4ZGCA

Crystal structure analysis of kelch protein (with disulfide bond) from plasmodium falciparum
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
377
structure length
372
Chain Sequence
TMIDINVGGAIFETSRHTLTQQKDSFIEKLHVTRDKQGRIFLDRDSELFRIILNFLRNPLTIPIPKDLSESEALLKEAEFYGIKFLPFPLVFCIGGFDGVEYLNSMELLDISQQCWRMCTPMSTKKAYFGSAVLNNFLYVFGGNNYDYKALFETEVYDRLRDVWYVSSNLNIPRRNNCGVTSNGRIYCIGGYDGSSIIPNVEAYDHRMKAWVEVAPLNTPRSSAMCVAFDNKIYVIGGTNGERLNSIEVYEEKMNKWEQFPYALLEARSSGAAFNYLNQIYVVGGIDNEHNILDSVEQYQPFNKRWQFLNGVPEKKMNFGAATLSDSYIITGGENGEVLNSCHFFSPDTNEWQLGPSLLVPRFGHSVLIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of kelch protein with disulfide bond from Plasmodium falciparum.
rcsb
molecule keywords Kelch protein
molecule tags Structural genomics
source organism Plasmodium falciparum
total genus 91
structure length 372
sequence length 377
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01344 Kelch_1 Kelch motif
A PF02214 BTB_2 BTB/POZ domain
A PF13418 Kelch_4 Galactose oxidase, central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.80 Mainly Beta 6 Propeller Neuraminidase Kelch-type beta propeller 4zgcA02
3.30.710.20 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 4zgcA01
4ZGCA 3ZGCA 2VPJA 5FNUA 3II7A 2ZZKA 2Z32A 5FNRA 5FNTA 4N1BA 3VNHA 4YY8A 2DYHA 3DRYA 4IFJA 3ADEA 2FLUX 2ZW9A 3WDZA 3WN7A 4IFNX 5F72C 5FZNA 4L7CA 1U6DX 5FNQA 4L7BA 1ZGKA 3ZGDA 5CGJA 4L7DA 5FNSA 4XMBA 1X2JA 4IQKA 2WOZA 5FZJA 3VNGA 4ASCA 1X2RA 4ZY3A 4CH9A 4IFLX 3DRXA 2ZWAA 4IN4A 4CHBA 2XN4A
chains in the Genus database with same CATH superfamily
4BKSB 4WEFA 3GVKA 4QN7A 1V3EA 2W38A 5BXHA 4FZHA 1QBIA 4MWJA 7NN9A 3VNHA 4R40A 4GZTA 2W8BA 5DADA 1IVCA 4H52A 2AEQA 2GVUA 2SIMA 4XJ8A 3HU6A 3ZKJB 3WN7A 2BZDA 4GDIA 4CPYA 1Z4VA 5BXBA 5M1ZA 3LI4A 2IAQA 4FOVA 2C4LA 3B7EA 3SOVA 2MA9C 4YZ4A 3DCGB 4AJYC 1EUTA 2F13A 4WQOC 3KGGA 3LNMB 1USRA 1NCDN 1X2RA 2QWHA 3HVEA 4B7JA 2YA4A 4GEZA 1C5KA 2E31B 2VKPA 1N1YA 4FPHA 3DRYA 2GVVA 1QDWA 1IVFA 4XIKA 4QNPA 2B8HA 4X47A 3TI8A 3OHVA 1VCBB 1E8UA 4DG6A 3TI3A 2ISMA 4C1YA 5DAFA 1NN7A 4MWVA 2ZB6A 2HT5A 3WW9A 4BBWA 3K38A 