2BW9M

Laue structure of l29w mbco
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
153
structure length
153
Chain Sequence
VLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Migration Pathway and Protein Dynamics in Myoglobin: A Time-Resolved Crystallographic Study on L29W Mbco.
pubmed doi rcsb
source organism Physeter catodon
molecule tags Oxygen transport
molecule keywords MYOGLOBIN
total genus 64
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 2bw9M00
1VXAA 3WHMB 5ILMA 1YDZB 1A6KA 2D5XA 3ARKA 1A0ZA 1V4UB 4ZVBA 3NMMB 1YHUD 1HBRA 3P5QA 1MZ0A 5ILPA 1Y5KA 5JGGB 1SDLA 1XYEB 1IDRA 1MBNA 2ZS0A 2SPMA 1DXVB 1DUKA 3UHGA 2G14A 2MGBA 1O1NB 2ZLVB 4FC3A 1J41B 3AQ9A 1MLUA 1MOHA 3LQDA 2Z6NA 3G52A 2QLSA 2W72A 3A0GB 1FHJB 3K9ZA 1KD2A 1CO9A 3A59B 1J3ZB 2BLIA 1G0BA 3D4XB 1ABWA 3IA3B 1IOPA 3KMFA 3HF4A 1FCSA 1Y7CB 1AZIA 1HABB 1HBBB 1FN3B 1RQAA 1F65A 4TWVA 2AV0A 3TM9A 1C40A 3BA2A 1YZIA 1VREA 2QSPB 1YEQA 1DXDA 4F69A 2ZLVA 1CH1A 4NXAA 3UHBA 1QI8B 3LB3A 2LH2A 1HDAA 2ZLXB 1Y4RB 1HDSB 2QLSB 2AUPA 3UHTA 1GCVB 1NS6A 2G11A 1HBGA 1Y4BB 3GQGA 1NWIA 5C6YA 3IC2A 1MYMA 1PMBA 2W6VB 1Y5KB 2ZT1A 1LHSA 5EETA 1VRFA 1YHUA 2ZT4A 3DR9A 5EE4C 3ARJA 2G0SA 3NMMA 4F4OA 3UH3A 4ROMB 3ZJOA 3WCTB 1Q1FA 2R4WA 3IC2B 3PT7B 1C7CA 1MLRA 109MA 3UGYA 2MGJA 3HEOA 3MKBA 3UBVA 1YIEA 3GQPA 3PT7A 1IWHB 1V4XB 1MYHA 1HGAA 4HBIA 1YHRA 1XY0A 2NX0A 1O1OB 4N7PB 1RPSB 2VRYA 1X46A 1YVQA 1Y8IA 4HRTB 5E83A 3UHRA 1XZVA 1IT2A 1MOAA 1ECAA 1Y7CA 3HXNB 1JF3A 1OUTA 3QJCA 1XZUA 3V2VA 2D60B 1HHOA 1V9QA 3AQ7A 1LH1A 1JP8A 1BZZB 3CY5A 2RI4B 1J3FA 1F5OA 1CQXA 2HHBB 1YENB 2ZLUA 1I3DA 4MBNA 3GLNA 5E29A 1MWBA 1D8UA 4NI1A 1HV4B 4HSWA 2SPNA 2SPOA 2NRMA 1O1MA 4U8UA 5CN6A 1HDBB 1JZKA 3UHIA 1L2KA 1LH7A 1Y35B 2D2NB 1A6NA 3ZJQA 1J3YA 3OO5A 1X9FA 1J7WB 1DM1A 1Y0CB 1Y4PB 3O7NA 4N7PA 2EVKA 2GTLA 4O1TA 3LB4A 2H8FB 1XYEA 1NQPA 2W6YA 1CIOA 1RVWA 5JDOC 2XKHA 105MA 2D2NC 3ZH0A 3WTGA 1Y46A 1NQPB 3QM9A 1Y7ZA 2RAOB 1RVWB 4N8TB 1C7CB 1YG5A 1Y5FA 3U3EA 1A9WE 4TWUA 1BVCA 1HBRB 2E2YA 1LFLA 1GLIB 1DKEA 2FRFA 2ZSOA 4B4YA 1MLFA 4B3WA 1C40B 1NPGA 1CPWA 1CMYA 2HBGA 1UMOA 3WCWB 2V1EA 3A2GA 4UURA 3OZUA 3UHKA 1OUTB 1RSEA 1J7WA 2MGLA 1KFRA 3UH5A 1A01B 2ZSNA 2ZSQA 3M38A 2QSPA 1FN3A 3UHSA 1UIWB 1QXDB 3A5AA 3QJBA 4NK2A 1YE2B 1YHEA 1IRDA 2OLPA 3SZKA 1VHBA 2DHBB 1LFZA 3TM3A 4DC7A 1CH5A 1I3EA 5CN7A 1N9HA 3ZJHA 1MLJA 2DN2B 1A6MA 2B7HB 1BZ0A 4NS2A 2FALA 5E6EA 1WLAA 1COHA 2ZSTA 4M4AA 1XZ5B 3D7OA 3RJNB 2BLHA 3ZJLA 3B75B 3FH9B 1O1JA 2BK9A 1Y8HB 1YGDA 1UVYA 4DWTA 1HACB 1CBLA 1Y4QA 3ZOLA 1CMYB 3WCTA 2O5SX 4PQCA 1NS9A 3SDHA 4PQ6A 1IRCA 3RGKA 1JF4A 1Y2ZA 4NXCA 4WJGA 1XZ7B 1RPSA 5EV5A 1SHRA 1JP9A 4KJTA 2VEBA 4F4OB 1MLHA 1MWCA 3S1IA 5CNBA 1GZXA 1HGAB 1YIEB 1HDSA 1M9PA 1OR6A 1LFTB 1VWTB 1YEOB 2QSSB 3MYMA 1GCVA 3A9MA 4FWZA 3BJ3A 2EF2A 1G09B 2PGHA 3NG6A 3R0GA 1XZ5A 3D7OB 1YGFB 1A4FB 1G08A 1BINA 2DN2A 3MBAA 3PI8A 2MYDA 1Y0AA 1LJWA 1HCOB 5ILEA 4ROMA 1O1MB 1MWDA 1Y09A 2QRWA 2BWHA 4L2MA 2D2MA 5SW7B 1BBBA 3LB2A 1YE2A 1FAWA 2XKGA 3HYUA 2V1FA 2D5ZA 3ORDA 1CP0A 1HACA 1WMUB 5CHRA 4M4AB 1FSLA 1LA6A 2XYKA 1JDOA 1RTXA 4MQHA 1BABA 1MNHA 2PEGA 1Y4PA 4OF9A 2HBSA 1Y7GA 4PNJA 1VXEA 1FHJA 2Z6NB 3GDJA 3HHBA 2DN1B 3A59A 1VXBA 1DXTB 5C6EA 5JDOF 4TYXA 1DLYA 1JZMA 2V1HA 2GKNA 1Y0AB 3MJUB 1SDLB 2BW9M 4FWYA 1C7DB 2MYEA 1A0UB 3PI2A 1YENA 1R1YA 1FSXB 2WY4A 1KR7A 1K0YB 1Y0DB 1T1NA 5MBAA 1CP5A 4N8TA 4H07A 1ECOA 1HJTA 3EU1B 4ODCB 1OFJA 1K1KB 3LB1A 1NZ3A 3NG6B 4O2GA 1Y85A 1GCWB 1G0AA 1EBCA 3ZJSA 1B0BA 3GQPB 1EWAA 3E55A 3CIUB 1HGBB 1A3OA 2ZS0C 4JACA 1YGFA 1LFQA 2VM0A 1XQ5A 2ZWJA 2VEEA 1Y4BA 2WTGA 3GQGB 2D2MD 3SDNA 3K8BB 1CG8B 1RQ4B 1SI4B 2W72C 2ZLXA 2O5BX 1OFKA 1Y83B 2G3HA 2EVPA 1MKOB 3WCUC 3PI3A 1MNOA 1SDKB 3DHTA 1X3KA 1JZLA 4MQKA 2ZS1B 1HRMA 3WR1A 1YOGA 5E6EB 3HENA 2ZSZA 5EUIA 1CG5B 3PI4A 1CQ2A 2GKMA 1PBXB 3NMLA 1Y8HA 5KERA 1DWSA 3UHDA 1QXEA 1DO7A 1BABB 3AQ5A 1GJNA 3BJ1B 1IRDB 3SZKB 4KMVA 3EDBA 5E83B 3M39A 1HBSB 3WCWA 3GDJB 1TESA 2R80B 3EDAA 1Y0TB 1MLLA 1YOIA 1DUOA 1QSIA 3M3BA 2VLZA 3E5OA 1XCHA 1YMBA 2G10A 3R5IA 4G51B 2ZLWA 2MHBB 2ZFOB 3D1KB 1ABSA 1YHRB 1YH9B 2WTHA 3WCWD 3WFTA 3DHRA 1GDJA 2Z8AA 1J7SB 4HRTA 4KN3A 3DUTB 1NWNA 2HHDB 2ZS0B 1JEBB 1XZ4A 4UIQA 3WTGB 2R4ZA 4BJAA 3LQDB 1DXVA 1V5HA 2GTLB 1MLKA 108MA 1RQ4A 2ZFOC 1THBA 3ECLA 1YG5B 1R1XA 3QQRA 5AZQA 1F5PA 4WJG1 1BIJB 2QFNA 3VAUA 3G4YA 2HZ3A 3S65B 1Y35A 3BCQB 2QMBA 1CH3A 1Y46B 1DLWA 3BJ1A 4F6DA 1HGCB 2BNLA 2DN1A 3GKTA 2KSCA 2M6ZA 1YHUB 4G1VA 1UX8A 1LUEA 2MGAA 4MQGA 1MBIA 2LH5A 5KKKA 2OHAA 4XS0B 2R4XA 3GQRA 4QAUA 1N9XA 1FSXA 2Z6TA 1BUWA 2W31A 3ZJJA 1YEQB 2EKTA 3GK9A 1DXCA 2GNWA 3WCTC 1LFVA 3H57A 1A3NA 3KUOA 3GYSB 4MQJA 4ZVAA 2G0VA 3PI9B 3EOKA 2O5QX 1GLIA 5HU6B 2GTLC 1DO4A 1DXUA 2V1GA 2XKIA 2ZFBA 5CN5A 2HBSB 3CIUA 2ZSPA 2BKMA 1URVA 1BZZA 1YVTB 2AUQA 2LH7A 3D1AA 5CN4A 1A6GA 1SHRB 1WVPA 1NIHB 3QM6A 1GCWA 1MYZA 4G1BA 1MBDA 1MTJA 4ESAA 3G4RA 2HZ2A 3UHHA 1YHUC 2H8DA 3NFEA 3P5QB 5EU2A 2ZS1D 2MBWA 1HBAB 2ZT3A 3FH9A 3QJDA 1SPGA 1O1IB 4AVEA 1Y4FA 3BJ3B 3OO5B 1S0HB 1Y2ZB 1LFQB 1Y4VA 2W6XA 3EOKB 2LHBA 3LR7A 2DC3A 4U8UB 1YEVB 1GDIA 4YU4A 1Y85B 1YZIB 3IC0B 3PT8B 2MGIA 4M4BA 5CMVA 1O1LB 1Y8WA 1HDAB 1Y22B 1IBEA 1YMCA 3S66A 1CH2A 1YIHA 2ZFBB 4F6JA 5CNEA 2VHBA 2W6WA 1DTMA 3R5IB 4NI0B 4F68A 1J3YB 1DWRA 3MN0A 1IBEB 1XZ2A 1JL7A 4WCHD 5C6EB 1Y0TA 2DXMB 5CNDA 4F6FA 1YCAA 2EB8A 1AJ9B 1O1PB 1ITHA 2C0KA 4FH6A 1H1XA 3WCUD 3WFXA 2LH3A 2GRFA 1A01A 3PI8B 1O1IA 4H2LA 1MBSA 3ZJIA 2RAOA 2Z6SA 1FDHA 1S0HA 3IC0A 3NFEB 2VYYA 1LFYA 1SPGB 3VREB 2EB9A 2GNVA 1S61A 3V2ZA 4F6GA 3NL7B 1J52A 2AA1B 2QU0B 3UHQA 2NRLA 3ZJPA 1IWHA 5B84A 1YGDB 1YMAA 4MQCA 2HHDA 5KDQA 1THBB 3NL7A 1NZ4A 1M6MA 1S69A 2LH1A 1MNIA 5CNCA 1BZ0B 1T1NB 1BZ1B 3AT6A 5JGGA 1YFFA 1NS6B 3WFUA 2NSRA 3A5BA 3VRGA 1J7SA 2YRSB 3WHMA 2OIFA 3MJUA 2MGKA 2D5XB 1O1KA 1YEUA 6HBWB 2FAMA 1F63A 1S56A 106MA 4NK1A 104MA 3PELB 2DHBA 2V1IA 2MYBA 1FDHG 5ILRA 1J40B 4X0LA 2HZ1A 111MA 4FWXA 4XS0A 1Y31A 2B7HA 2D2MB 5SW7A 4GZGA 3HEPA 1AJHA 1LTWA 2MGCA 1G0BB 1UFJA 2FRKX 5EUIB 4X0LB 3ODQB 2O5LX 3PI9A 1DKEB 1MBAA 1QPWB 5HY8B 1YVQB 1MYGA 3A5GA 4MQIA 101MA 1HCOA 1DO1A 1ABWB 2HBDA 1DTIA 1BUWB 3WCVD 2GRZA 1V4XA 1CG8A 2HCOB 2MGMA 1MKOA 4MAXA 3WCVC 1W92A 1MYFA 5CNGA 1GZXB 1YEVA 5KDQB 4C44A 5CN8A 1HBHB 1O1KB 3ZHWA 2R4YA 1V4WA 1LJWB 1Y4FB 3GOUA 2OHBA 1A4FA 1G08B 1X9FC 1MOCA 3DHRB 2O5TX 3MJPB 5CN9A 2G12A 4L7YB 1YH9A 2GTLD 1A00B 4HHBA 3DUTA 2HHEA 1MNJA 5JDOE 2HBCB 1YCBA 1A9WA 2H35B 2O5OX 1CO8A 2W6VA 1MLGA 2Z85A 2DXMA 1CLSB 1FLPA 4U8UC 5HAVA 2O5MX 2GLNA 2ZLTA 2G0RA 3EU1A 4ODCA 2D2NA 3HHBB 1DWTA 4KMWA 1HLMA 3OZWA 5HBIA 1Y31B 1GBUB 3WFWA 1OJ6A 2MYAA 3HRWA 1BJEA 5F0BA 3QJCB 1J7YB 1COHB 3MOUA 1MLSA 1Y5JB 2HBDB 3ZJNA 2BLJM 4MQJB 1NGKA 3S66B 107MA 1V75A 2IG3A 4MQIB 1YOHA 2ZSRA 2LH6A 1G9VA 1BZPA 1J7YA 1UX9A 1CH7A 3UHYA 1JPBA 1MYIA 1YE0B 3A0GA 4JYQA 1MLNA 3O89A 1O1LA 1Y8WB 3BOMA 1VXCA 1J3ZA 1GDLA 1Y22A 3HC9A 3CY5B 1B86B 1OBMA 110MA 4ROLB 4FC3B 2QSSA 5D1VA 112MA 2AUOA 4HHBB 1WMUA 1LFTA 4N7NB 4HSXA 2ZLTB 2HBCA 3D17B 1HGCA 4O4TA 2SPLA 4MQKB 2YRSA 1XZVB 1VWTA 2MGFA 3UHWA 2W72B 3M3AA 4U8UD 1RQ3B 1GDKA 1HBAA 2ZT2A 2FRJX 1VXHA 2HHEB 4N7OB 1OR4A 3ED9A 1M9PB 1YEOA 1BZ1A 2O58X 3AT6B 2GDMA 3RJ6A 2ZS1C 1Y5FB 1N9FA 2H8FA 1CH9A 3QJDB 3D1AB 1S5YB 1LH5A 3FS4A 1NIHA 1QSHA 2BMMA 3OVUC 4ESAB 5EE4D 3G4QA 3D1KA 3BOMB 2H8DB 1YHEB 2DN3A 4XDIA 2MYCA 1JWNA 1DXTA 1MGNA 2VLYA 5EQMA 3QM8A 1Y7GB 3UBCA 5MBNA 4G51A 1EW6A 1JP6A 4N7NA 1Y0CA 4ROLA 3UHVA 4MQHB 3WCUA 4FH7A 1C7BA 2NSSA 1MBOA 4VHBA 2R1HB 1TU9A 1NZ5A 1MYJA 1QI8A 3GKVB 2M6ZB 1Y4GA 1NEJB 1O1PA 1MLMA 1Y8IB 3UHCA 3LR9A 3AT5B 3KMFC 7HBIA 2MGDA 2VYZA 1O16A 2D60A 2MGGA 1GBVA 2DN3B 2OH8A 2QMBB 3G4WA 1MODA 1Z8UB 1Y8KA 3DHTB 1CBMA 3S65A 4MPMA 1V4UA 1ECDA 3K8BA 3BCQA 1GVHA 3VHBA 1S5YA 3UHEA 5HLUA 4YU4B 1HLBA 3UGZA 3PT8A 4UZVA 1O1NA 1MLOA 3VRFA 2AV3A 2ZS0D 1V4WB 2JHOA 1VXGA 2AURA 3PIAA 3QJEB 1O1OA 5CNFA 3QM7A 1CIKA 1HGBA 4L7YA 3UHUA 1X9FB 1A0UA 5HLQA 3VREA 1K0YA 1Y0DA 2MHBA 2ZFOA 4HRRB 1Y4QB 4MBAA 3E5IA 1ASHA 1HBHA 1XXTA 1NS9B 3S1JA 1HSYA 5AB8A 1XZ7A 2V1KA 4H0BA 5M3SA 4NI1B 1QSIB 1Y5JA 1O1JB 103MA 2ZFOD 2ZLWB 1A3NB 3ONZB 1M6CA 1Y45B 1Y8KB 3ZJMA 1J40A 1G9VB 1UT0A 1GBUA 3UHXA 2FRIX 1LH2A 5HU6A 1N9IA 2R80A 1V75B 3WCVA 2PEGB 1C7BB 3OO4A 1Y4RA 1QPWA 1HABA 3ASEA 1RQAB 3HF4B 4SDHA 1HBIA 1XY0B 1UFPA 4IROB 3QZZA 1Y0WB 1Y4VB 3UH6A 1JY7B 1OUUA 4MU5A 3UH7A 4NI0A 4M4BB 2D5ZB 1G09A 2PGHB 1XQ5B 4O4ZA 5F2AA 1LFLB 3UHZA 1HHOB 4MQGB 1YEUB 5EYJA 3QM5A 1MBCA 3G4UA 3OZVA 1EBTA 2GRHA 5IKSA 1SPEA 3FS4B 2ZSSA 1MYTA 1U7SA 1UVXA 3GOUB 4LPIA 1MNKA 1JL6A 102MA 1K1KA 4YU3A 1MCYA 2HBFA 3OGBA 3E4NA 3AQ6A 1JEBA 1A00A 1XZ4B 1RQ3A 1RTEA 1NZ2A 2GL3A 3AG0A 3MJPA 3W4UA 2EKUA 1CH4A 3IXFA 3K3UA 3ZOMA 1LH3A 2QFKA 1A3OB 2D2MC 3OK5A 3ODQA 1BZRA 2G0ZA 2IN4A 1A0ZB 3AT5A 1JY7A 1OUUB 1HBBA 1S6AA 5HY8A 1HV4A 1YVTA 5HLXA 1NEJA 1IT3A 1V07A 1Y0WA 1C7DA 1Y7DA 1Y01B 2D6CA 2AA1A 2QU0A 1ECNA 1NXFA 2MGEA 4DC8A 2HBEA 2G0XA 2HCOA 1EMYA 5JDOD 1SWMA 1LFYB 2R1HA 2VYWA 5EYSA 3WI8A 2D2ND 1DXUB 3GKVA 3WCUB 6HBIA 5JOMA 3BJ2A 1X9FD 3GYSA 3PELA 3MYNA 1CG5A 1ABYB 1LFVB 3S48C 1Y4GB 4PQBA 3H58A 3ECXA 1S5XA 1MOBA 4MXKA 3BJ2B 4O35A 3G4VA 6HBWA 3VRGB 1BBBB 1PBXA 2ZS1A 1R1XB 3ECZA 3AQ8A 1Y7DB 4F6BA 1LA6B 2HBFB 2VLXA 1Y09B 2ZT0A 1YDZA 3OJ1A 3VRFB 1MDNA 3ARLA 3LHBA 4HRRA 3PIAB 3QJEA 2R50A 4N7OA 3MVCA 3MKBB 1QSHB 1XXTB 4YU3B 1Y7ZB 3ZJRA 4NZIA 4ILZA 3TLDA 4MXLA 1DO3A 1G0AB 3W4UB 3QZXA 3D17A 3PI1A 3G46A 3WCPB 1H97A 1R1YB 1S5XB 1HBSA 1UC3A 1B86A 1JW8A 1YE0A 1VXDA 2ZSXA 1URYA 1U7RA 1ABYA 3QJBB 1AJ9A 1XZ2B 4DWUA 1LHTA 4C0NA 5CHQA 1MTKA 1QXDA 1YIHB 3WCVB 1Y45A 2OH9A 2MB5A 2ZLUB 1BVDA 3UHNA 1LFZB 4H2LB 5E29B 1BZ6A 2HBEB 3B75A 1MTIA 2HHBA 4IT8A 4IROA 3WCWC 1VXFA 1LH6A 1HDBA 1GBVB 1UIWA 1SDKA 3QMAA 3OO4B 5AZRA 3HXNA 3QQQA 3G53A 2H35A 2MGHA 3D4XA 5KERB 5D5RA 2RI4A 4OODA 3UI0A 1MLQA 1KD2B 1J41A 1NAZA 1QXEB 3WCTD 3ONZA 1XZUB 3WCPA 3GQRB 4F6IA 1BIJA 5B85A 1AJGA 2ZSYA 3HYUB 1Y83A 1NPFA 3WR1B 1SI4A 1YFFB 3KUNA 3HRWB 1FAWB 4MQCB 5EOHA 1CLSA 2CMMA 4AVDA 2V1JA
