GCV A;  1MLO A;  1SPG B;  4NI0 B;  3FH9 A;  1FAW B;  2R4Y A;  3UHB A;  6HBW B;  3AQ7 A;  1R1Y A;  3UHD A;  2QSP A;  1BIN A;  2ZLT A;  3MOU A;  2XYK A;  1Y4Q A;  3BCQ B;  3CIU B;  3QJD A;  1JDO A;  1CQX A;  1XZV B;  1MGN A;  1DLY A;  1YGF B;  3GYS B;  4TWU A;  1OJ6 A;  1S0H B;  1THB A;  3HHB A;  3A5G A;  1BUW B;  2D60 B;  1A4F B;  1YH9 B;  2MBW A;  1MWD A;  1FHJ B;  3PI1 A;  1N9X A;  1ASH A;  3V2V A;  2HBD B;  4M4A B;  4ESA A;  1CG5 B;  1YHU A;  4U8U A;  1BZR A;  3ED9 A;  1Y8I A; 
#chains in the Genus database with same CATH topology
 4A8S A;  5EET A;  4G1B A;  3FEW X;  4F6J A;  3DHT B;  2GKM A;  1A4F A;  2H8D B;  3QJE B;  1Y4R A;  1HBA B;  5EE4 C;  1LFY B;  1MYZ A;  3CY5 A;  3BOM B;  1ECD A;  4HHB A;  1PHN A;  4PO5 A;  3OO5 B;  2HZ1 A;  1SDL A;  4N7P A;  1BVC A;  2OH8 A;  5E29 B;  1V07 A;  1DWT A;  1GLI B;  1ABW B;  2G10 A;  2ZT3 A;  2MGD A;  4YU3 B;  3UHQ A;  1B8D A;  3HRW A;  1RSE A;  1KN1 A;  1BZZ A;  1F65 A;  1LJW B;  1HBB B;  1Y4R B;  2OIF A;  2G12 A;  1YGD B;  1I7Y A;  2GTL C;  4LPI A;  2IG3 A;  1V4U A;  2V1F A;  3HF4 A;  1IT2 A;  3G4R A;  2GTL B;  1SPG A;  3EU1 A;  1Y7D B;  1UVM A;  4MAX A;  1ABY B;  2V1I A;  5MBA A;  1S5Y A;  2DKA A;  3GQP A;  4Z8K A;  4DC8 A;  4M4B B;  1HHO B;  1MYI A;  3ZJH A;  1HLM A;  2MYE A;  1MNJ A;  2QMB B;  1JBO A;  1B8D B;  4UZV A;  1YEV A;  3UGY A;  2VYZ A;  1NZ2 A;  1BZ0 A;  3P5Q A;  1CH2 A;  1XQ5 A;  1DXV A;  3QJB A;  1CPC A;  1SGK A;  1DUK A;  4XS0 A;  4Q70 A;  1AJ9 B;  2O5T X;  2VYY A;  2AV0 A;  3VRF A;  3B75 A;  3BJ1 B;  1Y4F B;  4MQG A;  4G51 B;  1XZ5 A;  4MQJ A;  5CNB A;  2G0R A;  3A5A A;  1J40 B;  1MBA A;  1QSI A;  1LFQ A;  5EV5 A;  4F6B A;  1GH0 B;  2Z6T A;  4XXI A;  1YMC A;  1URV A;  1CG5 A;  2BV8 A;  4LM6 B;  2HHD B;  1V75 B;  1BJE A;  4F4O A;  1YOH A;  1A0Z A;  4F68 A;  1OUU B;  3PMC A;  4NK2 A;  1GBU B;  1UFP A;  3NML A;  5B85 A;  4UUR A;  1X9F B;  2WCR A;  1YCA A;  1VRF A;  2W72 B;  2ZS0 A;  1XZ4 A;  4DWT A;  2HBS B;  3WCU D;  1FLP A;  3BOM A;  1X9F D;  1ABS A;  3WCU B;  3MJU A;  1YGD A;  5EOH A;  1HDB A;  3QZX A;  4ODC B;  3GQG A;  3PEL B;  4FH7 A;  3WCW D;  2MB5 A;  3GYS A;  3QJC A;  3ARL A;  1COH A;  1LFL A;  1MYG A;  1CO8 A;  1UVJ A;  1G08 A;  4ROM A;  3HEN A;  1SDK B;  3UH3 A;  2D60 A;  1S5Y B;  1J7S A;  4IT8 A;  1GDK A;  1O1N B;  1YIE B;  1JBO B;  3QM7 A;  2ZS1 B;  1Y45 B;  2W6V B;  3ODQ B;  2JLG A;  1Y0T B;  1YEQ A;  2GTL D;  2O5B X;  1SWM A;  1Y5J B;  2GL3 A;  3UHW A;  1NS9 B;  2ZLX B;  4ZIZ A;  3O18 B;  5D1V A;  2HZ2 A;  5CHQ A;  3ORD A;  4ESU A;  1WAC A;  3VRF B;  3PI8 A;  1ON7 A;  1THB B;  4F0T A;  5CN4 A;  2VJR A;  1VWT B;  3UH7 A;  3NMM B;  6HBI A;  1FHJ A;  3WCT C;  4O4T A;  5EE4 D;  1SPE A;  1NY9 A;  3UHK A;  1YEN A;  4VHB A;  3PT8 B;  2DHB B;  3ECZ A;  2HHD A;  1G08 B;  3GKV B;  3WCP A;  3MYN A;  3IC0 A;  2O5S X;  1Y46 A;  2RAO A;  1WMU B;  1LIA A;  2HHE B;  1YMA A;  3QQQ A;  1YIE A;  3FH9 B;  1QXE A;  2ZT1 A;  3M39 A;  1GZX A;  4NS2 A;  1XY0 A;  5CN5 A;  2OH9 A;  2QSS A;  1JWN A;  3HEO A;  1LFL B;  4LMS B;  4PQC A;  3WFU A;  2MYB A;  1UX8 A;  1CH7 A;  1O16 A;  2RI4 B;  1S5X B;  3WCV A;  1J3Z B;  1KFR A;  1Y83 B;  1R1X B;  2HBE B;  3BA2 A;  1XZ4 B;  4GZG A;  2QFK A;  5SW7 A;  4WJG A;  4MQK B;  3PIA B;  1HBG A;  2AUP A;  1COH B;  1DKE A;  1MDN A;  1NPF A;  1DO4 A;  4L1E A;  4MQG B;  1O1L A;  1HDA B;  2EVP A;  1B33 A;  1RTX A;  5B13 A;  2BNL A;  1Y7D A;  3UHS A;  2G0V A;  1Y09 B;  1BZ6 A;  2UUM B;  2V1E A;  2R4X A;  2R4Z A;  1Y4B A;  1VXB A;  2DN1 B;  3IC0 B;  3S66 A;  1Y5J A;  1RTE A;  3BJ1 A;  5EUI B;  2XKH A;  1TOX A;  2UUL C;  3UHZ A;  2C0K A;  3VRE A;  1RQ3 A;  4DWU A;  1YHR A;  4F0U B;  1JEB B;  2UUN B;  3LQ9 A;  2I88 A;  3WCT A;  2R80 B;  4HHB B;  1JZK A;  1MLS A;  1CP0 A;  1CG8 B;  2PGH B;  2ZSS A;  1MLH A;  111M