4APFA 1INWA 4HXIA 2QWEA 4B7QA 2A75A 3HVEB 1VCUA 3PJQA 3ALWA 1V3DA 1S0IA 1SUUA 2HTVA 2IASA 3I1CA 4QN4A 4WA3A 4ZGCA 4W9JB 3V7DA 4B95B 3KYAA 4I00A 4MWLA 4GN7A 1Z4XA 2P1MA 4N1BA 2VW1A 3TICA 3GA1A 2VW2A 3KVTA 3D12A 4JTAB 2C9WC 1CQ1A 4CPLA 4YZ1A 4FPCA 5F72C 4L7CA 1R28A 3G4EA 4C1YB 4W9LB 1K32A 4AWJB 2IARA 1CRUA 3ZGDA 4N9F5 5HUNA 1LM8C 4M4UA 5GTQA 1ZI0A 4UIJA 5IBKA 1N6EA 1V0FA 2IAWA 1Z4ZA 4W9DB 3TI5A 1C9UA 4YZ5A 1EODA 3M52A 2VSMA 2OVRA 1E1AA 1IUCA 3OHUA 1EUSA 2FNJC 4QN3A 1NEXA 4CXTA 1NMCA 4IYGA 2X9MA 3B84A 3TI6A 1MZ6A 1LDKD 4D8SA 2BATA 4FPOB 5CGJA 2IHCA 1NSDA 2WOZA 1E8TA 4K1JA 4ZOUA 4NCSA 2XCYA 4GZOA 1DSXA 1NCBN 1USXA 4HZXA 4CP3A 1INHA 4FOQA 2QE8A 5HUKA 2Z32A 3M4TA 1NNCA 4FPLA 4O5SA 4UF7A 5GX1A 5BO4C 4MZEA 3ADEA 3C6PA 4B9KE 1MS3A 1W1XA 2IATA 4HZWA 2HU4A 1S0JA 1W0PA 1INVA 1N1VA 4KS2A 2IAXA 3SOBB 2GVXA 4MJVA 3E5ZA 2RKCA 1INYA 2ZWAA 4DGRA 4XJWA 4GNBA 1MS1A 5FWWA 2F12A 3CL0A 3M5BA 2P4OA 5NN9A 3BEQA 3GVJA 3ALXA 4HIZA 3LUTB 4JTCB 1CS3A 4CPOA 3WSOB 1WP5A 1F8DA 2YA7A 2FLUX 1B9TA 5GX2A 3FVZA 1H6LA 4M4VA 2FP9A 2XZIA 1Z4WA 5FNQA 4UOUA 1B9SA 1EXBE 4X6KA 4FP2A 1B9VA 4QN5A 4XJAA 4GDJA 4GB1A 1INFA 4MWUA 1BJIA 3T1EA 3K39A 3HTMA 5D9DA 3K36A 1F8EA 3O9JA 3UC1A 4FOWA 2ASSA 3ZTCB 3HLHA 3CL2A 3D11A 1WCSA 4YZ3A 2POOA 2QWDA 3INBA 4EOZA 5GX3A 5BXDA 4I6JC 4MWYA 2I2RA 4XJUA 4FQ4A 3TIBA 4KS5A 1BUOA 3SRGA 4D52A 3MKSA 3SREA 1MS9A 3H71A 3A9HA 5LLIB 4GZXA 2QWGA 1Q7FA 3HRPA 1W8NA 3DRZA 3OGLA 5D9CA 2OJHA 2FPCA 4X49A 4B9KB 2VK5A 3B69A 4IFJA 1EUUA 2P1NA 4MZAA 4JF7A 3HQIA 4W9FB 4AGTA 1EOFA 4H53A 4D52B 2YA8A 3G4HA 4KS1A 1V04A 4XMBA 4J9TA 3P5BL 2GHSA 1W21A 4CPMA 2AH2A 5A6RA 4CH9A 4UYIA 1Z50A 4IFLX 5HUGA 2QWBA 2VK6A 4IMBA 1MR5A 4HHOA 4XYXA 5FNUA 1IVBA 1NCAN 3H72A 2JZ3C 4U2MA 5FNTA 2F28A 3U0SA 4HZYA 4YZ2A 4FP3A 2Z8HA 1SO7A 3M8VA 4MWWA 3SILA 2ZW9A 4XMAA 4FPFA 4W9HB 2F27A 4XJ9A 1HV2A 3AMRA 1XOGA 5H7GA 5FNSA 3ZNGB 5F9TA 4FPEA 2V91A 2HT7A 3V1SA 1XOEA 4GN8A 4W9IB 1A4QA 2FPBA 2H2UA 1F8CA 4GZPA 3S8ZA 4YW2A 4W9GB 1L7FA 1DILA 1OFZA 2HT8A 2NZ0B 5HZGC 2YDTA 3TIAA 4FJ6A 4AHAA 4YW3A 2YA5A 2ZB5A 3S8VA 2F24A 5EX7A 3O4PA 1N1SA 2HTWA 1U6DX 2BF6A 2VWDA 2XZKA 3OGMA 1N6DA 3CKZA 