1DWTA

Photorelaxed horse heart myoglobin co complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
152
structure length
152
Chain Sequence
GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a New Ligand Binding Intermediate in Wildtype Carbonmonoxy Myoglobin
pubmed doi rcsb
molecule tags Oxygen transport
molecule keywords MYOGLOBIN
total genus 62
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 1999-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1dwtA00
2VYWA 3M3BA 1VWTA 5E29A 3ZOMA 2VYYA 3WCTB 3GKVA 3K8BA 1MZ0A 1N9HA 2GKMA 3AT5B 1GBUB 1HDBA 3HC9A 1DXCA 1UVYA 1JF4A 1RQ3B 1XQ5B 105MA 3H58A 2QSSB 1V4UB 4U8UB 1JP6A 1K0YB 1Y5FB 1C7CA 1Y7ZA 3G4QA 1EBTA 1V4WA 2MHBA 1RQ4B 1LTWA 3K3UA 4MPMA 1LFTB 1HLMA 4ODCB 2G0XA 4PNJA 1Y01B 5KERB 3ECZA 2CMMA 2XKIA 1ECDA 2HBEA 1Y8KA 1TESA 3UH3A 4NK1A 3HXNA 2D2NB 3AG0A 3G4UA 3UHEA 4F6GA 2H35B 3UHGA 2HZ2A 2W72C 4NK2A 1Y4BA 2MGCA 4F4OB 3UHVA 1H1XA 5C6EA 2EB9A 3NFEA 3IXFA 1UT0A 4WJGA 3AQ6A 3GK9A 1SHRA 2HBCA 2LH1A 3ORDA 1YH9B 2QFKA 1MLLA 1QXDB 1Y2ZB 1XXTB 1J3ZA 1J7SA 2DN1A 5JGGB 3MJPA 1LFYA 1MOBA 1MBIA 1YIEB 1XZ7B 4O4TA 3S1IA 1BVCA 1CH7A 4WCHD 3P5QB 2DHBA 4KJTA 4N8TA 1K0YA 2EVPA 2SPOA 1DXTB 3NG6B 1Y8HB 1GLIB 2Z6NA 2ZFOD 4MQCB 1A0UA 1BZRA 2BW9M 1YCAA 1BZ0A 3UBVA 5SW7A 3MYNA 4IROB 1Y5JA 1OJ6A 1O1LA 1GCWA 1NPFA 1YMCA 1LH7A 1A0UB 1GBUA 1U7SA 2R4WA 1NXFA 1GLIA 1B0BA 3DHTB 2O5SX 1Y5KB 1FLPA 1A3OA 3SDNA 2PGHA 1NIHA 1OBMA 2W72A 3GQPB 3ZJHA 5CMVA 4B4YA 3WCPB 2ZLTB 1C40B 1MBSA 1MOAA 2ZSPA 1LH5A 3D17A 4O4ZA 1UIWA 1OR6A 3S66A 3GOUA 4YU3A 1N9FA 3A0GB 1LFLB 3BJ3B 1F5OA 2ZT2A 3B75A 1Y0DB 2GTLC 2FRFA 4XS0B 3E4NA 3BA2A 2FAMA 1Y0TB 3UHXA 1CH2A 1MTJA 4MBNA 1CQXA 1YOHA 3MBAA 4F6BA 2ZLVB 2ZFBA 1IWHA 1O1PA 108MA 2ZS0B 1MWCA 2MYCA 2HZ3A 1ABSA 2QSPA 1HGBA 1O1LB 2O5OX 1Y8WB 2H8FB 2BK9A 2G0RA 5E83A 1Y09A 2BWHA 2XKGA 1S5XB 1THBB 1HDAB 2HHDB 1Y22A 1YFFB 3VREA 1HBGA 1LFQB 3A5GA 2EKUA 4OODA 1R1XB 1LFZA 3EDBA 1QPWB 3VHBA 5CHRA 2ZSXA 4NI1A 1F5PA 1BZ1B 1ECAA 1HBAB 2V1FA 3P5QA 3ZJNA 1YVTB 5IKSA 4L2MA 2AV0A 109MA 1YIEA 1HBHB 1CQ2A 3WCPA 3PIAB 1VRFA 5CNCA 4FWYA 1AZIA 3R5IA 1HHOA 3WCVA 1HGCA 4G1BA 3G53A 1A6GA 1Y5KA 4H0BA 1O1KB 3M3AA 3NL7A 3BOMB 3VAUA 1XY0B 2YRSA 2RI4A 1Y83A 1J7WB 5C6YA 2C0KA 4ROMA 1JF3A 4MQJB 1BZ0B 1LH1A 1SDKB 2DN3A 2D2MB 1HGCB 2ZFOC 3W4UB 1A6KA 1YGFB 2QU0A 2HBDA 5KKKA 1SDKA 1JL6A 1A01A 4UIQA 4F68A 3EU1A 3UHNA 3DHRB 1YMBA 1XYEB 1LFZB 1M6CA 3HRWB 3NL7B 3WCWC 2R4YA 1YMAA 4G51A 3QJBB 2MHBB 4SDHA 1T1NA 4HRRB 3E55A 3OO4A 1Y0AB 3LB4A 3M38A 1YHUB 1R1YA 5F2AA 2DN1B 3EOKB 1Y4VB 1QSHA 3PELB 5EV5A 1O1IA 1F65A 3GQGB 1QPWA 2VRYA 5HLQA 1Y46B 3QJEB 1RSEA 1FN3B 3UHKA 4H07A 1YEVB 1CH3A 2Z8AA 1G08B 1HBRB 1YHEA 3DUTA 1HCOB 2R80A 3R5IB 3RJ6A 3PIAA 1Y8IA 1CLSA 2OH8A 3UHSA 2WTHA 1NZ3A 1V4XB 1YE2B 3HENA 5EQMA 1A9WA 3BJ3A 3O89A 3WCWA 1HBAA 2V1IA 2ZS1A 1MWBA 1LFVB 1AJ9A 2LH3A 4N7OA 1YHRA 3OO5A 3OGBA 3OK5A 3HHBB 2ZLXA 1X3KA 5CNEA 1DO1A 3D1AB 1Y5JB 1IBEA 1DO7A 1CP0A 3QZZA 5SW7B 3TM9A 4U8UA 2GTLA 3D7OA 1URVA 1MOHA 1FHJB 2ZS0A 3UHHA 1O1NA 3QQRA 5AZQA 3WCVD 4O1TA 3UHCA 1GJNA 1Y8HA 4MQJA 4PQBA 2ZT0A 1MNHA 3ZJPA 1M9PB 2HBFB 2E2YA 2HZ1A 3D4XA 3WFTA 3ZOLA 1MODA 2GRHA 1XZ7A 1A3NB 3PI3A 1J7YA 2VM0A 4TWUA 3UH7A 1Y4RA 1Y0AA 1Y7DA 3A9MA 1SPGB 1SPEA 3PT7A 3EDAA 2LHBA 1GBVB 3G4WA 3SDHA 1JEBA 1A01B 4MAXA 5HLUA 4N7NA 1DKEA 3PT8B 2SPLA 3PI4A 1Y7DB 3O7NA 1YH9A 2R1HA 4AVEA 1ABYA 5KDQB 4N7NB 1NIHB 1NEJB 2O5QX 3NMMB 3ED9A 1FDHG 1XZVA 2H8DA 1PBXB 3QZXA 3WCUC 2G12A 3OVUC 4QAUA 5E83B 1Y09B 1O1MB 3S48C 4BJAA 3WCVB 1SI4A 1XZVB 4M4AB 1NQPB 1QXEB 3FH9B 1HBHA 1CBMA 5EOHA 4N7PA 1IT2A 1YHRB 3PI2A 4HHBA 2G0SA 3FS4A 103MA 1Y35A 3SZKB 4MQGB 1MLUA 4PQ6A 1MNKA 1I3DA 4HSXA 3WFUA 1Y7ZB 3KMFA 1S69A 2PEGA 3UHBA 1J7SB 2HHDA 5EU2A 2R4XA 1HBSB 3AQ9A 2M6ZA 1Y0WB 1YZIB 2O5BX 3G52A 1MYZA 2DXMB 1CH4A 4KN3A 3MJUA 1IRDA 2EVKA 1MCYA 3VRGA 3D4XB 1CO9A 4H2LB 2V1HA 2V1KA 2MBWA 1DTIA 3QJCB 1Y0TA 1AJHA 1MYFA 1FHJA 3A5AA 1R1YB 1Y45B 4AVDA 1GCWB 1LFLA 5EYSA 1Y8KB 1Y85B 2MGEA 1YHUD 2ZS1C 1CH1A 3G46A 1SDLB 1X9FC 1MNOA 1C40A 3QM8A 1CG8B 4NXCA 1CG5B 1YE0A 1HGAB 2G0VA 1MNJA 3FS4B 2D5XB 4TWVA 2R1HB 2ZSSA 2AV3A 1NQPA 3A0GA 1Y4GA 1NS6B 1GBVA 1MLFA 3VRFB 1J3YB 3PT7B 1GDIA 2D2NC 1V07A 4ROLB 1YEUB 2ZWJA 3AT5A 3M39A 1HBIA 1Y7CA 1OUUB 2MGIA 5EYJA 4UURA 5E29B 3BCQA 2JHOA 1YOIA 107MA 1VHBA 1Y4VA 4MQKA 3UHTA 1A00A 2AUQA 3MJUB 1Z8UB 3PT8A 3UHDA 2ZSRA 3WCUD 6HBWB 3GYSA 1MWDA 1JL7A 3HYUA 3ARJA 3CIUB 2BKMA 3QJDB 3UGZA 5CN9A 1A6MA 1J41A 1MTIA 3AQ8A 1BZ6A 3PI1A 1L2KA 1YVTA 3UGYA 1JZKA 1MGNA 4NXAA 1C7DA 1SWMA 5EUIA 1KD2B 1QXDA 3U3EA 3A59B 4F6DA 3KUNA 3SZKA 1HRMA 1HSYA 2HBDB 1G0BA 1LFQA 1ABWA 3MJPB 3AT6A 1A6NA 2HCOA 2R4ZA 2MGFA 1DXVA 1MLSA 1HGBB 2ZS0D 2ZSQA 3ZJQA 101MA 2D2NA 1HDBB 1LA6A 3RGKA 3VRGB 2W6YA 2VEEA 3E5OA 4HRTB 3ZJIA 3ZH0A 2ZLVA 2D2MD 5EUIB 1QSHB 5JOMA 5CN5A 1YIHA 4MXLA 1EBCA 5HAVA 4YU3B 2M6ZB 2VHBA 3QM7A 1DWSA 1HBRA 5F0BA 3WR1A 1VXCA 3ONZB 1URYA 2HBSA 2ZT3A 3GDJB 1MNIA 3CY5A 4F6JA 4JYQA 3HEOA 2HHBB 4O35A 4ESAB 1O1IB 1O1JA 1V4UA 1WVPA 1YDZA 3GQRB 4F6FA 1A0ZB 1YDZB 3W4UA 1XQ5A 2MYAA 3NMMA 1O1JB 2D5XA 4DWUA 2MYBA 2H8DB 2BLHA 2GNWA 2RI4B 2RAOA 5JDOF 1J41B 3WCWD 3WR1B 1BIJA 1DWRA 2SPMA 3OZWA 1XXTA 1IT3A 1JEBB 2DN2B 3TM3A 1K1KB 2GRZA 3UI0A 3TLDA 1SPGA 5E6EA 4C44A 1Y45A 2ZLWB 1YGFA 1N9IA 3NFEB 2Z6SA 3ZJJA 1BZ1A 1OUUA 1LH2A 2ZSTA 4DC8A 1MKOA 2QMBA 2Z6TA 4MQIA 1MYMA 1YEOB 5AB8A 1DLYA 3ZHWA 3ASEA 1HBBB 1GDLA 2DXMA 1D8UA 1BUWB 1MYTA 2FALA 4L7YA 2HBSB 1XZ4A 3WCTC 1EW6A 2D6CA 3QM6A 3IA3B 3ZJMA 5ILPA 2V1JA 2ZFOA 3ARLA 2GRFA 2GKNA 4TYXA 1DTMA 1Y0CA 2MGHA 3HEPA 2V1EA 2D5ZB 1CLSB 1Y0CB 2OHAA 2IG3A 5CNBA 3S66B 1Y7GB 3GYSB 1S6AA 1MYGA 2AA1B 1JZMA 1V75B 1S5YA 1BJEA 3LQDB 3GKVB 3K8BB 1X9FD 4F4OA 1QI8B 1JY7B 1DXVB 3A2GA 3DUTB 1RPSB 1AJGA 3A59A 2VLXA 1LJWA 4UZVA 2LH7A 2MGDA 4M4AA 1Y83B 2AA1A 1G0BB 3WCTA 2ZSYA 3V2VA 1MYHA 1U7RA 2VYZA 3OZUA 5MBNA 3QJBA 5HBIA 3LR9A 3GLNA 1YHUC 1UC3A 1M6MA 2ZSZA 6HBIA 1LH3A 1RVWB 2G11A 2ZLUB 2RAOB 2PEGB 1BINA 1W92A 1G09B 1RQAA 3CIUA 1VXGA 1KD2A 2DN2A 1C7CB 5KDQA 3DHTA 1DUOA 4VHBA 1FSXB 2WTGA 7HBIA 1MBDA 1XZ5B 1Y85A 4KMVA 1HDAA 4KMWA 5HU6B 1UFPA 1O1OB 2MGBA 4NI0B 2WY4A 2QSPB 2NSRA 3OZVA 1J7WA 4DC7A 1NAZA 1IWHB 2GTLB 1DXTA 2W6WA 2D60B 3AQ5A 4MQHB 1MYJA 1LUEA 1VREA 1Y7CB 2MGJA 3K9ZA 3QM5A 1V4XA 3OO5B 5E6EB 2ZSNA 1ECOA 3S65A 3WCTD 1XZ2A 1R1XA 2ZS0C 3AQ7A 1YE2A 1J7YB 1F63A 4U8UD 1VXFA 3D1KB 1LJWB 1S5XA 1THBA 1IDRA 3BJ2A 3IC2A 1HCOA 2R80B 1UX8A 2ZFOB 1YENA 1YHEB 1G9VA 1A9WE 1J40A 2NSSA 2G10A 3EOKA 3PELA 3WHMB 1G9VB 2ZSOA 4IT8A 1BUWA 1CH9A 1VXHA 1Y0WA 1YZIA 1Y8WA 2H8FA 2HBEB 3KUOA 3BJ2B 1Q1FA 1LHTA 3G4RA 5HY8B 4XS0A 1FN3A 2EF2A 1S0HB 1J40B 2AUOA 1DUKA 4MU5A 3QMAA 1AJ9B 3OO4B 2MYEA 1UIWB 1NEJA 1G0AA 4HBIA 3HRWA 4N7PB 1HDSA 1XYEA 3MVCA 1HV4A 1MLJA 1K1KA 110MA 4MQGA 1FAWB 5CNFA 1A3OB 1RQ3A 2D2ND 3UH6A 3WCVC 4NZIA 3BJ1A 104MA 1UVXA 1YEOA 1CMYB 3V2ZA 4MQIB 1SHRB 106MA 1BVDA 2YRSB 3EU1B 1DXUB 1COHA 2DN3B 2FRKX 3HF4B 4HHBB 1O1OA 1Y4BB 2BNLA 3WFXA 1YEQB 5B85A 1NS9A 1YG5B 112MA 1N9XA 3LB1A 1YVQB 3PI8A 5EE4D 1ABYB 1WMUB 2R50A 1DM1A 1OFKA 2DHBB 1YE0B 5D5RA 3WTGB 1EMYA 3UHYA 2D5ZA 1JP8A 2ZLUA 1Y4QA 3H57A 2SPNA 1FCSA 1NWIA 1GDJA 3ARKA 1S56A 1V4WB 2HBGA 4FC3B 2FRIX 1XZUB 2O5MX 4YU4B 1HDSB 1MTKA 2QFNA 2QLSB 1SDLA 1PMBA 1TU9A 3ECXA 1OR4A 1NS9B 1MBCA 1IRCA 5HY8A 1Y8IB 4MXKA 1HACA 2B7HB 2GTLD 3QJCA 2GL3A 1DO4A 1S61A 1YEVA 1O1NB 1EWAA 1X9FA 3ZJSA 4ROLA 5C6EB 1YCBA 1XZ2B 5CHQA 1HABA 1CO8A 1B86A 3S65B 1NZ4A 3WHMA 1MYIA 2BLJM 1LFTA 1RQ4A 1B86B 3R0GA 2PGHB 5JDOC 3GOUB 1HABB 5JDOE 3WCUA 1MLGA 1I3EA 4NS2A 3HHBA 4O2GA 2GNVA 3B75B 1S0HA 2Z85A 1MLMA 1OUTB 2HHEB 2QSSA 1SI4B 1Y46A 3QJEA 3HYUB 3GQGA 1HBBA 1G08A 3S1JA 2V1GA 3LB3A 1O16A 4MQKB 1MBAA 1GCVA 1JWNA 2D60A 2NRMA 2ZT1A 1NWNA 1VXAA 4C0NA 1XCHA 4N8TB 1CP5A 2GLNA 1PBXA 3GDJA 5CN7A 2G14A 4MQCA 1IRDB 1XY0A 2QLSA 1CMYA 4NI0A 1DXDA 3NG6A 1J3ZB 1UMOA 1J3YA 3UHZA 5EE4C 1HHOB 3IC0B 1NZ5A 4F6IA 5CN4A 1LH6A 1A00B 1YVQA 3PI8B 2MGAA 1MOCA 1BBBB 1VXDA 1HGAA 4FH6A 3A5BA 1BIJB 1A4FB 1QI8A 1COHB 1WMUA 1Y4RB 3UHQA 2QU0B 1YFFA 3VREB 4GZGA 2EB8A 1GDKA 5MBAA 1V75A 3UBCA 1M9PA 2HBFA 1NZ2A 1O1KA 2EKTA 3HF4A 1MLNA 3MN0A 1JY7A 1KR7A 1XZ5A 1CH5A 4WJG1 1GCVB 3MKBB 2ZLXB 3AT6B 3UH5A 2NX0A 2O5LX 2LH2A 4X0LB 4U8UC 2LH5A 3WI8A 1Y4PA 1C7DB 3G4VA 3D1KA 1MDNA 2OIFA 1JZLA 3IC0A 2MGLA 2G0ZA 1MLQA 3WCWB 1C7BA 1A3NA 5JDOD 4ODCA 2GDMA 1JW8A 2QMBB 2ZLTA 3NMLA 2O58X 4ZVAA 3UHIA 2ZFBB 3QM9A 5ILEA 4LPIA 3LHBA 2W6VA 2HCOB 5EETA 1X9FB 2G3HA 2D2MC 3D7OB 2QRWA 3ZJRA 4IROA 5ILRA 3ZJLA 1MLRA 111MA 1CIKA 4YU4A 1Y7GA 1T1NB 2W31A 1IBEB 4HRRA 1HACB 2B7HA 1VXEA 2MYDA 1V5HA 5D1VA 1Y4QB 1YGDA 1MBOA 2BMMA 1CIOA 1YENB 2MB5A 1Y4PB 3QJDA 2AURA 4FC3A 1RTXA 2MGMA 1BBBA 1BABA 1DO3A 5AZRA 1GVHA 1RTEA 1DKEB 5CN8A 2W72B 3GQPA 3MOUA 2NRLA 3MKBA 4HSWA 3WTGA 2VLYA 4FWXA 3D17B 2MGKA 5HU6A 4JACA 1MLOA 1WLAA 1BZZB 2VLZA 1A0ZA 3ONZA 4G1VA 2Z6NB 1YOGA 2D2MA 3BCQB 4F69A 2OH9A 1CPWA 1VWTB 2H35A 3MYMA 3UHUA 1DXUA 1Y4GB 3ECLA 2ZLWA 3ODQA 3G4YA 5ILMA 1LFYB 1X46A 1HLBA 3BJ1B 1XZUA 1NPGA 5HLXA 3CY5B 1RQAB 1CG8A 1HV4B 3RJNB 4HRTA 4B3WA 3ZJOA 5CNDA 1UFJA 1VXBA 4N7OB 2LH6A 1LA6B 1Y22B 3E5IA 1UX9A 1BZPA 3GKTA 4OF9A 2O5TX 1CG5A 2FRJX 3KMFC 4X0LA 1Y5FA 2DC3A 1GZXB 5B84A 3DR9A 2HBCB 2ZT4A 1RVWA 1KFRA 2KSCA 5JGGA 5M3SA 5CN6A 4ILZA 1QXEA 1YEQA 2W6VB 1XZ4B 1Y31B 1GZXA 1Y2ZA 2OLPA 2HHBA 4ESAA 3LR7A 1O1MA 1IOPA 4H2LA 3LQDA 1MKOB 5KERA 4DWTA 3BOMA 1C7BB 4PQCA 3QQQA 1HJTA 1LFVA 1J52A 1RPSA 3WCUB 1NGKA 1Y31A 1HBSA 3IC2B 4ZVBA 4FH7A 1ITHA 1DLWA 1JP9A 3HXNB 1S5YB 1H97A 3OJ1A 3UHRA 2ZS1D 2AUPA 4NI1B 4MQHA 4MBAA 1ASHA 1OFJA 3WFWA 1CBLA 1FDHA 3FH9A 2MGGA 102MA 3LB2A 3DHRA 2XKHA 1Y4FB 1DWTA 1Y35B 1J3FA 1LHSA 1FSLA 2W6XA 4M4BA 3PI9A 1JDOA 4FWZA 1FSXA 1ABWB 3GQRA 1O1PB 1YHUA 2OHBA 4M4BB 1MLKA 4L7YB 1A4FA 1YEUA 1BABB 1JPBA 3UHWA 4ROMB 1ECNA 3VRFA 1Y4FA 5CNGA 3D1AA 2IN4A 4G51B 1QSIB 1V9QA 1G09A 1OUTA 1Y0DA 2HHEA 1BZZA 2VEBA 1QSIA 2BLIA 2ZS1B 1FAWA 1NS6A 2XYKA 6HBWA 1MLHA 3ODQB 1YGDB 1MBNA 1YIHB 1YG5A 3PI9B 1G0AB 4XDIA