chains in the Genus database with same CATH superfamily
1VXAA 3WHMB 5ILMA 4ZIZB 1YDZB 1A6KA 2D5XA 3ARKA 3RQRA 1A0ZA 1CIIA 1V4UB 3LQ9A 4ZVBA 3NMMB 1YHUD 1HBRA 3P5QA 1MZ0A 4F0TA 5ILPA 1Y5KA 5JGGB 1SDLA 1XYEB 1IDRA 1MBNA 2ZS0A 2SPMA 1DXVB 1DUKA 3UHGA 2G14A 2MGBA 1O1NB 2ZLVB 4FC3A 3V58A 1J41B 3AQ9A 1MLUA 1MOHA 3LQDA 2Z6NA 3G52A 2QLSA 2W72A 3A0GB 1FHJB 3K9ZA 1KD2A 2C7KB 1CO9A 3A59B 1J3ZB 2BLIA 1G0BA 3D4XB 1ABWA 3IA3B 1IOPA 3KMFA 3HF4A 1FCSA 1Y7CB 1AZIA 1HABB 1HBBB 1QGWC 1FN3B 1RQAA 1F65A 1F0LA 4TWVA 2AV0A 3TM9A 1C40A 3BA2A 1YZIA 1VREA 2QSPB 1YEQA 1DXDA 4F69A 2ZLVA 1CH1A 4NXAA 3UHBA 1QI8B 3LB3A 2LH2A 1HDAA 2ZLXB 1Y4RB 1HDSB 2QLSB 2AUPA 3UHTA 1GCVB 1NS6A 2G11A 1HBGA 1A87A 1Y4BB 1NWIA 3GQGA 5C6YA 3IC2A 1MYMA 1PMBA 2W6VB 1Y5KB 2ZT1A 5AQDA 1LHSA 5EETA 1VRFA 1YHUA 2ZT4A 3DR9A 5EE4C 3ARJA 2G0SA 3NMMA 4F4OA 4LMXB 3UH3A 4ROMB 3ZJOA 3WCTB 1Q1FA 2R4WA 3IC2B 3PT7B 1C7CA 1MLRA 109MA 4GXEA 1ON7A 3UGYA 1HHTP 2MGJA 3HEOA 3MKBA 3UBVA 1YIEA 3GQPA 3PT7A 1IWHB 1V4XB 1MYHA 1HGAA 4HBIA 1ON7B 1YHRA 1XY0A 2NX0A 1O1OB 4N7PB 1RPSB 2VRYA 1B8DB 1X46A 1Y8IA 1YVQA 4HRTB 5E83A 3UHRA 1XZVA 1IT2A 1MOAA 1ECAA 1Y7CA 4BS9A 3HXNB 1JF3A 1OUTA 3QJCA 1XZUA 3V2VA 2D60B 1HHOA 1V9QA 3AQ7A 1LH1A 1JP8A 1BZZB 3CY5A 2RI4B 1J3FA 1F5OA 2VMLA 1CQXA 2HHBB 1YENB 2ZLUA 1I3DA 4MBNA 3GLNA 5E29A 1HI0P 1MWBA 1D8UA 4NI1A 1HV4B 4HSWA 4AE1A 2SPNA 2SPOA 2NRMA 1O1MA 4U8UA 5CN6A 1XF6C 1HDBB 1JZKA 3UHIA 1L2KA 4ETVA 1LH7A 1Y35B 2D2NB 1A6NA 3ZJQA 1J3YA 3OO5A 1X9FA 1J7WB 1DM1A 1Y0CB 1Y4PB 3O7NA 4N7PA 2EVKA 2GTLA 4O1TA 3LB4A 2H8FB 1XYEA 1NQPA 2W6YA 1CIOA 1RVWA 3V57B 5JDOC 2XKHA 105MA 2D2NC 3ZH0A 3WTGA 1I7YA 1Y46A 1NQPB 2JLGA 3QM9A 1Y7ZA 2RAOB 1RVWB 4N8TB 1C7CB 1YG5A 1Y5FA 3U3EA 1A9WE 4TWUA 1BVCA 2V8AA 1HBRB 2E2YA 1LFLA 1GLIB 1DKEA 2FRFA 2X49A 2ZSOA 4B4YA 1SGKA 1MLFA 4B3WA 1C40B 1NPGA 1CPWA 1CMYA 2HBGA 1UMOA 3WCWB 2V1EA 3A2GA 4UURA 3OZUA 2JLFA 1DDTA 3UHKA 1B33B 1OUTB 5B13G 1RSEA 4GY3B 1J7WA 2MGLA 1KFRA 1A01B 2ZSNA 3UH5A 2ZSQA 3M38A 2QSPA 1FN3A 2WCRA 3UHSA 1UIWB 1QXDB 3A5AA 3QJBA 4NK2A 1YE2B 1YHEA 1IRDA 2OLPA 3SZKA 1CPCB 1VHBA 2DHBB 1LFZA 3TM3A 4DC7A 1CH5A 1I3EA 5CN7A 1N9HA 3ZJHA 1MLJA 2DN2B 1A6MA 2B7HB 1BZ0A 4NS2A 2FALA 5E6EA 1WLAA 1COHA 2ZSTA 4M4AA 1XZ5B 3D7OA 4YJJB 3RJNB 2BLHA 3ZJLA 3B75B 3FH9B 1O1JA 2BK9A 1Y8HB 1YGDA 1UVYA 4DWTA 1LIAB 1HACB 1CBLA 1Y4QA 3ZOLA 1CMYB 3WCTA 2O5SX 4BJUA 4PQCA 1NS9A 3SDHA 4PQ6A 1IRCA 3RGKA 1JF4A 1Y2ZA 4NXCA 4WJGA 1XZ7B 1RPSA 5EV5A 1SHRA 1JP9A 4KJTA 2VEBA 4F4OB 1MLHA 1MWCA 3S1IA 5CNBA 1GZXA 1HGAB 1YIEB 1HDSA 1UVNA 1M9PA 1OR6A 1LFTB 1VWTB 1YEOB 2QSSB 3MYMA 1GCVA 3A9MA 4FWZA 3BJ3A 2EF2A 1G09B 2PGHA 3NG6A 3R0GA 1XZ5A 3D7OB 1YGFB 1A4FB 1G08A 1BINA 2DN2A 3MBAA 3PI8A 2MYDA 1Y0AA 1LJWA 1HCOB 5ILEA 4ROMA 1O1MB 1MWDA 1Y09A 4LMSB 2QRWA 2BWHA 4L2MA 2D2MA 5SW7B 1BBBA 3LB2A 1YE2A 1FAWA 2XKGA 3HYUA 2V1FA 2D5ZA 3ORDA 1CP0A 1HACA 1WMUB 5CHRA 4M4AB 1HI1A 1FSLA 1LA6A 2XYKA 1JDOA 1RTXA 4MQHA 1BABA 1MNHA 2PEGA 1Y4PA 4OF9A 2HBSA 3PMCA 2UUMB 1Y7GA 4PNJA 4N6SA 1VXEA 1FHJA 2Z6NB 3GDJA 1KN1A 3HHBA 2DN1B 3A59A 1VXBA 4A8QA 1DXTB 5C6EA 5JDOF 4TYXA 1DLYA 1JZMA 2V1HA 2GKNA 1PHNA 1Y0AB 3MJUB 1SDLB 2BW9M 4FWYA 1C7DB 2MYEA 1A0UB 3PI2A 1YENA 1R1YA 1FSXB 2WY4A 1KR7A 1K0YB 1Y0DB 1T1NA 5MBAA 1CP5A 4N8TA 4H07A 1ECOA 1HJTA 3EU1B 4ODCB 1OFJA 1K1KB 3LB1A 1NZ3A 3NG6B 3DBJA 4O2GA 1Y85A 1GCWB 1G0AA 1EBCA 3ZJSA 1B0BA 3GQPB 1EWAA 3E55A 3CIUB 1HGBB 1A3OA 2ZS0C 4JACA 1YGFA 1LFQA 1NY9A 2VM0A 1XQ5A 2ZWJA 2VEEA 1Y4BA 2WTGA 3GQGB 2D2MD 3O2CB 3SDNA 3K8BB 1CG8B 1RQ4B 1SI4B 2W72C 2ZLXA 2O5BX 1OFKA 1Y83B 2G3HA 2EVPA 1MKOB 3WCUC 3PI3A 1MNOA 1SDKB 3DHTA 1X3KA 1JZLA 4MQKA 2ZS1B 1HRMA 3WR1A 1YOGA 5E6EB 3HENA 2ZSZA 5EUIA 1CG5B 4B02A 3PI4A 2UUNB 1CQ2A 2GKMA 1PBXB 3NMLA 1Y8HA 5KERA 1DWSA 3UHDA 1QXEA 1DO7A 1BABB 3AQ5A 1GJNA 2UULC 3BJ1B 1IRDB 3SZKB 4KMVA 3EDBA 5E83B 3M39A 1HBSB 3WCWA 3GDJB 1TESA 2R80B 4PO5A 2VMLB 3EDAA 1Y0TB 1MLLA 1YOIA 1DUOA 1QSIA 3M3BA 2VLZA 3E5OA 1XCHA 1YMBA 2G10A 1B33A 3R5IA 4G51B 2ZLWA 2MHBB 2ZFOB 3D1KB 1ABSA 1YHRB 1YH9B 2WTHA 3WCWD 3WFTA 3DHRA 1GDJA 2Z8AA 1J7SB 4HRTA 4KN3A 3DUTB 1NWNA 1F99B 2HHDB 2ZS0B 1JEBB 1XZ4A 4UIQA 3WTGB 2R4ZA 4BJAA 3LQDB 1DXVA 2VJTB 1V5HA 2GTLB 1MLKA 108MA 1RQ4A 2ZFOC 1THBA 3ECLA 1YG5B 1R1XA 3QQRA 5AZQA 1F5PA 4WJG1 1BIJB 2QFNA 3VAUA 3G4YA 2HZ3A 3S65B 1Y35A 4L1EB 3BCQB 2QMBA 1CH3A 1Y46B 3V57A 1DLWA 3BJ1A 4F6DA 1HGCB 2BNLA 2DN1A 3GKTA 4A8FA 4A8YA 1MDTA 2KSCA 2M6ZA 1YHUB 4G1VA 1UX8A 1LUEA 2MGAA 1PHNB 4MQGA 1TOXA 1UVKA 1MBIA 2LH5A 4A8OA 5KKKA 2OHAA 4XS0B 2R4XA 3GQRA 4QAUA 1N9XA 1FSXA 2Z6TA 1BUWA 2W31A 3ZJJA 1YEQB 2EKTA 1ALLA 3GK9A 1DXCA 2GNWA 3WCTC 1LFVA 3H57A 1A3NA 3KUOA 3GYSB 4MQJA 4ZVAA 2G0VA 3PI9B 3EOKA 2O5QX 4Q70A 2V8AB 4XXKA 1GLIA 5HU6B 2GTLC 1DO4A 1DXUA 2V1GA 2XKIA 2ZFBA 5CN5A 2HBSB 3CIUA 3KVSA 2ZSPA 2BKMA 1URVA 1WACA 1BZZA 1YVTB 2AUQA 2LH7A 3D1AA 5CN4A 1A6GA 1SHRB 1WVPA 1NIHB 3QM6A 4H0MB 1GCWA 1MYZA 1GH0A 4G1BA 1MBDA 1MTJA 4ESAA 3G4RA 2HZ2A 3UHHA 1YHUC 2H8DA 3NFEA 3P5QB 5EU2A 3O2CA 2ZS1D 2MBWA 1HBAB 2ZT3A 3FH9A 3QJDA 1SPGA 1O1IB 4AVEA 1Y4FA 3BJ3B 3OO5B 1LIAA 1S0HB 1Y2ZB 1LFQB 1Y4VA 2W6XA 3EOKB 2LHBA 1KTPB 3LR7A 2DC3A 4U8UB 1YEVB 1GDIA 4YU4A 1Y85B 1YZIB 3IC0B 3PT8B 2MGIA 4M4BA 5CMVA 4YJJA 1O1LB 1Y8WA 1HDAB 1Y22B 1IBEA 1YMCA 3S66A 1CH2A 1YIHA 2ZFBB 4F6JA 5CNEA 2BV8A 2VHBA 2W6WA 1DTMA 3R5IB 4NI0B 4F68A 1J3YB 1DWRA 3MN0A 1IBEB 1XZ2A 1JL7A 4WCHD 5C6EB 1Y0TA 2DXMB 5CNDA 4F6FA 1YCAA 2EB8A 1AJ9B 1O1PB 1ITHA 2C0KA 4FH6A 1H1XA 3WCUD 3WFXA 2LH3A 2GRFA 1A01A 4XXIA 3PI8B 1O1IA 2VJTA 4H2LA 1MBSA 3ZJIA 2RAOA 2Z6SA 1FDHA 1S0HA 3IC0A 1XG0C 3NFEB 2VYYA 1LFYA 1SPGB 1EYXA 3VREB 2EB9A 2GNVA 1S61A 3V2ZA 4F6GA 3NL7B 1J52A 2AA1B 2QU0B 3UHQA 2NRLA 4HH0A 3ZJPA 1IWHA 5B84A 3PMDA 1YGDB 1YMAA 4MQCA 1F99A 2HHDA 5KDQA 5FVBA 1THBB 3NL7A 1NZ4A 1M6MA 1S69A 2LH1A 1MNIA 5CNCA 1BZ0B 1T1NB 2VJRA 1BZ1B 3AT6A 5JGGA 1YFFA 1NS6B 3WFUA 2NSRA 3A5BA 3VRGA 1J7SA 2YRSB 3WHMA 2OIFA 3DBJB 3MJUA 2UULA 2MGKA 2D5XB 1O1KA 1YEUA 6HBWB 2FAMA 1F63A 1S56A 4GY3A 106MA 4NK1A 104MA 3PELB 2DHBA 2V1IA 2MYBA 1FDHG 5ILRA 1J40B 3VNCA 4X0LA 2HZ1A 111MA 2UUND 4FWXA 4Z8KA 4XS0A 1Y31A 2B7HA 5B13A 2D2MB 2BV8B 5SW7A 4GZGA 3HEPA 1AJHA 1LTWA 1ALLB 2MGCA 1G0BB 1UFJA 2FRKX 5EUIB 4X0LB 3ODQB 2O5LX 3PI9A 1DKEB 1MBAA 4Z8KB 1QPWB 5HY8B 1YVQB 1MYGA 3A5GA 4MQIA 101MA 1HCOA 1DO1A 3GIOA 1ABWB 2UUNA 2HBDA 1DTIA 4ETTA 1BUWB 2UULH 3WCVD 2GRZA 1V4XA 1CG8A 2HCOB 2MGMA 1MKOA 4MAXA 3WCVC 1XDTT 1W92A 1MYFA 5CNGA 1GZXB 1YEVA 5KDQB 4C44A 5CN8A 1GH0B 1HBHB 1O1KB 3ZHWA 1I7YB 2R4YA 1V4WA 1LJWB 1Y4FB 2UULB 3GOUA 2OHBA 1A4FA 1G08B 1X9FC 1MOCA 3DHRB 2O5TX 3MJPB 5CN9A 2G12A 4L7YB 1YH9A 2GTLD 1A00B 4HHBA 3DUTA 2DKAA 2HHEA 2VJHA 1MNJA 5JDOE 2HBCB 1YCBA 1A9WA 2H35B 2O5OX 1CO8A 2W6VA 1MLGA 2Z85A 2DXMA 1CLSB 3O18B 1UVLA 3NUHB 1FLPA 4U8UC 5HAVA 2O5MX 2GLNA 2ZLTA 2G0RA 3EU1A 4ODCA 2D2NA 3HHBB 1DWTA 2UUMA 4KMWA 1HLMA 3OZWA 5HBIA 1Y31B 1GBUB 3WFWA 1OJ6A 2MYAA 3HRWA 1BJEA 1KN1B 5F0BA 3QJCB 1J7YB 1COHB 3MOUA 1MLSA 4ERVA 1Y5JB 2HBDB 3ZJNA 2C7JB 2BLJM 4MQJB 1NGKA 3S66B 107MA 1V75A 2IG3A 4MQIB 1YOHA 2ZSRA 2LH6A 1G9VA 1BZPA 1J7YA 1UX9A 1CH7A 3UHYA 1JPBA 1MYIA 1YE0B 3A0GA 4JYQA 1MLNA 3O89A 1O1LA 1Y8WB 3BOMA 1VXCA 1J3ZA 1GDLA 1Y22A 3HC9A 3CY5B 1B86B 2DKCA 1OBMA 110MA 4ROLB 4FC3B 2QSSA 4LM6B 5D1VA 112MA 3BRPA 2AUOA 2DKDA 4HHBB 4A8WA 1WMUA 1LFTA 4N7NB 4HSXA 2ZLTB 2HBCA 3D17B 1HGCA 4O4TA 4HH1A 2SPLA 4MQKB 2YRSA 1XZVB 1VWTA 2MGFA 3UHWA 2W72B 3M3AA 4U8UD 1RQ3B 2UUMX 1GDKA 1HBAA 2ZT2A 2FRJX 1VXHA 2HHEB 4N7OB 1OR4A 3ED9A 1M9PB 1YEOA 1BZ1A 2O58X 3AT6B 2GDMA 3RJ6A 4F0UB 2ZS1C 1Y5FB 1N9FA 2H8FA 1CH9A 3QJDB 3D1AB 4RMPA 1S5YB 1LH5A 3FS4A 1NIHA 1QSHA 1JBOB 2BMMA 4H0MA 3OVUC 4ESAB 5EE4D 3MWNA 3G4QA 3D1KA 3BOMB 4A8SA 2H8DB 1YHEB 2DN3A 4XDIA 4A8KA 2MYCA 1JWNA 1DXTA 1MGNA 2VLYA 5EQMA 3QM8A 1Y7GB 3UBCA 5MBNA 4G51A 1EW6A 4N7NA 1JP6A 1Y0CA 4ROLA 3UHVA 4MQHB 3WCUA 4ESUA 4FH7A 1C7BA 2NSSA 1MBOA 4VHBA 2R1HB 1RH1A 1TU9A 2X4AA 1NZ5A 1MYJA 1QI8A 3GKVB 2M6ZB 1Y4GA 1NEJB 1O1PA 1MLMA 1UVIA 1Y8IB 3UHCA 3LR9A 3AT5B 3KMFC 7HBIA 2MGDA 2VYZA 3FEWX 1O16A 2D60A 2MGGA 1GBVA 2DN3B 2OH8A 2QMBB 3G4WA 1MODA 1Z8UB 1Y8KA 3DHTB 1CBMA 3S65A 4MPMA 1B8DA 1V4UA 1ECDA 3K8BA 3BCQA 2VJHB 1GVHA 3VHBA 1S5YA 3UHEA 5HLUA 4YU4B 2I88A 1HLBA 1JBOA 3UGZA 3PT8A 4UZVA 1O1NA 1MLOA 3VRFA 4L1EA 2AV3A 2ZS0D 1V4WB 2JHOA 1VXGA 2AURA 3PIAA 3QJEB 1O1OA 5CNFA 3QM7A 1CIKA 1HGBA 4L7YA 3UHUA 1X9FB 4F0TB 1A0UA 3L0FA 5HLQA 3VREA 1K0YA 1Y0DA 2MHBA 2ZFOA 4HRRB 1Y4QB 4MBAA 3E5IA 1ASHA 1HBHA 1XXTA 1NS9B 3S1JA 1HSYA 5AB8A 1XZ7A 2V1KA 4H0BA 3GUQA 5M3SA 4NI1B 1QSIB 1Y5JA 1O1JB 1EYXB 103MA 2ZFOD 2ZLWB 2UULD 4PO5B 1A3NB 3ONZB 1M6CA 1Y45B 1Y8KB 3ZJMA 1J40A 1G9VB 1UT0A 1GBUA 3UHXA 2FRIX 1LH2A 5HU6A 1N9IA 2C7KA 2R80A 1V75B 3WCVA 4TMAB 2PEGB 1COLA 1C7BB 3OO4A 1Y4RA 