4SLIA 1SLLA 2Q81A 5JH5B 5A15A 1X2JA 1N6FA 4W9CB 4A0PA 4GZQA 3O9KA 5EO7A 1QDVA 3Q6KA 4GNCA 4O5TA 2VSKA 3L2OA 3Q6PA 1E8VA 1W8OA 3LI3A 4IN4A 4CHBA 4MWXA 2XN4A 3VNGA 2NN2A 2YA6A 5HX0A 5HYWB 4FPKA 4XILA 4JTDB 3SLIA 1POOA 2GVWA 4CSDA 1EOEA 2P1QA 1PJXA 2G8SA 4IFNX 4NC5A 2F29A 3SOQA 2IF5A 3WWAA 4B7NA 4MC7A 1CRZA 1RWIA 1DIMA 2YDPA 2HTQA 1F8BA 2P1OA 2SILA 1L7GA 2BERA 2F26A 3FW0A 1NSBA 1WCQA 1RWLA 2F0ZA 1V0EA 4XE9A 4BGCA 4GZSA 2VPJA 3DR2A 2W5OA 2ASTA 2VK7A 4XHXA 4YW1A 4XIOA 1W20A 5GX5A 1N7DA 4W9HH 1P22B 1NSCA 2W20A 4AP2A 1A14N 3H6JA 1IVDA 4U77A 2QWIA 3S2KA 3SALA 4X4AA 3BYCA 4CPNA 4PWZA 5H7HA 4YW5A 3TC9A 1IVGA 4L7DA 5B2DA 1MS4A 2HU0A 3JU4A 2PPIA 3ZUNB 4D4UA 1S18A 1NCCN 2QWCA 4K1KA 1IUBA 5H47A 4WA5A 4ZY3A 2P1PA 2F25A 1INXA 3K37A 3C6OA 3DRXA 2OVPA 4XJQA 2W8BB 4YW4A 4HW6A 4W9EB 1MS0A 1S1DA 3NSSA 4FOYA 3BIMA 4BKTB 5FTAA 3AMSA 2QWFA 4FPGA 4KS4A 1FS2B 3DASA 3TI4A 4AH4A 2F10A 4B7MA 1S1GA 4HZZA 4NN9A 5B2CA 2XZJA 3ZTDB 3GVLA 4M3MA 1V0ZA 3V65B 1NN2A 4WEGA 1CVMA 2FHRA 3LBZA 4Q6KA 4B7RA 2C4AA 2VPKA 1MS8A 2DG0A 3A71A 4CRHA 3HLIA 5EUPA 1MS5A 4HZVA 4ZLRA 4MX0A 4MWQA 4FPYA 4D52C 6NN9A 3II7A 5FNRA 1FS1B 3ZRCB 5HUMA 2IZVC 4GNAA 1L7HA 4JGHC 3H73A 1R2BA 3NO0A 2HTUA 2IAOA 2DYHA 4MJUA 2R9RB 3NN9A 2OVQA 1V2IA 2AGSA 4J8ZA 3Q6TA 2SLIA 1NMBN 3A9GA 1NMAN 3ZRFB 1V3CA 3OGKA 4K1HA 1LQBB 3K3AA 3W09A 1VCJA 2VAQA 4CXIA 5FZJA 4XMIA 2DG1A 4CPZA 2YY9A 2CMLA 1IVEA 2HQSA 4HHQA 2AEPA 1Z4YA 2ZZKA 1FQVB 1W0OA 1NPEA 4FPJA 4Q1UA 2QWJA 5D9BA 4YY8A 1A68A 3A72A 2W5NA 1T1DA 1MZ5A 5EO8A 3L6VA 5FZNA 4GN9A 2JKBA 1SLIA 1SNTA 1INGA 4XHBA 2DSOA 4CXJA 1ZGKA 3SANA 5JYYA 4IQKA 3S94A 1R29A 3IAXA 4K1IA 2VW0A 3I3NA 3FKCA 4ASCA 1NNBA 4U2NA 1MWEA 4GZWA 4GJTA 3C6NA 4W9KB 3WDZA 4K3YA 3ZGCA 2VVZA 3V64C 2HTYA 2IAUA 2QWKA 4AGIA 4FVKA 3LI5A 3CYEA 1EURA 3OPZA 2H2NA 4XOGA 1IJQA 1V3BA 4KS3A 2IAVA 4G3NA 4L7BA 2F11A 2IAPA 2QWAA 4M4NA 1A4GA 1NNAA 1KITA 4JMLA 4WA4A 4XJZA 5GX4A 2A79B 4QN6A 2E32B 2IVZA 4MWRA 4XJRA 1N1TA 2HTRA 1QLGA 3E4UA 2FP8A
chains in the Genus database with same CATH topology