chains in the Genus database with same CATH superfamily
2VYWA 3M3BA 1VWTA 5E29A 3ZOMA 2VYYA 3WCTB 3GKVA 3K8BA 1MZ0A 1N9HA 2GKMA 3AT5B 1GBUB 1HDBA 3HC9A 1DXCA 1UVYA 1JF4A 1RQ3B 1XQ5B 105MA 3H58A 2J96A 2QSSB 2VJTB 4TMAB 1V4UB 4U8UB 1JP6A 1K0YB 2VJHA 1Y5FB 1C7CA 3O18A 1Y7ZA 3G4QA 4RMPB 1EBTA 1V4WA 2MHBA 1RQ4B 1LTWA 3K3UA 4MPMA 1LFTB 4Z8KA 1HLMA 4ODCB 2G0XA 4PNJA 1Y01B 5KERB 3ECZA 2CMMA 2XKIA 1ECDA 2HBEA 1Y8KA 4LMXB 1TESA 3UH3A 4NK1A 3HXNA 2D2NB 3AG0A 3G4UA 3V57A 3UHEA 4F6GA 2H35B 1HA7A 5FVBM 3UHGA 2HZ2A 2W72C 4NK2A 1Y4BA 2MGCA 4F4OB 1UVKA 3UHVA 1H1XA 5C6EA 2EB9A 2JL9A 3NFEA 3IXFA 4A8FA 1UT0A 4WJGA 3AQ6A 3GK9A 1SHRA 2HBCA 2LH1A 3ORDA 4GY3A 1YH9B 1LIAA 2QFKA 1MLLA 1KTPA 1QXDB 1Y2ZB 3PMCA 1XXTB 1J3ZA 1J7SA 2DN1A 5JGGB 3MJPA 1LFYA 1MOBA 1MBIA 1YIEB 1XZ7B 4O4TA 3S1IA 1BVCA 1CH7A 4WCHD 3P5QB 2DHBA 4KJTA 4N8TA 3DBJB 1K0YA 2VJHB 2EVPA 2SPOA 1DXTB 4LM6B 3NG6B 1Y8HB 1GLIB 2Z6NA 4H0MA 2ZFOD 4MQCB 1A0UA 1BZRA 2BW9M 1YCAA 1BZ0A 3UBVA 5SW7A 3MYNA 4IROB 1Y5JA 1OJ6A 1O1LA 1GCWA 1NPFA 1YMCA 3FEWX 1LH7A 1A0UB 1GBUA 1U7SA 2R4WA 1NXFA 1GLIA 1B0BA 3DHTB 2O5SX 1F99A 1Y5KB 1FLPA 1A3OA 3SDNA 2PGHA 1NIHA 1OBMA 2W72A 3GQPB 3ZJHA 5CMVA 4B4YA 3WCPB 2ZLTB 1C40B 1MBSA 1MOAA 2ZSPA 1LH5A 2UUNB 3D17A 4O4ZA 1UIWA 1OR6A 3S66A 3GOUA 4YU3A 1N9FA 3A0GB 1LFLB 3BJ3B 1F5OA 2ZT2A 3B75A 1Y0DB 2GTLC 2FRFA 3E4NA 4XS0B 3BA2A 2FAMA 1Y0TB 3UHXA 1CH2A 1MTJA 4MBNA 1CQXA 1YOHA 3MBAA 4F6BA 2ZLVB 3O18B 2C7LB 2ZFBA 1IWHA 1O1PA 108MA 2ZS0B 1MWCA 2MYCA 2HZ3A 1ABSA 2QSPA 1HGBA 1O1LB 2O5OX 1Y8WB 2H8FB 2BK9A 2G0RA 1Y09A 5E83A 2BWHA 2XKGA 1S5XB 1THBB 1HDAB 2HHDB 1Y22A 1YFFB 3VREA 1HBGA 1LFQB 3A5GA 2EKUA 4OODA 4AE0A 4Z8KB 1R1XB 1LFZA 3EDBA 1QPWB 3VHBA 2ZSXA 4NI1A 5CHRA 1F5PA 1BZ1B 1ECAA 5B13G 1HBAB 2V1FA 3P5QA 3ZJNA 1YVTB 5IKSA 4L2MA 2AV0A 109MA 1YIEA 1HBHB 1CQ2A 3WCPA 1XDTT 3PIAB 1VRFA 5CNCA 4FWYA 1AZIA 3R5IA 1HHOA 1JBOA 3WCVA 1HGCA 4G1BA 3G53A 1A6GA 1Y5KA 4H0BA 3M3AA 3NL7A 1O1KB 3BOMB 3VAUA 1XY0B 2YRSA 2RI4A 1Y83A 3L0FA 1J7WB 5C6YA 2C0KA 4ROMA 1JF3A 4MQJB 1BZ0B 1LH1A 1SDKB 2DN3A 2D2MB 1HGCB 2ZFOC 3W4UB 1A6KA 1YGFB 2DKCA 2QU0A 2HBDA 5KKKA 1SDKA 2WCRA 1JL6A 1A01A 3KVSB 4UIQA 4F68A 3EU1A 3UHNA 3DHRB 1YMBA 1XYEB 1LFZB 1M6CA 2BV8A 1ON7A 3HRWB 3NL7B 3WCWC 2R4YA 1YMAA 4G51A 3QJBB 2MHBB 4SDHA 1PHNB 1T1NA 4HRRB 3E55A 3OO4A 1Y0AB 3LB4A 3M38A 1YHUB 1R1YA 5F2AA 2DN1B 1XG0C 3EOKB 1Y4VB 1QSHA 3PELB 4XXIA 5EV5A 1O1IA 1F65A 3GQGB 1QPWA 2VRYA 5HLQA 3BRPA 2UULA 1Y46B 3QJEB 1RSEA 1FN3B 3UHKA 4H07A 1YEVB 1CH3A 2Z8AA 1G08B 1HBRB 1YHEA 3DUTA 1HCOB 2R80A 3R5IB 3RJ6A 3PIAA 1Y8IA 1CLSA 2OH8A 3UHSA 2WTHA 1GH0B 1NZ3A 1V4XB 1YE2B 3HENA 2VJRA 1KN1A 5EQMA 1A9WA 2VMLA 3BJ3A 3O89A 3WCWA 1HBAA 2V1IA 2ZS1A 2VMLB 1MWBA 1LFVB 1AJ9A 2LH3A 4N7OA 1YHRA 3OO5A 3OGBA 3OK5A 3HHBB 1HI0P 2ZLXA 1X3KA 5CNEA 1DO1A 3D1AB 1Y5JB 1IBEA 1DO7A 1CP0A 3QZZA 5SW7B 4ESUA 3TM9A 4U8UA 2GTLA 3D7OA 1URVA 1MOHA 1FHJB 2ZS0A 3UHHA 1O1NA 3QQRA 5AZQA 3WCVD 4O1TA 3UHCA 4B02A 1UVMA 3BRPB 1GJNA 1Y8HA 4MQJA 4PQBA 2ZT0A 1MNHA 3LQ9A 3ZJPA 1M9PB 2HBFB 2E2YA 2HZ1A 3D4XA 3WFTA 3ZOLA 1MODA 2GRHA 1XZ7A 1A3NB 3PI3A 1J7YA 1SGKA 2VM0A 4TWUA 2UULB 3UH7A 1Y4RA 1Y0AA 1Y7DA 3A9MA 1SPGB 1SPEA 3PT7A 3EDAA 2LHBA 1GBVB 3G4WA 3SDHA 1JEBA 1A01B 3KVSA 2UUMB 4MAXA 5HLUA 4N7NA 1DKEA 3PT8B 2SPLA 3PI4A 1Y7DB 3O7NA 1YH9A 2R1HA 4XXKA 4AVEA 1ABYA 5KDQB 4N7NB 1NIHB 1NEJB 2O5QX 3NMMB 3VNCA 3ED9A 1FDHG 1XZVA 2H8DA 2WCQA 1PBXB 3QZXA 3WCUC 2G12A 3OVUC 1Y09B 4QAUA 5E83B 1O1MB 3S48C 4BJAA 3WCVB 1SI4A 1XZVB 4M4AB 1NQPB 1QXEB 3FH9B 1HBHA 1CBMA 5EOHA 4N7PA 1IT2A 1YHRB 3PI2A 4HHBA 2G0SA 3FS4A 103MA 1Y35A 3SZKB 4MQGB 1MLUA 4PQ6A 1MNKA 1I3DA 4HSXA 3WFUA 1Y7ZB 3L0FB 3KMFA 1S69A 2PEGA 3UHBA 4AE1A 1J7SB 1DDTA 2HHDA 5EU2A 2R4XA 1HBSB 3AQ9A 2M6ZA 1Y0WB 1YZIB 2O5BX 3G52A 1MYZA 2DXMB 1CH4A 4KN3A 3MJUA 1IRDA 2EVKA 1MCYA 3VRGA 3D4XB 1GH0A 1XF6C 1CO9A 4H2LB 2V1HA 2V1KA 2C7LA 2MBWA 1DTIA 3QJCB 2C7JA 1Y0TA 1AJHA 1MYFA 1FHJA 1ALLA 3A5AA 1R1YB 1Y45B 4AVDA 1GCWB 1LFLA 5EYSA 1Y8KB 1Y85B 2MGEA 1YHUD 2ZS1C 1CH1A 3G46A 1SDLB 1X9FC 4A8YA 1MNOA 1C40A 3QM8A 1CG8B 4NXCA 1CG5B 1YE0A 1HGAB 2G0VA 1MNJA 3FS4B 2D5XB 4TWVA 2R1HB 2ZSSA 2AV3A 1NQPA 3A0GA 1Y4GA 1NS6B 1GBVA 1MLFA 3VRFB 1J3YB 3PT7B 1GDIA 2D2NC 1V07A 3NUHB 4ROLB 1YEUB 2X49A 2ZWJA 3AT5A 1UVNA 3M39A 1HBIA 1Y7CA 1OUUB 2MGIA 1QGWC 5EYJA 4UURA 4F0UA 4A8MP 5E29B 3BCQA 2JHOA 1YOIA 107MA 1VHBA 1Y4VA 4F0TB 4MQKA 3UHTA 1A00A 2AUQA 3MJUB 1Z8UB 3PT8A 3UHDA 2ZSRA 3WCUD 6HBWB 3GYSA 1MWDA 1PHNA 1JL7A 3HYUA 2UUMX 3ARJA 3CIUB 4ETUA 2BKMA 3QJDB 3UGZA 4YJJA 5CN9A 1A6MA 1J41A 1MTIA 3AQ8A 1BZ6A 3PI1A 1L2KA 1YVTA 3UGYA 1JZKA 1MGNA 4NXAA 1C7DA 1SWMA 5EUIA 1KD2B 1KTPB 1QXDA 3U3EA 3A59B 4F6DA 3KUNA 3SZKA 1HRMA 1HSYA 2HBDB 1HA7B 1G0BA 1LFQA 1ABWA 3MJPB 3AT6A 1A6NA 2HCOA 2R4ZA 4ERVA 2MGFA 1DXVA 1MLSA 1HGBB 2ZS0D 2ZSQA 1I7YA 3ZJQA 101MA 2D2NA 1HDBB 1LA6A 3RGKA 3VRGB 2W6YA 2VEEA 3E5OA 4HRTB 3ZJIA 3ZH0A 2ZLVA 2D2MD 5EUIB 5B13A 1QSHB 5JOMA 5CN5A 1YIHA 4MXLA 1EBCA 5HAVA 4YU3B 2M6ZB 2VHBA 3QM7A 1DWSA 4L1EB 1HBRA 5F0BA 3WR1A 1VXCA 3ONZB 1URYA 2HBSA 2ZT3A 3GDJB 1MNIA 3CY5A 4F6JA 4JYQA 3HEOA 2HHBB 4O35A 4ESAB 1F0LA 1O1IB 1O1JA 1V4UA 1WVPA 1YDZA 4HH1A 3GQRB 4F6FA 1A0ZB 1YDZB 3W4UA 1XQ5A 2MYAA 3NMMA 1O1JB 2D5XA 4DWUA 2MYBA 2H8DB 2BLHA 2GNWA 2RI4B 2RAOA 5JDOF 1J41B 3WCWD 3WR1B 2BV8B 1BIJA 1DWRA 2SPMA 3OZWA 1XXTA 1IT3A 1JEBB 2DN2B 3TM3A 1K1KB 2GRZA 3UI0A 3TLDA 1SPGA 5E6EA 1EYXB 4C44A 1Y45A 4ZIZB 2ZLWB 2YSKA 1YGFA 1N9IA 2UUMA 3NFEB 2Z6SA 2UULH 3ZJJA 1BZ1A 1OUUA 1LH2A 2ZSTA 4DC8A 1MKOA 2QMBA 2Z6TA 4MQIA 1MYMA 1I7YB 1YEOB 5AB8A 1DLYA 1HHTP 3ZHWA 3ASEA 1HBBB 1GDLA 2DXMA 1D8UA 1BUWB 1MDTA 1MYTA 2FALA 4L7YA 2HBSB 1NY9A 1XZ4A 3WCTC 1EW6A 2D6CA 3QM6A 5AQDA 3IA3B 3ZJMA 5ILPA 3RQRA 1B8DB 2V1JA 2ZFOA 3ARLA 2GRFA 2GKNA 4TYXA 1B33A 1DTMA 1Y0CA 2MGHA 3HEPA 2V1EA 2D5ZB 1CLSB 1Y0CB 2OHAA 2IG3A 5CNBA 3S66B 2V8AA 1Y7GB 3GYSB 1S6AA 4GY3B 1MYGA 2AA1B 1JZMA 1V75B 1S5YA 1BJEA 3LQDB 4A8WA 3GKVB 3K8BB 1X9FD 4F4OA 1QI8B 1JY7B 1DXVB 3A2GA 3DUTB 1RPSB 1AJGA 3A59A 2VLXA 1LJWA 4UZVA 2LH7A 2JLGA 2MGDA 4M4AA 1Y83B 2AA1A 1G0BB 3WCTA 2ZSYA 3V2VA 4GXEA 1CIIA 1MYHA 1U7RA 2VYZA 3OZUA 5MBNA 3QJBA 5HBIA 3LR9A 3GLNA 1YHUC 4A8QA 1UC3A 1M6MA 2ZSZA 6HBIA 1LH3A 1RVWB 2G11A 2ZLUB 2RAOB 2PEGB 1BINA 1W92A 1G09B 1RQAA 3CIUA 1VXGA 3DBJA 1KD2A 4BJUA 3O2CA 2DN2A 1C7CB 5KDQA 3DHTA 1DUOA 4PO5A 4VHBA 1FSXB 2WTGA 7HBIA 1MBDA 1XZ5B 1Y85A 4KMVA 1HDAA 4KMWA 5HU6B 1UFPA 1O1OB 2MGBA 4NI0B 2WY4A 2QSPB 2NSRA 3OZVA 1J7WA 4DC7A 1NAZA 2UULD 1IWHB 2GTLB 1DXTA 2W6WA 4F0UB 5FVBA 2D60B 3AQ5A 4MQHB 1MYJA 1LUEA 1VREA 1Y7CB 2MGJA 3K9ZA 3QM5A 1V4XA 3OO5B 4ETTA 5E6EB 2ZSNA 1ECOA 4N6SA 3S65A 3WCTD 1XZ2A 1R1XA 4N6SB 2ZS0C 3AQ7A 1YE2A 1J7YB 1F63A 2DKAA 4U8UD 1VXFA 4A8SA 3D1KB 3V58A 1LJWB 1S5XA 1THBA 1IDRA 3BJ2A 3IC2A 1HCOA 2R80B 1UX8A 2ZFOB 1YENA 1YHEB 1G9VA 1A9WE 1J40A 2NSSA 2VJTA 2G10A 3EOKA 3PELA 3WHMB 1G9VB 2ZSOA 4IT8A 1BUWA 1CH9A 1VXHA 1Y0WA 1YZIA 1Y8WA 2H8FA 2HBEB 3KUOA 3BJ2B 1Q1FA 1LHTA 3G4RA 5HY8B 4XS0A 1FN3A 2EF2A 1S0HB 1J40B 2AUOA 1DUKA 4MU5A 3QMAA 1AJ9B 3OO4B 2MYEA 1UIWB 1NEJA 3MWNA 1G0AA 4HBIA 1ON7B 3HRWA 4N7PB 1HDSA 1XYEA 3MVCA 1UVLA 1HV4A 1MLJA 1K1KA 110MA 4MQGA 1FAWB 5CNFA 1A3OB 1RQ3A 2D2ND 3UH6A 3WCVC 4NZIA 3BJ1A 104MA 1UVXA 1YEOA 1CMYB 3V2ZA 4MQIB 1SHRB 106MA 1BVDA 2YRSB 3EU1B 1DXUB 1COHA 2DN3B 2FRKX 3HF4B 4HHBB 1O1OA 1Y4BB 2BNLA 3WFXA 1YEQB 5B85A 1NS9A 1YG5B 112MA 1N9XA 3LB1A 1YVQB 3PI8A 5EE4D 1ABYB 1WMUB 2R50A 1DM1A 1OFKA 2DHBB 1UVIA 1YE0B 5D5RA 3WTGB 1EMYA 3UHYA 2D5ZA 1JP8A 2ZLUA 1Y4QA 3H57A 2SPNA 1FCSA 1NWIA 1GDJA 3ARKA 1S56A 1V4WB 2HBGA 4FC3B 2FRIX 1XZUB 2O5MX 4YU4B 1HDSB 1MTKA 2QFNA 2QLSB 1SDLA 1PMBA 1TU9A 3ECXA 1OR4A 1NS9B 1MBCA 1IRCA 5HY8A 1Y8IB 4MXKA 1HACA 2B7HB 2GTLD 3QJCA 2GL3A 1DO4A 1S61A 1YEVA 1O1NB 1EWAA 1X9FA 3ZJSA 4ROLA 5C6EB 1YCBA 1XZ2B 5CHQA 1HABA 1CO8A 1B86A 3S65B 1NZ4A 2C7KB 3WHMA 4A8KA 2VJRB 1MYIA 2BLJM 1LFTA 1RQ4A 1B86B 3R0GA 2PGHB 5JDOC 3GOUB 1HABB 5JDOE 3WCUA 1B8DA 1I3EA 1MLGA 4NS2A 3HHBA 4O2GA 2GNVA 3B75B 1S0HA 2Z85A 1MLMA 2C7KA 1OUTB 2HHEB 2QSSA 1SI4B 1Y46A 3QJEA 3HYUB 4ERTA 3GQGA 1HBBA 1G08A 3S1JA 2V1GA 3LB3A 1O16A 4MQKB 1MBAA 4F0TA 1GCVA 2C7JB 1JWNA 2D60A 2NRMA 2ZT1A 1NWNA 1VXAA 4C0NA 1XCHA 4N8TB 1CP5A 2GLNA 1PBXA 3GDJA 5CN7A 2G14A 4MQCA 3PMDA 1IRDB 1XY0A 2QLSA 1CMYA 4NI0A 1DXDA 3NG6A 1J3ZB 1UMOA 1J3YA 3UHZA 5EE4C 1JBOB 1HHOB 3IC0B 1NZ5A 4F6IA 5CN4A 1LH6A 1A00B 1EYXA 1YVQA 3PI8B 2MGAA 1MOCA 1BBBB 1VXDA 1HGAA 4FH6A 3A5BA 1BIJB 1A4FB 1QI8A 1COHB 1WMUA 1Y4RB 3UHQA 2QU0B 1YFFA 3VREB 4GZGA 2EB8A 1GDKA 5MBAA 1V75A 3UBCA 2DKDA 1M9PA 2HBFA 1NZ2A 1O1KA 2EKTA 3HF4A 1WACA 1MLNA 3MN0A 1JY7A 1KR7A 1XZ5A 1CH5A 4WJG1 1GCVB 3MKBB 4LMSB 2ZLXB 3AT6B 3UH5A 2NX0A 2O5LX 2LH2A 4X0LB 4U8UC 2LH5A 3WI8A 1Y4PA 1C7DB 3G4VA 3D1KA 1MDNA 