A;  1LIA B;  4OOD A;  3ZOM A;  1J7Y B;  1T1N A;  3PT7 A;  2ZLW A;  3OGB A;  2DKD A;  2WY4 A;  1LFT A;  2H8F B;  1Y0A B;  1EYX A;  3WCV C;  1F5O A;  3S48 C;  3WR1 A;  1IRC A;  4FWY A;  1S69 A;  2AUQ A;  3IXF A;  1YH9 A;  1EMY A;  2DKC A;  1B86 A;  3IA3 B;  1FDH G;  3PT8 A;  1ABW A;  1O1J B;  3ZH0 A;  4IRO B;  3HF4 B;  3ARJ A;  2Z6S A;  1HAC A;  2RAO B;  1Y4V B;  4U8U B;  2VRY A;  4ROL A;  1YEO B;  3E5I A;  1HGA B;  1J7W B;  1NEJ A;  2MGK A;  1K1K B;  2BK9 A;  3QM5 A;  106M A;  1HCO A;  2C7J B;  1GDI A;  1QXD A;  3D1K B;  1UT0 A;  2ZSP A;  3GK9 A;  2Z85 A;  3A5B A;  1O1J A;  1VXE A;  4UIQ A;  5D5R A;  1LH3 A;  2G11 A;  1XZU B;  3NFE B;  4HH1 A;  5E29 A;  1X9F A;  1HHT P;  2DN1 A;  2FRK X;  1V4X A;  5CN8 A;  1Y2Z B;  3WFX A;  4GXE B;  3HHB B;  1RPS A;  4N6S B;  1J3Y B;  2V8A A;  1A6N A;  1GCW A;  4ROM B;  4L2M A;  3GKT A;  1JZM A;  1QSH A;  2GRF A;  3UHE A;  3E4N A;  3UGZ A;  2IN4 A;  3O89 A;  1C7B B;  2D2N B;  1EWA A;  3GQR B;  2BMM A;  3PI9 B;  4ETU A;  2DXM A;  4ROL B;  3UHR A;  5E6E A;  3ZJQ A;  1ECO A;  4F6I A;  3R0G A;  3SZK A;  3HRW B;  2MGA A;  1CH5 A;  1FN3 B;  1KR7 A;  3ZJI A;  1Y8W A;  3UBC A;  2MGJ A;  3LB1 A;  1Y5F A;  3O2C A;  2EKT A;  2SPL A;  110M A;  4BS9 A;  1C40 B;  1R1Y B;  5KDQ A;  2R1H B;  1IWH A;  2V1G A;  3AQ5 A;  4ODC A;  5AQD A;  5JGG B;  1SHR B;  4N7O B;  1Y85 B;  2ZFO C;  3VRG B;  1A0Z B;  1SI4 B;  2AA1 A;  1UC3 A;  3S65 A;  1A87 A;  1YEU A;  1Y01 B;  1QPW A;  2BWH A;  3M38 A;  1NQP A;  4G1V A;  1DO7 A;  1O1K B;  3DBJ A;  4ZVA A;  1XQ5 B;  1NIH B;  1GCV B;  3EU1 B;  3NFE A;  2RI4 A;  4ETV A;  4F6F A;  5C6Y A;  1HDA A;  1HBA A;  1Y7G A;  4A8M P;  1UFJ A;  2Z6N A;  4AVD A;  1XY0 B;  5KKK A;  1Y31 B;  2MYA A;  3G4W A;  3G52 A;  4H2L A;  3A59 B;  3UHI A;  4G51 A;  4ERV A;  5KDQ B;  1FSX B;  2G0S A;  2G14 A;  108M A;  1K0Y A;  2D2N D;  2W6X A;  2ZT0 A;  1CMY A;  1V4W A;  101M A;  3MKB A;  5CND A;  5CHR A;  1A9W E;  1YZI A;  3ECL A;  3H57 A;  2DXM B;  2MGC A;  2R80 A;  5E83 B;  2UUL A;  3E5O A;  5HLU A;  1G09 A;  3E55 A;  2HBG A;  5HBI A;  3GDJ A;  3D7O B;  1RQ3 B;  3QM8 A;  1J7Y A;  1Y46 B;  2WTH A;  2LH7 A;  5EU2 A;  1FSX A;  2JL9 A;  1BBB B;  4YJJ B;  5FVB M;  1NWI A;  3LB4 A;  1YMB A;  2VJT A;  1Y0D B;  1Y22 B;  3WCU C;  2ZLW B;  2M6Z A;  1RPS B;  1QXD B;  1Y85 A;  2VEE A;  3WFW A;  3ZOL A;  2O5M X;  3L0F A;  3MVC A;  1ECA A;  3U3E A;  2HCO A;  3FS4 B;  5CNE A;  1CPC B;  1Y7G B;  1JP8 A;  2VHB A;  3QM6 A;  4MQI A;  1H97 A;  2LH1 A;  3D4X B;  1S5X A;  2DC3 A;  1YIH A;  2ZSZ A;  107M A;  2Z8A A;  4FH6 A;  1MKO B;  3PI4 A;  3ZJP A;  4KJT A;  1JL6 A;  1HBS A;  1QSI B;  2ZS1 D;  3DHR A;  3WHM B;  1CPW A;  3GIO A;  3EOK A;  2EF2 A;  4DC7 A;  2X49 A;  104M A;  1OUT B;  1OFK A;  1CH4 A;  1JP9 A;  1LJW A;  1KN1 B;  2ZFO B;  2W72 C;  1Y7C A;  1XZ7 B;  3OO4 B;  5JOM A;  1FCS A;  4B4Y A;  1S6A A;  1MYT A;  1GLI A;  3BJ3 B;  2ZST A;  4YU4 A;  1JL7 A;  1CMY B;  1HDS A;  2SPM A;  2ZSX A;  1Y7Z B;  1YCB A;  1CG8 A;  7HBI A;  1BAB B;  1X46 A;  2QSP B;  3NL7 B;  3WTG B;  4C0N A;  1ON7 B;  3TLD A;  3KUO A;  1X3K A;  1EBT A;  5ILE A;  3VAU A;  1HJT A;  5HU6 A;  2ZS0 C;  3PT7 B;  1GBU A;  1V4W B;  1HI1 A;  3AT5 B;  1CH3 A;  1CBL A;  1DXT B;  1NS6 A;  3OZU A;  1EYX B;  1H1X A;  1PBX A;  1MBC A;  1MNO A;  1J3Y A;  2V8A B;  1VXG A;  4L7Y B;  1RQ4 A;  1C7D B;  1LA6 A;  3BRP A;  4AVE A;  2NRL A;  1Y45 A;  2W6V A;  2NRM A;  1QI8 A;  2NSS A;  1DXU A;  3RJN B;  1Y5F B;  3O2C B;  2ZSR A;  1KTP A;  1YFF A;  3G4Q A;  1DO1 A;  3KMF C;  1YIH B;  2DN2 A;  1HI0 P;  4GY3 B;  2MGL A;  3S66 B;  4A8F A;  1U7S A;  1Y4Q B;  3BCQ A;  2MHB B;  3CIU A;  2YRS B;  1IDR A;  4Q70 B;  1MTJ A;  3IC2 B;  1BZZ B;  2MGE A;  4XXK A;  1BIJ A;  1IBE B;  3GUQ A;  2H35 A;  2XKG A;  1N9I A;  1DWR A;  1XYE A;  1KTP B;  3OZW