4BKSB 4CP3A 5FNUA 4W9EB 2Z32A 5BXHA 3M4TA 2JZ3C 4U2MA 5FNTA 2Z8HA 3VNHA 3BIMA 4BKTB 5DADA 5BO4C 5FTAA 3M8VA 3ADEA 3C6PA 3HU6A 1FS2B 3ZKJB 2ZW9A 3WN7A 4B9KE 4W9HB 1S1GA 1HV2A 3ZTDB 5BXBA 5H7GA 5FNSA 3ZNGB 3LBZA 2MA9C 2VPKA 4CRHA 3DCGB 4AJYC 5EUPA 4WQOC 3LNMB 4W9IB 1X2RA 2ZWAA 4W9GB 3HVEA 3DRXA 3II7A 5HZGC 5FNRA 2NZ0B 1FS1B 3M5BA 3ZRCB 2E31B 2IZVC 2VKPA 4JGHC 3LUTB 1R2BA 4JTCB 1CS3A 3WSOB 2DYHA 3DRYA 2R9RB 1QDWA 2FLUX 2OVQA 4J8ZA 1U6DX 3OGMA 3OHVA 5FNQA 1VCBB 3ZRFB 3OGKA 1EXBE 2Q81A 5JH5B 1LQBB 5A15A 1X2JA 5DAFA 1NN7A 4W9CB 4APFA 4CXIA 5FZJA 4HXIA 1QDVA 2YY9A 3HVEB 3L2OA 2NN2A 4IN4A 4CHBA 3VNGA 2XN4A 4ZGCA 5HYWB 4W9JB 3V7DA 4B95B 3HTMA 2ZZKA 4JTDB 1FQVB 3E4UA 2P1MA 4N1BA 4YY8A 3GA1A 2ASSA 1A68A 3KVTA 4JTAB 2C9WC 3ZTCB 1EOEA 1T1DA 2P1QA 4IFNX 5F72C 5FZNA 4EOZA 4L7CA 1R28A 5BXDA 4I6JC 4W9LB 2I2RA 2IF5A 4AWJB 4CXJA 1ZGKA 3ZGDA 4N9F5 1BUOA 4IQKA 1LM8C 1R29A 3MKSA 3I3NA 2P1OA 3FKCA 4ASCA 5LLIB 4UIJA 5IBKA 4U2NA 3DRZA 4W9DB 3C6NA 4W9KB 3OGLA 3WDZA 3ZGCA 4BGCA 2VPJA 1EODA 2ASTA 3M52A 2OVRA 3OHUA 4B9KB 2FNJC 1NEXA 4W9HH 4CXTA 4IFJA 1P22B 2P1NA 3B84A 4AP2A 3HQIA 4U77A 4W9FB 1EOFA 1LDKD 4L7BA 5H7HA 5CGJA 4L7DA 4XMBA 2IHCA 2A79B 2PPIA 3ZUNB 2WOZA 2E32B 4ZOUA 4ZY3A 2P1PA 5A6RA 4CH9A 4UYIA 4IFLX 3C6OA 1DSXA 2OVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGC A;  3ZGC A;  2VPJ A;  5FNU A;  3II7 A;  2ZZK A;  2Z32 A;  5FNR A;  5FNT A;  4N1B A;  3VNH A;  4YY8 A;  2DYH A;  3DRY A;  4IFJ A;  3ADE A;  2FLU X;  2ZW9 A;  3WDZ A;  3WN7 A;  4IFN X;  5F72 C;  5FZN A;  4L7C A;  1U6D X;  5FNQ A;  4L7B A;  1ZGK A;  3ZGD A;  5CGJ A;  4L7D A;  5FNS A;  4XMB A;  1X2J A;  4IQK A;  2WOZ A;  5FZJ A;  3VNG A;  4ASC A;  1X2R A;  4ZY3 A;  4CH9 A;  4IFL X;  3DRX A;  2ZWA A;  4IN4 A;  4CHB A;  2XN4 A; 
#chains in the Genus database with same CATH topology
 4BKS B;  4WEF A;  3GVK A;  4QN7 A;  1V3E A;  2W38 A;  5BXH A;  4FZH A;  1QBI A;  4MWJ A;  7NN9 A;  3VNH A;  4R40 A;  4GZT A;  2W8B A;  5DAD A;  1IVC A;  4H52 A;  2AEQ A;  2GVU A;  2SIM A;  4XJ8 A;  3HU6 A;  3ZKJ B;  3WN7 A;  2BZD A;  4GDI A;  4CPY A;  1Z4V A;  5BXB A;  5M1Z A;  3LI4 A;  2IAQ A;  4FOV A;  2C4L A;  3B7E A;  3SOV A;  2MA9 C;  4YZ4 A;  3DCG B;  4AJY C;  1EUT A;  2F13 A;  4WQO C;  