2OIFA 2I88A 1JZLA 4L1EA 3IC0A 1TOXA 2MGLA 2G0ZA 1MLQA 3WCWB 1C7BA 1A3NA 5JDOD 4ODCA 2GDMA 1JW8A 2QMBB 1B33B 2ZLTA 3NMLA 2O58X 4ZVAA 3UHIA 2ZFBB 3QM9A 5ILEA 4LPIA 3LHBA 2W6VA 2HCOB 3V58B 5EETA 1X9FB 2G3HA 1HHSA 2D2MC 3D7OB 2QRWA 3ZJRA 4IROA 5ILRA 3ZJLA 1MLRA 111MA 1CIKA 4YU4A 1Y7GA 1T1NB 2W31A 1IBEB 4HRRA 1HACB 2B7HA 1VXEA 2MYDA 1V5HA 5D1VA 1Y4QB 1YGDA 1MBOA 2BMMA 1CIOA 1YENB 2MB5A 1Y4PB 3QJDA 2AURA 4FC3A 1RTXA 2MGMA 1BBBA 1BABA 1DO3A 5AZRA 1GVHA 1RTEA 1DKEB 5CN8A 2W72B 3GQPA 3MOUA 2NRLA 3MKBA 4HSWA 3WTGA 1UVJA 2VLYA 4FWXA 1F99B 3D17B 2MGKA 1LIAB 5HU6A 4JACA 1MLOA 1WLAA 1BZZB 2VLZA 1A0ZA 3ONZA 4G1VA 2Z6NB 1YOGA 4PO5B 2D2MA 3ZTAA 3BCQB 4F69A 2OH9A 1CPWA 1VWTB 2H35A 3O2CB 3MYMA 3UHUA 1DXUA 1Y4GB 3GIOA 3ECLA 2ZLWA 1COLA 3ODQA 3G4YA 5ILMA 1LFYB 1X46A 1HLBA 3BJ1B 1XZUA 1NPGA 5HLXA 3CY5B 4Q70B 1HI8A 1RQAB 1CG8A 1HV4B 3RJNB 4HRTA 4B3WA 3ZJOA 5CNDA 1UFJA 1VXBA 4N7OB 2LH6A 2UULC 1LA6B 1Y22B 3E5IA 1UX9A 1BZPA 3GKTA 4OF9A 2O5TX 1CG5A 2FRJX 3KMFC 4X0LA 1Y5FA 2DC3A 1GZXB 5B84A 4BS9A 1HI1A 3DR9A 2HBCB 2ZT4A 1RH1A 1RVWA 1KFRA 2KSCA 5JGGA 5M3SA 5CN6A 4ILZA 1QXEA 1YEQA 2W6VB 1A87A 1XZ4B 1CPCB 1Y31B 1GZXA 1Y2ZA 2OLPA 2HHBA 4ESAA 4GXEB 3LR7A 1O1MA 1IOPA 4H2LA 2X4AA 3V57B 3LQDA 1MKOB 5KERA 4DWTA 3BOMA 1C7BB 4HH0A 4PQCA 3QQQA 1HJTA 1LFVA 1J52A 1RPSA 3WCUB 2V8AB 1NGKA 1CPCA 1Y31A 1HBSA 3IC2B 4ETVA 4RMPA 4ZVBA 4FH7A 1ITHA 1DLWA 1JP9A 3HXNB 1KN1B 1S5YB 1H97A 3OJ1A 3UHRA 2ZS1D 2AUPA 4NI1B 4MQHA 4MBAA 1ASHA 1OFJA 3WFWA 1CBLA 2JLFA 1FDHA 3FH9A 2MGGA 102MA 4YJJB 3LB2A 3DHRA 2XKHA 1Y4FB 1DWTA 1Y35B 1J3FA 1LHSA 1FSLA 2W6XA 4M4BA 3PI9A 1JDOA 4FWZA 5AQDM 1FSXA 1ABWB 3GQRA 1O1PB 1YHUA 2OHBA 4M4BB 1MLKA 4L7YB 1A4FA 1YEUA 1BABB 3GUQA 2UUND 1JPBA 3UHWA 4ROMB 1ECNA 3VRFA 1Y4FA 5CNGA 3D1AA 2IN4A 4G51B 1QSIB 1V9QA 1G09A 4H0MB 1OUTA 1Y0DA 2HHEA 1BZZA 2VEBA 1QSIA 2BLIA 2ZS1B 1FAWA 1NS6A 2XYKA 4Q70A 6HBWA 2UUNA 1MLHA 4ZIZA 4A8OA 3ODQB 1YGDB 1MBNA 1ALLB 1YIHB 1YG5A 3PI9B 1G0AB 4XDIA
chains in the Genus database with same CATH topology
2VYWA 3M3BA 1VWTA 5E29A 3ZOMA 2VYYA 3WCTB 3GKVA 3K8BA 1MZ0A 1N9HA 2GKMA 3AT5B 1GBUB 1HDBA 3HC9A 1DXCA 1UVYA 1JF4A 1RQ3B 1XQ5B 105MA 3H58A 2QSSB 1V4UB 4U8UB 1JP6A 1K0YB 1Y5FB 1C7CA 1Y7ZA 3G4QA 1EBTA 1V4WA 2MHBA 1RQ4B 1LTWA 3K3UA 4MPMA 1LFTB 1HLMA 4ODCB 2G0XA 4PNJA 1Y01B 5KERB 3ECZA 2CMMA 2XKIA 1ECDA 2HBEA 1Y8KA 1TESA 3UH3A 4NK1A 3HXNA 2D2NB 3AG0A 3G4UA 3UHEA 4F6GA 2H35B 3UHGA 2HZ2A 2W72C 4NK2A 1Y4BA 2MGCA 4F4OB 3UHVA 1H1XA 5C6EA 2EB9A 3NFEA 3IXFA 1UT0A 4WJGA 3AQ6A 3GK9A 1SHRA 2HBCA 2LH1A 3ORDA 1YH9B 2QFKA 1MLLA 1QXDB 1Y2ZB 1XXTB 1J3ZA 1J7SA 2DN1A 5JGGB 3MJPA 1LFYA 1MOBA 1MBIA 1YIEB 1XZ7B 4O4TA 3S1IA 1BVCA 1CH7A 4WCHD 3P5QB 2DHBA 4KJTA 4N8TA 1K0YA 2EVPA 2SPOA 1DXTB 3NG6B 1Y8HB 1GLIB 2Z6NA 2ZFOD 4MQCB 1A0UA 1BZRA 2BW9M 1YCAA 1BZ0A 3UBVA 5SW7A 3MYNA 4IROB 1Y5JA 1OJ6A 1O1LA 1GCWA 1NPFA 1YMCA 1LH7A 1A0UB 1GBUA 1U7SA 2R4WA 1NXFA 1GLIA 1B0BA 3DHTB 2O5SX 1Y5KB 1FLPA 1A3OA 3SDNA 2PGHA 1NIHA 1OBMA 2W72A 3GQPB 3ZJHA 5CMVA 4B4YA 3WCPB 2ZLTB 1C40B 1MBSA 1MOAA 2ZSPA 1LH5A 3D17A 4O4ZA 1UIWA 1OR6A 3S66A 3GOUA 4YU3A 1N9FA 3A0GB 1LFLB 3BJ3B 1F5OA 2ZT2A 3B75A 1Y0DB 2GTLC 2FRFA 4XS0B 3E4NA 3BA2A 2FAMA 1Y0TB 3UHXA 1CH2A 1MTJA 4MBNA 1CQXA 1YOHA 3MBAA 4F6BA 2ZLVB 2ZFBA 1IWHA 1O1PA 108MA 2ZS0B 1MWCA 2MYCA 2HZ3A 1ABSA 2QSPA 1HGBA 1O1LB 2O5OX 1Y8WB 2H8FB 2BK9A 2G0RA 5E83A 1Y09A 2BWHA 2XKGA 1S5XB 1THBB 1HDAB 2HHDB 1Y22A 1YFFB 3VREA 1HBGA 1LFQB 3A5GA 2EKUA 4OODA 1R1XB 1LFZA 3EDBA 1QPWB 3VHBA 5CHRA 2ZSXA 4NI1A 1F5PA 1BZ1B 1ECAA 1HBAB 2V1FA 3P5QA 3ZJNA 1YVTB 5IKSA 4L2MA 2AV0A 109MA 1YIEA 1HBHB 1CQ2A 3WCPA 3PIAB 1VRFA 5CNCA 4FWYA 1AZIA 3R5IA 1HHOA 3WCVA 1HGCA 4G1BA 3G53A 1A6GA 1Y5KA 4H0BA 1O1KB 3M3AA 3NL7A 3BOMB 3VAUA 1XY0B 2YRSA 2RI4A 1Y83A 1J7WB 5C6YA 2C0KA 4ROMA 1JF3A 4MQJB 1BZ0B 1LH1A 1SDKB 2DN3A 2D2MB 1HGCB 2ZFOC 3W4UB 1A6KA 1YGFB 2QU0A 2HBDA 5KKKA 1SDKA 1JL6A 1A01A 4UIQA 4F68A 3EU1A 3UHNA 3DHRB 1YMBA 1XYEB 1LFZB 1M6CA 3HRWB 3NL7B 3WCWC 2R4YA 1YMAA 4G51A 3QJBB 2MHBB 4SDHA 1T1NA 4HRRB 3E55A 3OO4A 1Y0AB 3LB4A 3M38A 1YHUB 1R1YA 5F2AA 2DN1B 3EOKB 1Y4VB 1QSHA 3PELB 5EV5A 1O1IA 1F65A 3GQGB 1QPWA 2VRYA 5HLQA 1Y46B 3QJEB 1RSEA 1FN3B 3UHKA 4H07A 1YEVB 1CH3A 2Z8AA 1G08B 1HBRB 1YHEA 3DUTA 1HCOB 2R80A 3R5IB 3RJ6A 3PIAA 1Y8IA 1CLSA 2OH8A 3UHSA 2WTHA 1NZ3A 1V4XB 1YE2B 3HENA 5EQMA 1A9WA 3BJ3A 3O89A 3WCWA 1HBAA 2V1IA 2ZS1A 1MWBA 1LFVB 1AJ9A 2LH3A 4N7OA 1YHRA 3OO5A 3OGBA 3OK5A 3HHBB 2ZLXA 1X3KA 5CNEA 1DO1A 3D1AB 1Y5JB 1IBEA 1DO7A 1CP0A 3QZZA 5SW7B 3TM9A 4U8UA 2GTLA 3D7OA 1URVA 1MOHA 1FHJB 2ZS0A 3UHHA 1O1NA 3QQRA 5AZQA 3WCVD 4O1TA 3UHCA 1GJNA 1Y8HA 4MQJA 4PQBA 2ZT0A 1MNHA 3ZJPA 1M9PB 2HBFB 2E2YA 2HZ1A 3D4XA 3WFTA 3ZOLA 1MODA 2GRHA 1XZ7A 1A3NB 3PI3A 1J7YA 2VM0A 4TWUA 3UH7A 1Y4RA 1Y0AA 1Y7DA 3A9MA 1SPGB 1SPEA 3PT7A 3EDAA 2LHBA 1GBVB 3G4WA 3SDHA 1JEBA 1A01B 4MAXA 5HLUA 4N7NA 1DKEA 3PT8B 2SPLA 3PI4A 1Y7DB 3O7NA 1YH9A 2R1HA 4AVEA 1ABYA 5KDQB 4N7NB 1NIHB 1NEJB 2O5QX 3NMMB 3ED9A 1FDHG 1XZVA 2H8DA 1PBXB 3QZXA 3WCUC 2G12A 3OVUC 4QAUA 5E83B 1Y09B 1O1MB 3S48C 4BJAA 3WCVB 1SI4A 1XZVB 4M4AB 1NQPB 1QXEB 3FH9B 1HBHA 1CBMA 5EOHA 4N7PA 1IT2A 1YHRB 3PI2A 4HHBA 2G0SA 3FS4A 103MA 1Y35A 3SZKB 4MQGB 1MLUA 4PQ6A 1MNKA 1I3DA 4HSXA 3WFUA 1Y7ZB 3KMFA 1S69A 2PEGA 3UHBA 1J7SB 2HHDA 5EU2A 2R4XA 1HBSB 3AQ9A 2M6ZA 1Y0WB 1YZIB 2O5BX 3G52A 1MYZA 2DXMB 1CH4A 4KN3A 3MJUA 1IRDA 2EVKA 1MCYA 3VRGA 3D4XB 1CO9A 4H2LB 2V1HA 2V1KA 2MBWA 1DTIA 3QJCB 1Y0TA 1AJHA 1MYFA 1FHJA 3A5AA 1R1YB 1Y45B 4AVDA 1GCWB 1LFLA 5EYSA 1Y8KB 1Y85B 2MGEA 1YHUD 2ZS1C 1CH1A 3G46A 1SDLB 1X9FC 1MNOA 1C40A 3QM8A 1CG8B 4NXCA 1CG5B 1YE0A 1HGAB 2G0VA 1MNJA 3FS4B 2D5XB 4TWVA 2R1HB 2ZSSA 2AV3A 1NQPA 3A0GA 1Y4GA 1NS6B 1GBVA 1MLFA 3VRFB 1J3YB 3PT7B 1GDIA 2D2NC 1V07A 4ROLB 1YEUB 2ZWJA 3AT5A 3M39A 1HBIA 1Y7CA 1OUUB 2MGIA 5EYJA 4UURA 5E29B 3BCQA 2JHOA 1YOIA 107MA 1VHBA 1Y4VA 4MQKA 3UHTA 1A00A 2AUQA 3MJUB 1Z8UB 3PT8A 3UHDA 2ZSRA 3WCUD 6HBWB 3GYSA 1MWDA 1JL7A 3HYUA 3ARJA 3CIUB 2BKMA 3QJDB 3UGZA 5CN9A 1A6MA 1J41A 1MTIA 3AQ8A 1BZ6A 3PI1A 1L2KA 1YVTA 3UGYA 1JZKA 1MGNA 4NXAA 1C7DA 1SWMA 5EUIA 1KD2B 1QXDA 3U3EA 3A59B 4F6DA 3KUNA 3SZKA 1HRMA 1HSYA 2HBDB 1G0BA 1LFQA 1ABWA 3MJPB 3AT6A 1A6NA 2HCOA 2R4ZA 2MGFA 1DXVA 1MLSA 1HGBB 2ZS0D 2ZSQA 3ZJQA 101MA 2D2NA 1HDBB 1LA6A 3RGKA 3VRGB 2W6YA 2VEEA 3E5OA 4HRTB 3ZJIA 3ZH0A 2ZLVA 2D2MD 5EUIB 1QSHB 5JOMA 5CN5A 1YIHA 4MXLA 1EBCA 5HAVA 4YU3B 2M6ZB 2VHBA 3QM7A 1DWSA 1HBRA 5F0BA 3WR1A 1VXCA 3ONZB 1URYA 2HBSA 2ZT3A 3GDJB 1MNIA 3CY5A 4F6JA 4JYQA 3HEOA 2HHBB 4O35A 4ESAB 1O1IB 1O1JA 1V4UA 1WVPA 1YDZA 3GQRB 4F6FA 1A0ZB 1YDZB 3W4UA 1XQ5A 2MYAA 3NMMA 1O1JB 2D5XA 4DWUA 2MYBA 2H8DB 2BLHA 2GNWA 2RI4B 2RAOA 5JDOF 1J41B 3WCWD 3WR1B 1BIJA 1DWRA 2SPMA 3OZWA 1XXTA 1IT3A 1JEBB 2DN2B 3TM3A 1K1KB 2GRZA 3UI0A 3TLDA 1SPGA 5E6EA 4C44A 1Y45A 2ZLWB 1YGFA 1N9IA 3NFEB 2Z6SA 3ZJJA 1BZ1A 1OUUA 1LH2A 2ZSTA 4DC8A 1MKOA 2QMBA 2Z6TA 4MQIA 1MYMA 1YEOB 5AB8A 1DLYA 3ZHWA 3ASEA 1HBBB 1GDLA 2DXMA 1D8UA 1BUWB 1MYTA 2FALA 4L7YA 2HBSB 1XZ4A 3WCTC 1EW6A 2D6CA 3QM6A 3IA3B 3ZJMA 5ILPA 2V1JA 2ZFOA 3ARLA 2GRFA 2GKNA 4TYXA 1DTMA 1Y0CA 2MGHA 3HEPA 2V1EA 2D5ZB 1CLSB 1Y0CB 2OHAA 2IG3A 5CNBA 3S66B 1Y7GB 3GYSB 1S6AA 1MYGA 2AA1B 1JZMA 1V75B 1S5YA 1BJEA 3LQDB 3GKVB 3K8BB 1X9FD 4F4OA 1QI8B 1JY7B 1DXVB 3A2GA 3DUTB 1RPSB 1AJGA 3A59A 2VLXA 1LJWA 4UZVA 2LH7A 2MGDA 4M4AA 1Y83B 2AA1A 1G0BB 3WCTA 2ZSYA 3V2VA 1MYHA 1U7RA 2VYZA 3OZUA 5MBNA 3QJBA 5HBIA 3LR9A 3GLNA 1YHUC 1UC3A 1M6MA 2ZSZA 6HBIA 1LH3A 1RVWB 2G11A 2ZLUB 2RAOB 2PEGB 1BINA 1W92A 1G09B 1RQAA 3CIUA 1VXGA 1KD2A 2DN2A 1C7CB 5KDQA 3DHTA 1DUOA 4VHBA 1FSXB 2WTGA 7HBIA 1MBDA 1XZ5B 1Y85A 4KMVA 1HDAA 4KMWA 5HU6B 1UFPA 1O1OB 2MGBA 4NI0B 2WY4A 2QSPB 2NSRA 3OZVA 1J7WA 4DC7A 1NAZA 1IWHB 2GTLB 1DXTA 2W6WA 2D60B 3AQ5A 4MQHB 1MYJA 1LUEA 1VREA 1Y7CB 2MGJA 3K9ZA 3QM5A 1V4XA 3OO5B 5E6EB 2ZSNA 1ECOA 3S65A 3WCTD 1XZ2A 1R1XA 2ZS0C 3AQ7A 1YE2A 1J7YB 1F63A 4U8UD 1VXFA 3D1KB 1LJWB 1S5XA 1THBA 1IDRA 3BJ2A 3IC2A 1HCOA 2R80B 1UX8A 2ZFOB 1YENA 1YHEB 1G9VA 1A9WE 1J40A 2NSSA 2G10A 3EOKA 3PELA 3WHMB 1G9VB 2ZSOA 4IT8A 1BUWA 1CH9A 1VXHA 1Y0WA 1YZIA 1Y8WA 2H8FA 2HBEB 3KUOA 3BJ2B 1Q1FA 1LHTA 3G4RA 5HY8B 4XS0A 1FN3A 2EF2A 1S0HB 1J40B 2AUOA 1DUKA 4MU5A 3QMAA 1AJ9B 3OO4B 2MYEA 1UIWB 1NEJA 1G0AA 4HBIA 3HRWA 4N7PB 1HDSA 1XYEA 3MVCA 1HV4A 1MLJA 1K1KA 110MA 4MQGA 1FAWB 5CNFA 1A3OB 1RQ3A 2D2ND 3UH6A 3WCVC 4NZIA 3BJ1A 104MA 1UVXA 1YEOA 1CMYB 3V2ZA 4MQIB 1SHRB 106MA 1BVDA 2YRSB 3EU1B 1DXUB 1COHA 2DN3B 2FRKX 3HF4B 4HHBB 1O1OA 1Y4BB 2BNLA 3WFXA 1YEQB 5B85A 1NS9A 1YG5B 112MA 1N9XA 3LB1A 1YVQB 3PI8A 5EE4D 1ABYB 1WMUB 2R50A 1DM1A 1OFKA 2DHBB 1YE0B 5D5RA 3WTGB 1EMYA 3UHYA 2D5ZA 1JP8A 2ZLUA 1Y4QA 3H57A 2SPNA 1FCSA 1NWIA 1GDJA 3ARKA 1S56A 1V4WB 2HBGA 4FC3B 2FRIX 1XZUB 2O5MX 4YU4B 1HDSB 1MTKA 2QFNA 2QLSB 1SDLA 1PMBA 1TU9A 3ECXA 1OR4A 1NS9B 1MBCA 1IRCA 5HY8A 1Y8IB 4MXKA 1HACA 2B7HB 2GTLD 3QJCA 2GL3A 1DO4A 1S61A 1YEVA 1O1NB 1EWAA 1X9FA 3ZJSA 4ROLA 5C6EB 1YCBA 1XZ2B 5CHQA 1HABA 1CO8A 1B86A 3S65B 1NZ4A 3WHMA 1MYIA 2BLJM 1LFTA 1RQ4A 1B86B 3R0GA 2PGHB 5JDOC 3GOUB 1HABB 5JDOE 3WCUA 1MLGA 1I3EA 4NS2A 3HHBA 4O2GA 2GNVA 3B75B 1S0HA 2Z85A 1MLMA 1OUTB 2HHEB 2QSSA 1SI4B 1Y46A 3QJEA 3HYUB 3GQGA 1HBBA 1G08A 3S1JA 2V1GA 3LB3A 1O16A 4MQKB 1MBAA 1GCVA 1JWNA 2D60A 2NRMA 2ZT1A 1NWNA 1VXAA 4C0NA 1XCHA 4N8TB 1CP5A 2GLNA 1PBXA 3GDJA 5CN7A 2G14A 4MQCA 1IRDB 1XY0A 2QLSA 1CMYA 