A;  1JF3 A;  4JYQ A;  1Y7Z A;  2V1J A;  3D17 A;  2UUL B;  1MOA A;  1O1K A;  3DBJ B;  1SDK A;  5CNG A;  3ZJM A;  1GJN A;  1MNK A;  4BJU A;  1QXE B;  5HLQ A;  1NZ4 A;  3UH5 A;  3HXN B;  3M3B A;  3BJ2 A;  1K0Y B;  2C7K B;  1UX9 A;  4U8U C;  1F99 A;  4H0B A;  4BJA A;  1Y0W B;  3PI8 B;  4TYX A;  2ZWJ A;  4N8T A;  4NXC A;  2HBD A;  4M4A A;  3ECX A;  3DHR B;  2HCO B;  3K3U A;  4MQH A;  3D1A A;  3V58 B;  1A6M A;  3O18 A;  1MBD A;  1MLU A;  2UUN A;  4O1T A;  3V2Z A;  1Y4P B;  1MLR A;  2ZFB A;  3OO5 A;  5HLX A;  1MLJ A;  4ESA B;  3NUH B;  3OVU C;  1S0H A;  4C44 A;  1UVI A;  1LFY A;  1VXA A;  1NPG A;  1CIO A;  1DDT A;  4LMX B;  3A9M A;  4H07 A;  3KVS B;  1TU9 A;  1Z8U B;  5JDO D;  1OUU A;  2UUN D;  3G4Y A;  1ABY A;  5AB8 A;  3O7N A;  3CY5 B;  1NAZ A;  1Y0D A;  1N9H A;  1RVW B;  1OBM A;  3ZHW A;  2ZFB B;  1B0B A;  2W6Y A;  1AJG A;  1IRD B;  1J3F A;  1YE2 A;  1M6C A;  2G3H A;  3L0F B;  2AUO A;  3WCP B;  4N7O A;  4N7N B;  3WI8 A;  1V4X B;  3V57 A;  1O1P B;  1MLN A;  2AUR A;  1UVX A;  1LTW A;  1HA7 A;  3OZV A;  1EW6 A;  2B7H B;  1FDH A;  1A9W A;  5EUI A;  1G09 B;  4MXL A;  1O1M B;  1WLA A;  3HEP A;  4XDI A;  1BZ1 A;  3WCV B;  1JEB A;  1HHS A;  1JP6 A;  2UUM A;  3ONZ B;  2WTG A;  1IT3 A;  1GBV B;  2YRS A;  4ETT A;  4MPM A;  1MLF A;  1ITH A;  1Y22 A;  5E6E B;  3V57 B;  1XXT B;  5KER A;  3GLN A;  3GKV A;  1M9P A;  4NXA A;  3WHM A;  1Y7C B;  1M6M A;  4A8K A;  1S56 A;  1HBR A;  3D7O A;  2VJH A;  3BJ2 B;  3ZJN A;  1D8U A;  3LQD A;  1F63 A;  2ZLX A;  2MHB A;  1O1M A;  2FAM A;  2DN3 A;  1Y35 B;  1PBX B;  1YE0 A;  3UHT A;  2D2M C;  4KN3 A;  3TM3 A;  3NL7 A;  1BZ0 B;  3RJ6 A;  1CBM A;  3QZZ A;  1VRE A;  2ZLV B;  4QAU A;  2O5Q X;  4XS0 B;  5CN7 A;  5JGG A;  1B86 B;  2LH2 A;  1Y8W B;  3UH6 A;  1F5P A;  1LFV B;  1DM1 A;  1Y0C B;  1YVT B;  2CMM A;  1DTI A;  2D5X A;  1HV4 A;  2HBF B;  2GRZ A;  1FAW A;  4FWZ A;  3W4U B;  1FSL A;  2G0X A;  5SW7 B;  1CQ2 A;  1Y2Z A;  2R4W A;  5C6E A;  1XXT A;  1IRD A;  1A3O B;  2VLZ A;  4SDH A;  2O5O X;  2ZS1 A;  3RGK A;  4JAC A;  1J41 B;  1CP5 A;  1LHT A;  3KMF A;  1CH9 A;  1LH5 A;  5EYS A;  1XYE B;  2GKN A;  4HRT B;  2DN3 B;  3LHB A;  1Y83 A;  1WVP A;  2NX0 A;  1C7B A;  2JHO A;  1A0U B;  1Y31 A;  3UI0 A;  3S65 B;  1HCO B;  103M A;  1HRM A;  1MOB A;  4FWX A;  3BJ3 A;  1VXH A;  1VXD A;  2AV3 A;  1HGC B;  2PGH A;  2FRI X;  1LFZ B;  2YSK A;  1BZP A;  1YHU D;  3EDB A;  2VLX A;  3DHT A;  1GBV A;  3ONZ A;  4F69 A;  1G0A B;  2GRH A;  1L2K A;  1M9P B;  2R50 A;  1YEQ B;  2GDM A;  1GCW B;  1DXD A;  1A00 B;  3MN0 A;  3LR9 A;  3AQ8 A;  1YG5 B;  3ASE A;  2MGG A;  3K8B B;  1COL A;  2FRJ X;  1XZ2 B;  4AE0 A;  3G53 A;  2E2Y A;  5ILM A;  2QU0 B;  3GQR A;  3D17 B;  2VEB A;  4N8T B;  4O4Z A;  2HHE A;  1NZ5 A;  2BKM A;  4O2G A;  2D5X B;  1YDZ B;  3WR1 B;  1HAB B;  1RQA B;  1QSH B;  1MYF A;  3HXN A;  1U7R A;  1QGW C;  3QQR A;  1NWN A;  2LHB A;  2HHB A;  4MBN A;  5CN9 A;  1V9Q A;  5KER B;  3UHY A;  3PI2 A;  1MBO A;  2BW9 M;  5HY8 B;  1BAB A;  1YEV B;  1DKE B;  2LH3 A;  5EQM A;  2MGF A;  4HRT A;  5C6E B;  2QRW A;  3EDA A;  3GQG B;  5ILR A;  1DO3 A;  2QLS B;  5MBN A;  1OR4 A;  2D2N A;  1G9V B;  1J41 A;  2PEG A;  5CNF A;  1HA7 B;  2QMB A;  3QJC B;  1I7Y B;  1A6K A;  1PHN B;  1NZ3 A;  4ERT A;  5CN6 A;  2D2M B;  1KD2 B;  1N9F A;  4NI0 A;  3LB3 A;  1Y4V A;  2H35 B;  1MOC A;  3H58 A;  1RQ4 B;  1G0B A;  2ZSO A;  2W72 A;  2ZS0 B;  3M3A A;  2V1H A;  2MYD A;  1YEU B;  1Y09 A;  1MBS A;  4A8W A;  3A0G A;  1LFZ A;  1YHU B;  1OR6 A;  3VRE B;  3ZTA A;  3P5Q B;  4HRR A;  1DWS A;  4WJG 1;  1MZ0 A;  1F99 B;  3R5I A;  2C7L A;  1YEN B;  3LB2 A;  1Y4P A;  4MQK A;  1MOD A;  3PEL A;  1SHR A;  1Q1F A;  4H0M B;  3UHH A;  2D5Z B;  4H2L B;  2MGM A;  1RH1 A;  1Y4F A;  3HYU B;  3LR7 A;  4A8O A;  2KSC A;  2ZSQ A;  5CNC A;  3VRG A;  