3KGG A;  3LNM B;  1USR A;  1NCD N;  1X2R A;  2QWH A;  3HVE A;  4B7J A;  2YA4 A;  4GEZ A;  1C5K A;  2E31 B;  2VKP A;  1N1Y A;  4FPH A;  3DRY A;  2GVV A;  1QDW A;  1IVF A;  4XIK A;  4QNP A;  2B8H A;  4X47 A;  3TI8 A;  3OHV A;  1VCB B;  1E8U A;  4DG6 A;  3TI3 A;  2ISM A;  4C1Y A;  5DAF A;  1NN7 A;  4MWV A;  2ZB6 A;  2HT5 A;  3WW9 A;  4BBW A;  3K38 A;  4APF A;  1INW A;  4HXI A;  2QWE A;  4B7Q A;  2A75 A;  3HVE B;  1VCU A;  3PJQ A;  3ALW A;  1V3D A;  1S0I A;  1SUU A;  2HTV A;  2IAS A;  3I1C A;  4QN4 A;  4WA3 A;  4ZGC A;  4W9J B;  3V7D A;  4B95 B;  3KYA A;  4I00 A;  4MWL A;  4GN7 A;  1Z4X A;  2P1M A;  4N1B A;  2VW1 A;  3TIC A;  3GA1 A;  2VW2 A;  3KVT A;  3D12 A;  4JTA B;  2C9W C;  1CQ1 A;  4CPL A;  4YZ1 A;  4FPC A;  5F72 C;  4L7C A;  1R28 A;  3G4E A;  4C1Y B;  4W9L B;  1K32 A;  4AWJ B;  2IAR A;  1CRU A;  3ZGD A;  4N9F 5;  5HUN A;  1LM8 C;  4M4U A;  5GTQ A;  1ZI0 A;  4UIJ A;  5IBK A;  1N6E A;  1V0F A;  2IAW A;  1Z4Z A;  4W9D B;  3TI5 A;  1C9U A;  4YZ5 A;  1EOD A;  3M52 A;  2VSM A;  2OVR A;  1E1A A;  1IUC A;  3OHU A;  1EUS A;  2FNJ C;  4QN3 A;  1NEX A;  4CXT A;  1NMC A;  4IYG A;  2X9M A;  3B84 A;  3TI6 A;  1MZ6 A;  1LDK D;  4D8S A;  2BAT A;  4FPO B;  5CGJ A;  2IHC A;  1NSD A;  2WOZ A;  1E8T A;  4K1J A;  4ZOU A;  4NCS A;  2XCY A;  4GZO A;  1DSX A;  1NCB N;  1USX A;  4HZX A;  4CP3 A;  1INH A;  4FOQ A;  2QE8 A;  5HUK A;  2Z32 A;  3M4T A;  1NNC A;  4FPL A;  4O5S A;  4UF7 A;  5GX1 A;  5BO4 C;  4MZE A;  3ADE A;  3C6P A;  4B9K E;  1MS3 A;  1W1X A;  2IAT A;  4HZW A;  2HU4 A;  1S0J A;  1W0P A;  1INV A;  1N1V A;  4KS2 A;  2IAX A;  3SOB B;  2GVX A;  4MJV A;  3E5Z A;  2RKC A;  1INY A;  2ZWA A;  4DGR A;  4XJW A;  4GNB A;  1MS1 A;  5FWW A;  2F12 A;  3CL0 A;  3M5B A;  2P4O A;  5NN9 A;  3BEQ A;  3GVJ A;  3ALX A;  4HIZ A;  3LUT B;  4JTC B;  1CS3 A;  4CPO A;  3WSO B;  1WP5 A;  1F8D A;  2YA7 A;  2FLU X;  1B9T A;  5GX2 A;  3FVZ A;  1H6L A;  4M4V A;  2FP9 A;  2XZI A;  1Z4W A;  5FNQ A;  4UOU A;  1B9S A;  1EXB E;  4X6K A;  4FP2 A;  1B9V A;  4QN5 A;  4XJA A;  4GDJ A;  4GB1 A;  1INF A;  4MWU A;  1BJI A;  3T1E A;  3K39 A;  3HTM A;  5D9D A;  3K36 