1QPWA 1HABA 3ASEA 1RQAB 3HF4B 4SDHA 1HBIA 1XY0B 1UFPA 4IROB 3QZZA 1Y0WB 1Y4VB 3UH6A 1JY7B 1OUUA 4MU5A 3UH7A 4NI0A 4M4BB 2D5ZB 1G09A 2PGHB 1XQ5B 2VJRB 4O4ZA 5F2AA 1LFLB 3UHZA 1HHOB 4MQGB 1YEUB 5EYJA 3QM5A 1MBCA 3G4UA 3OZVA 1EBTA 2GRHA 5IKSA 1SPEA 3FS4B 2ZSSA 1MYTA 1U7SA 1UVXA 3GOUB 4LPIA 1MNKA 1JL6A 102MA 1K1KA 4YU3A 1MCYA 2HBFA 3OGBA 3E4NA 3AQ6A 1JEBA 1A00A 1XZ4B 1RQ3A 1RTEA 4ETUA 1NZ2A 2GL3A 3AG0A 3MJPA 3W4UA 3BRPB 4ZIZA 5FVBM 2EKUA 1CH4A 4F0UA 1HA7B 3IXFA 3K3UA 3ZOMA 2C7LB 1LH3A 2QFKA 1A3OB 2D2MC 3OK5A 3ODQA 1BZRA 2G0ZA 2IN4A 1A0ZB 3AT5A 1JY7A 1OUUB 1HBBA 1S6AA 5HY8A 1HV4A 1YVTA 5HLXA 1NEJA 1IT3A 1V07A 1Y0WA 1C7DA 1Y7DA 1Y01B 2D6CA 2AA1A 2QU0A 1ECNA 1NXFA 2MGEA 5AQDM 1UVJA 2C7JA 4DC8A 2HBEA 2G0XA 2HCOA 1EMYA 5JDOD 3KVSB 1SWMA 1LFYB 2R1HA 2VYWA 5EYSA 3WI8A 2D2ND 1DXUB 4Q70B 3GKVA 3WCUB 6HBIA 5JOMA 4ERTA 3BJ2A 1HHSA 1X9FD 3GYSA 3PELA 3MYNA 3V58B 2J96A 1CG5A 1ABYB 1LFVB 3S48C 1Y4GB 4PQBA 3H58A 3ECXA 1S5XA 1MOBA 4MXKA 3BJ2B 4O35A 3G4VA 4N6SB 6HBWA 3VRGB 1BBBB 1PBXA 2ZS1A 1R1XB 3ECZA 3AQ8A 1Y7DB 4F6BA 1LA6B 2HBFB 2VLXA 1Y09B 2YSKA 2ZT0A 1YDZA 3OJ1A 3VRFB 1MDNA 3ARLA 2C7LA 3LHBA 4HRRA 3PIAB 3QJEA 2R50A 4N7OA 3MVCA 3MKBB 1QSHB 1XXTB 3L0FB 4YU3B 4GXEB 4RMPB 1Y7ZB 3ZJRA 4NZIA 4ILZA 3ZTAA 3TLDA 4MXLA 4AE0A 1DO3A 1G0AB 3W4UB 3QZXA 3D17A 3PI1A 3G46A 3WCPB 1H97A 1R1YB 1S5XB 1HBSA 1UC3A 1B86A 1JW8A 1YE0A 1VXDA 2ZSXA 1URYA 1U7RA 1ABYA 3QJBB 1AJ9A 1XZ2B 4DWUA 2JL9A 1LHTA 4C0NA 5CHQA 1MTKA 1QXDA 1YIHB 3WCVB 1Y45A 2OH9A 2MB5A 2ZLUB 1BVDA 3UHNA 1LFZB 4H2LB 5E29B 1BZ6A 2HBEB 3B75A 1MTIA 2HHBA 4IT8A 4IROA 3WCWC 1VXFA 1LH6A 1HDBA 1GBVB 1UIWA 1SDKA 3QMAA 3OO4B 5AZRA 3HXNA 3QQQA 3G53A 2H35A 1CPCA 2MGHA 3D4XA 5KERB 5D5RA 2RI4A 4OODA 3UI0A 1MLQA 1KD2B 1J41A 1NAZA 1QXEB 3WCTD 3ONZA 1XZUB 3WCPA 3GQRB 4F6IA 1UVMA 1BIJA 5B85A 1AJGA 2ZSYA 3HYUB 1Y83A 1NPFA 4A8MP 3WR1B 1SI4A 1YFFB 1HA7A 3KUNA 3HRWB 1KTPA 1FAWB 4MQCB 1HI8A 5EOHA 2WCQA 1CLSA 3O18A 2CMMA 4AVDA 2V1JA
chains in the Genus database with same CATH topology
1VXAA 3WHMB 5ILMA 1YDZB 1A6KA 2D5XA 3ARKA 1A0ZA 1V4UB 4ZVBA 3NMMB 1YHUD 1HBRA 3P5QA 1MZ0A 5ILPA 1Y5KA 5JGGB 1SDLA 1XYEB 1IDRA 1MBNA 2ZS0A 2SPMA 1DXVB 1DUKA 3UHGA 2G14A 2MGBA 1O1NB 2ZLVB 4FC3A 1J41B 3AQ9A 1MLUA 1MOHA 3LQDA 2Z6NA 3G52A 2QLSA 2W72A 3A0GB 1FHJB 3K9ZA 1KD2A 1CO9A 3A59B 1J3ZB 2BLIA 1G0BA 3D4XB 1ABWA 3IA3B 1IOPA 3KMFA 3HF4A 1FCSA 1Y7CB 1AZIA 1HABB 1HBBB 1FN3B 1RQAA 1F65A 4TWVA 2AV0A 3TM9A 1C40A 3BA2A 1YZIA 1VREA 2QSPB 1YEQA 1DXDA 4F69A 2ZLVA 1CH1A 4NXAA 3UHBA 1QI8B 3LB3A 2LH2A 1HDAA 2ZLXB 1Y4RB 1HDSB 2QLSB 2AUPA 3UHTA 1GCVB 1NS6A 2G11A 1HBGA 1Y4BB 3GQGA 1NWIA 5C6YA 3IC2A 1MYMA 1PMBA 2W6VB 1Y5KB 2ZT1A 1LHSA 5EETA 1VRFA 1YHUA 2ZT4A 3DR9A 5EE4C 3ARJA 2G0SA 3NMMA 4F4OA 3UH3A 4ROMB 3ZJOA 3WCTB 1Q1FA 2R4WA 3IC2B 3PT7B 1C7CA 1MLRA 109MA 3UGYA 2MGJA 3HEOA 3MKBA 3UBVA 1YIEA 3GQPA 3PT7A 1IWHB 1V4XB 1MYHA 1HGAA 4HBIA 1YHRA 1XY0A 2NX0A 1O1OB 4N7PB 1RPSB 2VRYA 1X46A 1YVQA 1Y8IA 4HRTB 5E83A 3UHRA 1XZVA 1IT2A 1MOAA 1ECAA 1Y7CA 3HXNB 1JF3A 1OUTA 3QJCA 1XZUA 3V2VA 2D60B 1HHOA 1V9QA 3AQ7A 1LH1A 1JP8A 1BZZB 3CY5A 2RI4B 1J3FA 1F5OA 1CQXA 2HHBB 1YENB 2ZLUA 1I3DA 4MBNA 3GLNA 5E29A 1MWBA 1D8UA 4NI1A 1HV4B 4HSWA 2SPNA 2SPOA 2NRMA 1O1MA 4U8UA 5CN6A 1HDBB 1JZKA 3UHIA 1L2KA 1LH7A 1Y35B 2D2NB 1A6NA 3ZJQA 1J3YA 3OO5A 1X9FA 1J7WB 1DM1A 1Y0CB 1Y4PB 3O7NA 4N7PA 2EVKA 2GTLA 4O1TA 3LB4A 2H8FB 1XYEA 1NQPA 2W6YA 1CIOA 1RVWA 5JDOC 2XKHA 105MA 2D2NC 3ZH0A 3WTGA 1Y46A 1NQPB 3QM9A 1Y7ZA 2RAOB 1RVWB 4N8TB 1C7CB 1YG5A 1Y5FA 3U3EA 1A9WE 4TWUA 1BVCA 1HBRB 2E2YA 1LFLA 1GLIB 1DKEA 2FRFA 2ZSOA 4B4YA 1MLFA 4B3WA 1C40B 1NPGA 1CPWA 1CMYA 2HBGA 1UMOA 3WCWB 2V1EA 3A2GA 4UURA 3OZUA 3UHKA 1OUTB 1RSEA 1J7WA 2MGLA 1KFRA 3UH5A 1A01B 2ZSNA 2ZSQA 3M38A 2QSPA 1FN3A 3UHSA 1UIWB 1QXDB 3A5AA 3QJBA 4NK2A 1YE2B 1YHEA 1IRDA 2OLPA 3SZKA 1VHBA 2DHBB 1LFZA 3TM3A 4DC7A 1CH5A 1I3EA 5CN7A 1N9HA 3ZJHA 1MLJA 2DN2B 1A6MA 2B7HB 1BZ0A 4NS2A 2FALA 5E6EA 1WLAA 1COHA 2ZSTA 4M4AA 1XZ5B 3D7OA 3RJNB 2BLHA 3ZJLA 3B75B 3FH9B 1O1JA 2BK9A 1Y8HB 1YGDA 1UVYA 4DWTA 1HACB 1CBLA 1Y4QA 3ZOLA 1CMYB 3WCTA 2O5SX 4PQCA 1NS9A 3SDHA 4PQ6A 1IRCA 3RGKA 1JF4A 1Y2ZA 4NXCA 4WJGA 1XZ7B 1RPSA 5EV5A 1SHRA 1JP9A 4KJTA 2VEBA 4F4OB 1MLHA 1MWCA 3S1IA 5CNBA 1GZXA 1HGAB 1YIEB 1HDSA 1M9PA 1OR6A 1LFTB 1VWTB 1YEOB 2QSSB 3MYMA 1GCVA 3A9MA 4FWZA 3BJ3A 2EF2A 1G09B 2PGHA 3NG6A 3R0GA 1XZ5A 3D7OB 1YGFB 1A4FB 1G08A 1BINA 2DN2A 3MBAA 3PI8A 2MYDA 1Y0AA 1LJWA 1HCOB 5ILEA 4ROMA 1O1MB 1MWDA 1Y09A 2QRWA 2BWHA 4L2MA 2D2MA 5SW7B 1BBBA 3LB2A 1YE2A 1FAWA 2XKGA 3HYUA 2V1FA 2D5ZA 3ORDA 1CP0A 1HACA 1WMUB 5CHRA 4M4AB 1FSLA 1LA6A 2XYKA 1JDOA 1RTXA 4MQHA 1BABA 1MNHA 2PEGA 1Y4PA 4OF9A 2HBSA 1Y7GA 4PNJA 1VXEA 1FHJA 2Z6NB 3GDJA 3HHBA 2DN1B 3A59A 1VXBA 1DXTB 5C6EA 5JDOF 4TYXA 1DLYA 1JZMA 2V1HA 2GKNA 1Y0AB 3MJUB 1SDLB 2BW9M 4FWYA 1C7DB 2MYEA 1A0UB 3PI2A 1YENA 1R1YA 1FSXB 2WY4A 1KR7A 1K0YB 1Y0DB 1T1NA 5MBAA 1CP5A 4N8TA 4H07A 1ECOA 1HJTA 3EU1B 4ODCB 1OFJA 1K1KB 3LB1A 1NZ3A 3NG6B 4O2GA 1Y85A 1GCWB 1G0AA 1EBCA 3ZJSA 1B0BA 3GQPB 1EWAA 3E55A 3CIUB 1HGBB 1A3OA 2ZS0C 4JACA 1YGFA 1LFQA 2VM0A 1XQ5A 2ZWJA 2VEEA 1Y4BA 2WTGA 3GQGB 2D2MD 3SDNA 3K8BB 1CG8B 1RQ4B 1SI4B 2W72C 2ZLXA 2O5BX 1OFKA 1Y83B 2G3HA 2EVPA 1MKOB 3WCUC 3PI3A 1MNOA 1SDKB 3DHTA 1X3KA 1JZLA 4MQKA 2ZS1B 1HRMA 3WR1A 1YOGA 5E6EB 3HENA 2ZSZA 5EUIA 1CG5B 3PI4A 1CQ2A 2GKMA 1PBXB 3NMLA 1Y8HA 5KERA 1DWSA 3UHDA 1QXEA 1DO7A 1BABB 3AQ5A 1GJNA 3BJ1B 1IRDB 3SZKB 4KMVA 3EDBA 5E83B 3M39A 1HBSB 3WCWA 3GDJB 1TESA 2R80B 3EDAA 1Y0TB 1MLLA 1YOIA 1DUOA 1QSIA 3M3BA 2VLZA 3E5OA 1XCHA 1YMBA 2G10A 3R5IA 4G51B 2ZLWA 2MHBB 2ZFOB 3D1KB 1ABSA 1YHRB 1YH9B 2WTHA 3WCWD 3WFTA 3DHRA 1GDJA 2Z8AA 1J7SB 4HRTA 4KN3A 3DUTB 1NWNA 2HHDB 2ZS0B 1JEBB 1XZ4A 4UIQA 3WTGB 2R4ZA 4BJAA 3LQDB 1DXVA 1V5HA 2GTLB 1MLKA 108MA 1RQ4A 2ZFOC 1THBA 3ECLA 1YG5B 1R1XA 3QQRA 5AZQA 1F5PA 4WJG1 1BIJB 2QFNA 3VAUA 3G4YA 2HZ3A 3S65B 1Y35A 3BCQB 2QMBA 1CH3A 1Y46B 1DLWA 3BJ1A 4F6DA 1HGCB 2BNLA 2DN1A 3GKTA 2KSCA 2M6ZA 1YHUB 4G1VA 1UX8A 1LUEA 2MGAA 4MQGA 1MBIA 2LH5A 5KKKA 2OHAA 4XS0B 2R4XA 3GQRA 4QAUA 1N9XA 1FSXA 2Z6TA 1BUWA 2W31A 3ZJJA 1YEQB 2EKTA 3GK9A 1DXCA 2GNWA 3WCTC 1LFVA 3H57A 1A3NA 3KUOA 3GYSB 4MQJA 4ZVAA 2G0VA 3PI9B 3EOKA 2O5QX 1GLIA 5HU6B 2GTLC 1DO4A 1DXUA 2V1GA 2XKIA 2ZFBA 5CN5A 2HBSB 3CIUA 2ZSPA 2BKMA 1URVA 1BZZA 1YVTB 2AUQA 2LH7A 3D1AA 5CN4A 1A6GA 1SHRB 1WVPA 1NIHB 3QM6A 1GCWA 1MYZA 4G1BA 1MBDA 1MTJA 4ESAA 3G4RA 2HZ2A 3UHHA 1YHUC 2H8DA 3NFEA 3P5QB 5EU2A 2ZS1D 2MBWA 1HBAB 2ZT3A 3FH9A 3QJDA 1SPGA 1O1IB 4AVEA 1Y4FA 3BJ3B 3OO5B 1S0HB 1Y2ZB 1LFQB 1Y4VA 2W6XA 3EOKB 2LHBA 3LR7A 2DC3A 4U8UB 1YEVB 1GDIA 4YU4A 1Y85B 1YZIB 3IC0B 3PT8B 2MGIA 4M4BA 5CMVA 1O1LB 1Y8WA 1HDAB 1Y22B 1IBEA 1YMCA 3S66A 1CH2A 1YIHA 2ZFBB 4F6JA 5CNEA 2VHBA 2W6WA 1DTMA 3R5IB 4NI0B 4F68A 1J3YB 1DWRA 3MN0A 1IBEB 1XZ2A 1JL7A 4WCHD 5C6EB 1Y0TA 2DXMB 5CNDA 4F6FA 1YCAA 2EB8A 1AJ9B 1O1PB 1ITHA 2C0KA 4FH6A 1H1XA 3WCUD 3WFXA 2LH3A 2GRFA 1A01A 3PI8B 1O1IA 4H2LA 1MBSA 3ZJIA 2RAOA 2Z6SA 1FDHA 1S0HA 3IC0A 3NFEB 2VYYA 1LFYA 1SPGB 3VREB 2EB9A 2GNVA 1S61A 3V2ZA 4F6GA 3NL7B 1J52A 2AA1B 2QU0B 3UHQA 2NRLA 3ZJPA 1IWHA 5B84A 1YGDB 1YMAA 4MQCA 2HHDA 5KDQA 1THBB 3NL7A 1NZ4A 1M6MA 1S69A 2LH1A 1MNIA 5CNCA 1BZ0B 1T1NB 1BZ1B 3AT6A 5JGGA 1YFFA 1NS6B 3WFUA 2NSRA 3A5BA 3VRGA 1J7SA 2YRSB 3WHMA 2OIFA 3MJUA 2MGKA 2D5XB 1O1KA 1YEUA 6HBWB 2FAMA 1F63A 1S56A 106MA 4NK1A 104MA 3PELB 2DHBA 2V1IA 2MYBA 1FDHG 5ILRA 1J40B 4X0LA 2HZ1A 111MA 4FWXA 4XS0A 1Y31A 2B7HA 2D2MB 5SW7A 4GZGA 3HEPA 1AJHA 1LTWA 2MGCA 1G0BB 1UFJA 2FRKX 5EUIB 4X0LB 3ODQB 2O5LX 3PI9A 1DKEB 1MBAA 1QPWB 5HY8B 1YVQB 1MYGA 3A5GA 4MQIA 101MA 1HCOA 1DO1A 1ABWB 2HBDA 1DTIA 1BUWB 3WCVD 2GRZA 1V4XA 1CG8A 2HCOB 2MGMA 1MKOA 4MAXA 3WCVC 1W92A 1MYFA 5CNGA 1GZXB 1YEVA 5KDQB 4C44A 5CN8A 1HBHB 1O1KB 3ZHWA 2R4YA 1V4WA 1LJWB 1Y4FB 3GOUA 2OHBA 1A4FA 1G08B 1X9FC 1MOCA 3DHRB 2O5TX 3MJPB 5CN9A 2G12A 4L7YB 1YH9A 2GTLD 1A00B 4HHBA 3DUTA 2HHEA 1MNJA 5JDOE 2HBCB 1YCBA 1A9WA 2H35B 2O5OX 1CO8A 2W6VA 1MLGA 2Z85A 2DXMA 1CLSB 1FLPA 4U8UC 5HAVA 2O5MX 2GLNA 2ZLTA 2G0RA 3EU1A 4ODCA 2D2NA 3HHBB 1DWTA 4KMWA 1HLMA 3OZWA 5HBIA 1Y31B 1GBUB 3WFWA 1OJ6A 2MYAA 3HRWA 1BJEA 5F0BA 3QJCB 1J7YB 1COHB 3MOUA 1MLSA 1Y5JB 2HBDB 3ZJNA 2BLJM 4MQJB 1NGKA 3S66B 107MA 1V75A 2IG3A 4MQIB 1YOHA 2ZSRA 2LH6A 1G9VA 1BZPA 1J7YA 1UX9A 1CH7A 3UHYA 1JPBA 1MYIA 1YE0B 3A0GA 4JYQA 1MLNA 3O89A 1O1LA 1Y8WB 3BOMA 1VXCA 1J3ZA 1GDLA 1Y22A 3HC9A 3CY5B 1B86B 1OBMA 110MA 4ROLB 4FC3B 2QSSA 5D1VA 112MA 2AUOA 4HHBB 1WMUA 1LFTA 4N7NB 4HSXA 2ZLTB 2HBCA 3D17B 1HGCA 4O4TA 2SPLA 4MQKB 2YRSA 1XZVB 1VWTA 2MGFA 3UHWA 2W72B 3M3AA 4U8UD 1RQ3B 1GDKA 1HBAA 2ZT2A 2FRJX 1VXHA 2HHEB 4N7OB 1OR4A 3ED9A 1M9PB 1YEOA 1BZ1A 2O58X 3AT6B 2GDMA 3RJ6A 2ZS1C 1Y5FB 1N9FA 2H8FA 1CH9A 3QJDB 3D1AB 1S5YB 1LH5A 3FS4A 1NIHA 1QSHA 2BMMA 3OVUC 4ESAB 5EE4D 3G4QA 3D1KA 3BOMB 2H8DB 1YHEB 2DN3A 4XDIA 2MYCA 1JWNA 1DXTA 1MGNA 2VLYA 5EQMA 3QM8A 1Y7GB 3UBCA 5MBNA 4G51A 1EW6A 1JP6A 4N7NA 1Y0CA 4ROLA 3UHVA 4MQHB 3WCUA 4FH7A 1C7BA 2NSSA 1MBOA 4VHBA 2R1HB 1TU9A 1NZ5A 1MYJA 1QI8A 3GKVB 2M6ZB 1Y4GA 1NEJB 1O1PA 1MLMA 1Y8IB 3UHCA 3LR9A 3AT5B 3KMFC 7HBIA 2MGDA 2VYZA 1O16A 2D60A 2MGGA 1GBVA 2DN3B 2OH8A 2QMBB 3G4WA 1MODA 1Z8UB 1Y8KA 3DHTB 1CBMA 3S65A 4MPMA 1V4UA 1ECDA 3K8BA 3BCQA 1GVHA 3VHBA 1S5YA 3UHEA 5HLUA 4YU4B 1HLBA 3UGZA 3PT8A 4UZVA 1O1NA 1MLOA 3VRFA 2AV3A 2ZS0D 1V4WB 2JHOA 