4NI0A 1DXDA 3NG6A 1J3ZB 1UMOA 1J3YA 3UHZA 5EE4C 1HHOB 3IC0B 1NZ5A 4F6IA 5CN4A 1LH6A 1A00B 1YVQA 3PI8B 2MGAA 1MOCA 1BBBB 1VXDA 1HGAA 4FH6A 3A5BA 1BIJB 1A4FB 1QI8A 1COHB 1WMUA 1Y4RB 3UHQA 2QU0B 1YFFA 3VREB 4GZGA 2EB8A 1GDKA 5MBAA 1V75A 3UBCA 1M9PA 2HBFA 1NZ2A 1O1KA 2EKTA 3HF4A 1MLNA 3MN0A 1JY7A 1KR7A 1XZ5A 1CH5A 4WJG1 1GCVB 3MKBB 2ZLXB 3AT6B 3UH5A 2NX0A 2O5LX 2LH2A 4X0LB 4U8UC 2LH5A 3WI8A 1Y4PA 1C7DB 3G4VA 3D1KA 1MDNA 2OIFA 1JZLA 3IC0A 2MGLA 2G0ZA 1MLQA 3WCWB 1C7BA 1A3NA 5JDOD 4ODCA 2GDMA 1JW8A 2QMBB 2ZLTA 3NMLA 2O58X 4ZVAA 3UHIA 2ZFBB 3QM9A 5ILEA 4LPIA 3LHBA 2W6VA 2HCOB 5EETA 1X9FB 2G3HA 2D2MC 3D7OB 2QRWA 3ZJRA 4IROA 5ILRA 3ZJLA 1MLRA 111MA 1CIKA 4YU4A 1Y7GA 1T1NB 2W31A 1IBEB 4HRRA 1HACB 2B7HA 1VXEA 2MYDA 1V5HA 5D1VA 1Y4QB 1YGDA 1MBOA 2BMMA 1CIOA 1YENB 2MB5A 1Y4PB 3QJDA 2AURA 4FC3A 1RTXA 2MGMA 1BBBA 1BABA 1DO3A 5AZRA 1GVHA 1RTEA 1DKEB 5CN8A 2W72B 3GQPA 3MOUA 2NRLA 3MKBA 4HSWA 3WTGA 2VLYA 4FWXA 3D17B 2MGKA 5HU6A 4JACA 1MLOA 1WLAA 1BZZB 2VLZA 1A0ZA 3ONZA 4G1VA 2Z6NB 1YOGA 2D2MA 3BCQB 4F69A 2OH9A 1CPWA 1VWTB 2H35A 3MYMA 3UHUA 1DXUA 1Y4GB 3ECLA 2ZLWA 3ODQA 3G4YA 5ILMA 1LFYB 1X46A 1HLBA 3BJ1B 1XZUA 1NPGA 5HLXA 3CY5B 1RQAB 1CG8A 1HV4B 3RJNB 4HRTA 4B3WA 3ZJOA 5CNDA 1UFJA 1VXBA 4N7OB 2LH6A 1LA6B 1Y22B 3E5IA 1UX9A 1BZPA 3GKTA 4OF9A 2O5TX 1CG5A 2FRJX 3KMFC 4X0LA 1Y5FA 2DC3A 1GZXB 5B84A 3DR9A 2HBCB 2ZT4A 1RVWA 1KFRA 2KSCA 5JGGA 5M3SA 5CN6A 4ILZA 1QXEA 1YEQA 2W6VB 1XZ4B 1Y31B 1GZXA 1Y2ZA 2OLPA 2HHBA 4ESAA 3LR7A 1O1MA 1IOPA 4H2LA 3LQDA 1MKOB 5KERA 4DWTA 3BOMA 1C7BB 4PQCA 3QQQA 1HJTA 1LFVA 1J52A 1RPSA 3WCUB 1NGKA 1Y31A 1HBSA 3IC2B 4ZVBA 4FH7A 1ITHA 1DLWA 1JP9A 3HXNB 1S5YB 1H97A 3OJ1A 3UHRA 2ZS1D 2AUPA 4NI1B 4MQHA 4MBAA 1ASHA 1OFJA 3WFWA 1CBLA 1FDHA 3FH9A 2MGGA 102MA 3LB2A 3DHRA 2XKHA 1Y4FB 1DWTA 1Y35B 1J3FA 1LHSA 1FSLA 2W6XA 4M4BA 3PI9A 1JDOA 4FWZA 1FSXA 1ABWB 3GQRA 1O1PB 1YHUA 2OHBA 4M4BB 1MLKA 4L7YB 1A4FA 1YEUA 1BABB 1JPBA 3UHWA 4ROMB 1ECNA 3VRFA 1Y4FA 5CNGA 3D1AA 2IN4A 4G51B 1QSIB 1V9QA 1G09A 1OUTA 1Y0DA 2HHEA 1BZZA 2VEBA 1QSIA 2BLIA 2ZS1B 1FAWA 1NS6A 2XYKA 6HBWA 1MLHA 3ODQB 1YGDB 1MBNA 1YIHB 1YG5A 3PI9B 1G0AB 4XDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYW A;  3M3B A;  1VWT A;  5E29 A;  3ZOM A;  2VYY A;  3WCT B;  3GKV A;  3K8B A;  1MZ0 A;  1N9H A;  2GKM A;  3AT5 B;  1GBU B;  1HDB A;  3HC9 A;  1DXC A;  1UVY A;  1JF4 A;  1RQ3 B;  1XQ5 B;  105M A;  3H58 A;  2QSS B;  1V4U B;  4U8U B;  1JP6 A;  1K0Y B;  1Y5F B;  1C7C A;  1Y7Z A;  3G4Q A;  1EBT A;  1V4W A;  2MHB A;  1RQ4 B;  1LTW A;  3K3U A;  4MPM A;  1LFT B;  1HLM A;  4ODC B;  2G0X A;  4PNJ A;  1Y01 B;  5KER B;  3ECZ A;  2CMM A;  2XKI A;  1ECD A;  2HBE A;  1Y8K A;  1TES A;  3UH3 A;  4NK1 A;  3HXN A;  2D2N B;  3AG0 A;  3G4U A;  3UHE A;  4F6G A;  2H35 B;  3UHG A;  2HZ2 A;  2W72 C;  4NK2 A;  1Y4B A;  2MGC A;  4F4O B;  3UHV A;  1H1X A;  5C6E A;  2EB9 A;  3NFE A;  3IXF A;  1UT0 A;  4WJG A;  3AQ6 A;  3GK9 A;  1SHR A;  2HBC A;  2LH1 A;  3ORD A;  1YH9 B;  2QFK A;  1MLL A;  1QXD B;  1Y2Z B;  1XXT B;  1J3Z A;  1J7S A;  2DN1 A;  5JGG B;  3MJP A;  1LFY A;  1MOB A;  1MBI A;  1YIE B;  1XZ7 B;  4O4T A;  3S1I A;  1BVC A;  1CH7 A;  4WCH D;  3P5Q B;  2DHB A;  4KJT A;  4N8T A;  1K0Y A;  2EVP A;  2SPO A;  1DXT B;  3NG6 B;  1Y8H B;  1GLI B;  2Z6N A;  2ZFO D;  4MQC B;  1A0U A;  1BZR A;  2BW9 M;  1YCA A;  1BZ0 A;  3UBV A;  5SW7 A;  3MYN A;  4IRO B;  1Y5J A;  1OJ6 A;  1O1L A;  1GCW A;  1NPF A;  1YMC A;  1LH7 A;  1A0U B;  1GBU A;  1U7S A;  2R4W A;  1NXF A;  1GLI A;  1B0B A;  3DHT B;  2O5S X;  1Y5K B;  1FLP A;  1A3O A;  3SDN A;  2PGH A;  1NIH A;  1OBM A;  2W72 A;  3GQP B;  3ZJH A;  5CMV A;  4B4Y A;  3WCP B;  2ZLT B;  1C40 B;  1MBS A;  1MOA A;  2ZSP A;  1LH5 A;  3D17 A;  4O4Z A;  1UIW A;  1OR6 A;  3S66 A;  3GOU A;  4YU3 A;  1N9F A;  3A0G B;  1LFL B;  3BJ3 B;  1F5O A;  2ZT2 A;  3B75 A;  1Y0D B;  2GTL C;  2FRF A;  4XS0 B;  3E4N A;  3BA2 A;  2FAM A;  1Y0T B;  3UHX A;  1CH2 A;  1MTJ A;  4MBN A;  1CQX A;  1YOH A;  3MBA A;  4F6B A;  2ZLV B;  2ZFB A;  1IWH A;  1O1P A;  108M A;  2ZS0 B;  1MWC A;  2MYC A;  2HZ3 A;  1ABS A;  2QSP A;  1HGB A;  1O1L B;  2O5O X;  1Y8W B;  2H8F B;  2BK9 A;  2G0R A;  5E83 A;  1Y09 A;  2BWH A;  2XKG A;  1S5X B;  1THB B;  1HDA B;  2HHD B;  1Y22 A;  1YFF B;  3VRE A;  1HBG A;  1LFQ B;  3A5G A;  2EKU A;  4OOD A;  1R1X B;  1LFZ A;  3EDB A;  1QPW B;  3VHB A;  5CHR A;  2ZSX A;  4NI1 A;  1F5P A;  1BZ1 B;  1ECA A;  1HBA B;  2V1F A;  3P5Q A;  3ZJN A;  1YVT B;  5IKS A;  4L2M A;  2AV0 A;  109M A;  1YIE A;  1HBH B;  1CQ2 A;  3WCP A;  3PIA B;  1VRF A;  5CNC A;  4FWY A;  1AZI A;  3R5I A;  1HHO A;  3WCV A;  1HGC A;  4G1B A;  3G53 A;  1A6G A;  1Y5K A;  4H0B A;  1O1K B;  3M3A A;  3NL7 A;  3BOM B;  3VAU A;  1XY0 B;  2YRS A;  2RI4 A;  1Y83 A;  1J7W B;  5C6Y A;  2C0K A;  4ROM A;  1JF3 A;  4MQJ B;  1BZ0 B;  1LH1 A;  1SDK B;  2DN3 A;  2D2M B;  1HGC B;  2ZFO C;  3W4U B;  1A6K A;  1YGF B;  2QU0 A;  2HBD A;  5KKK A;  1SDK A;  1JL6 A;  1A01 A;  4UIQ A;  4F68 A;  3EU1 A;  3UHN A;  3DHR B;  1YMB A;  1XYE B;  1LFZ B;  1M6C A;  3HRW B;  3NL7 B;  3WCW C;  2R4Y A;  1YMA A;  4G51 A;  3QJB B;  2MHB B;  4SDH A;  1T1N A;  4HRR B;  3E55 A;  3OO4 A;  1Y0A B;  3LB4 A;  3M38 A;  1YHU B;  1R1Y A;  5F2A A;  2DN1 B;  3EOK B;  1Y4V B;  1QSH A;  3PEL B;  5EV5 A;  1O1I A;  1F65 A;  3GQG B;  1QPW A;  2VRY A;  5HLQ A;  1Y46 B;  3QJE B;  1RSE A;  1FN3 B;  3UHK A;  4H07 A;  1YEV B;  1CH3 A;  2Z8A A;  1G08 B;  1HBR B;  1YHE A;  3DUT A;  1HCO B;  2R80 A;  3R5I B;  3RJ6 A;  3PIA A;  1Y8I A;  1CLS A;  2OH8 A;  3UHS A;  2WTH A;  1NZ3 A;  1V4X B;  1YE2 B;  3HEN A;  5EQM A;  1A9W A;  3BJ3 A;  3O89 A;  3WCW A;  1HBA A;  2V1I A;  2ZS1 A;  1MWB A;  1LFV B;  1AJ9 A;  2LH3 A;  4N7O A;  1YHR A;  3OO5 A;  3OGB A;  3OK5 A;  3HHB B;  2ZLX A;  1X3K A;  5CNE A;  1DO1 A;  3D1A B;  1Y5J B;  1IBE A;  1DO7 A;  1CP0 A;  3QZZ A;  5SW7 B;  3TM9 A;  4U8U A;  2GTL A;  3D7O A;  1URV A;  1MOH A;  1FHJ B;  2ZS0 A;  3UHH A;  1O1N A;  3QQR A;  5AZQ A;  3WCV D;  4O1T A;  3UHC A;  1GJN A;  1Y8H A;  4MQJ A;  4PQB A;  2ZT0 A;  1MNH A;  3ZJP A;  1M9P B;  2HBF B;  2E2Y A;  2HZ1 A;  3D4X A;  3WFT A;  3ZOL A;  1MOD A;  2GRH A;  1XZ7 A;  1A3N B;  3PI3 A;  1J7Y A;  2VM0 A;  4TWU A;  3UH7 A;  1Y4R A;  1Y0A A;  1Y7D A;  3A9M A;  1SPG B;  1SPE A;  3PT7 A;  3EDA A;  2LHB A;  1GBV B;  3G4W A;  3SDH A;  1JEB A;  1A01 B;  4MAX A;  5HLU A;  4N7N A;  1DKE A;  3PT8 B;  2SPL A;  3PI4 A;  1Y7D B;  3O7N A;  1YH9 A;  2R1H A;  4AVE A;  1ABY A;  5KDQ B;  4N7N B;  1NIH B;  1NEJ B;  2O5Q X;  3NMM B;  3ED9 A;  1FDH G;  1XZV A;  2H8D A;  1PBX B;  3QZX A;  3WCU C;  2G12 A;  3OVU C;  4QAU A;  5E83 B;  1Y09 B;  1O1M B;  3S48 C;  4BJA A;  3WCV B;  1SI4 A;  1XZV B;  4M4A B;  1NQP B;  1QXE B;  3FH9 B;  1HBH A;  1CBM A;  5EOH A;  4N7P A;  1IT2 A;  1YHR B;  3PI2 A;  4HHB A;  2G0S A;  3FS4 A;  103M A;  1Y35 A;  3SZK B;  4MQG B;  1MLU A;  4PQ6 A;  1MNK A;  1I3D A;  4HSX A;  3WFU A;  1Y7Z B;  3KMF A;  1S69 A;  2PEG A;  3UHB A;  1J7S B;  2HHD A;  5EU2 A;  2R4X A;  1HBS B;  3AQ9 A;  2M6Z A;  1Y0W B;  1YZI B;  2O5B X;  3G52 A;  1MYZ A;  2DXM B;  1CH4 A;  4KN3 A;  3MJU A;  1IRD A;  2EVK A;  1MCY A;  3VRG A;  3D4X B;  1CO9 A;  4H2L B;  2V1H A;  2V1K A;  2MBW A;  1DTI A;  3QJC B;  1Y0T A;  1AJH A;  1MYF A;  1FHJ A;  3A5A A;  1R1Y B;  1Y45 B;  4AVD A;  1GCW B;  1LFL A;  5EYS A;  1Y8K B;  1Y85 B;  2MGE A;  1YHU D;  2ZS1 C;  1CH1 A;  3G46 A;  1SDL B;  1X9F C;  1MNO A;  1C40 A;  3QM8 A;  1CG8 B;  4NXC A;  1CG5 B;  1YE0 A;  1HGA B;  2G0V A;  1MNJ A;  3FS4 B;  2D5X B;  4TWV A;  2R1H B;  2ZSS A;  2AV3 A;  1NQP A;  3A0G A;  1Y4G A;  1NS6 B;  1GBV A;  1MLF A;  3VRF B;  1J3Y B;  3PT7 B;  1GDI A;  2D2N C;  1V07 A;  4ROL B;  1YEU B;  2ZWJ A;  3AT5 A;  3M39 A;  1HBI A;  1Y7C A;  1OUU B;  2MGI A;  5EYJ A;  4UUR A;  5E29 B;  3BCQ A;  2JHO A;  1YOI A;  107M A;  1VHB A;  1Y4V A;  4MQK A;  3UHT A;  1A00 A;  2AUQ A;  3MJU B;  1Z8U B;  3PT8 A;  3UHD A;  2ZSR A;  3WCU D;  6HBW B;  3GYS A;  1MWD A;  1JL7 A;  3HYU A;  3ARJ A;  3CIU B;  2BKM A;  3QJD B;  3UGZ A;  5CN9 A;  1A6M A;  1J41 A;  1MTI A;  3AQ8 A;  1BZ6 A;  3PI1 A;  1L2K A;  1YVT A;  3UGY A;  1JZK A;  1MGN A;  4NXA A;  1C7D A;  1SWM A;  5EUI A;  1KD2 B;  1QXD A;  3U3E A;  3A59 B;  4F6D A;  3KUN A;  3SZK A;  1HRM A;  1HSY A;  2HBD B;  1G0B A;  1LFQ A;  1ABW A;  3MJP B;  3AT6 A;  1A6N A;  2HCO A;  2R4Z A;  2MGF A;  1DXV A;  1MLS A;  1HGB B;  2ZS0 D;  2ZSQ A;  3ZJQ A;  101M A;  2D2N A;  1HDB B;  1LA6 A;  3RGK A;  3VRG B;  2W6Y A;  2VEE A;  3E5O A;  4HRT B;  3ZJI A;  3ZH0 A;  2ZLV A;  2D2M D;  5EUI B;  1QSH B;  5JOM A;  5CN5 A;  1YIH A;  4MXL A;  1EBC A;  5HAV A;  4YU3 B;  2M6Z B;  2VHB A;  3QM7 A;  1DWS A;  1HBR A;  5F0B A;  3WR1 A;  1VXC A;  3ONZ B;  1URY A;  2HBS A;  2ZT3 A;  3GDJ B;  1MNI A;  3CY5 A;  4F6J A;  4JYQ A;  3HEO A;  2HHB B;  4O35 A;  4ESA B;  1O1I B;  1O1J A;  1V4U A;  1WVP A;  1YDZ A;  3GQR B;  4F6F A;  1A0Z B;  1YDZ B;  3W4U A;  1XQ5 A;  2MYA A;  3NMM A;  1O1J B;  2D5X A;  4DWU A;  2MYB A;  2H8D B;  2BLH A;  2GNW A;  2RI4 B;  2RAO A;  5JDO F;  1J41 B;  3WCW D;  3WR1 B;  1BIJ A;  1DWR A;  2SPM A;  3OZW A;  1XXT A;  1IT3 A;  1JEB B;  2DN2 B;  3TM3 A;  1K1K B;  2GRZ A;  3UI0 A;  3TLD A;  1SPG A;  5E6E A;  4C44 A;  1Y45 A;  2ZLW B;  