A;  1F8E A;  3O9J A;  3UC1 A;  4FOW A;  2ASS A;  3ZTC B;  3HLH A;  3CL2 A;  3D11 A;  1WCS A;  4YZ3 A;  2POO A;  2QWD A;  3INB A;  4EOZ A;  5GX3 A;  5BXD A;  4I6J C;  4MWY A;  2I2R A;  4XJU A;  4FQ4 A;  3TIB A;  4KS5 A;  1BUO A;  3SRG A;  4D52 A;  3MKS A;  3SRE A;  1MS9 A;  3H71 A;  3A9H A;  5LLI B;  4GZX A;  2QWG A;  1Q7F A;  3HRP A;  1W8N A;  3DRZ A;  3OGL A;  5D9C A;  2OJH A;  2FPC A;  4X49 A;  4B9K B;  2VK5 A;  3B69 A;  4IFJ A;  1EUU A;  2P1N A;  4MZA A;  4JF7 A;  3HQI A;  4W9F B;  4AGT A;  1EOF A;  4H53 A;  4D52 B;  2YA8 A;  3G4H A;  4KS1 A;  1V04 A;  4XMB A;  4J9T A;  3P5B L;  2GHS A;  1W21 A;  4CPM A;  2AH2 A;  5A6R A;  4CH9 A;  4UYI A;  1Z50 A;  4IFL X;  5HUG A;  2QWB A;  2VK6 A;  4IMB A;  1MR5 A;  4HHO A;  4XYX A;  5FNU A;  1IVB A;  1NCA N;  3H72 A;  2JZ3 C;  4U2M A;  5FNT A;  2F28 A;  3U0S A;  4HZY A;  4YZ2 A;  4FP3 A;  2Z8H A;  1SO7 A;  3M8V A;  4MWW A;  3SIL A;  2ZW9 A;  4XMA A;  4FPF A;  4W9H B;  2F27 A;  4XJ9 A;  1HV2 A;  3AMR A;  1XOG A;  5H7G A;  5FNS A;  3ZNG B;  5F9T A;  4FPE A;  2V91 A;  2HT7 A;  3V1S A;  1XOE A;  4GN8 A;  4W9I B;  1A4Q A;  2FPB A;  2H2U A;  1F8C A;  4GZP A;  3S8Z A;  4YW2 A;  4W9G B;  1L7F A;  1DIL A;  1OFZ A;  2HT8 A;  2NZ0 B;  5HZG C;  2YDT A;  3TIA A;  4FJ6 A;  4AHA A;  4YW3 A;  2YA5 A;  2ZB5 A;  3S8V A;  2F24 A;  5EX7 A;  3O4P A;  1N1S A;  2HTW A;  1U6D X;  2BF6 A;  2VWD A;  2XZK A;  3OGM A;  1N6D A;  3CKZ A;  4SLI A;  1SLL A;  2Q81 A;  5JH5 B;  5A15 A;  1X2J A;  1N6F A;  4W9C B;  4A0P A;  4GZQ A;  3O9K A;  5EO7 A;  1QDV A;  3Q6K A;  4GNC A;  4O5T A;  2VSK A;  3L2O A;  3Q6P A;  1E8V A;  1W8O A;  3LI3 A;  4IN4 A;  4CHB A;  4MWX A;  2XN4 A;  3VNG A;  2NN2 A;  2YA6 A;  5HX0 A;  5HYW B;  4FPK A;  4XIL A;  4JTD B;  3SLI A;  1POO A;  2GVW A;  4CSD A;  1EOE A;  2P1Q A;  1PJX A;  2G8S A;  4IFN X;  4NC5 A;  2F29 A;  3SOQ A;  2IF5 A;  3WWA A;  4B7N A;  4MC7 A;  1CRZ A;  1RWI A;  1DIM A;  2YDP A;  2HTQ A;  1F8B A;  2P1O A;  2SIL A;  1L7G A;  2BER A;  2F26 A;  3FW0 A;  1NSB A;  1WCQ A;  1RWL A;  2F0Z A;  1V0E A;  4XE9 A;  4BGC A;  4GZS A;  2VPJ A;  3DR2 A;  2W5O A;  2AST A;  2VK7 A;  