3HVEA

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
216
Chain Sequence
b'SDPQHAARLLRALSSFRERFCDAHLVLDGEEIPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLNDTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLERYVFEAVIRWIAHEIRKVHMKDVMSALWVSGLDSYLREQMLNEPLVREIVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gigaxonin
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
total genus 52
structure length 216
sequence length 240
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveA01
4B9KB 2VKPA 2EQXA 2IHCA 2OVQA 4W9HH 2P1OA 4W9IB 5HZGC 5BXHA 2FNJC 1FQVB 3ZNGB 2P1QA 3E4UA 3C6OA 4W9CB 2IF5A 2IZVC 1VCBB 3ZKJB 5DAFA 4WQOC 4BKTB 2YY9A 3HQIA 3OGLA 3BIMA 4ZOUA 1CS3A 5HYWB 4JTDB 4U2NA 3OGKA 3WSOB 5EUPA 3M52A 3KVTA 1FS1B 3ZTDB 2E31B 3HVEA 4W9GB 1LQBB 4UIJA 1S1GA 1R2BA 4AJYC 1FS2B 1R28A 3OHUA 1LM8C 1EOEA 3OGMA 4B9KE 3M5BA 5FTAA 4U77A 2E32B 4BGCA 1EOFA 2P1MA 1LDKD 4APFA 4BKSB 5BXBA 4W9KB 4CXIA 3MKSA 1NN7A 5H7GA 2P1NA 1EXBE 3C6PA 2NN2A 3ZRCB 3L2OA 2OVRA 4HXIA 3ZRFB 1QDVA 3ZUNB 5JH5B 2Q81A 2P1PA 2NZ0B 4JGHC 3HTMA 4W9JB 4HS2A 5H7HA 4W9HB 4I6JC 3C6NA 3DRZA 1BUOA 5LLIB 5A6RA 4JTAB 4AP2A 4W9LB 4EOZA 4UYIA 5BO4C 1QDWA 3HU6A 3V7DA 3LNMB 4CP3A 5BXDA 4N9F5 4W9DB 4CRHA 4W9FB 2MA9C 1T1DA 4B95B 1DSXA 3M8VA 1R29A 3LBZA 2R9RB 4U2MA 2VPKA 1EODA 3B84A 5A15A 4JTCB 2C9WC 2I2RA 3FKCA 3GA1A 5DADA 2OVPA 4J8ZA 3OHVA 3ZTCB 2ASTA 4CXTA 3LUTB 4AWJB 1HV2A 4W9EB 1P22B 3HVEB 5IBKA 2PPIA 1A68A 4CXJA 3I3NA 3DCGB 2Z8HA 1NEXA 2A79B 2JZ3C 2ASSA 3M4TA
chains in the Genus database with same CATH superfamily
2Y0BG 5CECB 3MV3B 4GCOA 1YMPA 4A1SA 2OEWA 3B7TA 3FEYA 3KSLA 5C2YA 4CT0A 2F8XK 3FTUA 4F7AA 2ZGGA 2WXFA 3CK8A 3O4ZA 4PS7A 3SHFA 3APDA 5BUZA 4Q94A 3R7RA 4BEPA 3HVEA 3Q79A 2WXOA 2HYZA 3SFZA 4F53A 3Q7FA 5ENTD 3TWVA 2E0IA 2CFUA 2WM9A 2XEEA 2AVPA 4CXIA 4K5BA 2WMOA 5H7GA 1EXBE 3ZIMA 3LY7A 4J8DA 4YDEA 4N2SA 4ANWA 4FJZA 2PQRA 1FPPA 3NBNB 4FA6A 1BUOA 1OY3D 1WDYA 2EINE 4KYOB 5KWDA 2J07A 1T1DA 4A63B 5EDSA 3GZ2A 4UI9J 3R9MA 3ASDA 5G05C 4AY6A 4JTCB 5T8IA 2OVPA 4J8ZA 2Q7FA 1SZ9A 1E7UA 4XEIG 3Q15A 4W9EB 3PNLB 3HVEB 1A68A 4MBGA 3HXFA 1Z6TA 3D9IA 4JVSA 