1C7D A;  2ZSN A;  1RQA A;  1C7C A;  1UVN A;  4YU4 B;  2HZ3 A;  1UVL A;  109M A;  1MWB A;  2BLJ M;  4MQH B;  2VJH B;  1O1I B;  1MLL A;  4HSX A;  3GOU A;  1Y8K A;  1YVT A;  1MTI A;  3UHU A;  1Y8H A;  5JDO E;  3HYU A;  1YOI A;  2ZLT B;  3RQR A;  3MJP A;  1LH6 A;  2DHB A;  5M3S A;  1ALL A;  1YZI B;  1FN3 A;  1HGB A;  3WCT D;  1XF6 C;  4MBA A;  1O1I A;  4N7N A;  1A01 B;  1VXC A;  2ZLV A;  2VML A;  1MCY A;  1WMU A;  4PO5 B;  4F4O B;  1Y0C A;  102M A;  3NG6 A;  2OHB A;  2UUL H;  1GZX B;  5B13 G;  1C40 A;  105M A;  4PNJ A;  4H0M A;  3LQD B;  1G0A A;  1TES A;  1MYM A;  2PEG B;  1QPW B;  3ZJL A;  1YDZ A;  1GDJ A;  1HGC A;  3B75 B;  2D2M A;  1O1L B;  1YEO A;  1R1X A;  2HBE A;  2ZS0 D;  4X0L B;  1HBH B;  1JW8 A;  1YVQ B;  3AT6 A;  2UUM X;  1XZV A;  1DXC A;  3PIA A;  1A0U A;  1BZ1 B;  1A3O A;  3D1K A;  1CH1 A;  3OO4 A;  2GNW A;  1A00 A;  1V75 A;  2X4A A;  2MGI A;  3MWN A;  3VNC A;  3ZJR A;  1XZ5 B;  1T1N B;  1HV4 B;  1HSY A;  3UHX A;  1JY7 B;  3PI3 A;  1Y4G B;  3AT5 A;  1GH0 A;  2EVK A;  3DR9 A;  3G46 A;  3MBA A;  5ILP A;  3EOK B;  2VM0 A;  1LFT B;  2H8F A;  1G9V A;  1O1N A;  4RMP A;  1LUE A;  1UVY A;  2HBC A;  4PQ6 A;  1V4U B;  5E83 A;  1MYJ A;  5JDO C;  1HBS B;  1YFF B;  2VYW A;  3DUT B;  1J3Z A;  3NMM A;  1Y8H B;  2C7L B;  2ZS1 C;  2C7K A;  3OK5 A;  1YG5 A;  1UMO A;  1LFV A;  1HHO A;  1HLB A;  2ZT4 A;  4HSW A;  5AQD M;  1X9F C;  3UHC A;  1VXF A;  1HI8 A;  1XZ2 A;  2H8D A;  1CO9 A;  1XZ7 A;  1BIJ B;  3D1A B;  2ZLU B;  3WCW B;  3R5I B;  1VWT A;  1J7W A;  1NEJ B;  2W6W A;  4KMV A;  1UIW A;  6HBW A;  2SPN A;  1DXT A;  1NS6 B;  1OFJ A;  2HHB B;  3ZJJ A;  2QU0 A;  1MLQ A;  2VML B;  1GDL A;  1A01 A;  1MBI A;  3KUN A;  3ZJS A;  1J40 A;  3QM9 A;  3AG0 A;  2O58 X;  2GNV A;  2R1H A;  1JPB A;  1HBH A;  2DN2 B;  2OLP A;  1MTK A;  4FC3 A;  2BV8 B;  4MQC B;  1YGF A;  3WCT B;  1UVK A;  1AZI A;  1HGB B;  1Y8K B;  3OJ1 A;  3DUT A;  1QI8 B;  1BUW A;  1Y0A A;  4WCH D;  1HBR B;  2D2N C;  1YHU C;  2ZFO D;  4HRR B;  4HBI A;  1CII A;  1SI4 A;  1KD2 A;  1MBN A;  2EB9 A;  2MGH A;  2XKI A;  1CLS A;  2VLY A;  3GQP B;  4Z8K B;  1BVD A;  1HBB A;  2LH5 A;  4RMP B;  4IRO A;  3K9Z A;  1S61 A;  5JDO F;  2ZFO A;  1NGK A;  1Y0T A;  1HAB A;  1MLM A;  3HC9 A;  1I3E A;  3MKB B;  2ZT2 A;  5FVB A;  1DLW A;  4B3W A;  1V5H A;  1LH2 A;  1EBC A;  2G0Z A;  1A6G A;  3D4X A;  1YOG A;  2QLS A;  4OF9 A;  3PI9 A;  1J52 A;  4ILZ A;  2BLH A;  2W31 A;  1IBE A;  2MYC A;  1MKO A;  1MNH A;  3UBV A;  1MDT A;  4HH0 A;  1MNI A;  2MGB A;  1LFQ B;  1A3N B;  3AT6 B;  4B02 A;  1K1K A;  2LH6 A;  1HGA A;  4F6G A;  2EKU A;  5CMV A;  2D6C A;  5F2A A;  2D5Z A;  1MLG A;  2HBS A;  1Y5K A;  2ZLU A;  1HBI A;  3WCW A;  3PMD A;  1MYH A;  1JF4 A;  3GDJ B;  4ZIZ B;  2M6Z B;  3G4U A;  5AZR A;  3MYM A;  1B33 B;  1IWH B;  1YVQ A;  1MLK A;  2D2M D;  1Y0W A;  3MJP B;  5HAV A;  1HDS B;  112M A;  5EYJ A;  1Y4B B;  3FS4 A;  1XG0 C;  2SPO A;  3QJB B;  3G4V A;  1DXV B;  1Y5K B;  4MXK A;  1XZU A;  4NI1 B;  4MQI B;  4O35 A;  2OHA A;  2VJT B;  3SZK B;  2Z6N B;  4ZVB A;  2NSR A;  3AQ9 A;  4M4B A;  1AJ9 A;  2WCQ A;  1XDT T;  1YHE A;  3S1J A;  3WCU A;  2C7J A;  1LH7 A;  3AQ6 A;  1RVW A;  1LH1 A;  3S1I A;  3UHG A;  4A8Y A;  1NS9 A;  4MQJ B;  1NIH A;  1HDB B;  1URY A;  3ZJO A;  2EB8 A;  1JY7 A;  1CLS B;  4F0U A;  1OUT A;  4TWV A;  1I3D A;  1JZL A;  3QJD B;  5IKS A;  1LHS A;  1MWC A;  2VJR B;  1O1P A;  3A2G A;  1IOP A;  4GXE A;  3GOU B;  3UHV A;  3WTG A;  3WFT A;  2B7H A;  3W4U A;  1DXU B;  4TMA B;  1O1O B;  4L7Y A;  3K8B A;  4MQC A;  4F6D A;  1Y4G A;  2QFN A;  1C7C B;  2FAL A;  3WCW C;  5HY8 A;  1DTM A;  1F0L A;  1LA6 B;  1YE0 B;  2GLN A;  4MU5 A;  4L1E B;  3A59 A;  3SDN A;  1DUO A;  3ARK A;  1A3N A;  2JLF A;  3QMA A;  1HAC B;  3IC2 A;  1YE2 B;  1MOH A;  2HBF A;  2J96 A;  4PQB A;  4N7P B;  