4XHX A;  4YW1 A;  4XIO A;  1W20 A;  5GX5 A;  1N7D A;  4W9H H;  1P22 B;  1NSC A;  2W20 A;  4AP2 A;  1A14 N;  3H6J A;  1IVD A;  4U77 A;  2QWI A;  3S2K A;  3SAL A;  4X4A A;  3BYC A;  4CPN A;  4PWZ A;  5H7H A;  4YW5 A;  3TC9 A;  1IVG A;  4L7D A;  5B2D A;  1MS4 A;  2HU0 A;  3JU4 A;  2PPI A;  3ZUN B;  4D4U A;  1S18 A;  1NCC N;  2QWC A;  4K1K A;  1IUB A;  5H47 A;  4WA5 A;  4ZY3 A;  2P1P A;  2F25 A;  1INX A;  3K37 A;  3C6O A;  3DRX A;  2OVP A;  4XJQ A;  2W8B B;  4YW4 A;  4HW6 A;  4W9E B;  1MS0 A;  1S1D A;  3NSS A;  4FOY A;  3BIM A;  4BKT B;  5FTA A;  3AMS A;  2QWF A;  4FPG A;  4KS4 A;  1FS2 B;  3DAS A;  3TI4 A;  4AH4 A;  2F10 A;  4B7M A;  1S1G A;  4HZZ A;  4NN9 A;  5B2C A;  2XZJ A;  3ZTD B;  3GVL A;  4M3M A;  1V0Z A;  3V65 B;  1NN2 A;  4WEG A;  1CVM A;  2FHR A;  3LBZ A;  4Q6K A;  4B7R A;  2C4A A;  2VPK A;  1MS8 A;  2DG0 A;  3A71 A;  4CRH A;  3HLI A;  5EUP A;  1MS5 A;  4HZV A;  4ZLR A;  4MX0 A;  4MWQ A;  4FPY A;  4D52 C;  6NN9 A;  3II7 A;  5FNR A;  1FS1 B;  3ZRC B;  5HUM A;  2IZV C;  4GNA A;  1L7H A;  4JGH C;  3H73 A;  1R2B A;  3NO0 A;  2HTU A;  2IAO A;  2DYH A;  4MJU A;  2R9R B;  3NN9 A;  2OVQ A;  1V2I A;  2AGS A;  4J8Z A;  3Q6T A;  2SLI A;  1NMB N;  3A9G A;  1NMA N;  3ZRF B;  1V3C A;  3OGK A;  4K1H A;  1LQB B;  3K3A A;  3W09 A;  1VCJ A;  2VAQ A;  4CXI A;  5FZJ A;  4XMI A;  2DG1 A;  4CPZ A;  2YY9 A;  2CML A;  1IVE A;  2HQS A;  4HHQ A;  2AEP A;  1Z4Y A;  2ZZK A;  1FQV B;  1W0O A;  1NPE A;  4FPJ A;  4Q1U A;  2QWJ A;  5D9B A;  4YY8 A;  1A68 A;  3A72 A;  2W5N A;  1T1D A;  1MZ5 A;  5EO8 A;  3L6V A;  5FZN A;  4GN9 A;  2JKB A;  1SLI A;  1SNT A;  1ING A;  4XHB A;  2DSO A;  4CXJ A;  1ZGK A;  3SAN A;  5JYY A;  4IQK A;  3S94 A;  1R29 A;  3IAX A;  4K1I A;  2VW0 A;  3I3N A;  3FKC A;  4ASC A;  1NNB A;  4U2N A;  1MWE A;  4GZW A;  4GJT A;  3C6N A;  4W9K B;  3WDZ A;  4K3Y A;  3ZGC A;  2VVZ A;  3V64 C;  2HTY A;  2IAU A;  2QWK A;  4AGI A;  4FVK A;  3LI5 A;  3CYE A;  1EUR A;  3OPZ A;  2H2N A;  4XOG A;  1IJQ A;  1V3B A;  4KS3 A;  2IAV A;  4G3N A;  4L7B A;  2F11 A;  2IAP A;  2QWA A;  4M4N A;  1A4G A;  1NNA A;  1KIT A;  4JML A;  4WA4 A;  4XJZ A;  5GX4 A;  2A79 B;  4QN6 A;  2E32 B;  2IVZ A;  4MWR A;  4XJR A;  1N1T A;  2HTR A;  1QLG A;  3E4U A;  2FP8 A; 