1YGF A;  1N9I A;  3NFE B;  2Z6S A;  3ZJJ A;  1BZ1 A;  1OUU A;  1LH2 A;  2ZST A;  4DC8 A;  1MKO A;  2QMB A;  2Z6T A;  4MQI A;  1MYM A;  1YEO B;  5AB8 A;  1DLY A;  3ZHW A;  3ASE A;  1HBB B;  1GDL A;  2DXM A;  1D8U A;  1BUW B;  1MYT A;  2FAL A;  4L7Y A;  2HBS B;  1XZ4 A;  3WCT C;  1EW6 A;  2D6C A;  3QM6 A;  3IA3 B;  3ZJM A;  5ILP A;  2V1J A;  2ZFO A;  3ARL A;  2GRF A;  2GKN A;  4TYX A;  1DTM A;  1Y0C A;  2MGH A;  3HEP A;  2V1E A;  2D5Z B;  1CLS B;  1Y0C B;  2OHA A;  2IG3 A;  5CNB A;  3S66 B;  1Y7G B;  3GYS B;  1S6A A;  1MYG A;  2AA1 B;  1JZM A;  1V75 B;  1S5Y A;  1BJE A;  3LQD B;  3GKV B;  3K8B B;  1X9F D;  4F4O A;  1QI8 B;  1JY7 B;  1DXV B;  3A2G A;  3DUT B;  1RPS B;  1AJG A;  3A59 A;  2VLX A;  1LJW A;  4UZV A;  2LH7 A;  2MGD A;  4M4A A;  1Y83 B;  2AA1 A;  1G0B B;  3WCT A;  2ZSY A;  3V2V A;  1MYH A;  1U7R A;  2VYZ A;  3OZU A;  5MBN A;  3QJB A;  5HBI A;  3LR9 A;  3GLN A;  1YHU C;  1UC3 A;  1M6M A;  2ZSZ A;  6HBI A;  1LH3 A;  1RVW B;  2G11 A;  2ZLU B;  2RAO B;  2PEG B;  1BIN A;  1W92 A;  1G09 B;  1RQA A;  3CIU A;  1VXG A;  1KD2 A;  2DN2 A;  1C7C B;  5KDQ A;  3DHT A;  1DUO A;  4VHB A;  1FSX B;  2WTG A;  7HBI A;  1MBD A;  1XZ5 B;  1Y85 A;  4KMV A;  1HDA A;  4KMW A;  5HU6 B;  1UFP A;  1O1O B;  2MGB A;  4NI0 B;  2WY4 A;  2QSP B;  2NSR A;  3OZV A;  1J7W A;  4DC7 A;  1NAZ A;  1IWH B;  2GTL B;  1DXT A;  2W6W A;  2D60 B;  3AQ5 A;  4MQH B;  1MYJ A;  1LUE A;  1VRE A;  1Y7C B;  2MGJ A;  3K9Z A;  3QM5 A;  1V4X A;  3OO5 B;  5E6E B;  2ZSN A;  1ECO A;  3S65 A;  3WCT D;  1XZ2 A;  1R1X A;  2ZS0 C;  3AQ7 A;  1YE2 A;  1J7Y B;  1F63 A;  4U8U D;  1VXF A;  3D1K B;  1LJW B;  1S5X A;  1THB A;  1IDR A;  3BJ2 A;  3IC2 A;  1HCO A;  2R80 B;  1UX8 A;  2ZFO B;  1YEN A;  1YHE B;  1G9V A;  1A9W E;  1J40 A;  2NSS A;  2G10 A;  3EOK A;  3PEL A;  3WHM B;  1G9V B;  2ZSO A;  4IT8 A;  1BUW A;  1CH9 A;  1VXH A;  1Y0W A;  1YZI A;  1Y8W A;  2H8F A;  2HBE B;  3KUO A;  3BJ2 B;  1Q1F A;  1LHT A;  3G4R A;  5HY8 B;  4XS0 A;  1FN3 A;  2EF2 A;  1S0H B;  1J40 B;  2AUO A;  1DUK A;  4MU5 A;  3QMA A;  1AJ9 B;  3OO4 B;  2MYE A;  1UIW B;  1NEJ A;  1G0A A;  4HBI A;  3HRW A;  4N7P B;  1HDS A;  1XYE A;  3MVC A;  1HV4 A;  1MLJ A;  1K1K A;  110M A;  4MQG A;  1FAW B;  5CNF A;  1A3O B;  1RQ3 A;  2D2N D;  3UH6 A;  3WCV C;  4NZI A;  3BJ1 A;  104M A;  1UVX A;  1YEO A;  1CMY B;  3V2Z A;  4MQI B;  1SHR B;  106M A;  1BVD A;  2YRS B;  3EU1 B;  1DXU B;  1COH A;  2DN3 B;  2FRK X;  3HF4 B;  4HHB B;  1O1O A;  1Y4B B;  2BNL A;  3WFX A;  1YEQ B;  5B85 A;  1NS9 A;  1YG5 B;  112M A;  1N9X A;  3LB1 A;  1YVQ B;  3PI8 A;  5EE4 D;  1ABY B;  1WMU B;  2R50 A;  1DM1 A;  1OFK A;  2DHB B;  1YE0 B;  5D5R A;  3WTG B;  1EMY A;  3UHY A;  2D5Z A;  1JP8 A;  2ZLU A;  1Y4Q A;  3H57 A;  2SPN A;  1FCS A;  1NWI A;  1GDJ A;  3ARK A;  1S56 A;  1V4W B;  2HBG A;  4FC3 B;  2FRI X;  1XZU B;  2O5M X;  4YU4 B;  1HDS B;  1MTK A;  2QFN A;  2QLS B;  1SDL A;  1PMB A;  1TU9 A;  3ECX A;  1OR4 A;  1NS9 B;  1MBC A;  1IRC A;  5HY8 A;  1Y8I B;  4MXK A;  1HAC A;  2B7H B;  2GTL D;  3QJC A;  2GL3 A;  1DO4 A;  1S61 A;  1YEV A;  1O1N B;  1EWA A;  1X9F A;  3ZJS A;  4ROL A;  5C6E B;  1YCB A;  1XZ2 B;  5CHQ A;  1HAB A;  1CO8 A;  1B86 A;  3S65 B;  1NZ4 A;  3WHM A;  1MYI A;  2BLJ M;  1LFT A;  1RQ4 A;  1B86 B;  3R0G A;  2PGH B;  5JDO C;  3GOU B;  1HAB B;  5JDO E;  3WCU A;  1MLG A;  1I3E A;  4NS2 A;  3HHB A;  4O2G A;  2GNV A;  3B75 B;  1S0H A;  2Z85 A;  1MLM A;  1OUT B;  2HHE B;  2QSS A;  1SI4 B;  1Y46 A;  3QJE A;  3HYU B;  3GQG A;  1HBB A;  1G08 A;  3S1J A;  2V1G A;  3LB3 A;  1O16 A;  4MQK B;  1MBA A;  1GCV A;  1JWN A;  2D60 A;  2NRM A;  2ZT1 A;  1NWN A;  1VXA A;  4C0N A;  1XCH A;  4N8T B;  1CP5 A;  2GLN A;  1PBX A;  3GDJ A;  5CN7 A;  2G14 A;  4MQC A;  1IRD B;  1XY0 A;  2QLS A;  1CMY A;  4NI0 A;  1DXD A;  3NG6 A;  1J3Z B;  1UMO A;  1J3Y A;  3UHZ A;  5EE4 C;  1HHO B;  3IC0 B;  1NZ5 A;  4F6I A;  5CN4 A;  1LH6 A;  1A00 B;  1YVQ A;  3PI8 B;  2MGA A;  1MOC A;  1BBB B;  1VXD A;  1HGA A;  4FH6 A;  3A5B A;  1BIJ B;  1A4F B;  1QI8 A;  1COH B;  1WMU A;  1Y4R B;  3UHQ A;  2QU0 B;  1YFF A;  3VRE B;  4GZG A;  2EB8 A;  1GDK A;  5MBA A;  1V75 A;  3UBC A;  1M9P A;  2HBF A;  1NZ2 A;  1O1K A;  2EKT A;  3HF4 A;  1MLN A;  3MN0 A;  1JY7 A;  1KR7 A;  1XZ5 A;  1CH5 A;  4WJG 1;  1GCV B;  3MKB B;  2ZLX B;  3AT6 B;  3UH5 A;  2NX0 A;  2O5L X;  2LH2 A;  4X0L B;  4U8U C;  2LH5 A;  3WI8 A;  1Y4P A;  1C7D B;  3G4V A;  3D1K A;  1MDN A;  2OIF A;  1JZL A;  3IC0 A;  2MGL A;  2G0Z A;  1MLQ A;  3WCW B;  1C7B A;  1A3N A;  5JDO D;  4ODC A;  2GDM A;  1JW8 A;  2QMB B;  2ZLT A;  3NML A;  2O58 X;  4ZVA A;  3UHI A;  2ZFB B;  3QM9 A;  5ILE A;  4LPI A;  3LHB A;  2W6V A;  2HCO B;  5EET A;  1X9F B;  2G3H A;  2D2M C;  3D7O B;  2QRW A;  3ZJR A;  4IRO A;  5ILR A;  3ZJL A;  1MLR A;  111M A;  1CIK A;  4YU4 A;  1Y7G A;  1T1N B;  2W31 A;  1IBE B;  4HRR A;  1HAC B;  2B7H A;  1VXE A;  2MYD A;  1V5H A;  5D1V A;  1Y4Q B;  1YGD A;  1MBO A;  2BMM A;  1CIO A;  1YEN B;  2MB5 A;  1Y4P B;  3QJD A;  2AUR A;  4FC3 A;  1RTX A;  2MGM A;  1BBB A;  1BAB A;  1DO3 A;  5AZR A;  1GVH A;  1RTE A;  1DKE B;  5CN8 A;  2W72 B;  3GQP A;  3MOU A;  2NRL A;  3MKB A;  4HSW A;  3WTG A;  2VLY A;  4FWX A;  3D17 B;  2MGK A;  5HU6 A;  4JAC A;  1MLO A;  1WLA A;  1BZZ B;  2VLZ A;  1A0Z A;  3ONZ A;  4G1V A;  2Z6N B;  1YOG A;  2D2M A;  3BCQ B;  4F69 A;  2OH9 A;  1CPW A;  1VWT B;  2H35 A;  3MYM A;  3UHU A;  1DXU A;  1Y4G B;  3ECL A;  2ZLW A;  3ODQ A;  3G4Y A;  5ILM A;  1LFY B;  1X46 A;  1HLB A;  3BJ1 B;  1XZU A;  1NPG A;  5HLX A;  3CY5 B;  1RQA B;  1CG8 A;  1HV4 B;  3RJN B;  4HRT A;  4B3W A;  3ZJO A;  5CND A;  1UFJ A;  1VXB A;  4N7O B;  2LH6 A;  1LA6 B;  1Y22 B;  3E5I A;  1UX9 A;  1BZP A;  3GKT A;  4OF9 A;  2O5T X;  1CG5 A;  2FRJ X;  3KMF C;  4X0L A;  1Y5F A;  2DC3 A;  1GZX B;  5B84 A;  3DR9 A;  2HBC B;  2ZT4 A;  1RVW A;  1KFR A;  2KSC A;  5JGG A;  5M3S A;  5CN6 A;  4ILZ A;  1QXE A;  1YEQ A;  2W6V B;  1XZ4 B;  1Y31 B;  1GZX A;  1Y2Z A;  2OLP A;  2HHB A;  4ESA A;  3LR7 A;  1O1M A;  1IOP A;  4H2L A;  3LQD A;  1MKO B;  5KER A;  4DWT A;  3BOM A;  1C7B B;  4PQC A;  3QQQ A;  1HJT A;  1LFV A;  1J52 A;  1RPS A;  3WCU B;  1NGK A;  1Y31 A;  1HBS A;  3IC2 B;  4ZVB A;  4FH7 A;  1ITH A;  1DLW A;  1JP9 A;  3HXN B;  1S5Y B;  1H97 A;  3OJ1 A;  3UHR A;  2ZS1 D;  2AUP A;  4NI1 B;  4MQH A;  4MBA A;  1ASH A;  1OFJ A;  3WFW A;  1CBL A;  1FDH A;  3FH9 A;  2MGG A;  102M A;  3LB2 A;  3DHR A;  2XKH A;  1Y4F B;  1DWT A;  1Y35 B;  1J3F A;  1LHS A;  1FSL A;  2W6X A;  4M4B A;  3PI9 A;  1JDO A;  4FWZ A;  1FSX A;  1ABW B;  3GQR A;  1O1P B;  1YHU A;  2OHB A;  4M4B B;  1MLK A;  4L7Y B;  1A4F A;  1YEU A;  1BAB B;  1JPB A;  3UHW A;  4ROM B;  1ECN A;  3VRF A;  1Y4F A;  5CNG A;  3D1A A;  2IN4 A;  4G51 B;  1QSI B;  1V9Q A;  1G09 A;  1OUT A;  1Y0D A;  2HHE A;  1BZZ A;  2VEB A;  1QSI A;  2BLI A;  2ZS1 B;  1FAW A;  1NS6 A;  2XYK A;  6HBW A;  1MLH A;  3ODQ B;  1YGD B;  1MBN A;  1YIH B;  1YG5 A;  3PI9 B;  1G0A B;  4XDI A; 
#chains in the Genus database with same CATH topology
 2VYW A;  3M3B A;  1VWT A;  5E29 A;  3ZOM A;  2VYY A;  3WCT B;  3GKV A;  3K8B A;  1MZ0 A;  1N9H A;  2GKM A;  3AT5 B;  1GBU B;  1HDB A;  3HC9 A;  1DXC A;  1UVY A;  1JF4 A;  1RQ3 B;  1XQ5 B;  105M A;  3H58 A;  2J96 A;  2QSS B;  2VJT B;  4TMA B;  1V4U B;  4U8U B;  1JP6 A;  1K0Y B;  2VJH A;  1Y5F B;  1C7C A;  3O18 A;  1Y7Z A;  3G4Q A;  4RMP B;  1EBT A;  1V4W A;  2MHB A;  1RQ4 B;  1LTW A;  3K3U A;  4MPM A;  1LFT B;  4Z8K A;  1HLM A;  4ODC B;  2G0X A;  4PNJ A;  1Y01 B;  5KER B;  3ECZ A;  2CMM A;  2XKI A;  1ECD A;  2HBE A;  1Y8K A;  4LMX B;  1TES A;  3UH3 A;  4NK1 A;  3HXN A;  2D2N B;  3AG0 A;  3G4U A;  3V57 A;  3UHE A;  4F6G A;  2H35 B;  1HA7 A;  5FVB M;  3UHG A;  2HZ2 A;  2W72 C;  4NK2 A;  1Y4B A;  2MGC A;  4F4O B;  1UVK A;  3UHV A;  1H1X A;  5C6E A;  2EB9 A;  2JL9 A;  3NFE A;  3IXF A;  4A8F A;  1UT0 A;  4WJG A;  3AQ6 A;  3GK9 A;  1SHR A;  2HBC A;  2LH1 A;  3ORD A;  4GY3 A;  1YH9 B;  1LIA A;  2QFK A;  1MLL A;  1KTP A;  1QXD B;  1Y2Z B;  3PMC A;  1XXT B;  1J3Z A;  1J7S A;  2DN1 A;  5JGG B;  3MJP A;  1LFY A;  1MOB A;  1MBI A;  1YIE B;  1XZ7 B;  4O4T A;  3S1I A;  1BVC A;  1CH7 A;  4WCH D;  3P5Q B;  2DHB A;  4KJT A;  4N8T A;  3DBJ B;  1K0Y A;  2VJH B;  2EVP A;  2SPO A;  1DXT B;  4LM6 B;  3NG6 B;  1Y8H B;  1GLI B;  2Z6N A;  4H0M A;  2ZFO D;  4MQC B;  1A0U A;  1BZR A;  2BW9 M;  1YCA A;  1BZ0 A;  3UBV A;  5SW7 A;  3MYN A;  4IRO B;  1Y5J A;  1OJ6 A;  1O1L A;  1GCW A;  1NPF A;  1YMC A;  3FEW X;  1LH7 A;  1A0U B;  1GBU A;  1U7S A;  2R4W A;  1NXF A;  1GLI A;  1B0B A;  3DHT B;  2O5S X;  1F99 A;  1Y5K B;  1FLP A;  1A3O A;  3SDN A;  2PGH A;  1NIH A;  1OBM A;  2W72 A;  3GQP B;  3ZJH A;  5CMV A;  4B4Y A;  3WCP B;  2ZLT B;  1C40 B;  1MBS A;  1MOA A;  2ZSP A;  1LH5 A;  2UUN B;  3D17 A;  4O4Z A;  1UIW A;  1OR6 A;  3S66 A;  3GOU A;  4YU3 A;  1N9F A;  3A0G B;  1LFL B;  3BJ3 B;  1F5O A;  2ZT2 A;  3B75 A;  1Y0D B;  2GTL C;  2FRF A;  3E4N A;  4XS0 B;  3BA2 A;  2FAM A;  1Y0T B;  3UHX A;  1CH2 A;  1MTJ A;  4MBN A;  1CQX A;  1YOH A;  3MBA A;  4F6B A;  2ZLV B;  3O18 B;  2C7L B;  2ZFB A;  1IWH A;  1O1P A;  108M A;  2ZS0 B;  1MWC A;  2MYC A;  2HZ3 A;  1ABS A;  2QSP A;  1HGB A;  1O1L B;  2O5O X;  1Y8W B;  2H8F