5F0B A;  1SDL B;  1ALL B;  1PMB A;  1J7S B;  2O5L X;  1AJH A;  1CIK A;  1VHB A;  1BBB A;  2AA1 B;  4YJJ A;  4FC3 B;  3TM9 A;  4YU3 A;  2ZSY A;  1Y35 A;  1NQP B;  5HU6 B;  1W92 A;  1ECN A;  2FRF A;  4NZI A;  1YHR B;  4KMW A;  1G0B B;  1Y8I B;  4X0L A;  2GTL A;  3BRP B;  1XCH A;  5AZQ A;  4NK1 A;  3WCV D;  3NG6 B;  1UIW B;  3UHN A;  3A0G B;  3QJE A;  1YHE B;  3ODQ A;  2QSS B;  4U8U D;  3MJU B;  3VHB A;  4GY3 A;  1NXF A;  2V1K A;  3SDH A;  1O1O A;  2BLI A;  2HBC B;  1GVH A;  4NI1 A;  5B84 A;  1GCV A;  1MLO A;  1SPG B;  4NI0 B;  3FH9 A;  1FAW B;  2R4Y A;  3UHB A;  6HBW B;  3AQ7 A;  1R1Y A;  3UHD A;  2QSP A;  1BIN A;  2ZLT A;  3MOU A;  2XYK A;  1Y4Q A;  3BCQ B;  3CIU B;  3QJD A;  1JDO A;  1CQX A;  1XZV B;  1MGN A;  1DLY A;  1YGF B;  3GYS B;  4TWU A;  1OJ6 A;  1S0H B;  1THB A;  4F0T B;  3HHB A;  4N6S A;  3A5G A;  1BUW B;  2D60 B;  1A4F B;  1YH9 B;  2MBW A;  1MWD A;  1FHJ B;  3KVS A;  2UUL D;  3PI1 A;  3V58 A;  1N9X A;  1ASH A;  3V2V A;  2HBD B;  4M4A B;  4ESA A;  1CG5 B;  1YHU A;  4A8Q A;  4U8U A;  1BZR A;  3ED9 A;  1Y8I A;  4AE1 A; 
#chains in the Genus database with same CATH homology
 5EET A;  4G1B A;  4F6J A;  3DHT B;  2GKM A;  1A4F A;  2H8D B;  3QJE B;  1Y4R A;  1HBA B;  5EE4 C;  1LFY B;  1MYZ A;  3CY5 A;  3BOM B;  1ECD A;  4HHB A;  3OO5 B;  2HZ1 A;  1SDL A;  4N7P A;  1BVC A;  2OH8 A;  5E29 B;  1V07 A;  1DWT A;  1GLI B;  1ABW B;  2G10 A;  2ZT3 A;  2MGD A;  4YU3 B;  3UHQ A;  3HRW A;  1RSE A;  1BZZ A;  1F65 A;  1LJW B;  1HBB B;  1Y4R B;  2OIF A;  2G12 A;  1YGD B;  2GTL C;  4LPI A;  2IG3 A;  1V4U A;  2V1F A;  3HF4 A;  1IT2 A;  3G4R A;  2GTL B;  1SPG A;  3EU1 A;  1Y7D B;  4MAX A;  1ABY B;  2V1I A;  5MBA A;  1S5Y A;  3GQP A;  4DC8 A;  4M4B B;  1HHO B;  1MYI A;  3ZJH A;  1HLM A;  2MYE A;  1MNJ A;  2QMB B;  4UZV A;  1YEV A;  3UGY A;  2VYZ A;  1NZ2 A;  1BZ0 A;  3P5Q A;  1CH2 A;  1XQ5 A;  1DXV A;  3QJB A;  1DUK A;  4XS0 A;  1AJ9 B;  2O5T X;  2VYY A;  2AV0 A;  3VRF A;  3B75 A;  3BJ1 B;  1Y4F B;  4MQG A;  4G51 B;  1XZ5 A;  4MQJ A;  5CNB A;  2G0R A;  3A5A A;  1J40 B;  1MBA A;  1QSI A;  1LFQ A;  5EV5 A;  4F6B A;  2Z6T A;  1YMC A;  1URV A;  1CG5 A;  2HHD B;  1V75 B;  1BJE A;  4F4O A;  1YOH A;  1A0Z A;  4F68 A;  1OUU B;  4NK2 A;  1GBU B;  1UFP A;  3NML A;  5B85 A;  4UUR A;  1X9F B;  1YCA A;  1VRF A;  2W72 B;  2ZS0 A;  1XZ4 A;  4DWT A;  2HBS B;  3WCU D;  1FLP A;  3BOM A;  1X9F D;  1ABS A;  3WCU B;  3MJU A;  1YGD A;  5EOH A;  1HDB A;  3QZX A;  4ODC B;  3GQG A;  3PEL B;  4FH7 A;  3WCW D;  2MB5 A;  3GYS A;  3QJC A;  3ARL A;  1COH A;  1LFL A;  1MYG A;  1CO8 A;  1G08 A;  4ROM A;  3HEN A;  1SDK B;  3UH3 A;  2D60 A;  1S5Y B;  1J7S A;  4IT8 A;  1GDK A;  1O1N B;  1YIE B;  3QM7 A;  2ZS1 B;  1Y45 B;  2W6V B;  3ODQ B;  1Y0T B;  1YEQ A;  2GTL D;  2O5B X;  1SWM A;  1Y5J B;  2GL3 A;  3UHW A;  1NS9 B;  2ZLX B;  5D1V A;  2HZ2 A;  5CHQ A;  3ORD A;  3VRF B;  3PI8 A;  1THB B;  5CN4 A;  1VWT B;  3UH7 A;  3NMM B;  6HBI A;  1FHJ A;  3WCT C;  4O4T A;  5EE4 D;  1SPE A;  3UHK A;  1YEN A;  4VHB A;  3PT8 B;  2DHB B;  3ECZ A;  2HHD A;  1G08 B;  3GKV B;  3WCP A;  3MYN A;  3IC0 A;  2O5S X;  1Y46 A;  2RAO A;  1WMU B;  2HHE B;  1YMA A;  3QQQ A;  1YIE A;  3FH9 B;  1QXE A;  2ZT1 A;  3M39 A;  1GZX A;  4NS2 A;  1XY0 A;  5CN5 A;  2OH9 A;  2QSS A;  1JWN A;  3HEO A;  1LFL B;  4PQC A;  3WFU A;  2MYB A;  1UX8 A;  1CH7 A;  1O16 A;  2RI4 B;  1S5X B;  3WCV A;  1J3Z B;  1KFR A;  1Y83 B;  1R1X B;  2HBE B;  3BA2 A;  1XZ4 B;  4GZG A;  2QFK A;  5SW7 A;  4WJG A;  4MQK B;  3PIA B;  1HBG A;  2AUP A;  1COH B;  1DKE A;  1MDN A;  1NPF A;  1DO4 A;  4MQG B;  1O1L A;  1HDA B;  2EVP A;  1RTX A;  2BNL A;  1Y7D A;  3UHS A;  2G0V A;  1Y09 B;  1BZ6 A;  2V1E A;  2R4X A;  2R4Z A;  1Y4B A;  1VXB A;  2DN1 B;  3IC0 B;  3S66 A;  1Y5J A;  1RTE A;  3BJ1 A;  5EUI B;  2XKH