#chains in the Genus database with same CATH homology
 4BKS B;  4CP3 A;  5FNU A;  4W9E B;  2Z32 A;  5BXH A;  3M4T A;  2JZ3 C;  4U2M A;  5FNT A;  2Z8H A;  3VNH A;  3BIM A;  4BKT B;  5DAD A;  5BO4 C;  5FTA A;  3M8V A;  3ADE A;  3C6P A;  3HU6 A;  1FS2 B;  3ZKJ B;  2ZW9 A;  3WN7 A;  4B9K E;  4W9H B;  1S1G A;  1HV2 A;  3ZTD B;  5BXB A;  5H7G A;  5FNS A;  3ZNG B;  3LBZ A;  2MA9 C;  2VPK A;  4CRH A;  3DCG B;  4AJY C;  5EUP A;  4WQO C;  3LNM B;  4W9I B;  1X2R A;  2ZWA A;  4W9G B;  3HVE A;  3DRX A;  3II7 A;  5HZG C;  5FNR A;  2NZ0 B;  1FS1 B;  3M5B A;  3ZRC B;  2E31 B;  2IZV C;  2VKP A;  4JGH C;  3LUT B;  1R2B A;  4JTC B;  1CS3 A;  3WSO B;  2DYH A;  3DRY A;  2R9R B;  1QDW A;  2FLU X;  2OVQ A;  4J8Z A;  1U6D X;  3OGM A;  3OHV A;  5FNQ A;  1VCB B;  3ZRF B;  3OGK A;  1EXB E;  2Q81 A;  5JH5 B;  1LQB B;  5A15 A;  1X2J A;  5DAF A;  1NN7 A;  4W9C B;  4APF A;  4CXI A;  5FZJ A;  4HXI A;  1QDV A;  2YY9 A;  3HVE B;  3L2O A;  2NN2 A;  4IN4 A;  4CHB A;  3VNG A;  2XN4 A;  4ZGC A;  5HYW B;  4W9J B;  3V7D A;  4B95 B;  3HTM A;  2ZZK A;  4JTD B;  1FQV B;  3E4U A;  2P1M A;  4N1B A;  4YY8 A;  3GA1 A;  2ASS A;  1A68 A;  3KVT A;  4JTA B;  2C9W C;  3ZTC B;  1EOE A;  1T1D A;  2P1Q A;  4IFN X;  5F72 C;  5FZN A;  4EOZ A;  4L7C A;  1R28 A;  5BXD A;  4I6J C;  4W9L B;  2I2R A;  2IF5 A;  4AWJ B;  4CXJ A;  1ZGK A;  3ZGD A;  4N9F 5;  1BUO A;  4IQK A;  1LM8 C;  1R29 A;  3MKS A;  3I3N A;  2P1O A;  3FKC A;  4ASC A;  5LLI B;  4UIJ A;  5IBK A;  4U2N A;  3DRZ A;  4W9D B;  3C6N A;  4W9K B;  3OGL A;  3WDZ A;  3ZGC A;  4BGC A;  2VPJ A;  1EOD A;  2AST A;  3M52 A;  2OVR A;  3OHU A;  4B9K B;  2FNJ C;  1NEX A;  4W9H H;  4CXT A;  4IFJ A;  1P22 B;  2P1N A;  3B84 A;  4AP2 A;  3HQI A;  4U77 A;  4W9F B;  1EOF A;  1LDK D;  4L7B A;  5H7H A;  5CGJ A;  4L7D A;  4XMB A;  2IHC A;  2A79 B;  2PPI A;  3ZUN B;  2WOZ A;  2E32 B;  4ZOU A;  4ZY3 A;  2P1P A;  5A6R A;  4CH9 A;  4UYI A;  4IFL X;  3C6O A;  1DSX A;  2OVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...