1QQEA 4JB8P 4LUNU 2P1OA 4YVQC 4U8VD 1UN9A 3NOCD 2RG8A 5KNHD 5BXHA 4GTTA 5E76A 2XS8A 4W9CB 4N3CA 2XHEA 1NI1A 3RIBA 3OGKA 3EHMA 4HQDA 3V2OA 3HRAA 1RZ4A 2C0LA 5FJYA 4TUMA 2XZDG 4ATGA 2P9NG 3ULYA 3JQ1A 3ONLA 4BWRA 2Y4UA 4B9KE 3IBEA 1DCQA 4G26A 3LEWA 2E32B 1ZU2A 2XQ0A 3F6QA 3FFLA 4JC8A 3ZVVA 3S7JA 4HORA 3QKYA 1KT1A 3ZRCB 4IN3B 5FQ7A 4PS8A 2GGFA 5JJTA 4LNGA 5AENA 1JCSA 3OXGA 4FC8A 4YNDA 3FUEA 1IHGA 4DX1A 4HB5A 4NURA 3R7QA 1JPLA 4MRUA 4XZ4A 2ETAA 2XEHA 1R29A 3DEPA 3ENEA 1IQUA 5EX0A 5A15A 4CGVA 2LAIA 1HV2A 2F37A 4I1OB 2XZTG 1TNUA 4ILGA 4CXJA 1EF1C 4EBAA 3TWQA 4U07A 3CR3A 2VKPA 2L9BA 3CGHA 4W9HH 1EYHA 4L2LA 5H7PA 3AS5A 2DBAA 1TEZA 5G55A 1E90A 3AU4A 4G24A 1EPUA 5ARGA 4EZJA 4DJAA 5DBKA 2BKGA 3B7BA 4GTQA 3CQGB 2PL2A 4BY6A 1E96B 3D9NA 4WWOA 5T3RA 1KLXA 5IY5E 3FH7A 3T5VA 3NZUA 2XCCA 1L5JA 1N4PA 2VGXA 1ZB1A 3SBTB 2C2LA 4W9KB 4UQXA 4GTRA 2PQNA 2X6IA 4K5CA 3C6PA 3B7RL 3D9JA 2DCPA 3G2SA 3ASOE 2WXJA 4UWGA 3FU5A 4KZ0A 1TJCA 2FI7A 4BFRA 3VLFA 3DSWA 3CSTA 3PE4A 3G2TA 1HG5A 3TXNA 4W9LB 4RSYA 4N9F5 4TXPA 4AVXA 4W9DB 2LUHA 3L9TA 3AG2E 3OXFA 3UIPC 1PY1A 2VTBA 3ZEFA 3TG4A 4U04A 2ASTA 2E2EA 2M63A 3FULA 3AG4E 3CVNA 3N71A 1K1AA 3CVYA 4XI9A 3QK0A 4JPSA 4XX5A 2A79B 3AS8A 4JZYA 2Y1LE 2ZGDA 5EX3A 4B93B 3R9AB 3FY4A 4Y6CA 4W9IB 4JL0A 1ELWA 2VGXB 4BETA 1FQVB 4N39A 1JWGA 3C6OA 4GZDA 4BKTB 3FUMA 3BIMA 5CBNA 2YQ8A 3B13A 5DIZA 3ULQA 2MHKA 4ANUA 2VSNA 1R2BA 4C48B 3X2QE 3L17A 1BI8B 3Q73A 2A5EA 3D9OA 4U77A 4J8FA 1UN8A 5BNWA 4WUYA 3L54A 2QYUA 2IQCA 4GYOA 5AQAA 3JUEA 2H6HA 5EILA 3JXJA 3CHSA 2ZU6B 2AXVA 4GTPA 4I9EA 5EIBE 3ZUNB 1SW6A 2P1PA 1N4QA 4HS2A 5ENPD 2ZXWE 5FZQA 2Y3AA 2WQ6A 2ETCA 4JTAB 3PRZA 3WG7E 5BO4C 2KM4A 5C1DA 2QC9A 4EQFA 3GZ1A 5JMND 1ELKA 1TN8A 1YCSB 2R9RB 2HM8A 3LDZA 5JA4D 2LSUA 2C0MA 5DADA 3OHVA 1N4SA 4QFVA 2EIME 2AJAA 1OUVA 1NEXA 4L9PA 2WXMA 3ZUVB 3FH5A 4LERA 3T8MA 1IKND 2ASSA 4DPRA 3PZ3A 2IHCA 5FIOA 5HZGC 2VSXE 1FT2A 1N52A 2ZISA 2JABA 2KCLA 2PM7A 2YY9A 2GRPB 1CS3A 5HYWB 4MS6A 3WSOB 1KZOA 2IF4A 4HI8A 3C3OA 3V79K 2OV8A 1S0PA 3T5XA 4UIJA 4KXKB 2L6JA 3ZHEA 1IHBA 3L16A 2KZTA 2V4HC 3M5BA 3DRXA 3UI2A 2LAHA 5LX8A 5KNGA 5LOZA 1OWMA 3G2VA 3FU0A 2ILRA 2P1NA 