B;  2BK9 A;  2G0R A;  1Y09 A;  5E83 A;  2BWH A;  2XKG A;  1S5X B;  1THB B;  1HDA B;  2HHD B;  1Y22 A;  1YFF B;  3VRE A;  1HBG A;  1LFQ B;  3A5G A;  2EKU A;  4OOD A;  4AE0 A;  4Z8K B;  1R1X B;  1LFZ A;  3EDB A;  1QPW B;  3VHB A;  2ZSX A;  4NI1 A;  5CHR A;  1F5P A;  1BZ1 B;  1ECA A;  5B13 G;  1HBA B;  2V1F A;  3P5Q A;  3ZJN A;  1YVT B;  5IKS A;  4L2M A;  2AV0 A;  109M A;  1YIE A;  1HBH B;  1CQ2 A;  3WCP A;  1XDT T;  3PIA B;  1VRF A;  5CNC A;  4FWY A;  1AZI A;  3R5I A;  1HHO A;  1JBO A;  3WCV A;  1HGC A;  4G1B A;  3G53 A;  1A6G A;  1Y5K A;  4H0B A;  3M3A A;  3NL7 A;  1O1K B;  3BOM B;  3VAU A;  1XY0 B;  2YRS A;  2RI4 A;  1Y83 A;  3L0F A;  1J7W B;  5C6Y A;  2C0K A;  4ROM A;  1JF3 A;  4MQJ B;  1BZ0 B;  1LH1 A;  1SDK B;  2DN3 A;  2D2M B;  1HGC B;  2ZFO C;  3W4U B;  1A6K A;  1YGF B;  2DKC A;  2QU0 A;  2HBD A;  5KKK A;  1SDK A;  2WCR A;  1JL6 A;  1A01 A;  3KVS B;  4UIQ A;  4F68 A;  3EU1 A;  3UHN A;  3DHR B;  1YMB A;  1XYE B;  1LFZ B;  1M6C A;  2BV8 A;  1ON7 A;  3HRW B;  3NL7 B;  3WCW C;  2R4Y A;  1YMA A;  4G51 A;  3QJB B;  2MHB B;  4SDH A;  1PHN B;  1T1N A;  4HRR B;  3E55 A;  3OO4 A;  1Y0A B;  3LB4 A;  3M38 A;  1YHU B;  1R1Y A;  5F2A A;  2DN1 B;  1XG0 C;  3EOK B;  1Y4V B;  1QSH A;  3PEL B;  4XXI A;  5EV5 A;  1O1I A;  1F65 A;  3GQG B;  1QPW A;  2VRY A;  5HLQ A;  3BRP A;  2UUL A;  1Y46 B;  3QJE B;  1RSE A;  1FN3 B;  3UHK A;  4H07 A;  1YEV B;  1CH3 A;  2Z8A A;  1G08 B;  1HBR B;  1YHE A;  3DUT A;  1HCO B;  2R80 A;  3R5I B;  3RJ6 A;  3PIA A;  1Y8I A;  1CLS A;  2OH8 A;  3UHS A;  2WTH A;  1GH0 B;  1NZ3 A;  1V4X B;  1YE2 B;  3HEN A;  2VJR A;  1KN1 A;  5EQM A;  1A9W A;  2VML A;  3BJ3 A;  3O89 A;  3WCW A;  1HBA A;  2V1I A;  2ZS1 A;  2VML B;  1MWB A;  1LFV B;  1AJ9 A;  2LH3 A;  4N7O A;  1YHR A;  3OO5 A;  3OGB A;  3OK5 A;  3HHB B;  1HI0 P;  2ZLX A;  1X3K A;  5CNE A;  1DO1 A;  3D1A B;  1Y5J B;  1IBE A;  1DO7 A;  1CP0 A;  3QZZ A;  5SW7 B;  4ESU A;  3TM9 A;  4U8U A;  2GTL A;  3D7O A;  1URV A;  1MOH A;  1FHJ B;  2ZS0 A;  3UHH A;  1O1N A;  3QQR A;  5AZQ A;  3WCV D;  4O1T A;  3UHC A;  4B02 A;  1UVM A;  3BRP B;  1GJN A;  1Y8H A;  4MQJ A;  4PQB A;  2ZT0 A;  1MNH A;  3LQ9 A;  3ZJP A;  1M9P B;  2HBF B;  2E2Y A;  2HZ1 A;  3D4X A;  3WFT A;  3ZOL A;  1MOD A;  2GRH A;  1XZ7 A;  1A3N B;  3PI3 A;  1J7Y A;  1SGK A;  2VM0 A;  4TWU A;  2UUL B;  3UH7 A;  1Y4R A;  1Y0A A;  1Y7D A;  3A9M A;  1SPG B;  1SPE A;  3PT7 A;  3EDA A;  2LHB A;  1GBV B;  3G4W A;  3SDH A;  1JEB A;  1A01 B;  3KVS A;  2UUM B;  4MAX A;  5HLU A;  4N7N A;  1DKE A;  3PT8 B;  2SPL A;  3PI4 A;  1Y7D B;  3O7N A;  1YH9 A;  2R1H A;  4XXK A;  4AVE A;  1ABY A;  5KDQ B;  4N7N B;  1NIH B;  1NEJ B;  2O5Q X;  3NMM B;  3VNC A;  3ED9 A;  1FDH G;  1XZV A;  2H8D A;  2WCQ A;  1PBX B;  3QZX A;  3WCU C;  2G12 A;  3OVU C;  1Y09 B;  4QAU A;  5E83 B;  1O1M B;  3S48 C;  4BJA A;  3WCV B;  1SI4 A;  1XZV B;  4M4A B;  1NQP B;  1QXE B;  3FH9 B;  1HBH A;  1CBM A;  5EOH A;  4N7P A;  1IT2 A;  1YHR B;  3PI2 A;  4HHB A;  2G0S A;  3FS4 A;  103M A;  1Y35 A;  3SZK B;  4MQG B;  1MLU A;  4PQ6 A;  1MNK A;  1I3D A;  4HSX A;  3WFU A;  1Y7Z B;  3L0F B;  3KMF A;  1S69 A;  2PEG A;  3UHB A;  4AE1 A;  1J7S B;  1DDT A;  2HHD A;  5EU2 A;  2R4X A;  1HBS B;  3AQ9 A;  2M6Z A;  1Y0W B;  1YZI B;  2O5B X;  3G52 A;  1MYZ A;  2DXM B;  1CH4 A;  4KN3 A;  3MJU A;  1IRD A;  2EVK A;  1MCY A;  3VRG A;  3D4X B;  1GH0 A;  1XF6 C;  1CO9 A;  4H2L B;  2V1H A;  2V1K A;  2C7L A;  2MBW A;  1DTI A;  3QJC B;  2C7J A;  1Y0T A;  1AJH A;  1MYF A;  1FHJ A;  1ALL A;  3A5A A;  1R1Y B;  1Y45 B;  4AVD A;  1GCW B;  1LFL A;  5EYS A;  1Y8K B;  1Y85 B;  2MGE A;  1YHU D;  2ZS1 C;  1CH1 A;  3G46 A;  1SDL B;  1X9F C;  4A8Y A;  1MNO A;  1C40 A;  3QM8 A;  1CG8 B;  4NXC A;  1CG5 B;  1YE0 A;  1HGA B;  2G0V A;  1MNJ A;  3FS4 B;  2D5X B;  4TWV A;  2R1H B;  2ZSS A;  2AV3 A;  1NQP A;  3A0G A;  1Y4G A;  1NS6 B;  1GBV A;  1MLF A;  3VRF B;  1J3Y B;  3PT7 B;  1GDI A;  2D2N C;  1V07 A;  3NUH B;  4ROL B;  1YEU B;  2X49 A;  2ZWJ A;  3AT5 A;  1UVN A;  3M39 A;  1HBI A;  1Y7C A;  1OUU B;  2MGI A;  1QGW C;  5EYJ A;  4UUR A;  4F0U A;  4A8M P;  5E29 B;  3BCQ A;  2JHO A;  1YOI A;  107M A;  1VHB A;  1Y4V A;  4F0T B;  4MQK A;  3UHT A;  1A00 A;  2AUQ A;  3MJU B;  1Z8U B;  3PT8 A;  3UHD A;  2ZSR A;  3WCU D;  6HBW B;  3GYS A;  1MWD A;  1PHN A;  1JL7 A;  3HYU A;  2UUM X;  3ARJ A;  3CIU B;  4ETU A;  2BKM A;  3QJD B;  3UGZ A;  4YJJ A;  5CN9 A;  1A6M A;  1J41 A;  1MTI A;  3AQ8 A;  1BZ6 A;  3PI1 A;  1L2K A;  1YVT A;  3UGY A;  1JZK A;  1MGN A;  4NXA A;  1C7D A;  1SWM A;  5EUI A;  1KD2 B;  1KTP B;  1QXD A;  3U3E A;  3A59 B;  4F6D A;  3KUN A;  3SZK A;  1HRM A;  1HSY A;  2HBD B;  1HA7 B;  1G0B A;  1LFQ A;  1ABW A;  3MJP B;  3AT6 A;  1A6N A;  2HCO A;  2R4Z A;  4ERV A;  2MGF A;  1DXV A;  1MLS A;  1HGB B;  2ZS0 D;  2ZSQ A;  1I7Y A;  3ZJQ A;  101M A;  2D2N A;  1HDB B;  1LA6 A;  3RGK A;  3VRG B;  2W6Y A;  2VEE A;  3E5O A;  4HRT B;  3ZJI A;  3ZH0 A;  2ZLV A;  2D2M D;  5EUI B;  5B13 A;  1QSH B;  5JOM A;  5CN5 A;  1YIH A;  4MXL A;  1EBC A;  5HAV A;  4YU3 B;  2M6Z B;  2VHB A;  3QM7 A;  1DWS A;  4L1E B;  1HBR A;  5F0B A;  3WR1 A;  1VXC A;  3ONZ B;  1URY A;  2HBS A;  2ZT3 A;  3GDJ B;  1MNI A;  3CY5 A;  4F6J A;  4JYQ A;  3HEO A;  2HHB B;  4O35 A;  4ESA B;  1F0L A;  1O1I B;  1O1J A;  1V4U A;  1WVP A;  1YDZ A;  4HH1 A;  3GQR B;  4F6F A;  1A0Z B;  1YDZ B;  3W4U A;  1XQ5 A;  2MYA A;  3NMM A;  1O1J B;  2D5X A;  4DWU A;  2MYB A;  2H8D B;  2BLH A;  2GNW A;  2RI4 B;  2RAO A;  5JDO F;  1J41 B;  3WCW D;  3WR1 B;  2BV8 B;  1BIJ A;  1DWR A;  2SPM A;  3OZW A;  1XXT A;  1IT3 A;  1JEB B;  2DN2 B;  3TM3 A;  1K1K B;  2GRZ A;  3UI0 A;  3TLD A;  1SPG A;  5E6E A;  1EYX B;  4C44 A;  1Y45 A;  4ZIZ B;  2ZLW B;  2YSK A;  1YGF A;  1N9I A;  2UUM A;  3NFE B;  2Z6S A;  2UUL H;  3ZJJ A;  1BZ1 A;  1OUU A;  1LH2 A;  2ZST A;  4DC8 A;  1MKO A;  2QMB A;  2Z6T A;  4MQI A;  1MYM A;  1I7Y B;  1YEO B;  5AB8 A;  1DLY A;  1HHT P;  3ZHW A;  3ASE A;  1HBB B;  1GDL A;  2DXM A;  1D8U A;  1BUW B;  1MDT A;  1MYT A;  2FAL A;  4L7Y A;  2HBS B;  1NY9 A;  1XZ4 A;  3WCT C;  1EW6 A;  2D6C A;  3QM6 A;  5AQD A;  3IA3 B;  3ZJM A;  5ILP A;  3RQR A;  1B8D B;  2V1J A;  2ZFO A;  3ARL A;  2GRF A;  2GKN A;  4TYX A;  1B33 A;  1DTM A;  1Y0C A;  2MGH A;  3HEP A;  2V1E A;  2D5Z B;  1CLS B;  1Y0C B;  2OHA A;  2IG3 A;  5CNB A;  3S66 B;  2V8A A;  1Y7G B;  3GYS B;  1S6A A;  4GY3 B;  1MYG A;  2AA1 B;  1JZM A;  1V75 B;  1S5Y A;  1BJE A;  3LQD B;  4A8W A;  3GKV B;  3K8B B;  1X9F D;  4F4O A;  1QI8 B;  1JY7 B;  1DXV B;  3A2G A;  3DUT B;  1RPS B;  1AJG A;  3A59 A;  2VLX A;  1LJW A;  4UZV A;  2LH7 A;  2JLG A;  2MGD A;  4M4A A;  1Y83 B;  2AA1 A;  1G0B B;  3WCT A;  2ZSY A;  3V2V A;  4GXE A;  1CII A;  1MYH A;  1U7R A;  2VYZ A;  3OZU A;  5MBN A;  3QJB A;  5HBI A;  3LR9 A;  3GLN A;  1YHU C;  4A8Q A;  1UC3 A;  1M6M A;  2ZSZ A;  6HBI A;  1LH3 A;  1RVW B;  2G11 A;  2ZLU B;  2RAO B;  2PEG B;  1BIN A;  1W92 A;  1G09 B;  1RQA A;  3CIU A;  1VXG A;  3DBJ A;  1KD2 A;  4BJU A;  3O2C A;  2DN2 A;  1C7C B;  5KDQ A;  3DHT A;  1DUO A;  4PO5 A;  4VHB A;  1FSX B;  2WTG A;  7HBI A;  1MBD A;  1XZ5 B;  1Y85 A;  4KMV A;  1HDA A;  4KMW A;  5HU6 B;  1UFP A;  1O1O B;  2MGB A;  4NI0 B;  2WY4 A;  2QSP B;  2NSR A;  3OZV A;  1J7W A;  4DC7 A;  1NAZ A;  2UUL D;  1IWH B;  2GTL B;  1DXT A;  2W6W A;  4F0U B;  5FVB A;  2D60 B;  3AQ5 A;  4MQH B;  1MYJ A;  1LUE A;  1VRE A;  1Y7C B;  2MGJ A;  3K9Z A;  3QM5 A;  1V4X A;  3OO5 B;  4ETT A;  5E6E B;  2ZSN A;  1ECO A;  4N6S A;  3S65 A;  3WCT D;  1XZ2 A;  1R1X A;  4N6S B;  2ZS0 C;  3AQ7 A;  1YE2 A;  1J7Y B;  1F63 A;  2DKA A;  4U8U D;  1VXF A;  4A8S A;  3D1K B;  3V58 A;  1LJW B;  1S5X A;  1THB A;  1IDR A;  3BJ2 A;  3IC2 A;  1HCO A;  2R80 B;  1UX8 A;  2ZFO B;  1YEN A;  1YHE B;  1G9V A;  1A9W E;  1J40 A;  2NSS A;  2VJT A;  2G10 A;  3EOK A;  3PEL A;  3WHM B;  1G9V B;  2ZSO A;  4IT8 A;  1BUW A;  1CH9 A;  1VXH A;  1Y0W A;  1YZI A;  1Y8W A;  2H8F A;  2HBE B;  3KUO A;  3BJ2 B;  1Q1F A;  1LHT A;  3G4R A;  5HY8 B;  4XS0 A;  1FN3 A;  2EF2 A;  1S0H B;  1J40 B;  2AUO A;  1DUK A;  4MU5 A;  3QMA A;  1AJ9 B;  3OO4 B;  2MYE A;  1UIW B;  1NEJ A;  3MWN A;  1G0A A;  4HBI A;  1ON7 B;  3HRW A;  4N7P B;  1HDS A;  1XYE A;  3MVC A;  1UVL A;  1HV4 A;  1MLJ A;  1K1K A;  110M A;  4MQG A;  1FAW B;  5CNF A;  1A3O B;  1RQ3 A;  2D2N D;  3UH6 A;  3WCV C;  4NZI A;  3BJ1 A;  104M A;  1UVX A;  1YEO A;  1CMY B;  3V2Z A;  4MQI B;  1SHR B;  106M A;  1BVD A;  2YRS B;  3EU1 B;  1DXU B;  1COH A;  2DN3 B;  2FRK X;  3HF4 B;  4HHB B;  1O1O A;  1Y4B B;  2BNL A;  3WFX A;  1YEQ B;  5B85 A;  1NS9 A;  1YG5 B;  112M A;  1N9X A;  3LB1 A;  1YVQ B;  3PI8 A;  5EE4 D;  1ABY B;  1WMU B;  2R50 A;  1DM1 A;  1OFK A;  2DHB B;  1UVI A;  1YE0 B;  5D5R A;  3WTG B;  1EMY A;  3UHY A;  2D5Z A;  1JP8 A;  2ZLU A;  1Y4Q A;  3H57 A;  2SPN A;  1FCS A;  1NWI A;  1GDJ A;  3ARK A;  1S56 A;  1V4W B;  2HBG A;  4FC3 B;  2FRI X;  1XZU B;  2O5M X;  4YU4 B;  1HDS B;  1MTK A;  2QFN A;  2QLS B;  1SDL A;  1PMB A;  1TU9 A;  3ECX A;  1OR4 A;  1NS9 B;  1MBC A;  1IRC A;  5HY8 A;  1Y8I B;  4MXK A;  1HAC A;  2B7H B;  2GTL D;  3QJC A;  2GL3 A;  1DO4 A;  1S61 A;  1YEV A;  1O1N B;  1EWA A;  1X9F A;  3ZJS A;  4ROL A;  5C6E B;  1YCB A;  1XZ2 B;  5CHQ A;  