1VXGA 2AURA 3PIAA 3QJEB 1O1OA 5CNFA 3QM7A 1CIKA 1HGBA 4L7YA 3UHUA 1X9FB 1A0UA 5HLQA 3VREA 1K0YA 1Y0DA 2MHBA 2ZFOA 4HRRB 1Y4QB 4MBAA 3E5IA 1ASHA 1HBHA 1XXTA 1NS9B 3S1JA 1HSYA 5AB8A 1XZ7A 2V1KA 4H0BA 5M3SA 4NI1B 1QSIB 1Y5JA 1O1JB 103MA 2ZFOD 2ZLWB 1A3NB 3ONZB 1M6CA 1Y45B 1Y8KB 3ZJMA 1J40A 1G9VB 1UT0A 1GBUA 3UHXA 2FRIX 1LH2A 5HU6A 1N9IA 2R80A 1V75B 3WCVA 2PEGB 1C7BB 3OO4A 1Y4RA 1QPWA 1HABA 3ASEA 1RQAB 3HF4B 4SDHA 1HBIA 1XY0B 1UFPA 4IROB 3QZZA 1Y0WB 1Y4VB 3UH6A 1JY7B 1OUUA 4MU5A 3UH7A 4NI0A 4M4BB 2D5ZB 1G09A 2PGHB 1XQ5B 4O4ZA 5F2AA 1LFLB 3UHZA 1HHOB 4MQGB 1YEUB 5EYJA 3QM5A 1MBCA 3G4UA 3OZVA 1EBTA 2GRHA 5IKSA 1SPEA 3FS4B 2ZSSA 1MYTA 1U7SA 1UVXA 3GOUB 4LPIA 1MNKA 1JL6A 102MA 1K1KA 4YU3A 1MCYA 2HBFA 3OGBA 3E4NA 3AQ6A 1JEBA 1A00A 1XZ4B 1RQ3A 1RTEA 1NZ2A 2GL3A 3AG0A 3MJPA 3W4UA 2EKUA 1CH4A 3IXFA 3K3UA 3ZOMA 1LH3A 2QFKA 1A3OB 2D2MC 3OK5A 3ODQA 1BZRA 2G0ZA 2IN4A 1A0ZB 3AT5A 1JY7A 1OUUB 1HBBA 1S6AA 5HY8A 1HV4A 1YVTA 5HLXA 1NEJA 1IT3A 1V07A 1Y0WA 1C7DA 1Y7DA 1Y01B 2D6CA 2AA1A 2QU0A 1ECNA 1NXFA 2MGEA 4DC8A 2HBEA 2G0XA 2HCOA 1EMYA 5JDOD 1SWMA 1LFYB 2R1HA 2VYWA 5EYSA 3WI8A 2D2ND 1DXUB 3GKVA 3WCUB 6HBIA 5JOMA 3BJ2A 1X9FD 3GYSA 3PELA 3MYNA 1CG5A 1ABYB 1LFVB 3S48C 1Y4GB 4PQBA 3H58A 3ECXA 1S5XA 1MOBA 4MXKA 3BJ2B 4O35A 3G4VA 6HBWA 3VRGB 1BBBB 1PBXA 2ZS1A 1R1XB 3ECZA 3AQ8A 1Y7DB 4F6BA 1LA6B 2HBFB 2VLXA 1Y09B 2ZT0A 1YDZA 3OJ1A 3VRFB 1MDNA 3ARLA 3LHBA 4HRRA 3PIAB 3QJEA 2R50A 4N7OA 3MVCA 3MKBB 1QSHB 1XXTB 4YU3B 1Y7ZB 3ZJRA 4NZIA 4ILZA 3TLDA 4MXLA 1DO3A 1G0AB 3W4UB 3QZXA 3D17A 3PI1A 3G46A 3WCPB 1H97A 1R1YB 1S5XB 1HBSA 1UC3A 1B86A 1JW8A 1YE0A 1VXDA 2ZSXA 1URYA 1U7RA 1ABYA 3QJBB 1AJ9A 1XZ2B 4DWUA 1LHTA 4C0NA 5CHQA 1MTKA 1QXDA 1YIHB 3WCVB 1Y45A 2OH9A 2MB5A 2ZLUB 1BVDA 3UHNA 1LFZB 4H2LB 5E29B 1BZ6A 2HBEB 3B75A 1MTIA 2HHBA 4IT8A 4IROA 3WCWC 1VXFA 1LH6A 1HDBA 1GBVB 1UIWA 1SDKA 3QMAA 3OO4B 5AZRA 3HXNA 3QQQA 3G53A 2H35A 2MGHA 3D4XA 5KERB 5D5RA 2RI4A 4OODA 3UI0A 1MLQA 1KD2B 1J41A 1NAZA 1QXEB 3WCTD 3ONZA 1XZUB 3WCPA 3GQRB 4F6IA 1BIJA 5B85A 1AJGA 2ZSYA 3HYUB 1Y83A 1NPFA 3WR1B 1SI4A 1YFFB 3KUNA 3HRWB 1FAWB 4MQCB 5EOHA 1CLSA 2CMMA 4AVDA 2V1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VXA A;  3WHM B;  5ILM A;  1YDZ B;  1A6K A;  2D5X A;  3ARK A;  1A0Z A;  1V4U B;  4ZVB A;  3NMM B;  1YHU D;  1HBR A;  3P5Q A;  1MZ0 A;  5ILP A;  1Y5K A;  5JGG B;  1SDL A;  1XYE B;  1IDR A;  1MBN A;  2ZS0 A;  2SPM A;  1DXV B;  1DUK A;  3UHG A;  2G14 A;  2MGB A;  1O1N B;  2ZLV B;  4FC3 A;  1J41 B;  3AQ9 A;  1MLU A;  1MOH A;  3LQD A;  2Z6N A;  3G52 A;  2QLS A;  2W72 A;  3A0G B;  1FHJ B;  3K9Z A;  1KD2 A;  1CO9 A;  3A59 B;  1J3Z B;  2BLI A;  1G0B A;  3D4X B;  1ABW A;  3IA3 B;  1IOP A;  3KMF A;  3HF4 A;  1FCS A;  1Y7C B;  1AZI A;  1HAB B;  1HBB B;  1FN3 B;  1RQA A;  1F65 A;  4TWV A;  2AV0 A;  3TM9 A;  1C40 A;  3BA2 A;  1YZI A;  1VRE A;  2QSP B;  1YEQ A;  1DXD A;  4F69 A;  2ZLV A;  1CH1 A;  4NXA A;  3UHB A;  1QI8 B;  3LB3 A;  2LH2 A;  1HDA A;  2ZLX B;  1Y4R B;  1HDS B;  2QLS B;  2AUP A;  3UHT A;  1GCV B;  1NS6 A;  2G11 A;  1HBG A;  1Y4B B;  3GQG A;  1NWI A;  5C6Y A;  3IC2 A;  1MYM A;  1PMB A;  2W6V B;  1Y5K B;  2ZT1 A;  1LHS A;  5EET A;  1VRF A;  1YHU A;  2ZT4 A;  3DR9 A;  5EE4 C;  3ARJ A;  2G0S A;  3NMM A;  4F4O A;  3UH3 A;  4ROM B;  3ZJO A;  3WCT B;  1Q1F A;  2R4W A;  3IC2 B;  3PT7 B;  1C7C A;  1MLR A;  109M A;  3UGY A;  2MGJ A;  3HEO A;  3MKB A;  3UBV A;  1YIE A;  3GQP A;  3PT7 A;  1IWH B;  1V4X B;  1MYH A;  1HGA A;  4HBI A;  1YHR A;  1XY0 A;  2NX0 A;  1O1O B;  4N7P B;  1RPS B;  2VRY A;  1X46 A;  1YVQ A;  1Y8I A;  4HRT B;  5E83 A;  3UHR A;  1XZV A;  1IT2 A;  1MOA A;  1ECA A;  1Y7C A;  3HXN B;  1JF3 A;  1OUT A;  3QJC A;  1XZU A;  3V2V A;  2D60 B;  1HHO A;  1V9Q A;  3AQ7 A;  1LH1 A;  1JP8 A;  1BZZ B;  3CY5 A;  2RI4 B;  1J3F A;  1F5O A;  1CQX A;  2HHB B;  1YEN B;  2ZLU A;  1I3D A;  4MBN A;  3GLN A;  5E29 A;  1MWB A;  1D8U A;  4NI1 A;  1HV4 B;  4HSW A;  2SPN A;  2SPO A;  2NRM A;  1O1M A;  4U8U A;  5CN6 A;  1HDB B;  1JZK A;  3UHI A;  1L2K A;  1LH7 A;  1Y35 B;  2D2N B;  1A6N A;  3ZJQ A;  1J3Y A;  3OO5 A;  1X9F A;  1J7W B;  1DM1 A;  1Y0C B;  1Y4P B;  3O7N A;  4N7P A;  2EVK A;  2GTL A;  4O1T A;  3LB4 A;  2H8F B;  1XYE A;  1NQP A;  2W6Y A;  1CIO A;  1RVW A;  5JDO C;  2XKH A;  105M A;  2D2N C;  3ZH0 A;  3WTG A;  1Y46 A;  1NQP B;  3QM9 A;  1Y7Z A;  2RAO B;  1RVW B;  4N8T B;  1C7C B;  1YG5 A;  1Y5F A;  3U3E A;  1A9W E;  4TWU A;  1BVC A;  1HBR B;  2E2Y A;  1LFL A;  1GLI B;  1DKE A;  2FRF A;  2ZSO A;  4B4Y A;  1MLF A;  4B3W A;  1C40 B;  1NPG A;  1CPW A;  1CMY A;  2HBG A;  1UMO A;  3WCW B;  2V1E A;  3A2G A;  4UUR A;  3OZU A;  3UHK A;  1OUT B;  1RSE A;  1J7W A;  2MGL A;  1KFR A;  3UH5 A;  1A01 B;  2ZSN A;  2ZSQ A;  3M38 A;  2QSP A;  1FN3 A;  3UHS A;  1UIW B;  1QXD B;  3A5A A;  3QJB A;  4NK2 A;  1YE2 B;  1YHE A;  1IRD A;  2OLP A;  3SZK A;  1VHB A;  2DHB B;  1LFZ A;  3TM3 A;  4DC7 A;  1CH5 A;  1I3E A;  5CN7 A;  1N9H A;  3ZJH A;  1MLJ A;  2DN2 B;  1A6M A;  2B7H B;  1BZ0 A;  4NS2 A;  2FAL A;  5E6E A;  1WLA A;  1COH A;  2ZST A;  4M4A A;  1XZ5 B;  3D7O A;  3RJN B;  2BLH A;  3ZJL A;  3B75 B;  3FH9 B;  1O1J A;  2BK9 A;  1Y8H B;  1YGD A;  1UVY A;  4DWT A;  1HAC B;  1CBL A;  1Y4Q A;  3ZOL A;  1CMY B;  3WCT A;  2O5S X;  4PQC A;  1NS9 A;  3SDH A;  4PQ6 A;  1IRC A;  3RGK A;  1JF4 A;  1Y2Z A;  4NXC A;  4WJG A;  1XZ7 B;  1RPS A;  5EV5 A;  1SHR A;  1JP9 A;  4KJT A;  2VEB A;  4F4O B;  1MLH A;  1MWC A;  3S1I A;  5CNB A;  1GZX A;  1HGA B;  1YIE B;  1HDS A;  1M9P A;  1OR6 A;  1LFT B;  1VWT B;  1YEO B;  2QSS B;  3MYM A;  1GCV A;  3A9M A;  4FWZ A;  3BJ3 A;  2EF2 A;  1G09 B;  2PGH A;  3NG6 A;  3R0G A;  1XZ5 A;  3D7O B;  1YGF B;  1A4F B;  1G08 A;  1BIN A;  2DN2 A;  3MBA A;  3PI8 A;  2MYD A;  1Y0A A;  1LJW A;  1HCO B;  5ILE A;  4ROM A;  1O1M B;  1MWD A;  1Y09 A;  2QRW A;  2BWH A;  4L2M A;  2D2M A;  5SW7 B;  1BBB A;  3LB2 A;  1YE2 A;  1FAW A;  2XKG A;  3HYU A;  2V1F A;  2D5Z A;  3ORD A;  1CP0 A;  1HAC A;  1WMU B;  5CHR A;  4M4A B;  1FSL A;  1LA6 A;  2XYK A;  1JDO A;  1RTX A;  4MQH A;  1BAB A;  1MNH A;  2PEG A;  1Y4P A;  4OF9 A;  2HBS A;  1Y7G A;  4PNJ A;  1VXE A;  1FHJ A;  2Z6N B;  3GDJ A;  3HHB A;  2DN1 B;  3A59 A;  1VXB A;  1DXT B;  5C6E A;  5JDO F;  4TYX A;  1DLY A;  1JZM A;  2V1H A;  2GKN A;  1Y0A B;  3MJU B;  1SDL B;  2BW9 M;  4FWY A;  1C7D B;  2MYE A;  1A0U B;  3PI2 A;  1YEN A;  1R1Y A;  1FSX B;  2WY4 A;  1KR7 A;  1K0Y B;  1Y0D B;  1T1N A;  5MBA A;  1CP5 A;  4N8T A;  4H07 A;  1ECO A;  1HJT A;  3EU1 B;  4ODC B;  1OFJ A;  1K1K B;  3LB1 A;  1NZ3 A;  3NG6 B;  4O2G A;  1Y85 A;  1GCW B;  1G0A A;  1EBC A;  3ZJS A;  1B0B A;  3GQP B;  1EWA A;  3E55 A;  3CIU B;  1HGB B;  1A3O A;  2ZS0 C;  4JAC A;  1YGF A;  1LFQ A;  2VM0 A;  1XQ5 A;  2ZWJ A;  2VEE A;  1Y4B A;  2WTG A;  3GQG B;  2D2M D;  3SDN A;  3K8B B;  1CG8 B;  1RQ4 B;  1SI4 B;  2W72 C;  2ZLX A;  2O5B X;  1OFK A;  1Y83 B;  2G3H A;  2EVP A;  1MKO B;  3WCU C;  3PI3 A;  1MNO A;  1SDK B;  3DHT A;  1X3K A;  1JZL A;  4MQK A;  2ZS1 B;  1HRM A;  3WR1 A;  1YOG A;  5E6E B;  3HEN A;  2ZSZ A;  5EUI A;  1CG5 B;  3PI4 A;  1CQ2 A;  2GKM A;  1PBX B;  3NML A;  1Y8H A;  5KER A;  1DWS A;  3UHD A;  1QXE A;  1DO7 A;  1BAB B;  3AQ5 A;  1GJN A;  3BJ1 B;  1IRD B;  3SZK B;  4KMV A;  3EDB A;  5E83 B;  3M39 A;  1HBS B;  3WCW A;  3GDJ B;  1TES A;  2R80 B;  3EDA A;  1Y0T B;  1MLL A;  1YOI A;  1DUO A;  1QSI A;  3M3B A;  2VLZ A;  3E5O A;  1XCH A;  1YMB A;  2G10 A;  3R5I A;  4G51 B;  2ZLW A;  2MHB B;  2ZFO B;  3D1K B;  1ABS A;  1YHR B;  1YH9 B;  2WTH A;  3WCW D;  3WFT A;  3DHR A;  1GDJ A;  2Z8A A;  1J7S B;  4HRT A;  4KN3 A;  3DUT B;  1NWN A;  2HHD B;  2ZS0 B;  1JEB B;  1XZ4 A;  4UIQ A;  3WTG B;  2R4Z A;  4BJA A;  3LQD B;  1DXV A;  1V5H A;  2GTL B;  1MLK A;  108M A;  1RQ4 A;  2ZFO C;  1THB A;  3ECL A;  1YG5 B;  1R1X A;  3QQR A;  5AZQ A;  1F5P A;  4WJG 1;  1BIJ B;  2QFN A;  3VAU A;  3G4Y A;  2HZ3 A;  3S65 B;  1Y35 A;  3BCQ B;  2QMB A;  1CH3 A;  1Y46 B;  1DLW A;  3BJ1 A;  4F6D A;  1HGC B;  2BNL A;  2DN1 A;  3GKT A;  2KSC A;  2M6Z A;  1YHU B;  4G1V A;  1UX8 A;  1LUE A;  2MGA A;  4MQG A;  1MBI A;  2LH5 A;  5KKK A;  2OHA A;  4XS0 B;  2R4X A;  3GQR A;  4QAU A;  1N9X A;  1FSX A;  2Z6T A;  1BUW A;  2W31 A;  3ZJJ A;  1YEQ B;  2EKT A;  3GK9 A;  1DXC A;  2GNW A;  3WCT C;  1LFV A;  3H57 A;  1A3N A;  3KUO A;  3GYS B;  4MQJ A;  4ZVA A;  2G0V A;  3PI9 B;  3EOK A;  2O5Q X;  1GLI A;  5HU6 B;  2GTL C;  1DO4 A;  1DXU A;  2V1G A;  2XKI A;  2ZFB A;  5CN5 A;  2HBS B;  3CIU A;  2ZSP A;  2BKM A;  1URV A;  1BZZ A;  1YVT B;  2AUQ A;  2LH7 A;  3D1A A;  5CN4 A;  1A6G A;  1SHR B;  1WVP A;  1NIH B;  3QM6 A;  1GCW A;  1MYZ A;  4G1B A;  1MBD A;  1MTJ A;  4ESA A;  3G4R A;  2HZ2 A;  3UHH A;  1YHU C;  2H8D A;  3NFE A;  3P5Q B;  5EU2 A;  2ZS1 D;  2MBW A;  1HBA B;  2ZT3 A;  3FH9 A;  3QJD A;  1SPG A;  1O1I B;  4AVE A;  1Y4F A;  3BJ3 B;  3OO5 B;  1S0H B;  1Y2Z B;  1LFQ B;  1Y4V A;  2W6X A;  3EOK B;  2LHB A;  3LR7 A;  2DC3 A;  4U8U B;  1YEV B;  1GDI A;  4YU4 A;  1Y85 B;  1YZI B;  3IC0 B;  3PT8 B;  2MGI A;  4M4B A;  5CMV A;  1O1L B;  1Y8W A;  1HDA B;  1Y22 B;  1IBE A;  1YMC A;  3S66 A;  1CH2 A;  1YIH A;  2ZFB B;  4F6J A;  5CNE A;  2VHB A;  2W6W A;  1DTM A;  3R5I B;  4NI0 B;  4F68 A;  1J3Y B;  1DWR A;  3MN0 A;  