A;  3UHZ A;  2C0K A;  3VRE A;  1RQ3 A;  4DWU A;  1YHR A;  1JEB B;  3WCT A;  2R80 B;  4HHB B;  1JZK A;  1MLS A;  1CP0 A;  1CG8 B;  2PGH B;  2ZSS A;  1MLH A;  111M A;  4OOD A;  3ZOM A;  1J7Y B;  1T1N A;  3PT7 A;  2ZLW A;  3OGB A;  2WY4 A;  1LFT A;  2H8F B;  1Y0A B;  3WCV C;  1F5O A;  3S48 C;  3WR1 A;  1IRC A;  4FWY A;  1S69 A;  2AUQ A;  3IXF A;  1YH9 A;  1EMY A;  1B86 A;  3IA3 B;  1FDH G;  3PT8 A;  1ABW A;  1O1J B;  3ZH0 A;  4IRO B;  3HF4 B;  3ARJ A;  2Z6S A;  1HAC A;  2RAO B;  1Y4V B;  4U8U B;  2VRY A;  4ROL A;  1YEO B;  3E5I A;  1HGA B;  1J7W B;  1NEJ A;  2MGK A;  1K1K B;  2BK9 A;  3QM5 A;  106M A;  1HCO A;  1GDI A;  1QXD A;  3D1K B;  1UT0 A;  2ZSP A;  3GK9 A;  2Z85 A;  3A5B A;  1O1J A;  1VXE A;  4UIQ A;  5D5R A;  1LH3 A;  2G11 A;  1XZU B;  3NFE B;  5E29 A;  1X9F A;  2DN1 A;  2FRK X;  1V4X A;  5CN8 A;  1Y2Z B;  3WFX A;  3HHB B;  1RPS A;  1J3Y B;  1A6N A;  1GCW A;  4ROM B;  4L2M A;  3GKT A;  1JZM A;  1QSH A;  2GRF A;  3UHE A;  3E4N A;  3UGZ A;  2IN4 A;  3O89 A;  1C7B B;  2D2N B;  1EWA A;  3GQR B;  2BMM A;  3PI9 B;  2DXM A;  4ROL B;  3UHR A;  5E6E A;  3ZJQ A;  1ECO A;  4F6I A;  3R0G A;  3SZK A;  3HRW B;  2MGA A;  1CH5 A;  1FN3 B;  1KR7 A;  3ZJI A;  1Y8W A;  3UBC A;  2MGJ A;  3LB1 A;  1Y5F A;  2EKT A;  2SPL A;  110M A;  1C40 B;  1R1Y B;  5KDQ A;  2R1H B;  1IWH A;  2V1G A;  3AQ5 A;  4ODC A;  5JGG B;  1SHR B;  4N7O B;  1Y85 B;  2ZFO C;  3VRG B;  1A0Z B;  1SI4 B;  2AA1 A;  1UC3 A;  3S65 A;  1YEU A;  1Y01 B;  1QPW A;  2BWH A;  3M38 A;  1NQP A;  4G1V A;  1DO7 A;  1O1K B;  4ZVA A;  1XQ5 B;  1NIH B;  1GCV B;  3EU1 B;  3NFE A;  2RI4 A;  4F6F A;  5C6Y A;  1HDA A;  1HBA A;  1Y7G A;  1UFJ A;  2Z6N A;  4AVD A;  1XY0 B;  5KKK A;  1Y31 B;  2MYA A;  3G4W A;  3G52 A;  4H2L A;  3A59 B;  3UHI A;  4G51 A;  5KDQ B;  1FSX B;  2G0S A;  2G14 A;  108M A;  1K0Y A;  2D2N D;  2W6X A;  2ZT0 A;  1CMY A;  1V4W A;  101M A;  3MKB A;  5CND A;  5CHR A;  1A9W E;  1YZI A;  3ECL A;  3H57 A;  2DXM B;  2MGC A;  2R80 A;  5E83 B;  3E5O A;  5HLU A;  1G09 A;  3E55 A;  2HBG A;  5HBI A;  3GDJ A;  3D7O B;  1RQ3 B;  3QM8 A;  1J7Y A;  1Y46 B;  2WTH A;  2LH7 A;  5EU2 A;  1FSX A;  1BBB B;  1NWI A;  3LB4 A;  1YMB A;  1Y0D B;  1Y22 B;  3WCU C;  2ZLW B;  2M6Z A;  1RPS B;  1QXD B;  1Y85 A;  2VEE A;  3WFW A;  3ZOL A;  2O5M X;  3MVC A;  1ECA A;  3U3E A;  2HCO A;  3FS4 B;  5CNE A;  1Y7G B;  1JP8 A;  2VHB A;  3QM6 A;  4MQI A;  1H97 A;  2LH1 A;  3D4X B;  1S5X A;  2DC3 A;  1YIH A;  2ZSZ A;  107M A;  2Z8A A;  4FH6 A;  1MKO B;  3PI4 A;  3ZJP A;  4KJT A;  1JL6 A;  1HBS A;  1QSI B;  2ZS1 D;  3DHR A;  3WHM B;  1CPW A;  3EOK A;  2EF2 A;  4DC7 A;  104M A;  1OUT B;  1OFK A;  1CH4 A;  1JP9 A;  1LJW A;  2ZFO B;  2W72 C;  1Y7C A;  1XZ7 B;  3OO4 B;  5JOM A;  1FCS A;  4B4Y A;  1S6A A;  1MYT A;  1GLI A;  3BJ3 B;  2ZST A;  4YU4 A;  1JL7 A;  1CMY B;  1HDS A;  2SPM A;  2ZSX A;  1Y7Z B;  1YCB A;  1CG8 A;  7HBI A;  1BAB B;  1X46 A;  2QSP B;  3NL7 B;  3WTG B;  4C0N A;  3TLD A;  3KUO A;  1X3K A;  1EBT A;  5ILE A;  3VAU A;  1HJT A;  5HU6 A;  2ZS0 C;  3PT7 B;  1GBU A;  1V4W B;  3AT5 B;  1CH3 A;  1CBL A;  1DXT B;  1NS6 A;  3OZU A;  1H1X A;  1PBX A;  1MBC A;  1MNO A;  1J3Y A;  1VXG A;  4L7Y B;  1RQ4 A;  1C7D B;  1LA6 A;  4AVE A;  2NRL A;  1Y45 A;  2W6V A;  2NRM A;  1QI8 A;  2NSS A;  1DXU A;  3RJN B;  1Y5F B;  2ZSR A;  1YFF A;  3G4Q A;  1DO1 A;  3KMF C;  1YIH B;  2DN2 A;  2MGL A;  3S66 B;  1U7S A;  1Y4Q B;  3BCQ A;  2MHB B;  3CIU A;  2YRS B;  1IDR A;  1MTJ A;  3IC2 B;  1BZZ B;  2MGE A;  1BIJ A;  1IBE B;  2H35 A;  2XKG A;  1N9I A;  1DWR A;  1XYE A;  3OZW A;  1JF3 A;  4JYQ A;  1Y7Z A;  2V1J A;  3D17 A;  1MOA A;  1O1K A;  1SDK A;  5CNG A;  3ZJM A;  1GJN A;  1MNK A;  1QXE B;  5HLQ A;  1NZ4 A;  3UH5 A;  3HXN B;  3M3B A;  3BJ2 A;  1K0Y B;  1UX9 A;  4U8U C;  4H0B A;  4BJA A;  