1HAB A;  1CO8 A;  1B86 A;  3S65 B;  1NZ4 A;  2C7K B;  3WHM A;  4A8K A;  2VJR B;  1MYI A;  2BLJ M;  1LFT A;  1RQ4 A;  1B86 B;  3R0G A;  2PGH B;  5JDO C;  3GOU B;  1HAB B;  5JDO E;  3WCU A;  1B8D A;  1I3E A;  1MLG A;  4NS2 A;  3HHB A;  4O2G A;  2GNV A;  3B75 B;  1S0H A;  2Z85 A;  1MLM A;  2C7K A;  1OUT B;  2HHE B;  2QSS A;  1SI4 B;  1Y46 A;  3QJE A;  3HYU B;  4ERT A;  3GQG A;  1HBB A;  1G08 A;  3S1J A;  2V1G A;  3LB3 A;  1O16 A;  4MQK B;  1MBA A;  4F0T A;  1GCV A;  2C7J B;  1JWN A;  2D60 A;  2NRM A;  2ZT1 A;  1NWN A;  1VXA A;  4C0N A;  1XCH A;  4N8T B;  1CP5 A;  2GLN A;  1PBX A;  3GDJ A;  5CN7 A;  2G14 A;  4MQC A;  3PMD A;  1IRD B;  1XY0 A;  2QLS A;  1CMY A;  4NI0 A;  1DXD A;  3NG6 A;  1J3Z B;  1UMO A;  1J3Y A;  3UHZ A;  5EE4 C;  1JBO B;  1HHO B;  3IC0 B;  1NZ5 A;  4F6I A;  5CN4 A;  1LH6 A;  1A00 B;  1EYX A;  1YVQ A;  3PI8 B;  2MGA A;  1MOC A;  1BBB B;  1VXD A;  1HGA A;  4FH6 A;  3A5B A;  1BIJ B;  1A4F B;  1QI8 A;  1COH B;  1WMU A;  1Y4R B;  3UHQ A;  2QU0 B;  1YFF A;  3VRE B;  4GZG A;  2EB8 A;  1GDK A;  5MBA A;  1V75 A;  3UBC A;  2DKD A;  1M9P A;  2HBF A;  1NZ2 A;  1O1K A;  2EKT A;  3HF4 A;  1WAC A;  1MLN A;  3MN0 A;  1JY7 A;  1KR7 A;  1XZ5 A;  1CH5 A;  4WJG 1;  1GCV B;  3MKB B;  4LMS B;  2ZLX B;  3AT6 B;  3UH5 A;  2NX0 A;  2O5L X;  2LH2 A;  4X0L B;  4U8U C;  2LH5 A;  3WI8 A;  1Y4P A;  1C7D B;  3G4V A;  3D1K A;  1MDN A;  2OIF A;  2I88 A;  1JZL A;  4L1E A;  3IC0 A;  1TOX A;  2MGL A;  2G0Z A;  1MLQ A;  3WCW B;  1C7B A;  1A3N A;  5JDO D;  4ODC A;  2GDM A;  1JW8 A;  2QMB B;  1B33 B;  2ZLT A;  3NML A;  2O58 X;  4ZVA A;  3UHI A;  2ZFB B;  3QM9 A;  5ILE A;  4LPI A;  3LHB A;  2W6V A;  2HCO B;  3V58 B;  5EET A;  1X9F B;  2G3H A;  1HHS A;  2D2M C;  3D7O B;  2QRW A;  3ZJR A;  4IRO A;  5ILR A;  3ZJL A;  1MLR A;  111M A;  1CIK A;  4YU4 A;  1Y7G A;  1T1N B;  2W31 A;  1IBE B;  4HRR A;  1HAC B;  2B7H A;  1VXE A;  2MYD A;  1V5H A;  5D1V A;  1Y4Q B;  1YGD A;  1MBO A;  2BMM A;  1CIO A;  1YEN B;  2MB5 A;  1Y4P B;  3QJD A;  2AUR A;  4FC3 A;  1RTX A;  2MGM A;  1BBB A;  1BAB A;  1DO3 A;  5AZR A;  1GVH A;  1RTE A;  1DKE B;  5CN8 A;  2W72 B;  3GQP A;  3MOU A;  2NRL A;  3MKB A;  4HSW A;  3WTG A;  1UVJ A;  2VLY A;  4FWX A;  1F99 B;  3D17 B;  2MGK A;  1LIA B;  5HU6 A;  4JAC A;  1MLO A;  1WLA A;  1BZZ B;  2VLZ A;  1A0Z A;  3ONZ A;  4G1V A;  2Z6N B;  1YOG A;  4PO5 B;  2D2M A;  3ZTA A;  3BCQ B;  4F69 A;  2OH9 A;  1CPW A;  1VWT B;  2H35 A;  3O2C B;  3MYM A;  3UHU A;  1DXU A;  1Y4G B;  3GIO A;  3ECL A;  2ZLW A;  1COL A;  3ODQ A;  3G4Y A;  5ILM A;  1LFY B;  1X46 A;  1HLB A;  3BJ1 B;  1XZU A;  1NPG A;  5HLX A;  3CY5 B;  4Q70 B;  1HI8 A;  1RQA B;  1CG8 A;  1HV4 B;  3RJN B;  4HRT A;  4B3W A;  3ZJO A;  5CND A;  1UFJ A;  1VXB A;  4N7O B;  2LH6 A;  2UUL C;  1LA6 B;  1Y22 B;  3E5I A;  1UX9 A;  1BZP A;  3GKT A;  4OF9 A;  2O5T X;  1CG5 A;  2FRJ X;  3KMF C;  4X0L A;  1Y5F A;  2DC3 A;  1GZX B;  5B84 A;  4BS9 A;  1HI1 A;  3DR9 A;  2HBC B;  2ZT4 A;  1RH1 A;  1RVW A;  1KFR A;  2KSC A;  5JGG A;  5M3S A;  5CN6 A;  4ILZ A;  1QXE A;  1YEQ A;  2W6V B;  1A87 A;  1XZ4 B;  1CPC B;  1Y31 B;  1GZX A;  1Y2Z A;  2OLP A;  2HHB A;  4ESA A;  4GXE B;  3LR7 A;  1O1M A;  1IOP A;  4H2L A;  2X4A A;  3V57 B;  3LQD A;  1MKO B;  5KER A;  4DWT A;  3BOM A;  1C7B B;  4HH0 A;  4PQC A;  3QQQ A;  1HJT A;  1LFV A;  1J52 A;  1RPS A;  3WCU B;  2V8A B;  1NGK A;  1CPC A;  1Y31 A;  1HBS A;  3IC2 B;  4ETV A;  4RMP A;  4ZVB A;  4FH7 A;  1ITH A;  1DLW A;  1JP9 A;  3HXN B;  1KN1 B;  1S5Y B;  1H97 A;  3OJ1 A;  3UHR A;  2ZS1 D;  2AUP A;  4NI1 B;  4MQH A;  4MBA A;  1ASH A;  1OFJ A;  3WFW A;  1CBL A;  2JLF A;  1FDH A;  3FH9 A;  2MGG A;  102M A;  4YJJ B;  3LB2 A;  3DHR A;  2XKH A;  1Y4F B;  1DWT A;  1Y35 B;  1J3F A;  1LHS A;  1FSL A;  2W6X A;  4M4B A;  3PI9 A;  1JDO A;  4FWZ A;  5AQD M;  1FSX A;  1ABW B;  3GQR A;  1O1P B;  1YHU A;  2OHB A;  4M4B B;  1MLK A;  4L7Y B;  1A4F A;  1YEU A;  1BAB B;  3GUQ A;  2UUN D;  1JPB A;  3UHW A;  4ROM B;  1ECN A;  3VRF A;  1Y4F A;  5CNG A;  3D1A A;  2IN4 A;  4G51 B;  1QSI B;  1V9Q A;  1G09 A;  4H0M B;  1OUT A;  1Y0D A;  2HHE A;  1BZZ A;  2VEB A;  1QSI A;  2BLI A;  2ZS1 B;  1FAW A;  1NS6 A;  2XYK A;  4Q70 A;  6HBW A;  2UUN A;  1MLH A;  4ZIZ A;  4A8O A;  3ODQ B;  1YGD B;  1MBN A;  1ALL B;  1YIH B;  1YG5 A;  3PI9 B;  1G0A B;  4XDI A; 
#chains in the Genus database with same CATH homology
 2VYW A;  3M3B A;  1VWT A;  5E29 A;  3ZOM A;  2VYY A;  3WCT B;  3GKV A;  3K8B A;  1MZ0 A;  1N9H A;  2GKM A;  3AT5 B;  1GBU B;  1HDB A;  3HC9 A;  1DXC A;  1UVY A;  1JF4 A;  1RQ3 B;  1XQ5 B;  105M A;  3H58 A;  2QSS B;  1V4U B;  4U8U B;  1JP6 A;  1K0Y B;  1Y5F B;  1C7C A;  1Y7Z A;  3G4Q A;  1EBT A;  1V4W A;  2MHB A;  1RQ4 B;  1LTW A;  3K3U A;  4MPM A;  1LFT B;  1HLM A;  4ODC B;  2G0X A;  4PNJ A;  1Y01 B;  5KER B;  3ECZ A;  2CMM A;  2XKI A;  1ECD A;  2HBE A;  1Y8K A;  1TES A;  3UH3 A;  4NK1 A;  3HXN A;  2D2N B;  3AG0 A;  3G4U A;  3UHE A;  4F6G A;  2H35 B;  3UHG A;  2HZ2 A;  2W72 C;  4NK2 A;  1Y4B A;  2MGC A;  4F4O B;  3UHV A;  1H1X A;  5C6E A;  2EB9 A;  3NFE A;  3IXF A;  1UT0 A;  4WJG A;  3AQ6 A;  3GK9 A;  1SHR A;  2HBC A;  2LH1 A;  3ORD A;  1YH9 B;  2QFK A;  1MLL A;  1QXD B;  1Y2Z B;  1XXT B;  1J3Z A;  1J7S A;  2DN1 A;  5JGG B;  3MJP A;  1LFY A;  1MOB A;  1MBI A;  1YIE B;  1XZ7 B;  4O4T A;  3S1I A;  1BVC A;  1CH7 A;  4WCH D;  3P5Q B;  2DHB A;  4KJT A;  4N8T A;  1K0Y A;  2EVP A;  2SPO A;  1DXT B;  3NG6 B;  1Y8H B;  1GLI B;  2Z6N A;  2ZFO D;  4MQC B;  1A0U A;  1BZR A;  2BW9 M;  1YCA A;  1BZ0 A;  3UBV A;  5SW7 A;  3MYN A;  4IRO B;  1Y5J A;  1OJ6 A;  1O1L A;  1GCW A;  1NPF A;  1YMC A;  1LH7 A;  1A0U B;  1GBU A;  1U7S A;  2R4W A;  1NXF A;  1GLI A;  1B0B A;  3DHT B;  2O5S X;  1Y5K B;  1FLP A;  1A3O A;  3SDN A;  2PGH A;  1NIH A;  1OBM A;  2W72 A;  3GQP B;  3ZJH A;  5CMV A;  4B4Y A;  3WCP B;  2ZLT B;  1C40 B;  1MBS A;  1MOA A;  2ZSP A;  1LH5 A;  3D17 A;  4O4Z A;  1UIW A;  1OR6 A;  3S66 A;  3GOU A;  4YU3 A;  1N9F A;  3A0G B;  1LFL B;  3BJ3 B;  1F5O A;  2ZT2 A;  3B75 A;  1Y0D B;  2GTL C;  2FRF A;  4XS0 B;  3E4N A;  3BA2 A;  2FAM A;  1Y0T B;  3UHX A;  1CH2 A;  1MTJ A;  4MBN A;  1CQX A;  1YOH A;  3MBA A;  4F6B A;  2ZLV B;  2ZFB A;  1IWH A;  1O1P A;  108M A;  2ZS0 B;  1MWC A;  2MYC A;  2HZ3 A;  1ABS A;  2QSP A;  1HGB A;  1O1L B;  2O5O X;  1Y8W B;  2H8F B;  2BK9 A;  2G0R A;  5E83 A;  1Y09 A;  2BWH A;  2XKG A;  1S5X B;  1THB B;  1HDA B;  2HHD B;  1Y22 A;  1YFF B;  3VRE A;  1HBG A;  1LFQ B;  3A5G A;  2EKU A;  4OOD A;  1R1X B;  1LFZ A;  3EDB A;  1QPW B;  3VHB A;  5CHR A;  2ZSX A;  4NI1 A;  1F5P A;  1BZ1 B;  1ECA A;  1HBA B;  2V1F A;  3P5Q A;  3ZJN A;  1YVT B;  5IKS A;  4L2M A;  2AV0 A;  109M A;  1YIE A;  1HBH B;  1CQ2 A;  3WCP A;  3PIA B;  1VRF A;  5CNC A;  4FWY A;  1AZI A;  3R5I A;  1HHO A;  3WCV A;  1HGC A;  4G1B A;  3G53 A;  1A6G A;  1Y5K A;  4H0B A;  1O1K B;  3M3A A;  3NL7 A;  3BOM B;  3VAU A;  1XY0 B;  2YRS A;  2RI4 A;  1Y83 A;  1J7W B;  5C6Y A;  2C0K A;  4ROM A;  1JF3 A;  4MQJ B;  1BZ0 B;  1LH1 A;  1SDK B;  2DN3 A;  2D2M B;  1HGC B;  2ZFO C;  3W4U B;  1A6K A;  1YGF B;  2QU0 A;  2HBD A;  5KKK A;  1SDK A;  1JL6 A;  1A01 A;  4UIQ A;  4F68 A;  3EU1 A;  3UHN A;  3DHR B;  1YMB A;  1XYE B;  1LFZ B;  1M6C A;  3HRW B;  3NL7 B;  3WCW C;  2R4Y A;  1YMA A;  4G51 A;  3QJB B;  2MHB B;  4SDH A;  1T1N A;  4HRR B;  3E55 A;  3OO4 A;  1Y0A B;  3LB4 A;  3M38 A;  1YHU B;  1R1Y A;  5F2A A;  2DN1 B;  3EOK B;  1Y4V B;  1QSH A;  3PEL B;  5EV5 A;  1O1I A;  1F65 A;  3GQG B;  1QPW A;  2VRY A;  5HLQ A;  1Y46 B;  3QJE B;  1RSE A;  1FN3 B;  3UHK A;  4H07 A;  1YEV B;  1CH3 A;  2Z8A A;  1G08 B;  1HBR B;  1YHE A;  3DUT A;  1HCO B;  2R80 A;  3R5I B;  3RJ6 A;  3PIA A;  1Y8I A;  1CLS A;  2OH8 A;  3UHS A;  2WTH A;  1NZ3 A;  1V4X B;  1YE2 B;  3HEN A;  5EQM A;  1A9W A;  3BJ3 A;  3O89 A;  3WCW A;  1HBA A;  2V1I A;  2ZS1 A;  1MWB A;  1LFV B;  1AJ9 A;  2LH3 A;  4N7O A;  1YHR A;  3OO5 A;  3OGB A;  3OK5 A;  3HHB B;  2ZLX A;  1X3K A;  5CNE A;  1DO1 A;  3D1A B;  1Y5J B;  1IBE A;  1DO7 A;  1CP0 A;  3QZZ A;  5SW7 B;  3TM9 A;  4U8U A;  2GTL A;  3D7O A;  1URV A;  1MOH A;  1FHJ B;  2ZS0 A;  3UHH A;  1O1N A;  3QQR A;  5AZQ A;  3WCV D;  4O1T A;  3UHC A;  1GJN A;  1Y8H A;  4MQJ A;  4PQB A;  2ZT0 A;  1MNH A;  3ZJP A;  1M9P B;  2HBF B;  2E2Y A;  2HZ1 A;  3D4X A;  3WFT A;  3ZOL A;  1MOD A;  2GRH A;  1XZ7 A;  1A3N B;  3PI3 A;  1J7Y A;  2VM0 A;  4TWU A;  3UH7 A;  1Y4R A;  1Y0A A;  1Y7D A;  3A9M A;  1SPG B;  1SPE A;  3PT7 A;  3EDA A;  2LHB A;  1GBV B;  3G4W A;  3SDH A;  1JEB A;  1A01 B;  4MAX A;  5HLU A;  4N7N A;  1DKE A;  3PT8 B;  2SPL A;  3PI4 A;  1Y7D B;  3O7N A;  1YH9 A;  2R1H A;  4AVE A;  1ABY A;  5KDQ B;  4N7N B;  1NIH B;  1NEJ B;  2O5Q X;  3NMM B;  3ED9 A;  1FDH G;  1XZV A;  2H8D A;  1PBX B;  3QZX A;  3WCU C;  2G12 A;  3OVU C;  4QAU A;  5E83 B;  1Y09 B;  1O1M B;  3S48 C;  4BJA A;  3WCV B;  1SI4 A;  1XZV B;  4M4A B;  1NQP B;  1QXE B;  3FH9 B;  1HBH A;  1CBM A;  5EOH A;  4N7P A;  1IT2 A;  1YHR B;  3PI2 A;  4HHB A;  2G0S A;  3FS4 A;  103M A;  1Y35 A;  3SZK B;  4MQG B;  1MLU A;  4PQ6 A;  1MNK A;  1I3D A;  4HSX A;  3WFU A;  1Y7Z B;  3KMF A;  1S69 A;  2PEG A;  3UHB A;  1J7S B;  2HHD A;  5EU2 A;  2R4X A;  1HBS B;  3AQ9 A;  2M6Z A;  1Y0W B;  