1IBE B;  1XZ2 A;  1JL7 A;  4WCH D;  5C6E B;  1Y0T A;  2DXM B;  5CND A;  4F6F A;  1YCA A;  2EB8 A;  1AJ9 B;  1O1P B;  1ITH A;  2C0K A;  4FH6 A;  1H1X A;  3WCU D;  3WFX A;  2LH3 A;  2GRF A;  1A01 A;  3PI8 B;  1O1I A;  4H2L A;  1MBS A;  3ZJI A;  2RAO A;  2Z6S A;  1FDH A;  1S0H A;  3IC0 A;  3NFE B;  2VYY A;  1LFY A;  1SPG B;  3VRE B;  2EB9 A;  2GNV A;  1S61 A;  3V2Z A;  4F6G A;  3NL7 B;  1J52 A;  2AA1 B;  2QU0 B;  3UHQ A;  2NRL A;  3ZJP A;  1IWH A;  5B84 A;  1YGD B;  1YMA A;  4MQC A;  2HHD A;  5KDQ A;  1THB B;  3NL7 A;  1NZ4 A;  1M6M A;  1S69 A;  2LH1 A;  1MNI A;  5CNC A;  1BZ0 B;  1T1N B;  1BZ1 B;  3AT6 A;  5JGG A;  1YFF A;  1NS6 B;  3WFU A;  2NSR A;  3A5B A;  3VRG A;  1J7S A;  2YRS B;  3WHM A;  2OIF A;  3MJU A;  2MGK A;  2D5X B;  1O1K A;  1YEU A;  6HBW B;  2FAM A;  1F63 A;  1S56 A;  106M A;  4NK1 A;  104M A;  3PEL B;  2DHB A;  2V1I A;  2MYB A;  1FDH G;  5ILR A;  1J40 B;  4X0L A;  2HZ1 A;  111M A;  4FWX A;  4XS0 A;  1Y31 A;  2B7H A;  2D2M B;  5SW7 A;  4GZG A;  3HEP A;  1AJH A;  1LTW A;  2MGC A;  1G0B B;  1UFJ A;  2FRK X;  5EUI B;  4X0L B;  3ODQ B;  2O5L X;  3PI9 A;  1DKE B;  1MBA A;  1QPW B;  5HY8 B;  1YVQ B;  1MYG A;  3A5G A;  4MQI A;  101M A;  1HCO A;  1DO1 A;  1ABW B;  2HBD A;  1DTI A;  1BUW B;  3WCV D;  2GRZ A;  1V4X A;  1CG8 A;  2HCO B;  2MGM A;  1MKO A;  4MAX A;  3WCV C;  1W92 A;  1MYF A;  5CNG A;  1GZX B;  1YEV A;  5KDQ B;  4C44 A;  5CN8 A;  1HBH B;  1O1K B;  3ZHW A;  2R4Y A;  1V4W A;  1LJW B;  1Y4F B;  3GOU A;  2OHB A;  1A4F A;  1G08 B;  1X9F C;  1MOC A;  3DHR B;  2O5T X;  3MJP B;  5CN9 A;  2G12 A;  4L7Y B;  1YH9 A;  2GTL D;  1A00 B;  4HHB A;  3DUT A;  2HHE A;  1MNJ A;  5JDO E;  2HBC B;  1YCB A;  1A9W A;  2H35 B;  2O5O X;  1CO8 A;  2W6V A;  1MLG A;  2Z85 A;  2DXM A;  1CLS B;  1FLP A;  4U8U C;  5HAV A;  2O5M X;  2GLN A;  2ZLT A;  2G0R A;  3EU1 A;  4ODC A;  2D2N A;  3HHB B;  1DWT A;  4KMW A;  1HLM A;  3OZW A;  5HBI A;  1Y31 B;  1GBU B;  3WFW A;  1OJ6 A;  2MYA A;  3HRW A;  1BJE A;  5F0B A;  3QJC B;  1J7Y B;  1COH B;  3MOU A;  1MLS A;  1Y5J B;  2HBD B;  3ZJN A;  2BLJ M;  4MQJ B;  1NGK A;  3S66 B;  107M A;  1V75 A;  2IG3 A;  4MQI B;  1YOH A;  2ZSR A;  2LH6 A;  1G9V A;  1BZP A;  1J7Y A;  1UX9 A;  1CH7 A;  3UHY A;  1JPB A;  1MYI A;  1YE0 B;  3A0G A;  4JYQ A;  1MLN A;  3O89 A;  1O1L A;  1Y8W B;  3BOM A;  1VXC A;  1J3Z A;  1GDL A;  1Y22 A;  3HC9 A;  3CY5 B;  1B86 B;  1OBM A;  110M A;  4ROL B;  4FC3 B;  2QSS A;  5D1V A;  112M A;  2AUO A;  4HHB B;  1WMU A;  1LFT A;  4N7N B;  4HSX A;  2ZLT B;  2HBC A;  3D17 B;  1HGC A;  4O4T A;  2SPL A;  4MQK B;  2YRS A;  1XZV B;  1VWT A;  2MGF A;  3UHW A;  2W72 B;  3M3A A;  4U8U D;  1RQ3 B;  1GDK A;  1HBA A;  2ZT2 A;  2FRJ X;  1VXH A;  2HHE B;  4N7O B;  1OR4 A;  3ED9 A;  1M9P B;  1YEO A;  1BZ1 A;  2O58 X;  3AT6 B;  2GDM A;  3RJ6 A;  2ZS1 C;  1Y5F B;  1N9F A;  2H8F A;  1CH9 A;  3QJD B;  3D1A B;  1S5Y B;  1LH5 A;  3FS4 A;  1NIH A;  1QSH A;  2BMM A;  3OVU C;  4ESA B;  5EE4 D;  3G4Q A;  3D1K A;  3BOM B;  2H8D B;  1YHE B;  2DN3 A;  4XDI A;  2MYC A;  1JWN A;  1DXT A;  1MGN A;  2VLY A;  5EQM A;  3QM8 A;  1Y7G B;  3UBC A;  5MBN A;  4G51 A;  1EW6 A;  1JP6 A;  4N7N A;  1Y0C A;  4ROL A;  3UHV A;  4MQH B;  3WCU A;  4FH7 A;  1C7B A;  2NSS A;  1MBO A;  4VHB A;  2R1H B;  1TU9 A;  1NZ5 A;  1MYJ A;  1QI8 A;  3GKV B;  2M6Z B;  1Y4G A;  1NEJ B;  1O1P A;  1MLM A;  1Y8I B;  3UHC A;  3LR9 A;  3AT5 B;  3KMF C;  7HBI A;  2MGD A;  2VYZ A;  1O16 A;  2D60 A;  2MGG A;  1GBV A;  2DN3 B;  2OH8 A;  2QMB B;  3G4W A;  1MOD A;  1Z8U B;  1Y8K A;  3DHT B;  1CBM A;  3S65 A;  4MPM A;  1V4U A;  1ECD A;  3K8B A;  3BCQ A;  1GVH A;  3VHB A;  1S5Y A;  3UHE A;  5HLU A;  4YU4 B;  1HLB A;  3UGZ A;  3PT8 A;  4UZV A;  1O1N A;  1MLO A;  3VRF A;  2AV3 A;  2ZS0 D;  1V4W B;  2JHO A;  1VXG A;  2AUR A;  3PIA A;  3QJE B;  1O1O A;  5CNF A;  3QM7 A;  1CIK A;  1HGB A;  4L7Y A;  3UHU A;  1X9F B;  1A0U A;  5HLQ A;  3VRE A;  1K0Y A;  1Y0D A;  2MHB A;  2ZFO A;  4HRR B;  1Y4Q B;  4MBA A;  3E5I A;  1ASH A;  1HBH A;  1XXT A;  1NS9 B;  3S1J A;  1HSY A;  5AB8 A;  1XZ7 A;  2V1K A;  4H0B A;  5M3S A;  4NI1 B;  1QSI B;  1Y5J A;  1O1J B;  103M A;  2ZFO D;  2ZLW B;  1A3N B;  3ONZ B;  1M6C A;  1Y45 B;  1Y8K B;  3ZJM A;  1J40 A;  1G9V B;  1UT0 A;  1GBU A;  3UHX A;  2FRI X;  1LH2 A;  5HU6 A;  1N9I A;  2R80 A;  1V75 B;  3WCV A;  2PEG B;  1C7B B;  3OO4 A;  1Y4R A;  1QPW A;  1HAB A;  3ASE A;  1RQA B;  3HF4 B;  4SDH A;  1HBI A;  1XY0 B;  1UFP A;  4IRO B;  3QZZ A;  1Y0W B;  1Y4V B;  3UH6 A;  1JY7 B;  1OUU A;  4MU5 A;  3UH7 A;  4NI0 A;  4M4B B;  2D5Z B;  1G09 A;  2PGH B;  1XQ5 B;  4O4Z A;  5F2A A;  1LFL B;  3UHZ A;  1HHO B;  4MQG B;  1YEU B;  5EYJ A;  3QM5 A;  1MBC A;  3G4U A;  3OZV A;  1EBT A;  2GRH A;  5IKS A;  1SPE A;  3FS4 B;  2ZSS A;  1MYT A;  1U7S A;  1UVX A;  3GOU B;  4LPI A;  1MNK A;  1JL6 A;  102M A;  1K1K A;  4YU3 A;  1MCY A;  2HBF A;  3OGB A;  3E4N A;  3AQ6 A;  1JEB A;  1A00 A;  1XZ4 B;  1RQ3 A;  1RTE A;  1NZ2 A;  2GL3 A;  3AG0 A;  3MJP A;  3W4U A;  2EKU A;  1CH4 A;  3IXF A;  3K3U A;  3ZOM A;  1LH3 A;  2QFK A;  1A3O B;  2D2M C;  3OK5 A;  3ODQ A;  1BZR A;  2G0Z A;  2IN4 A;  1A0Z B;  3AT5 A;  1JY7 A;  1OUU B;  1HBB A;  1S6A A;  5HY8 A;  1HV4 A;  1YVT A;  5HLX A;  1NEJ A;  1IT3 A;  1V07 A;  1Y0W A;  1C7D A;  1Y7D A;  1Y01 B;  2D6C A;  2AA1 A;  2QU0 A;  1ECN A;  1NXF A;  2MGE A;  4DC8 A;  2HBE A;  2G0X A;  2HCO A;  1EMY A;  5JDO D;  1SWM A;  1LFY B;  2R1H A;  2VYW A;  5EYS A;  3WI8 A;  2D2N D;  1DXU B;  3GKV A;  3WCU B;  6HBI A;  5JOM A;  3BJ2 A;  1X9F D;  3GYS A;  3PEL A;  3MYN A;  1CG5 A;  1ABY B;  1LFV B;  3S48 C;  1Y4G B;  4PQB A;  3H58 A;  3ECX A;  1S5X A;  1MOB A;  4MXK A;  3BJ2 B;  4O35 A;  3G4V A;  6HBW A;  3VRG B;  1BBB B;  1PBX A;  2ZS1 A;  1R1X B;  3ECZ A;  3AQ8 A;  1Y7D B;  4F6B A;  1LA6 B;  2HBF B;  2VLX A;  1Y09 B;  2ZT0 A;  1YDZ A;  3OJ1 A;  3VRF B;  1MDN A;  3ARL A;  3LHB A;  4HRR A;  3PIA B;  3QJE A;  2R50 A;  4N7O A;  3MVC A;  3MKB B;  1QSH B;  1XXT B;  4YU3 B;  1Y7Z B;  3ZJR A;  4NZI A;  4ILZ A;  3TLD A;  4MXL A;  1DO3 A;  1G0A B;  3W4U B;  3QZX A;  3D17 A;  3PI1 A;  3G46 A;  3WCP B;  1H97 A;  1R1Y B;  1S5X B;  1HBS A;  1UC3 A;  1B86 A;  1JW8 A;  1YE0 A;  1VXD A;  2ZSX A;  1URY A;  1U7R A;  1ABY A;  3QJB B;  1AJ9 A;  1XZ2 B;  4DWU A;  1LHT A;  4C0N A;  5CHQ A;  1MTK A;  1QXD A;  1YIH B;  3WCV B;  1Y45 A;  2OH9 A;  2MB5 A;  2ZLU B;  1BVD A;  3UHN A;  1LFZ B;  4H2L B;  5E29 B;  1BZ6 A;  2HBE B;  3B75 A;  1MTI A;  2HHB A;  4IT8 A;  4IRO A;  3WCW C;  1VXF A;  1LH6 A;  1HDB A;  1GBV B;  1UIW A;  1SDK A;  3QMA A;  3OO4 B;  5AZR A;  3HXN A;  3QQQ A;  3G53 A;  2H35 A;  2MGH A;  3D4X A;  5KER B;  5D5R A;  2RI4 A;  4OOD A;  3UI0 A;  1MLQ A;  1KD2 B;  1J41 A;  1NAZ A;  1QXE B;  3WCT D;  3ONZ A;  1XZU B;  3WCP A;  3GQR B;  4F6I A;  1BIJ A;  5B85 A;  1AJG A;  2ZSY A;  3HYU B;  1Y83 A;  1NPF A;  3WR1 B;  1SI4 A;  1YFF B;  3KUN A;  3HRW B;  1FAW B;  4MQC B;  5EOH A;  1CLS A;  2CMM A;  4AVD A;  2V1J A; 
#chains in the Genus database with same CATH topology
 1VXA A;  3WHM B;  5ILM A;  4ZIZ B;  1YDZ B;  1A6K A;  2D5X A;  3ARK A;  3RQR A;  1A0Z A;  1CII A;  1V4U B;  3LQ9 A;  4ZVB A;  3NMM B;  1YHU D;  1HBR A;  3P5Q A;  1MZ0 A;  4F0T A;  5ILP A;  1Y5K A;  5JGG B;  1SDL A;  1XYE B;  1IDR A;  1MBN A;  2ZS0 A;  2SPM A;  1DXV B;  1DUK A;  3UHG A;  2G14 A;  2MGB A;  1O1N B;  2ZLV B;  4FC3 A;  3V58 A;  1J41 B;  3AQ9 A;  1MLU A;  1MOH A;  3LQD A;  2Z6N A;  3G52 A;  2QLS A;  2W72 A;  3A0G B;  1FHJ B;  3K9Z A;  1KD2 A;  2C7K B;  1CO9 A;  3A59 B;  1J3Z B;  2BLI A;  1G0B A;  3D4X B;  1ABW A;  3IA3 B;  1IOP A;  3KMF A;  3HF4 A;  1FCS A;  1Y7C B;  1AZI A;  1HAB B;  1HBB B;  1QGW C;  1FN3 B;  1RQA A;  1F65 A;  1F0L A;  4TWV A;  2AV0 A;  3TM9 A;  1C40 A;  3BA2 A;  1YZI A;  1VRE A;  2QSP B;  1YEQ A;  1DXD A;  4F69 A;  2ZLV A;  1CH1 A;  4NXA A;  3UHB A;  1QI8 B;  3LB3 A;  2LH2 A;  1HDA A;  2ZLX B;  1Y4R B;  1HDS B;  2QLS B;  2AUP A;  3UHT A;  1GCV B;  1NS6 A;  2G11 A;  1HBG A;  1A87 A;  1Y4B B;  1NWI A;  3GQG A;  5C6Y A;  3IC2 A;  1MYM A;  1PMB A;  2W6V B;  1Y5K B;  2ZT1 A;  5AQD A;  1LHS A;  5EET A;  1VRF A;  1YHU A;  2ZT4 A;  3DR9 A;  5EE4 C;  3ARJ A;  2G0S A;  3NMM A;  4F4O A;  4LMX B;  3UH3 A;  4ROM B;  3ZJO A;  3WCT B;  1Q1F A;  2R4W A;  3IC2 B;  3PT7 B;  1C7C A;  1MLR A;  109M A;  4GXE A;  1ON7 A;  3UGY A;  1HHT P;  2MGJ A;  3HEO A;  3MKB A;  3UBV A;  1YIE A;  3GQP A;  3PT7 A;  1IWH B;  1V4X B;  1MYH A;  1HGA A;  4HBI A;  1ON7 B;  1YHR A;  1XY0 A;  2NX0 A;  1O1O B;  4N7P B;  1RPS B;  2VRY A;  1B8D B;  1X46 A;  1Y8I A;  1YVQ A;  4HRT B;  5E83 A;  3UHR A;  1XZV A;  1IT2 A;  1MOA A;  1ECA A;  1Y7C A;  4BS9 A;  3HXN B;  1JF3 A;  1OUT A;  3QJC A;  1XZU A;  3V2V A;  2D60 B;  1HHO A;  1V9Q A;  3AQ7 A;  1LH1 A;  1JP8 A;  1BZZ B;  3CY5 A;  2RI4 B;  1J3F A;  1F5O A;  2VML A;  1CQX A;  2HHB B;  1YEN B;  2ZLU A;  1I3D A;  4MBN A;  3GLN A;  5E29 A;  1HI0 P;  1MWB A;  1D8U A;  4NI1 A;  1HV4 B;  4HSW A;  4AE1 A;  2SPN A;  2SPO A;  2NRM A;  1O1M A;  4U8U A;  5CN6 A;  1XF6 C;  1HDB B;  1JZK A;  3UHI A;  1L2K A;  4ETV A;  1LH7 A;  1Y35 B;  2D2N B;  1A6N A;  3ZJQ A;  1J3Y A;  3OO5 A;  1X9F A;  1J7W B;  1DM1 A;  1Y0C B;  1Y4P B;  3O7N A;  4N7P A;  2EVK A;  2GTL