1Y0W B;  3PI8 B;  4TYX A;  2ZWJ A;  4N8T A;  4NXC A;  2HBD A;  4M4A A;  3ECX A;  3DHR B;  2HCO B;  3K3U A;  4MQH A;  3D1A A;  1A6M A;  1MBD A;  1MLU A;  4O1T A;  3V2Z A;  1Y4P B;  1MLR A;  2ZFB A;  3OO5 A;  5HLX A;  1MLJ A;  4ESA B;  3OVU C;  1S0H A;  4C44 A;  1LFY A;  1VXA A;  1NPG A;  1CIO A;  3A9M A;  4H07 A;  1TU9 A;  1Z8U B;  5JDO D;  1OUU A;  3G4Y A;  1ABY A;  5AB8 A;  3O7N A;  3CY5 B;  1NAZ A;  1Y0D A;  1N9H A;  1RVW B;  1OBM A;  3ZHW A;  2ZFB B;  1B0B A;  2W6Y A;  1AJG A;  1IRD B;  1J3F A;  1YE2 A;  1M6C A;  2G3H A;  2AUO A;  3WCP B;  4N7O A;  4N7N B;  3WI8 A;  1V4X B;  1O1P B;  1MLN A;  2AUR A;  1UVX A;  1LTW A;  3OZV A;  1EW6 A;  2B7H B;  1FDH A;  1A9W A;  5EUI A;  1G09 B;  4MXL A;  1O1M B;  1WLA A;  3HEP A;  4XDI A;  1BZ1 A;  3WCV B;  1JEB A;  1JP6 A;  3ONZ B;  2WTG A;  1IT3 A;  1GBV B;  2YRS A;  4MPM A;  1MLF A;  1ITH A;  1Y22 A;  5E6E B;  1XXT B;  5KER A;  3GLN A;  3GKV A;  1M9P A;  4NXA A;  3WHM A;  1Y7C B;  1M6M A;  1S56 A;  1HBR A;  3D7O A;  3BJ2 B;  3ZJN A;  1D8U A;  3LQD A;  1F63 A;  2ZLX A;  2MHB A;  1O1M A;  2FAM A;  2DN3 A;  1Y35 B;  1PBX B;  1YE0 A;  3UHT A;  2D2M C;  4KN3 A;  3TM3 A;  3NL7 A;  1BZ0 B;  3RJ6 A;  1CBM A;  3QZZ A;  1VRE A;  2ZLV B;  4QAU A;  2O5Q X;  4XS0 B;  5CN7 A;  5JGG A;  1B86 B;  2LH2 A;  1Y8W B;  3UH6 A;  1F5P A;  1LFV B;  1DM1 A;  1Y0C B;  1YVT B;  2CMM A;  1DTI A;  2D5X A;  1HV4 A;  2HBF B;  2GRZ A;  1FAW A;  4FWZ A;  3W4U B;  1FSL A;  2G0X A;  5SW7 B;  1CQ2 A;  1Y2Z A;  2R4W A;  5C6E A;  1XXT A;  1IRD A;  1A3O B;  2VLZ A;  4SDH A;  2O5O X;  2ZS1 A;  3RGK A;  4JAC A;  1J41 B;  1CP5 A;  1LHT A;  3KMF A;  1CH9 A;  1LH5 A;  5EYS A;  1XYE B;  2GKN A;  4HRT B;  2DN3 B;  3LHB A;  1Y83 A;  1WVP A;  2NX0 A;  1C7B A;  2JHO A;  1A0U B;  1Y31 A;  3UI0 A;  3S65 B;  1HCO B;  103M A;  1HRM A;  1MOB A;  4FWX A;  3BJ3 A;  1VXH A;  1VXD A;  2AV3 A;  1HGC B;  2PGH A;  2FRI X;  1LFZ B;  1BZP A;  1YHU D;  3EDB A;  2VLX A;  3DHT A;  1GBV A;  3ONZ A;  4F69 A;  1G0A B;  2GRH A;  1L2K A;  1M9P B;  2R50 A;  1YEQ B;  2GDM A;  1GCW B;  1DXD A;  1A00 B;  3MN0 A;  3LR9 A;  3AQ8 A;  1YG5 B;  3ASE A;  2MGG A;  3K8B B;  2FRJ X;  1XZ2 B;  3G53 A;  2E2Y A;  5ILM A;  2QU0 B;  3GQR A;  3D17 B;  2VEB A;  4N8T B;  4O4Z A;  2HHE A;  1NZ5 A;  2BKM A;  4O2G A;  2D5X B;  1YDZ B;  3WR1 B;  1HAB B;  1RQA B;  1QSH B;  1MYF A;  3HXN A;  1U7R A;  3QQR A;  1NWN A;  2LHB A;  2HHB A;  4MBN A;  5CN9 A;  1V9Q A;  5KER B;  3UHY A;  3PI2 A;  1MBO A;  2BW9 M;  5HY8 B;  1BAB A;  1YEV B;  1DKE B;  2LH3 A;  5EQM A;  2MGF A;  4HRT A;  5C6E B;  2QRW A;  3EDA A;  3GQG B;  5ILR A;  1DO3 A;  2QLS B;  5MBN A;  1OR4 A;  2D2N A;  1G9V B;  1J41 A;  2PEG A;  5CNF A;  2QMB A;  3QJC B;  1A6K A;  1NZ3 A;  5CN6 A;  2D2M B;  1KD2 B;  1N9F A;  4NI0 A;  3LB3 A;  1Y4V A;  2H35 B;  1MOC A;  3H58 A;  1RQ4 B;  1G0B A;  2ZSO A;  2W72 A;  2ZS0 B;  3M3A A;  2V1H A;  2MYD A;  1YEU B;  1Y09 A;  1MBS A;  3A0G A;  1LFZ A;  1YHU B;  1OR6 A;  3VRE B;  3P5Q B;  4HRR A;  1DWS A;  4WJG 1;  1MZ0 A;  3R5I A;  1YEN B;  3LB2 A;  1Y4P A;  4MQK A;  1MOD A;  3PEL A;  1SHR A;  1Q1F A;  3UHH A;  2D5Z B;  4H2L B;  2MGM A;  1Y4F A;  3HYU B;  3LR7 A;  2KSC A;  2ZSQ A;  5CNC A;  3VRG A;  1C7D A;  2ZSN A;  1RQA A;  1C7C A;  4YU4 B;  2HZ3 A;  109M A;  1MWB A;  2BLJ M;  4MQH B;  1O1I B;  1MLL A;  4HSX A;  3GOU A;  1Y8K A;  1YVT A;  1MTI A;  3UHU A;  1Y8H A;  5JDO E;  3HYU A;  1YOI A;  2ZLT B;  3MJP A;  1LH6 A;  2DHB A;  5M3S A;  1YZI B;  1FN3 A;  1HGB A;  3WCT D;  4MBA A;  1O1I A;  4N7N A;  1A01 B;  1VXC A;  2ZLV A;  1MCY A;  1WMU A;  4F4O B;  1Y0C A;  102M A;  3NG6 A;  2OHB A;  1GZX B;  1C40 A;  105M A;  4PNJ A;  3LQD B;  1G0A A;  1TES A;  1MYM A;  2PEG B;  1QPW B;  3ZJL A;  1YDZ A;  1GDJ A;  1HGC A;  3B75 B;  2D2M A;  1O1L B;  1YEO A;  1R1X A;  