1YZI B;  2O5B X;  3G52 A;  1MYZ A;  2DXM B;  1CH4 A;  4KN3 A;  3MJU A;  1IRD A;  2EVK A;  1MCY A;  3VRG A;  3D4X B;  1CO9 A;  4H2L B;  2V1H A;  2V1K A;  2MBW A;  1DTI A;  3QJC B;  1Y0T A;  1AJH A;  1MYF A;  1FHJ A;  3A5A A;  1R1Y B;  1Y45 B;  4AVD A;  1GCW B;  1LFL A;  5EYS A;  1Y8K B;  1Y85 B;  2MGE A;  1YHU D;  2ZS1 C;  1CH1 A;  3G46 A;  1SDL B;  1X9F C;  1MNO A;  1C40 A;  3QM8 A;  1CG8 B;  4NXC A;  1CG5 B;  1YE0 A;  1HGA B;  2G0V A;  1MNJ A;  3FS4 B;  2D5X B;  4TWV A;  2R1H B;  2ZSS A;  2AV3 A;  1NQP A;  3A0G A;  1Y4G A;  1NS6 B;  1GBV A;  1MLF A;  3VRF B;  1J3Y B;  3PT7 B;  1GDI A;  2D2N C;  1V07 A;  4ROL B;  1YEU B;  2ZWJ A;  3AT5 A;  3M39 A;  1HBI A;  1Y7C A;  1OUU B;  2MGI A;  5EYJ A;  4UUR A;  5E29 B;  3BCQ A;  2JHO A;  1YOI A;  107M A;  1VHB A;  1Y4V A;  4MQK A;  3UHT A;  1A00 A;  2AUQ A;  3MJU B;  1Z8U B;  3PT8 A;  3UHD A;  2ZSR A;  3WCU D;  6HBW B;  3GYS A;  1MWD A;  1JL7 A;  3HYU A;  3ARJ A;  3CIU B;  2BKM A;  3QJD B;  3UGZ A;  5CN9 A;  1A6M A;  1J41 A;  1MTI A;  3AQ8 A;  1BZ6 A;  3PI1 A;  1L2K A;  1YVT A;  3UGY A;  1JZK A;  1MGN A;  4NXA A;  1C7D A;  1SWM A;  5EUI A;  1KD2 B;  1QXD A;  3U3E A;  3A59 B;  4F6D A;  3KUN A;  3SZK A;  1HRM A;  1HSY A;  2HBD B;  1G0B A;  1LFQ A;  1ABW A;  3MJP B;  3AT6 A;  1A6N A;  2HCO A;  2R4Z A;  2MGF A;  1DXV A;  1MLS A;  1HGB B;  2ZS0 D;  2ZSQ A;  3ZJQ A;  101M A;  2D2N A;  1HDB B;  1LA6 A;  3RGK A;  3VRG B;  2W6Y A;  2VEE A;  3E5O A;  4HRT B;  3ZJI A;  3ZH0 A;  2ZLV A;  2D2M D;  5EUI B;  1QSH B;  5JOM A;  5CN5 A;  1YIH A;  4MXL A;  1EBC A;  5HAV A;  4YU3 B;  2M6Z B;  2VHB A;  3QM7 A;  1DWS A;  1HBR A;  5F0B A;  3WR1 A;  1VXC A;  3ONZ B;  1URY A;  2HBS A;  2ZT3 A;  3GDJ B;  1MNI A;  3CY5 A;  4F6J A;  4JYQ A;  3HEO A;  2HHB B;  4O35 A;  4ESA B;  1O1I B;  1O1J A;  1V4U A;  1WVP A;  1YDZ A;  3GQR B;  4F6F A;  1A0Z B;  1YDZ B;  3W4U A;  1XQ5 A;  2MYA A;  3NMM A;  1O1J B;  2D5X A;  4DWU A;  2MYB A;  2H8D B;  2BLH A;  2GNW A;  2RI4 B;  2RAO A;  5JDO F;  1J41 B;  3WCW D;  3WR1 B;  1BIJ A;  1DWR A;  2SPM A;  3OZW A;  1XXT A;  1IT3 A;  1JEB B;  2DN2 B;  3TM3 A;  1K1K B;  2GRZ A;  3UI0 A;  3TLD A;  1SPG A;  5E6E A;  4C44 A;  1Y45 A;  2ZLW B;  1YGF A;  1N9I A;  3NFE B;  2Z6S A;  3ZJJ A;  1BZ1 A;  1OUU A;  1LH2 A;  2ZST A;  4DC8 A;  1MKO A;  2QMB A;  2Z6T A;  4MQI A;  1MYM A;  1YEO B;  5AB8 A;  1DLY A;  3ZHW A;  3ASE A;  1HBB B;  1GDL A;  2DXM A;  1D8U A;  1BUW B;  1MYT A;  2FAL A;  4L7Y A;  2HBS B;  1XZ4 A;  3WCT C;  1EW6 A;  2D6C A;  3QM6 A;  3IA3 B;  3ZJM A;  5ILP A;  2V1J A;  2ZFO A;  3ARL A;  2GRF A;  2GKN A;  4TYX A;  1DTM A;  1Y0C A;  2MGH A;  3HEP A;  2V1E A;  2D5Z B;  1CLS B;  1Y0C B;  2OHA A;  2IG3 A;  5CNB A;  3S66 B;  1Y7G B;  3GYS B;  1S6A A;  1MYG A;  2AA1 B;  1JZM A;  1V75 B;  1S5Y A;  1BJE A;  3LQD B;  3GKV B;  3K8B B;  1X9F D;  4F4O A;  1QI8 B;  1JY7 B;  1DXV B;  3A2G A;  3DUT B;  1RPS B;  1AJG A;  3A59 A;  2VLX A;  1LJW A;  4UZV A;  2LH7 A;  2MGD A;  4M4A A;  1Y83 B;  2AA1 A;  1G0B B;  3WCT A;  2ZSY A;  3V2V A;  1MYH A;  1U7R A;  2VYZ A;  3OZU A;  5MBN A;  3QJB A;  5HBI A;  3LR9 A;  3GLN A;  1YHU C;  1UC3 A;  1M6M A;  2ZSZ A;  6HBI A;  1LH3 A;  1RVW B;  2G11 A;  2ZLU B;  2RAO B;  2PEG B;  1BIN A;  1W92 A;  1G09 B;  1RQA A;  3CIU A;  1VXG A;  1KD2 A;  2DN2 A;  1C7C B;  5KDQ A;  3DHT A;  1DUO A;  4VHB A;  1FSX B;  2WTG A;  7HBI A;  1MBD A;  1XZ5 B;  1Y85 A;  4KMV A;  1HDA A;  4KMW A;  5HU6 B;  1UFP A;  1O1O B;  2MGB A;  4NI0 B;  2WY4 A;  2QSP B;  2NSR A;  3OZV A;  1J7W A;  4DC7 A;  1NAZ A;  1IWH B;  2GTL B;  1DXT A;  2W6W A;  2D60 B;  3AQ5 A;  4MQH B;  1MYJ A;  1LUE A;  1VRE A;  1Y7C B;  2MGJ A;  3K9Z A;  3QM5 A;  1V4X A;  3OO5 B;  5E6E B;  2ZSN A;  1ECO A;  3S65 A;  3WCT D;  1XZ2 A;  1R1X A;  2ZS0 C;  3AQ7 A;  1YE2 A;  1J7Y B;  1F63 A;  4U8U D;  1VXF A;  3D1K B;  1LJW B;  1S5X A;  1THB A;  1IDR A;  3BJ2 A;  3IC2 A;  1HCO A;  2R80 B;  1UX8 A;  2ZFO B;  1YEN A;  1YHE B;  1G9V A;  1A9W E;  1J40 A;  2NSS A;  2G10 A;  3EOK A;  3PEL A;  3WHM B;  1G9V B;  2ZSO A;  4IT8 A;  1BUW A;  1CH9 A;  1VXH A;  1Y0W A;  1YZI A;  1Y8W A;  2H8F A;  2HBE B;  3KUO A;  3BJ2 B;  1Q1F A;  1LHT A;  3G4R A;  5HY8 B;  4XS0 A;  1FN3 A;  2EF2 A;  1S0H B;  1J40 B;  2AUO A;  1DUK A;  4MU5 A;  3QMA A;  1AJ9 B;  3OO4 B;  2MYE A;  1UIW B;  1NEJ A;  1G0A A;  4HBI A;  3HRW A;  4N7P B;  1HDS A;  1XYE A;  3MVC A;  1HV4 A;  1MLJ A;  1K1K A;  110M A;  4MQG A;  1FAW B;  5CNF A;  1A3O B;  1RQ3 A;  2D2N D;  3UH6 A;  3WCV C;  4NZI A;  3BJ1 A;  104M A;  1UVX A;  1YEO A;  1CMY B;  3V2Z A;  4MQI B;  1SHR B;  106M A;  1BVD A;  2YRS B;  3EU1 B;  1DXU B;  1COH A;  2DN3 B;  2FRK X;  3HF4 B;  4HHB B;  1O1O A;  1Y4B B;  2BNL A;  3WFX A;  1YEQ B;  5B85 A;  1NS9 A;  1YG5 B;  112M A;  1N9X A;  3LB1 A;  1YVQ B;  3PI8 A;  5EE4 D;  1ABY B;  1WMU B;  2R50 A;  1DM1 A;  1OFK A;  2DHB B;  1YE0 B;  5D5R A;  3WTG B;  1EMY A;  3UHY A;  2D5Z A;  1JP8 A;  2ZLU A;  1Y4Q A;  3H57 A;  2SPN A;  1FCS A;  1NWI A;  1GDJ A;  3ARK A;  1S56 A;  1V4W B;  2HBG A;  4FC3 B;  2FRI X;  1XZU B;  2O5M X;  4YU4 B;  1HDS B;  1MTK A;  2QFN A;  2QLS B;  1SDL A;  1PMB A;  1TU9 A;  3ECX A;  1OR4 A;  1NS9 B;  1MBC A;  1IRC A;  5HY8 A;  1Y8I B;  4MXK A;  1HAC A;  2B7H B;  2GTL D;  3QJC A;  2GL3 A;  1DO4 A;  1S61 A;  1YEV A;  1O1N B;  1EWA A;  1X9F A;  3ZJS A;  4ROL A;  5C6E B;  1YCB A;  1XZ2 B;  5CHQ A;  1HAB A;  1CO8 A;  1B86 A;  3S65 B;  1NZ4 A;  3WHM A;  1MYI A;  2BLJ M;  1LFT A;  1RQ4 A;  1B86 B;  3R0G A;  2PGH B;  5JDO C;  3GOU B;  1HAB B;  5JDO E;  3WCU A;  1MLG A;  1I3E A;  4NS2 A;  3HHB A;  4O2G A;  2GNV A;  3B75 B;  1S0H A;  2Z85 A;  1MLM A;  1OUT B;  2HHE B;  2QSS A;  1SI4 B;  1Y46 A;  3QJE A;  3HYU B;  3GQG A;  1HBB A;  1G08 A;  3S1J A;  2V1G A;  3LB3 A;  1O16 A;  4MQK B;  1MBA A;  1GCV A;  1JWN A;  2D60 A;  2NRM A;  2ZT1 A;  1NWN A;  1VXA A;  4C0N A;  1XCH A;  4N8T B;  1CP5 A;  2GLN A;  1PBX A;  3GDJ A;  5CN7 A;  2G14 A;  4MQC A;  1IRD B;  1XY0 A;  2QLS A;  1CMY A;  4NI0 A;  1DXD A;  3NG6 A;  1J3Z B;  1UMO A;  1J3Y A;  3UHZ A;  5EE4 C;  1HHO B;  3IC0 B;  1NZ5 A;  4F6I A;  5CN4 A;  1LH6 A;  1A00 B;  1YVQ A;  3PI8 B;  2MGA A;  1MOC A;  1BBB B;  1VXD A;  1HGA A;  4FH6 A;  3A5B A;  1BIJ B;  1A4F B;  1QI8 A;  1COH B;  1WMU A;  1Y4R B;  3UHQ A;  2QU0 B;  1YFF A;  3VRE B;  4GZG A;  2EB8 A;  1GDK A;  5MBA A;  1V75 A;  3UBC A;  1M9P A;  2HBF A;  1NZ2 A;  1O1K A;  2EKT A;  3HF4 A;  1MLN A;  3MN0 A;  1JY7 A;  1KR7 A;  1XZ5 A;  1CH5 A;  4WJG 1;  1GCV B;  3MKB B;  2ZLX B;  3AT6 B;  3UH5 A;  2NX0 A;  2O5L X;  2LH2 A;  4X0L B;  4U8U C;  2LH5 A;  3WI8 A;  1Y4P A;  1C7D B;  3G4V A;  3D1K A;  1MDN A;  2OIF A;  1JZL A;  3IC0 A;  2MGL A;  2G0Z A;  1MLQ A;  3WCW B;  1C7B A;  1A3N A;  5JDO D;  4ODC A;  2GDM A;  1JW8 A;  2QMB B;  2ZLT A;  3NML A;  2O58 X;  4ZVA A;  3UHI A;  2ZFB B;  3QM9 A;  5ILE A;  4LPI A;  3LHB A;  2W6V A;  2HCO B;  5EET A;  1X9F B;  2G3H A;  2D2M C;  3D7O B;  2QRW A;  3ZJR A;  4IRO A;  5ILR A;  3ZJL A;  1MLR A;  111M A;  1CIK A;  4YU4 A;  1Y7G A;  1T1N B;  2W31 A;  1IBE B;  4HRR A;  1HAC B;  2B7H A;  1VXE A;  2MYD A;  1V5H A;  5D1V A;  1Y4Q B;  1YGD A;  1MBO A;  2BMM A;  1CIO A;  1YEN B;  2MB5 A;  1Y4P B;  3QJD A;  2AUR A;  4FC3 A;  1RTX A;  2MGM A;  1BBB A;  1BAB A;  1DO3 A;  5AZR A;  1GVH A;  1RTE A;  1DKE B;  5CN8 A;  2W72 B;  3GQP A;  3MOU A;  2NRL A;  3MKB A;  4HSW A;  3WTG A;  2VLY A;  4FWX A;  3D17 B;  2MGK A;  5HU6 A;  4JAC A;  1MLO A;  1WLA A;  1BZZ B;  2VLZ A;  1A0Z A;  3ONZ A;  4G1V A;  2Z6N B;  1YOG A;  2D2M A;  3BCQ B;  4F69 A;  2OH9 A;  1CPW A;  1VWT B;  2H35 A;  3MYM A;  3UHU A;  1DXU A;  1Y4G B;  3ECL A;  2ZLW A;  3ODQ A;  3G4Y A;  5ILM A;  1LFY B;  1X46 A;  1HLB A;  3BJ1 B;  1XZU A;  1NPG A;  5HLX A;  3CY5 B;  1RQA B;  1CG8 A;  1HV4 B;  3RJN B;  4HRT A;  4B3W A;  3ZJO A;  5CND A;  1UFJ A;  1VXB A;  4N7O B;  2LH6 A;  1LA6 B;  1Y22 B;  3E5I A;  1UX9 A;  1BZP A;  3GKT A;  4OF9 A;  2O5T X;  1CG5 A;  2FRJ X;  3KMF C;  4X0L A;  1Y5F A;  2DC3 A;  1GZX B;  5B84 A;  3DR9 A;  2HBC B;  2ZT4 A;  1RVW A;  1KFR A;  2KSC A;  5JGG A;  5M3S A;  5CN6 A;  4ILZ A;  1QXE A;  1YEQ A;  2W6V B;  1XZ4 B;  1Y31 B;  1GZX A;  1Y2Z A;  2OLP A;  2HHB A;  4ESA A;  3LR7 A;  1O1M A;  1IOP A;  4H2L A;  3LQD A;  1MKO B;  5KER A;  4DWT A;  3BOM A;  1C7B B;  4PQC A;  3QQQ A;  1HJT A;  1LFV A;  1J52 A;  1RPS A;  3WCU B;  1NGK A;  1Y31 A;  1HBS A;  3IC2 B;  4ZVB A;  4FH7 A;  1ITH A;  1DLW A;  1JP9 A;  3HXN B;  1S5Y B;  1H97 A;  3OJ1 A;  3UHR A;  2ZS1 D;  2AUP A;  4NI1 B;  4MQH A;  4MBA A;  1ASH A;  1OFJ A;  3WFW A;  1CBL A;  1FDH A;  3FH9 A;  2MGG A;  102M A;  3LB2 A;  3DHR A;  2XKH A;  1Y4F B;  1DWT A;  1Y35 B;  1J3F A;  1LHS A;  1FSL A;  2W6X A;  4M4B A;  3PI9 A;  1JDO A;  4FWZ A;  1FSX A;  1ABW B;  3GQR A;  1O1P B;  1YHU A;  2OHB A;  4M4B B;  1MLK A;  4L7Y B;  1A4F A;  1YEU A;  1BAB B;  1JPB A;  3UHW A;  4ROM B;  1ECN A;  3VRF A;  1Y4F A;  5CNG A;  3D1A A;  2IN4 A;  4G51 B;  1QSI B;  1V9Q A;  1G09 A;  1OUT A;  1Y0D A;  2HHE A;  1BZZ A;  2VEB A;  1QSI A;  2BLI A;  2ZS1 B;  1FAW A;  1NS6 A;  2XYK A;  6HBW A;  1MLH A;  3ODQ B;  1YGD B;  1MBN A;  1YIH B;  1YG5 A;  3PI9 B;  1G0A B;  4XDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...