A;  4O1T A;  3LB4 A;  2H8F B;  1XYE A;  1NQP A;  2W6Y A;  1CIO A;  1RVW A;  3V57 B;  5JDO C;  2XKH A;  105M A;  2D2N C;  3ZH0 A;  3WTG A;  1I7Y A;  1Y46 A;  1NQP B;  2JLG A;  3QM9 A;  1Y7Z A;  2RAO B;  1RVW B;  4N8T B;  1C7C B;  1YG5 A;  1Y5F A;  3U3E A;  1A9W E;  4TWU A;  1BVC A;  2V8A A;  1HBR B;  2E2Y A;  1LFL A;  1GLI B;  1DKE A;  2FRF A;  2X49 A;  2ZSO A;  4B4Y A;  1SGK A;  1MLF A;  4B3W A;  1C40 B;  1NPG A;  1CPW A;  1CMY A;  2HBG A;  1UMO A;  3WCW B;  2V1E A;  3A2G A;  4UUR A;  3OZU A;  2JLF A;  1DDT A;  3UHK A;  1B33 B;  1OUT B;  5B13 G;  1RSE A;  4GY3 B;  1J7W A;  2MGL A;  1KFR A;  1A01 B;  2ZSN A;  3UH5 A;  2ZSQ A;  3M38 A;  2QSP A;  1FN3 A;  2WCR A;  3UHS A;  1UIW B;  1QXD B;  3A5A A;  3QJB A;  4NK2 A;  1YE2 B;  1YHE A;  1IRD A;  2OLP A;  3SZK A;  1CPC B;  1VHB A;  2DHB B;  1LFZ A;  3TM3 A;  4DC7 A;  1CH5 A;  1I3E A;  5CN7 A;  1N9H A;  3ZJH A;  1MLJ A;  2DN2 B;  1A6M A;  2B7H B;  1BZ0 A;  4NS2 A;  2FAL A;  5E6E A;  1WLA A;  1COH A;  2ZST A;  4M4A A;  1XZ5 B;  3D7O A;  4YJJ B;  3RJN B;  2BLH A;  3ZJL A;  3B75 B;  3FH9 B;  1O1J A;  2BK9 A;  1Y8H B;  1YGD A;  1UVY A;  4DWT A;  1LIA B;  1HAC B;  1CBL A;  1Y4Q A;  3ZOL A;  1CMY B;  3WCT A;  2O5S X;  4BJU A;  4PQC A;  1NS9 A;  3SDH A;  4PQ6 A;  1IRC A;  3RGK A;  1JF4 A;  1Y2Z A;  4NXC A;  4WJG A;  1XZ7 B;  1RPS A;  5EV5 A;  1SHR A;  1JP9 A;  4KJT A;  2VEB A;  4F4O B;  1MLH A;  1MWC A;  3S1I A;  5CNB A;  1GZX A;  1HGA B;  1YIE B;  1HDS A;  1UVN A;  1M9P A;  1OR6 A;  1LFT B;  1VWT B;  1YEO B;  2QSS B;  3MYM A;  1GCV A;  3A9M A;  4FWZ A;  3BJ3 A;  2EF2 A;  1G09 B;  2PGH A;  3NG6 A;  3R0G A;  1XZ5 A;  3D7O B;  1YGF B;  1A4F B;  1G08 A;  1BIN A;  2DN2 A;  3MBA A;  3PI8 A;  2MYD A;  1Y0A A;  1LJW A;  1HCO B;  5ILE A;  4ROM A;  1O1M B;  1MWD A;  1Y09 A;  4LMS B;  2QRW A;  2BWH A;  4L2M A;  2D2M A;  5SW7 B;  1BBB A;  3LB2 A;  1YE2 A;  1FAW A;  2XKG A;  3HYU A;  2V1F A;  2D5Z A;  3ORD A;  1CP0 A;  1HAC A;  1WMU B;  5CHR A;  4M4A B;  1HI1 A;  1FSL A;  1LA6 A;  2XYK A;  1JDO A;  1RTX A;  4MQH A;  1BAB A;  1MNH A;  2PEG A;  1Y4P A;  4OF9 A;  2HBS A;  3PMC A;  2UUM B;  1Y7G A;  4PNJ A;  4N6S A;  1VXE A;  1FHJ A;  2Z6N B;  3GDJ A;  1KN1 A;  3HHB A;  2DN1 B;  3A59 A;  1VXB A;  4A8Q A;  1DXT B;  5C6E A;  5JDO F;  4TYX A;  1DLY A;  1JZM A;  2V1H A;  2GKN A;  1PHN A;  1Y0A B;  3MJU B;  1SDL B;  2BW9 M;  4FWY A;  1C7D B;  2MYE A;  1A0U B;  3PI2 A;  1YEN A;  1R1Y A;  1FSX B;  2WY4 A;  1KR7 A;  1K0Y B;  1Y0D B;  1T1N A;  5MBA A;  1CP5 A;  4N8T A;  4H07 A;  1ECO A;  1HJT A;  3EU1 B;  4ODC B;  1OFJ A;  1K1K B;  3LB1 A;  1NZ3 A;  3NG6 B;  3DBJ A;  4O2G A;  1Y85 A;  1GCW B;  1G0A A;  1EBC A;  3ZJS A;  1B0B A;  3GQP B;  1EWA A;  3E55 A;  3CIU B;  1HGB B;  1A3O A;  2ZS0 C;  4JAC A;  1YGF A;  1LFQ A;  1NY9 A;  2VM0 A;  1XQ5 A;  2ZWJ A;  2VEE A;  1Y4B A;  2WTG A;  3GQG B;  2D2M D;  3O2C B;  3SDN A;  3K8B B;  1CG8 B;  1RQ4 B;  1SI4 B;  2W72 C;  2ZLX A;  2O5B X;  1OFK A;  1Y83 B;  2G3H A;  2EVP A;  1MKO B;  3WCU C;  3PI3 A;  1MNO A;  1SDK B;  3DHT A;  1X3K A;  1JZL A;  4MQK A;  2ZS1 B;  1HRM A;  3WR1 A;  1YOG A;  5E6E B;  3HEN A;  2ZSZ A;  5EUI A;  1CG5 B;  4B02 A;  3PI4 A;  2UUN B;  1CQ2 A;  2GKM A;  1PBX B;  3NML A;  1Y8H A;  5KER A;  1DWS A;  3UHD A;  1QXE A;  1DO7 A;  1BAB B;  3AQ5 A;  1GJN A;  2UUL C;  3BJ1 B;  1IRD B;  3SZK B;  4KMV A;  3EDB A;  5E83 B;  3M39 A;  1HBS B;  3WCW A;  3GDJ B;  1TES A;  2R80 B;  4PO5 A;  2VML B;  3EDA A;  1Y0T B;  1MLL A;  1YOI A;  1DUO A;  1QSI A;  3M3B A;  2VLZ A;  3E5O A;  1XCH A;  1YMB A;  2G10 A;  1B33 A;  3R5I A;  4G51 B;  2ZLW A;  2MHB B;  2ZFO B;  3D1K B;  1ABS A;  1YHR B;  1YH9 B;  2WTH A;  3WCW D;  3WFT A;  3DHR A;  1GDJ A;  2Z8A A;  1J7S B;  4HRT A;  4KN3 A;  3DUT B;  1NWN A;  1F99 B;  2HHD B;  2ZS0 B;  1JEB B;  1XZ4 A;  4UIQ A;  3WTG B;  2R4Z A;  4BJA A;  3LQD B;  1DXV A;  2VJT B;  1V5H A;  2GTL B;  1MLK A;  108M A;  1RQ4 A;  2ZFO C;  1THB A;  3ECL A;  1YG5 B;  1R1X A;  3QQR A;  5AZQ A;  1F5P A;  4WJG 1;  1BIJ B;  2QFN A;  3VAU A;  3G4Y A;  2HZ3 A;  3S65 B;  1Y35 A;  4L1E B;  3BCQ B;  2QMB A;  1CH3 A;  1Y46 B;  3V57 A;  1DLW A;  3BJ1 A;  4F6D A;  1HGC B;  2BNL A;  2DN1 A;  3GKT A;  4A8F A;  4A8Y A;  1MDT A;  2KSC A;  2M6Z A;  1YHU B;  4G1V A;  1UX8 A;  1LUE A;  2MGA A;  1PHN B;  4MQG A;  1TOX A;  1UVK A;  1MBI A;  2LH5 A;  4A8O A;  5KKK A;  2OHA A;  4XS0 B;  2R4X A;  3GQR A;  4QAU A;  1N9X A;  1FSX A;  2Z6T A;  1BUW A;  2W31 A;  3ZJJ A;  1YEQ B;  2EKT A;  1ALL A;  3GK9 A;  1DXC A;  2GNW A;  3WCT C;  1LFV A;  3H57 A;  1A3N A;  3KUO A;  3GYS B;  4MQJ A;  4ZVA A;  2G0V A;  3PI9 B;  3EOK A;  2O5Q X;  4Q70 A;  2V8A B;  4XXK A;  1GLI A;  5HU6 B;  2GTL C;  1DO4 A;  1DXU A;  2V1G A;  2XKI A;  2ZFB A;  5CN5 A;  2HBS B;  3CIU A;  3KVS A;  2ZSP A;  2BKM A;  1URV A;  1WAC A;  1BZZ A;  1YVT B;  2AUQ A;  2LH7 A;  3D1A A;  5CN4 A;  1A6G A;  1SHR B;  1WVP A;  1NIH B;  3QM6 A;  4H0M B;  1GCW A;  1MYZ A;  1GH0 A;  4G1B A;  1MBD A;  1MTJ A;  4ESA A;  3G4R A;  2HZ2 A;  3UHH A;  1YHU C;  2H8D A;  3NFE A;  3P5Q B;  5EU2 A;  3O2C A;  2ZS1 D;  2MBW A;  1HBA B;  2ZT3 A;  3FH9 A;  3QJD A;  1SPG A;  1O1I B;  4AVE A;  1Y4F A;  3BJ3 B;  3OO5 B;  1LIA A;  1S0H B;  1Y2Z B;  1LFQ B;  1Y4V A;  2W6X A;  3EOK B;  2LHB A;  1KTP B;  3LR7 A;  2DC3 A;  4U8U B;  1YEV B;  1GDI A;  4YU4 A;  1Y85 B;  1YZI B;  3IC0 B;  3PT8 B;  2MGI A;  4M4B A;  5CMV A;  4YJJ A;  1O1L B;  1Y8W A;  1HDA B;  1Y22 B;  1IBE A;  1YMC A;  3S66 A;  1CH2 A;  1YIH A;  2ZFB B;  4F6J A;  5CNE A;  2BV8 A;  2VHB A;  2W6W A;  1DTM A;  3R5I B;  4NI0 B;  4F68 A;  1J3Y B;  1DWR A;  3MN0 A;  1IBE B;  1XZ2 A;  1JL7 A;  4WCH D;  5C6E B;  1Y0T A;  2DXM B;  5CND A;  4F6F A;  1YCA A;  2EB8 A;  1AJ9 B;  1O1P B;  1ITH A;  2C0K A;  4FH6 A;  1H1X A;  3WCU D;  3WFX A;  2LH3 A;  2GRF A;  1A01 A;  4XXI A;  3PI8 B;  1O1I A;  2VJT A;  4H2L A;  1MBS A;  3ZJI A;  2RAO A;  2Z6S A;  1FDH A;  1S0H A;  3IC0 A;  1XG0 C;  3NFE B;  2VYY A;  1LFY A;  1SPG B;  1EYX A;  3VRE B;  2EB9 A;  2GNV A;  1S61 A;  3V2Z A;  4F6G A;  3NL7 B;  1J52 A;  2AA1 B;  2QU0 B;  3UHQ A;  2NRL A;  4HH0 A;  3ZJP A;  1IWH A;  5B84 A;  3PMD A;  1YGD B;  1YMA A;  4MQC A;  1F99 A;  2HHD A;  5KDQ A;  5FVB A;  1THB B;  3NL7 A;  1NZ4 A;  1M6M A;  1S69 A;  2LH1 A;  1MNI A;  5CNC A;  1BZ0 B;  1T1N B;  2VJR A;  1BZ1 B;  3AT6 A;  5JGG A;  1YFF A;  1NS6 B;  3WFU A;  2NSR A;  3A5B A;  3VRG A;  1J7S A;  2YRS B;  3WHM A;  2OIF A;  3DBJ B;  3MJU A;  2UUL A;  2MGK A;  2D5X B;  1O1K A;  1YEU A;  6HBW B;  2FAM A;  1F63 A;  1S56 A;  4GY3 A;  106M A;  4NK1 A;  104M A;  3PEL B;  2DHB A;  2V1I A;  2MYB A;  1FDH G;  5ILR A;  1J40 B;  3VNC A;  4X0L A;  2HZ1 A;  111M A;  2UUN D;  4FWX A;  4Z8K A;  4XS0 A;  1Y31 A;  2B7H A;  5B13 A;  2D2M B;  2BV8 B;  5SW7 A;  4GZG A;  3HEP A;  1AJH A;  1LTW A;  1ALL B;  2MGC A;  1G0B B;  1UFJ A;  2FRK X;  5EUI B;  4X0L B;  3ODQ B;  2O5L X;  3PI9 A;  1DKE B;  1MBA A;  4Z8K B;  1QPW B;  5HY8 B;  1YVQ B;  1MYG A;  3A5G A;  4MQI A;  101M A;  1HCO A;  1DO1 A;  3GIO A;  1ABW B;  2UUN A;  2HBD A;  1DTI A;  4ETT A;  1BUW B;  2UUL H;  3WCV D;  2GRZ A;  1V4X A;  1CG8 A;  2HCO B;  2MGM A;  1MKO A;  4MAX A;  3WCV C;  1XDT T;  1W92 A;  1MYF A;  5CNG A;  1GZX B;  1YEV A;  5KDQ B;  4C44 A;  5CN8 A;  1GH0 B;  1HBH B;  1O1K B;  3ZHW A;  1I7Y B;  2R4Y A;  1V4W A;  1LJW B;  1Y4F B;  2UUL B;  3GOU A;  2OHB A;  1A4F A;  1G08 B;  1X9F C;  1MOC A;  3DHR B;  2O5T X;  3MJP B;  5CN9 A;  2G12 A;  4L7Y B;  1YH9 A;  2GTL D;  1A00 B;  4HHB A;  3DUT A;  2DKA A;  2HHE A;  2VJH A;  1MNJ A;  5JDO E;  2HBC B;  1YCB A;  1A9W A;  2H35 B;  2O5O X;  1CO8 A;  2W6V A;  1MLG A;  2Z85 A;  2DXM A;  1CLS B;  3O18 B;  1UVL A;  3NUH B;  1FLP A;  4U8U C;  5HAV A;  2O5M X;  2GLN A;  2ZLT A;  2G0R A;  3EU1 A;  4ODC A;  2D2N A;  3HHB B;  1DWT A;  2UUM A;  4KMW A;  1HLM A;  3OZW A;  5HBI A;  1Y31 B;  1GBU B;  3WFW A;  1OJ6 A;  2MYA A;  3HRW A;  1BJE A;  1KN1 B;  5F0B A;  3QJC B;  1J7Y B;  1COH B;  3MOU A;  1MLS A;  4ERV A;  1Y5J B;  2HBD B;  3ZJN A;  2C7J B;  2BLJ M;  4MQJ B;  1NGK A;  3S66 B;  107M A;  1V75 A;  2IG3 A;  4MQI B;  1YOH A;  2ZSR A;  2LH6 A;  1G9V A;  1BZP A;  1J7Y A;  1UX9 A;  1CH7 A;  3UHY A;  1JPB A;  1MYI A;  1YE0 B;  3A0G A;  4JYQ A;  1MLN A;  3O89 A;  1O1L A;  1Y8W B;  3BOM A;  1VXC A;  1J3Z A;  1GDL A;  1Y22 A;  3HC9 A;  3CY5 B;  1B86 B;  2DKC A;  1OBM A;  110M A;  4ROL B;  4FC3 B;  2QSS A;  4LM6 B;  5D1V A;  112M A;  3BRP A;  2AUO A;  2DKD A;  4HHB B;  4A8W A;  1WMU A;  1LFT A;  4N7N B;  4HSX A;  2ZLT B;  2HBC A;  3D17 B;  1HGC A;  4O4T A;  4HH1 A;  2SPL A;  4MQK B;  2YRS A;  1XZV B;  1VWT A;  2MGF A;  3UHW A;  2W72 B;  3M3A A;  4U8U D;  1RQ3 B;  2UUM X;  1GDK A;  1HBA A;  2ZT2 A;  2FRJ X;  1VXH A;  2HHE B;  4N7O B;  1OR4 A;  3ED9 A;  1M9P B;  1YEO A;  1BZ1 A;  2O58 X;  3AT6 B;  2GDM A;  3RJ6 A;  4F0U B;  2ZS1 C;  1Y5F B;  1N9F A;  2H8F A;  1CH9 A;  3QJD B;  3D1A B;  4RMP A;  1S5Y B;  1LH5 A;  3FS4 A;  1NIH A;  1QSH A;  1JBO B;  2BMM A;  4H0M A;  3OVU C;  4ESA B;  5EE4 D;  3MWN A;  3G4Q A;  3D1K A;  3BOM B;  4A8S A;  2H8D B;  1YHE B;  2DN3 A;  4XDI A;  4A8K A;  2MYC A;  1JWN A;  1DXT A;  1MGN A;  2VLY A;  5EQM A;  3QM8 A;  1Y7G B;  3UBC A;  5MBN A;  4G51 A;  