2HBE A;  2ZS0 D;  4X0L B;  1HBH B;  1JW8 A;  1YVQ B;  3AT6 A;  1XZV A;  1DXC A;  3PIA A;  1A0U A;  1BZ1 B;  1A3O A;  3D1K A;  1CH1 A;  3OO4 A;  2GNW A;  1A00 A;  1V75 A;  2MGI A;  3ZJR A;  1XZ5 B;  1T1N B;  1HV4 B;  1HSY A;  3UHX A;  1JY7 B;  3PI3 A;  1Y4G B;  3AT5 A;  2EVK A;  3DR9 A;  3G46 A;  3MBA A;  5ILP A;  3EOK B;  2VM0 A;  1LFT B;  2H8F A;  1G9V A;  1O1N A;  1LUE A;  1UVY A;  2HBC A;  4PQ6 A;  1V4U B;  5E83 A;  1MYJ A;  5JDO C;  1HBS B;  1YFF B;  2VYW A;  3DUT B;  1J3Z A;  3NMM A;  1Y8H B;  2ZS1 C;  3OK5 A;  1YG5 A;  1UMO A;  1LFV A;  1HHO A;  1HLB A;  2ZT4 A;  4HSW A;  1X9F C;  3UHC A;  1VXF A;  1XZ2 A;  2H8D A;  1CO9 A;  1XZ7 A;  1BIJ B;  3D1A B;  2ZLU B;  3WCW B;  3R5I B;  1VWT A;  1J7W A;  1NEJ B;  2W6W A;  4KMV A;  1UIW A;  6HBW A;  2SPN A;  1DXT A;  1NS6 B;  1OFJ A;  2HHB B;  3ZJJ A;  2QU0 A;  1MLQ A;  1GDL A;  1A01 A;  1MBI A;  3KUN A;  3ZJS A;  1J40 A;  3QM9 A;  3AG0 A;  2O58 X;  2GNV A;  2R1H A;  1JPB A;  1HBH A;  2DN2 B;  2OLP A;  1MTK A;  4FC3 A;  4MQC B;  1YGF A;  3WCT B;  1AZI A;  1HGB B;  1Y8K B;  3OJ1 A;  3DUT A;  1QI8 B;  1BUW A;  1Y0A A;  4WCH D;  1HBR B;  2D2N C;  1YHU C;  2ZFO D;  4HRR B;  4HBI A;  1SI4 A;  1KD2 A;  1MBN A;  2EB9 A;  2MGH A;  2XKI A;  1CLS A;  2VLY A;  3GQP B;  1BVD A;  1HBB A;  2LH5 A;  4IRO A;  3K9Z A;  1S61 A;  5JDO F;  2ZFO A;  1NGK A;  1Y0T A;  1HAB A;  1MLM A;  3HC9 A;  1I3E A;  3MKB B;  2ZT2 A;  1DLW A;  4B3W A;  1V5H A;  1LH2 A;  1EBC A;  2G0Z A;  1A6G A;  3D4X A;  1YOG A;  2QLS A;  4OF9 A;  3PI9 A;  1J52 A;  4ILZ A;  2BLH A;  2W31 A;  1IBE A;  2MYC A;  1MKO A;  1MNH A;  3UBV A;  1MNI A;  2MGB A;  1LFQ B;  1A3N B;  3AT6 B;  1K1K A;  2LH6 A;  1HGA A;  4F6G A;  2EKU A;  5CMV A;  2D6C A;  5F2A A;  2D5Z A;  1MLG A;  2HBS A;  1Y5K A;  2ZLU A;  1HBI A;  3WCW A;  1MYH A;  1JF4 A;  3GDJ B;  2M6Z B;  3G4U A;  5AZR A;  3MYM A;  1IWH B;  1YVQ A;  1MLK A;  2D2M D;  1Y0W A;  3MJP B;  5HAV A;  1HDS B;  112M A;  5EYJ A;  1Y4B B;  3FS4 A;  2SPO A;  3QJB B;  3G4V A;  1DXV B;  1Y5K B;  4MXK A;  1XZU A;  4NI1 B;  4MQI B;  4O35 A;  2OHA A;  3SZK B;  2Z6N B;  4ZVB A;  2NSR A;  3AQ9 A;  4M4B A;  1AJ9 A;  1YHE A;  3S1J A;  3WCU A;  1LH7 A;  3AQ6 A;  1RVW A;  1LH1 A;  3S1I A;  3UHG A;  1NS9 A;  4MQJ B;  1NIH A;  1HDB B;  1URY A;  3ZJO A;  2EB8 A;  1JY7 A;  1CLS B;  1OUT A;  4TWV A;  1I3D A;  1JZL A;  3QJD B;  5IKS A;  1LHS A;  1MWC A;  1O1P A;  3A2G A;  1IOP A;  3GOU B;  3UHV A;  3WTG A;  3WFT A;  2B7H A;  3W4U A;  1DXU B;  1O1O B;  4L7Y A;  3K8B A;  4MQC A;  4F6D A;  1Y4G A;  2QFN A;  1C7C B;  2FAL A;  3WCW C;  5HY8 A;  1DTM A;  1LA6 B;  1YE0 B;  2GLN A;  4MU5 A;  3A59 A;  3SDN A;  1DUO A;  3ARK A;  1A3N A;  3QMA A;  1HAC B;  3IC2 A;  1YE2 B;  1MOH A;  2HBF A;  4PQB A;  4N7P B;  5F0B A;  1SDL B;  1PMB A;  1J7S B;  2O5L X;  1AJH A;  1CIK A;  1VHB A;  1BBB A;  2AA1 B;  4FC3 B;  3TM9 A;  4YU3 A;  2ZSY A;  1Y35 A;  1NQP B;  5HU6 B;  1W92 A;  1ECN A;  2FRF A;  4NZI A;  1YHR B;  4KMW A;  1G0B B;  1Y8I B;  4X0L A;  2GTL A;  1XCH A;  5AZQ A;  4NK1 A;  3WCV D;  3NG6 B;  1UIW B;  3UHN A;  3A0G B;  3QJE A;  1YHE B;  3ODQ A;  2QSS B;  4U8U D;  3MJU B;  3VHB A;  1NXF A;  2V1K A;  3SDH A;  1O1O A;  2BLI A;  2HBC B;  1GVH A;  4NI1 A;  5B84 A;  1GCV A;  1MLO A;  1SPG B;  4NI0 B;  3FH9 A;  1FAW B;  2R4Y A;  3UHB A;  6HBW B;  3AQ7 A;  1R1Y A;  3UHD A;  2QSP A;  1BIN A;  2ZLT A;  3MOU A;  2XYK A;  1Y4Q A;  3BCQ B;  3CIU B;  3QJD A;  1JDO A;  1CQX A;  1XZV B;  1MGN A;  1DLY A;  1YGF B;  3GYS B;  4TWU A;  1OJ6 A;  1S0H B;  1THB A;  3HHB A;  3A5G A;  1BUW B;  2D60 B;  1A4F B;  1YH9 B;  2MBW A;  1MWD A;  1FHJ B;  3PI1 A;  1N9X A;  1ASH A;  3V2V A;  2HBD B;  4M4A B;  4ESA A;  1CG5 B;  1YHU A;  4U8U A;  1BZR A;  3ED9 A;  1Y8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...