1EW6 A;  4N7N A;  1JP6 A;  1Y0C A;  4ROL A;  3UHV A;  4MQH B;  3WCU A;  4ESU A;  4FH7 A;  1C7B A;  2NSS A;  1MBO A;  4VHB A;  2R1H B;  1RH1 A;  1TU9 A;  2X4A A;  1NZ5 A;  1MYJ A;  1QI8 A;  3GKV B;  2M6Z B;  1Y4G A;  1NEJ B;  1O1P A;  1MLM A;  1UVI A;  1Y8I B;  3UHC A;  3LR9 A;  3AT5 B;  3KMF C;  7HBI A;  2MGD A;  2VYZ A;  3FEW X;  1O16 A;  2D60 A;  2MGG A;  1GBV A;  2DN3 B;  2OH8 A;  2QMB B;  3G4W A;  1MOD A;  1Z8U B;  1Y8K A;  3DHT B;  1CBM A;  3S65 A;  4MPM A;  1B8D A;  1V4U A;  1ECD A;  3K8B A;  3BCQ A;  2VJH B;  1GVH A;  3VHB A;  1S5Y A;  3UHE A;  5HLU A;  4YU4 B;  2I88 A;  1HLB A;  1JBO A;  3UGZ A;  3PT8 A;  4UZV A;  1O1N A;  1MLO A;  3VRF A;  4L1E A;  2AV3 A;  2ZS0 D;  1V4W B;  2JHO A;  1VXG A;  2AUR A;  3PIA A;  3QJE B;  1O1O A;  5CNF A;  3QM7 A;  1CIK A;  1HGB A;  4L7Y A;  3UHU A;  1X9F B;  4F0T B;  1A0U A;  3L0F A;  5HLQ A;  3VRE A;  1K0Y A;  1Y0D A;  2MHB A;  2ZFO A;  4HRR B;  1Y4Q B;  4MBA A;  3E5I A;  1ASH A;  1HBH A;  1XXT A;  1NS9 B;  3S1J A;  1HSY A;  5AB8 A;  1XZ7 A;  2V1K A;  4H0B A;  3GUQ A;  5M3S A;  4NI1 B;  1QSI B;  1Y5J A;  1O1J B;  1EYX B;  103M A;  2ZFO D;  2ZLW B;  2UUL D;  4PO5 B;  1A3N B;  3ONZ B;  1M6C A;  1Y45 B;  1Y8K B;  3ZJM A;  1J40 A;  1G9V B;  1UT0 A;  1GBU A;  3UHX A;  2FRI X;  1LH2 A;  5HU6 A;  1N9I A;  2C7K A;  2R80 A;  1V75 B;  3WCV A;  4TMA B;  2PEG B;  1COL A;  1C7B B;  3OO4 A;  1Y4R A;  1QPW A;  1HAB A;  3ASE A;  1RQA B;  3HF4 B;  4SDH A;  1HBI A;  1XY0 B;  1UFP A;  4IRO B;  3QZZ A;  1Y0W B;  1Y4V B;  3UH6 A;  1JY7 B;  1OUU A;  4MU5 A;  3UH7 A;  4NI0 A;  4M4B B;  2D5Z B;  1G09 A;  2PGH B;  1XQ5 B;  2VJR B;  4O4Z A;  5F2A A;  1LFL B;  3UHZ A;  1HHO B;  4MQG B;  1YEU B;  5EYJ A;  3QM5 A;  1MBC A;  3G4U A;  3OZV A;  1EBT A;  2GRH A;  5IKS A;  1SPE A;  3FS4 B;  2ZSS A;  1MYT A;  1U7S A;  1UVX A;  3GOU B;  4LPI A;  1MNK A;  1JL6 A;  102M A;  1K1K A;  4YU3 A;  1MCY A;  2HBF A;  3OGB A;  3E4N A;  3AQ6 A;  1JEB A;  1A00 A;  1XZ4 B;  1RQ3 A;  1RTE A;  4ETU A;  1NZ2 A;  2GL3 A;  3AG0 A;  3MJP A;  3W4U A;  3BRP B;  4ZIZ A;  5FVB M;  2EKU A;  1CH4 A;  4F0U A;  1HA7 B;  3IXF A;  3K3U A;  3ZOM A;  2C7L B;  1LH3 A;  2QFK A;  1A3O B;  2D2M C;  3OK5 A;  3ODQ A;  1BZR A;  2G0Z A;  2IN4 A;  1A0Z B;  3AT5 A;  1JY7 A;  1OUU B;  1HBB A;  1S6A A;  5HY8 A;  1HV4 A;  1YVT A;  5HLX A;  1NEJ A;  1IT3 A;  1V07 A;  1Y0W A;  1C7D A;  1Y7D A;  1Y01 B;  2D6C A;  2AA1 A;  2QU0 A;  1ECN A;  1NXF A;  2MGE A;  5AQD M;  1UVJ A;  2C7J A;  4DC8 A;  2HBE A;  2G0X A;  2HCO A;  1EMY A;  5JDO D;  3KVS B;  1SWM A;  1LFY B;  2R1H A;  2VYW A;  5EYS A;  3WI8 A;  2D2N D;  1DXU B;  4Q70 B;  3GKV A;  3WCU B;  6HBI A;  5JOM A;  4ERT A;  3BJ2 A;  1HHS A;  1X9F D;  3GYS A;  3PEL A;  3MYN A;  3V58 B;  2J96 A;  1CG5 A;  1ABY B;  1LFV B;  3S48 C;  1Y4G B;  4PQB A;  3H58 A;  3ECX A;  1S5X A;  1MOB A;  4MXK A;  3BJ2 B;  4O35 A;  3G4V A;  4N6S B;  6HBW A;  3VRG B;  1BBB B;  1PBX A;  2ZS1 A;  1R1X B;  3ECZ A;  3AQ8 A;  1Y7D B;  4F6B A;  1LA6 B;  2HBF B;  2VLX A;  1Y09 B;  2YSK A;  2ZT0 A;  1YDZ A;  3OJ1 A;  3VRF B;  1MDN A;  3ARL A;  2C7L A;  3LHB A;  4HRR A;  3PIA B;  3QJE A;  2R50 A;  4N7O A;  3MVC A;  3MKB B;  1QSH B;  1XXT B;  3L0F B;  4YU3 B;  4GXE B;  4RMP B;  1Y7Z B;  3ZJR A;  4NZI A;  4ILZ A;  3ZTA A;  3TLD A;  4MXL A;  4AE0 A;  1DO3 A;  1G0A B;  3W4U B;  3QZX A;  3D17 A;  3PI1 A;  3G46 A;  3WCP B;  1H97 A;  1R1Y B;  1S5X B;  1HBS A;  1UC3 A;  1B86 A;  1JW8 A;  1YE0 A;  1VXD A;  2ZSX A;  1URY A;  1U7R A;  1ABY A;  3QJB B;  1AJ9 A;  1XZ2 B;  4DWU A;  2JL9 A;  1LHT A;  4C0N A;  5CHQ A;  1MTK A;  1QXD A;  1YIH B;  3WCV B;  1Y45 A;  2OH9 A;  2MB5 A;  2ZLU B;  1BVD A;  3UHN A;  1LFZ B;  4H2L B;  5E29 B;  1BZ6 A;  2HBE B;  3B75 A;  1MTI A;  2HHB A;  4IT8 A;  4IRO A;  3WCW C;  1VXF A;  1LH6 A;  1HDB A;  1GBV B;  1UIW A;  1SDK A;  3QMA A;  3OO4 B;  5AZR A;  3HXN A;  3QQQ A;  3G53 A;  2H35 A;  1CPC A;  2MGH A;  3D4X A;  5KER B;  5D5R A;  2RI4 A;  4OOD A;  3UI0 A;  1MLQ A;  1KD2 B;  1J41 A;  1NAZ A;  1QXE B;  3WCT D;  3ONZ A;  1XZU B;  3WCP A;  3GQR B;  4F6I A;  1UVM A;  1BIJ A;  5B85 A;  1AJG A;  2ZSY A;  3HYU B;  1Y83 A;  1NPF A;  4A8M P;  3WR1 B;  1SI4 A;  1YFF B;  1HA7 A;  3KUN A;  3HRW B;  1KTP A;  1FAW B;  4MQC B;  1HI8 A;  5EOH A;  2WCQ A;  1CLS A;  3O18 A;  2CMM A;  4AVD A;  2V1J A; 
#chains in the Genus database with same CATH homology
 1VXA A;  3WHM B;  5ILM A;  1YDZ B;  1A6K A;  2D5X A;  3ARK A;  1A0Z A;  1V4U B;  4ZVB A;  3NMM B;  1YHU D;  1HBR A;  3P5Q A;  1MZ0 A;  5ILP A;  1Y5K A;  5JGG B;  1SDL A;  1XYE B;  1IDR A;  1MBN A;  2ZS0 A;  2SPM A;  1DXV B;  1DUK A;  3UHG A;  2G14 A;  2MGB A;  1O1N B;  2ZLV B;  4FC3 A;  1J41 B;  3AQ9 A;  1MLU A;  1MOH A;  3LQD A;  2Z6N A;  3G52 A;  2QLS A;  2W72 A;  3A0G B;  1FHJ B;  3K9Z A;  1KD2 A;  1CO9 A;  3A59 B;  1J3Z B;  2BLI A;  1G0B A;  3D4X B;  1ABW A;  3IA3 B;  1IOP A;  3KMF A;  3HF4 A;  1FCS A;  1Y7C B;  1AZI A;  1HAB B;  1HBB B;  1FN3 B;  1RQA A;  1F65 A;  4TWV A;  2AV0 A;  3TM9 A;  1C40 A;  3BA2 A;  1YZI A;  1VRE A;  2QSP B;  1YEQ A;  1DXD A;  4F69 A;  2ZLV A;  1CH1 A;  4NXA A;  3UHB A;  1QI8 B;  3LB3 A;  2LH2 A;  1HDA A;  2ZLX B;  1Y4R B;  1HDS B;  2QLS B;  2AUP A;  3UHT A;  1GCV B;  1NS6 A;  2G11 A;  1HBG A;  1Y4B B;  3GQG A;  1NWI A;  5C6Y A;  3IC2 A;  1MYM A;  1PMB A;  2W6V B;  1Y5K B;  2ZT1 A;  1LHS A;  5EET A;  1VRF A;  1YHU A;  2ZT4 A;  3DR9 A;  5EE4 C;  3ARJ A;  2G0S A;  3NMM A;  4F4O A;  3UH3 A;  4ROM B;  3ZJO A;  3WCT B;  1Q1F A;  2R4W A;  3IC2 B;  3PT7 B;  1C7C A;  1MLR A;  109M A;  3UGY A;  2MGJ A;  3HEO A;  3MKB A;  3UBV A;  1YIE A;  3GQP A;  3PT7 A;  1IWH B;  1V4X B;  1MYH A;  1HGA A;  4HBI A;  1YHR A;  1XY0 A;  2NX0 A;  1O1O B;  4N7P B;  1RPS B;  2VRY A;  1X46 A;  1YVQ A;  1Y8I A;  4HRT B;  5E83 A;  3UHR A;  1XZV A;  1IT2 A;  1MOA A;  1ECA A;  1Y7C A;  3HXN B;  1JF3 A;  1OUT A;  3QJC A;  1XZU A;  3V2V A;  2D60 B;  1HHO A;  1V9Q A;  3AQ7 A;  1LH1 A;  1JP8 A;  1BZZ B;  3CY5 A;  2RI4 B;  1J3F A;  1F5O A;  1CQX A;  2HHB B;  1YEN B;  2ZLU A;  1I3D A;  4MBN A;  3GLN A;  5E29 A;  1MWB A;  1D8U A;  4NI1 A;  1HV4 B;  4HSW A;  2SPN A;  2SPO A;  2NRM A;  1O1M A;  4U8U A;  5CN6 A;  1HDB B;  1JZK A;  3UHI A;  1L2K A;  1LH7 A;  1Y35 B;  2D2N B;  1A6N A;  3ZJQ A;  1J3Y A;  3OO5 A;  1X9F A;  1J7W B;  1DM1 A;  1Y0C B;  1Y4P B;  3O7N A;  4N7P A;  2EVK A;  2GTL A;  4O1T A;  3LB4 A;  2H8F B;  1XYE A;  1NQP A;  2W6Y A;  1CIO A;  1RVW A;  5JDO C;  2XKH A;  105M A;  2D2N C;  3ZH0 A;  3WTG A;  1Y46 A;  1NQP B;  3QM9 A;  1Y7Z A;  2RAO B;  1RVW B;  4N8T B;  1C7C B;  1YG5 A;  1Y5F A;  3U3E A;  1A9W E;  4TWU A;  1BVC A;  1HBR B;  2E2Y A;  1LFL A;  1GLI B;  1DKE A;  2FRF A;  2ZSO A;  4B4Y A;  1MLF A;  4B3W A;  1C40 B;  1NPG A;  1CPW A;  1CMY A;  2HBG A;  1UMO A;  3WCW B;  2V1E A;  3A2G A;  4UUR A;  3OZU A;  3UHK A;  1OUT B;  1RSE A;  1J7W A;  2MGL A;  1KFR A;  3UH5 A;  1A01 B;  2ZSN A;  2ZSQ A;  3M38 A;  2QSP A;  1FN3 A;  3UHS A;  1UIW B;  1QXD B;  3A5A A;  3QJB A;  4NK2 A;  1YE2 B;  1YHE A;  1IRD A;  2OLP A;  3SZK A;  1VHB A;  2DHB B;  1LFZ A;  3TM3 A;  4DC7 A;  1CH5 A;  1I3E A;  5CN7 A;  1N9H A;  3ZJH A;  1MLJ A;  2DN2 B;  1A6M A;  2B7H B;  1BZ0 A;  4NS2 A;  2FAL A;  5E6E A;  1WLA A;  1COH A;  2ZST A;  4M4A A;  1XZ5 B;  3D7O A;  3RJN B;  2BLH A;  3ZJL A;  3B75 B;  3FH9 B;  1O1J A;  2BK9 A;  1Y8H B;  1YGD A;  1UVY A;  4DWT A;  1HAC B;  1CBL A;  1Y4Q A;  3ZOL A;  1CMY B;  3WCT A;  2O5S X;  4PQC A;  1NS9 A;  3SDH A;  4PQ6 A;  1IRC A;  3RGK A;  1JF4 A;  1Y2Z A;  4NXC A;  4WJG A;  1XZ7 B;  1RPS A;  5EV5 A;  1SHR A;  1JP9 A;  4KJT A;  2VEB A;  4F4O B;  1MLH A;  1MWC A;  3S1I A;  5CNB A;  1GZX A;  1HGA B;  1YIE B;  1HDS A;  1M9P A;  1OR6 A;  1LFT B;  1VWT B;  1YEO B;  2QSS B;  3MYM A;  1GCV A;  3A9M A;  4FWZ A;  3BJ3 A;  2EF2 A;  1G09 B;  2PGH A;  3NG6 A;  3R0G A;  1XZ5 A;  3D7O B;  1YGF B;  1A4F B;  1G08 A;  1BIN A;  2DN2 A;  3MBA A;  3PI8 A;  2MYD A;  1Y0A A;  1LJW A;  1HCO B;  5ILE A;  4ROM A;  1O1M B;  1MWD A;  1Y09 A;  2QRW A;  2BWH A;  4L2M A;  2D2M A;  5SW7 B;  1BBB A;  3LB2 A;  1YE2 A;  1FAW A;  2XKG A;  3HYU A;  2V1F A;  2D5Z A;  3ORD A;  1CP0 A;  1HAC A;  1WMU B;  5CHR A;  4M4A B;  1FSL A;  1LA6 A;  2XYK A;  1JDO A;  1RTX A;  4MQH A;  1BAB A;  1MNH A;  2PEG A;  1Y4P A;  4OF9 A;  2HBS A;  1Y7G A;  4PNJ A;  1VXE A;  1FHJ A;  2Z6N B;  3GDJ A;  3HHB A;  2DN1 B;  3A59 A;  1VXB A;  1DXT B;  5C6E A;  5JDO F;  4TYX A;  1DLY A;  1JZM A;  2V1H A;  2GKN A;  1Y0A B;  3MJU B;  1SDL B;  2BW9 M;  4FWY A;  1C7D B;  2MYE A;  1A0U B;  3PI2 A;  1YEN A;  1R1Y A;  1FSX B;  2WY4 A;  1KR7 A;  1K0Y B;  1Y0D B;  1T1N A;  5MBA A;  1CP5 A;  4N8T A;  4H07 A;  1ECO A;  1HJT A;  3EU1 B;  4ODC B;  1OFJ A;  1K1K B;  3LB1 A;  1NZ3 A;  3NG6 B;  4O2G A;  1Y85 A;  1GCW B;  1G0A A;  1EBC A;  3ZJS A;  1B0B A;  3GQP B;  1EWA A;  3E55 A;  3CIU B;  1HGB B;  1A3O A;  2ZS0 C;  4JAC A;  1YGF A;  1LFQ A;  2VM0 A;  1XQ5 A;  2ZWJ A;  2VEE A;  1Y4B A;  2WTG A;  3GQG B;  2D2M D;  3SDN A;  3K8B B;  1CG8 B;  1RQ4 B;  1SI4 B;  2W72 C;  2ZLX A;  2O5B X;  1OFK A;  1Y83 B;  2G3H A;  2EVP A;  1MKO B;  3WCU C;  3PI3 A;  1MNO A;  1SDK B;  3DHT A;  1X3K A;  1JZL A;  4MQK A;  2ZS1 B;  1HRM A;  3WR1 A;  1YOG A;  5E6E B;  3HEN A;  2ZSZ A;  5EUI A;  1CG5 B;  3PI4 A;  1CQ2 A;  2GKM A;  1PBX B;  3NML A;  1Y8H A;  5KER A;  1DWS A;  3UHD A;  1QXE A;  1DO7 A;  1BAB B;  3AQ5 A;  1GJN A;  3BJ1 B;  1IRD B;  3SZK B;  4KMV A;  3EDB A;  5E83 B;  3M39 A;  1HBS B;  3WCW A;  3GDJ B;  1TES A;  2R80 B;  3EDA A;  1Y0T B;  1MLL A;  1YOI A;  1DUO A;  1QSI A;  3M3B A;  2VLZ A;  3E5O A;  1XCH A;  1YMB A;  2G10 A;  3R5I A;  4G51 B;  2ZLW A;  2MHB B;  2ZFO B;  3D1K B;  1ABS A;  1YHR B;  1YH9 B;  2WTH A;  3WCW D;  3WFT A;  3DHR A;  1GDJ A;  2Z8A A;  1J7S B;  4HRT A;  4KN3 A;  3DUT B;  1NWN A;  2HHD B;  2ZS0 B;  1JEB B;  1XZ4 A;  4UIQ A;  3WTG B;  2R4Z A;  4BJA A;  3LQD B;  1DXV A;  1V5H A;  2GTL B;  1MLK A;  108M A;  1RQ4 A;  2ZFO C;  1THB A;  3ECL A;  1YG5 B;  1R1X A;  3QQR A;  5AZQ A;  1F5P A;  4WJG 1;  1BIJ B;  2QFN A;  3VAU A;  3G4Y A;  2HZ3 A;  3S65 B;  1Y35 A;  3BCQ B;  2QMB A;  1CH3 A;  1Y46 B;  1DLW A;  3BJ1 A;  4F6D A;  1HGC B;  2BNL A;  2DN1 A;  3GKT A;  2KSC A;  2M6Z A;  1YHU B;  4G1V A;  1UX8 A;  1LUE A;  2MGA A;  4MQG A;  1MBI A;  2LH5 A;  5KKK A;  2OHA A;  4XS0 B;  2R4X A;  3GQR A;  4QAU A;  1N9X A;  1FSX A;  2Z6T A;  1BUW A;  2W31 A;  3ZJJ A;  1YEQ B;  2EKT A;  3GK9 A;  1DXC A;  2GNW A;  3WCT C;  1LFV A;  3H57 A;  1A3N A;  3KUO A;  3GYS B;  4MQJ A;  4ZVA A;  2G0V A;  3PI9 B;  3EOK A;  2O5Q X;  1GLI A;  5HU6 B;  2GTL C;  1DO4 A;  1DXU A;  2V1G A;  2XKI A;  2ZFB A;  5CN5 A;  2HBS B;  3CIU A;  2ZSP A;  2BKM A;  1URV A;  1BZZ A;  1YVT B;  2AUQ A;  2LH7 A;  3D1A A;  5CN4 A;  1A6G A;  1SHR B;  1WVP A;  1NIH B;  3QM6 A;  1GCW A;  1MYZ A;  4G1B A;  1MBD A;  1MTJ A;  4ESA A;  3G4R A;  2HZ2 A;  3UHH A;  1YHU C;  2H8D A;  3NFE A;  3P5Q B;  5EU2 A;  2ZS1 D;  2MBW A;  1HBA B;  2ZT3 A;  3FH9 A;  3QJD A;  1SPG A;  1O1I B;  4AVE A;  1Y4F A;  3BJ3 B;  3OO5 B;  1S0H B;  1Y2Z B;  1LFQ B;  1Y4V A;  2W6X A;  3EOK B;  2LHB A;  3LR7 A;  2DC3 A;  4U8U B;  1YEV B;  1GDI A;  4YU4 A;  1Y85 B;  1YZI B;  3IC0 B;  3PT8 B;  2MGI A;  4M4B A;  5CMV A;  1O1L B;  1Y8W A;  1HDA B;  1Y22 B;  1IBE A;  1YMC A;  3S66 A;  1CH2 A;  1YIH A;  2ZFB B;  4F6J A;  5CNE A;  2VHB A;  2W6W A;  1DTM A;  3R5I B;  4NI0 B;  4F68 A;  1J3Y B;  1DWR A;  3MN0 A;  1IBE B;  1XZ2 A;  1JL7 A;  4WCH D;  5C6E B;  1Y0T A;  2DXM B;  5CND A;  4F6F A;  1YCA A;  2EB8 A;  1AJ9 B;  1O1P B;  1ITH A;  2C0K A;  4FH6 A;  1H1X A;  3WCU D;  3WFX A;  2LH3 A;  2GRF A;  1A01 A;  3PI8 B;  1O1I A;  4H2L A;  1MBS A;  3ZJI A;  2RAO A;  2Z6S A;  1FDH A;  1S0H A;  3IC0 A;  3NFE B;  2VYY A;  1LFY A;  1SPG B;  3VRE B;  2EB9 A;  2GNV A;  1S61 A;  3V2Z A;  4F6G A;  3NL7 B;  1J52 A;  2AA1 B;  2QU0 B;  3UHQ A;  2NRL A;  3ZJP A;  1IWH A;  5B84 A;  1YGD B;  1YMA A;  4MQC A;  2HHD A;  5KDQ A;  1THB B;  3NL7 A;  1NZ4 A;  1M6M A;  1S69 A;  2LH1 A;  1MNI A;  5CNC A;  1BZ0 B;  1T1N B;  1BZ1 B;  3AT6 A;  5JGG A;  1YFF A;  1NS6 B;  3WFU A;  2NSR A;  3A5B A;  3VRG A;  1J7S A;  2YRS B;  3WHM A;  2OIF A;  3MJU A;  2MGK A;  2D5X B;  1O1K A;  1YEU A;  6HBW B;  2FAM A;  1F63 A;  1S56 A;  106M A;  4NK1 A;  104M A;  3PEL B;  2DHB A;  2V1I A;  2MYB A;  1FDH G;  5ILR A;  1J40 B;  4X0L A;  2HZ1 A;  111M A;  4FWX A;  4XS0 A;  1Y31 A;  2B7H A;  2D2M B;  5SW7 A;  4GZG A;  3HEP A;  1AJH A;  1LTW A;  2MGC A;  1G0B B;  1UFJ A;  2FRK X;  5EUI B;  4X0L B;  3ODQ B;  2O5L X;  3PI9 A;  1DKE B;  1MBA A;  1QPW B;  5HY8 B;  1YVQ B;  1MYG A;  3A5G A;  4MQI A;  101M A;  1HCO A;  1DO1 A;  1ABW B;  2HBD A;  1DTI A;  1BUW B;  3WCV D;  2GRZ A;  1V4X A;  1CG8 A;  2HCO B;  2MGM A;  1MKO A;  4MAX A;  3WCV C;  1W92 A;  1MYF A;  5CNG A;  1GZX B;  1YEV A;  5KDQ B;  4C44 A;  5CN8 A;  1HBH B;  1O1K B;  3ZHW A;  2R4Y A;  1V4W A;  1LJW B;  1Y4F B;  3GOU A;  2OHB A;  1A4F A;  1G08 B;  1X9F C;  1MOC A;  3DHR B;  2O5T X;  3MJP B;  5CN9 A;  2G12 A;  4L7Y B;  1YH9 A;  2GTL D;  1A00 B;  4HHB A;  3DUT A;  2HHE A;  1MNJ A;  5JDO E;  2HBC B;  1YCB A;  1A9W A;  2H35 B;  2O5O X;  1CO8 A;  2W6V A;  1MLG A;  2Z85 A;  2DXM A;  1CLS B;  1FLP A;  4U8U C;  5HAV A;  2O5M X;  2GLN A;  2ZLT A;  2G0R A;  3EU1 A;  4ODC A;  2D2N A;  3HHB B;  1DWT A;  4KMW A;  1HLM A;  3OZW A;  5HBI A;  1Y31 B;  1GBU B;  3WFW A;  1OJ6 A;  2MYA A;  3HRW A;  1BJE A;  5F0B A;  3QJC B;  1J7Y B;  1COH B;  3MOU A;  1MLS A;  1Y5J B;  2HBD B;  3ZJN A;  2BLJ M;  4MQJ B;  1NGK A;  3S66 B;  107M A;  1V75 A;  2IG3 A;  4MQI B;  1YOH A;  2ZSR A;  2LH6 A;  1G9V A;  1BZP A;  1J7Y A;  1UX9 A;  1CH7 A;  3UHY A;  1JPB A;  1MYI A;  1YE0 B;  3A0G A;  4JYQ A;  1MLN A;  3O89 A;  1O1L A;  1Y8W B;  3BOM A;  1VXC A;  1J3Z A;  1GDL A;  1Y22 A;  3HC9 A;  3CY5 B;  1B86 B;  1OBM A;  110M A;  4ROL B;  4FC3 B;  2QSS A;  5D1V A;  112M A;  2AUO A;  4HHB B;  1WMU A;  1LFT A;  4N7N B;  4HSX A;  2ZLT B;  2HBC A;  3D17 B;  1HGC A;  4O4T A;  2SPL A;  4MQK B;  2YRS A;  1XZV B;  1VWT A;  2MGF A;  3UHW A;  2W72 B;  3M3A A;  4U8U D;  1RQ3 B;  1GDK A;  1HBA A;  2ZT2 A;  2FRJ X;  1VXH A;  2HHE B;  4N7O B;  1OR4 A;  3ED9 A;  1M9P B;  1YEO A;  1BZ1 A;  2O58 X;  3AT6 B;  2GDM A;  3RJ6 A;  2ZS1 C;  1Y5F B;  1N9F A;  2H8F A;  1CH9 A;  3QJD B;  3D1A B;  1S5Y B;  1LH5 A;  3FS4 A;  1NIH A;  1QSH A;  2BMM A;  3OVU C;  4ESA B;  5EE4 D;  3G4Q A;  3D1K A;  3BOM B;  2H8D B;  1YHE B;  2DN3 A;  4XDI A;  2MYC A;  1JWN A;  1DXT A;  1MGN A;  2VLY A;  5EQM A;  3QM8 A;  1Y7G B;  3UBC A;  5MBN A;  4G51 A;  1EW6 A;  1JP6 A;  4N7N A;  1Y0C A;  4ROL A;  3UHV A;  4MQH B;  3WCU A;  4FH7 A;  1C7B A;  2NSS A;  1MBO A;  4VHB A;  2R1H B;  1TU9 A;  1NZ5 A;  1MYJ A;  1QI8 A;  3GKV B;  2M6Z B;  1Y4G A;  1NEJ B;  1O1P A;  1MLM A;  1Y8I B;  3UHC A;  3LR9 A;  3AT5 B;  3KMF C;  7HBI A;  2MGD A;  2VYZ A;  1O16 A;  2D60 A;  2MGG A;  1GBV A;  2DN3 B;  2OH8 A;  2QMB B;  3G4W A;  1MOD A;  1Z8U B;  1Y8K A;  3DHT B;  1CBM A;  3S65 A;  4MPM A;  1V4U A;  1ECD A;  3K8B A;  3BCQ A;  1GVH A;  3VHB A;  1S5Y A;  3UHE A;  5HLU A;  4YU4 B;  1HLB A;  3UGZ A;  3PT8 A;  4UZV A;  1O1N A;  1MLO A;  3VRF A;  2AV3 A;  2ZS0 D;  1V4W B;  2JHO A;  1VXG A;  2AUR A;  3PIA A;  3QJE B;  1O1O A;  5CNF A;  3QM7 A;  1CIK A;  1HGB A;  4L7Y A;  3UHU A;  1X9F B;  1A0U A;  5HLQ A;  3VRE A;  1K0Y A;  1Y0D A;  2MHB A;  2ZFO A;  4HRR B;  1Y4Q B;  4MBA A;  3E5I A;  1ASH A;  1HBH A;  1XXT A;  1NS9 B;  3S1J A;  1HSY A;  5AB8 A;  1XZ7 A;  2V1K A;  4H0B A;  5M3S A;  4NI1 B;  1QSI B;  1Y5J A;  1O1J B;  103M A;  2ZFO D;  2ZLW B;  1A3N B;  3ONZ B;  1M6C A;  1Y45 B;  1Y8K B;  3ZJM A;  1J40 A;  1G9V B;  1UT0 A;  1GBU A;  3UHX A;  2FRI X;  1LH2 A;  5HU6 A;  1N9I A;  2R80 A;  1V75 B;  3WCV A;  2PEG B;  1C7B B;  3OO4 A;  1Y4R A;  1QPW A;  1HAB A;  3ASE A;  1RQA B;  3HF4 B;  4SDH A;  1HBI A;  1XY0 B;  1UFP A;  4IRO B;  3QZZ A;  1Y0W B;  1Y4V B;  3UH6 A;  1JY7 B;  1OUU A;  4MU5 A;  3UH7 A;  4NI0 A;  4M4B B;  2D5Z B;  1G09 A;  2PGH B;  1XQ5 B;  4O4Z A;  5F2A A;  1LFL B;  3UHZ A;  1HHO B;  4MQG B;  1YEU B;  5EYJ A;  3QM5 A;  1MBC A;  3G4U A;  3OZV A;  1EBT A;  2GRH A;  5IKS A;  1SPE A;  3FS4 B;  2ZSS A;  1MYT A;  1U7S A;  1UVX A;  3GOU B;  4LPI A;  1MNK A;  1JL6 A;  102M A;  1K1K A;  4YU3 A;  1MCY A;  2HBF A;  3OGB A;  3E4N A;  3AQ6 A;  1JEB A;  1A00 A;  1XZ4 B;  1RQ3 A;  1RTE A;  1NZ2 A;  2GL3 A;  3AG0 A;  3MJP A;  3W4U A;  2EKU A;  1CH4 A;  3IXF A;  3K3U A;  3ZOM A;  1LH3 A;  2QFK A;  1A3O B;  2D2M C;  3OK5 A;  3ODQ A;  1BZR A;  2G0Z A;  2IN4 A;  1A0Z B;  3AT5 A;  1JY7 A;  1OUU B;  1HBB A;  1S6A A;  5HY8 A;  1HV4 A;  1YVT A;  5HLX A;  1NEJ A;  1IT3 A;  1V07 A;  1Y0W A;  1C7D A;  1Y7D A;  1Y01 B;  2D6C A;  2AA1 A;  2QU0 A;  1ECN A;  1NXF A;  2MGE A;  4DC8 A;  2HBE A;  2G0X A;  2HCO A;  1EMY A;  5JDO D;  1SWM A;  1LFY B;  2R1H A;  2VYW A;  5EYS A;  3WI8 A;  2D2N D;  1DXU B;  3GKV A;  3WCU B;  6HBI A;  5JOM A;  3BJ2 A;  1X9F D;  3GYS A;  3PEL A;  3MYN A;  1CG5 A;  1ABY B;  1LFV B;  3S48 C;  1Y4G B;  4PQB A;  3H58 A;  3ECX A;  1S5X A;  1MOB A;  4MXK A;  3BJ2 B;  4O35 A;  3G4V A;  6HBW A;  3VRG B;  1BBB B;  1PBX A;  2ZS1 A;  1R1X B;  3ECZ A;  3AQ8 A;  1Y7D B;  4F6B A;  1LA6 B;  2HBF B;  2VLX A;  1Y09 B;  2ZT0 A;  1YDZ A;  3OJ1 A;  3VRF B;  1MDN A;  3ARL A;  3LHB A;  4HRR A;  3PIA B;  3QJE A;  2R50 A;  4N7O A;  3MVC A;  3MKB B;  1QSH B;  1XXT B;  4YU3 B;  1Y7Z B;  3ZJR A;  4NZI A;  4ILZ A;  3TLD A;  4MXL A;  1DO3 A;  1G0A B;  3W4U B;  3QZX A;  3D17 A;  3PI1 A;  3G46 A;  3WCP B;  1H97 A;  1R1Y B;  1S5X B;  1HBS A;  1UC3 A;  1B86 A;  1JW8 A;  1YE0 A;  1VXD A;  2ZSX A;  1URY A;  1U7R A;  1ABY A;  3QJB B;  1AJ9 A;  1XZ2 B;  4DWU A;  1LHT A;  4C0N A;  5CHQ A;  1MTK A;  1QXD A;  1YIH B;  3WCV B;  1Y45 A;  2OH9 A;  2MB5 A;  2ZLU B;  1BVD A;  3UHN A;  1LFZ B;  4H2L B;  5E29 B;  1BZ6 A;  2HBE B;  3B75 A;  1MTI A;  2HHB A;  4IT8 A;  4IRO A;  3WCW C;  1VXF A;  1LH6 A;  1HDB A;  1GBV B;  1UIW A;  1SDK A;  3QMA A;  3OO4 B;  5AZR A;  3HXN A;  3QQQ A;  3G53 A;  2H35 A;  2MGH A;  3D4X A;  5KER B;  5D5R A;  2RI4 A;  4OOD A;  3UI0 A;  1MLQ A;  1KD2 B;  1J41 A;  1NAZ A;  1QXE B;  3WCT D;  3ONZ A;  1XZU B;  3WCP A;  3GQR B;  4F6I A;  1BIJ A;  5B85 A;  1AJG A;  2ZSY A;  3HYU B;  1Y83 A;  1NPF A;  3WR1 B;  1SI4 A;  1YFF B;  3KUN A;  3HRW B;  1FAW B;  4MQC B;  5EOH A;  1CLS A;  2CMM A;  4AVD A;  2V1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...