4FLHA 3I5PA 1DC2A 3DSVA 2MRIA 4C0MA 4CT4A 1E8WA 2I1JA 3CVQA 3FDHA 3JYSA 4CDRA 2J4BA 3NB2A 3G2UA 3DRAA 5HRYA 4AP2A 4N2QA 4CRHA 2MA9C 5BXOA 1XGWA 3BEEA 4L23A 1TYQG 3ABKE 4BTBA 2IO2C 4J8EA 5BW8C 5D66A 1ZBPA 3TG5A 4ANVA 4CYMD 3S7DA 5B1BE 3ABLE 4HRNA 4FU3A 3DPDA 4BSZB 4O1OA 4YVOA 2LXLA 4WNGA 3FEXA 1HZ4A 4HVBA 5A6CA 3ZYLA 2KZTB 4IRUA 4ANXA 3FTSA 3CKBA 1NA3A 4HRLA 2P9KG 3KSQA 2HO1A 4HLEA 4CCAA 1Z3XA 3CIAA 1HF8A 1OCZE 2GRQB 2I2OA 5FZRA 4EPZA 2IONA 1LQBB 1HH8A 4AXHA 3CVWA 2WXKA 3OHUA 3HXEA 3LCAA 4JD2G 1H2UA 5EN5D 5KCMA 3CLJA 4AIFA 1EOFA 4XIFA 2H6GA 1U3DA 4PUCA 4IYPA 4UWFA 3SNXA 4UUCA 3IEGA 4FULA 1HU3A 4ME2A 1N4RA 3BG0B 3BG1B 3I4GA 2V5FA 2NZ0B 3Q5MA 1NP7A 5AARA 4NIKA 3FUNA 4UYIA 4JA7A 5BV0A 4HOTA 1N54A 3DRYA 4E6HA 3LBZA 1JUQA 3C3QA 4U2MA 2VPKA 1Y8MA 1MHQA 2OVFA 3KAEA 3FKCA 3GA1A 3Q75A 5AYWD 1K3ZD 3UM1A 4CXTA 4JHRA 4UI9C 4G8KA 1SA5A 3SFYA 3RK6A 3DSUA 3ESKA 4GCNA 4TUUA 2WPVA 4AJWA 3IXEA 5A23A 2H6IA 5AJLA 4I6JA 4U0SA 1S64A 1ELRA 2NSZA 1NA0A 3LKUA 1OWOA 4Q69A 3HQIA 2NXPA 4U0UA 5AJDA 3ZU7B 4WWPA 3EJNA 4ZGCA 3FTZA 3IHVA 3TWRA 3OTNA 3MA5A 4IULA 1D9SA 3RAUA 5AAOA 3CSFA 4C0EA 3E34A 1UG3A 3JCKC 2R05A 3QOUA 3CVUA 1NZNA 3JUIA 1U3CA 3V31A 1YA0A 4E85A 1NN7A 4UQYA 3C5RA 3CKCA 1X5BA 2XRZA 1H6PA 2L0IA 1MX4A 4AOFA 4GTSA 5CMYA 5M72A 5FINA 2FF4A 4EZKA 4U96D 4CEMA 3G2WA 1D8DA 4FHKA 4GPKA 4M7CA 3ONKA 3ML9A 3MJWA 4DI4A 3EIQC 3S2AA 1NL4A 2DYRE 4N5CA 3LVRE 4TRQA 1P22B 4I2ZA 4BSXA 3DCGB 4I6GA 1H0AA 2CG2A 2CHWA 4B9KB 2J9QA 2XRYA 1E8XA 3GYZA 2GRMA 2LSVA 3ASFA 2WXNA 1INZA 1UJKA 5CEDB 4GYWA 2X38A 3T8KA 4JEUA 2IEJA 1B89A 2Y4TA 4KVOA 2F0YA 4K0RA 1S1GA 4FHJA 4B8CB 4JW1A 1SZAA 5EYPF 2WXQA 4RG6A 4U7EB 2JLBA 4LCTA 2DYSE 2BUGA 4BGCA 5ENNA 2LNIA 5LCWJ 3ZW3A 2WB2A 3GW4A 4BESA 2X6HA 3PS6A 4HOUA 3PH0C 3ZPJA 3QARA 2DVWA 5FZSA 1TN7A 2J49A 3TWWA 3MX3A 3V30A 3Q7AA 2GRRB 3LNMB 5BXDA 1TN6A 5FT9A 1N0QA 5AQ9A 2RFMA 3KEAA 3ZYMA 4DI3A 5KJMA 2IU1A 3QB2A 4LNUD 4I6EA 4O1PA 4O6FA 2I2RA 4G2VA 3CK7A 3PZ1A 4R7LA 3AG1E 2BEDA 1X81A 2XPYA 2V4LA 4UWKA 3UT8A 2AW6A 2JZ3C 1S63A 2XCBA 2DWZA 2V5QC 1SQMA 3BQOA 4EZLA 2VYIA 3QAQA 2IZVC 2BF0X 4W9RA 2NYJA 3CEQA 4OYSA 4ILIA 3TAXA 3OGLA 1NFIE 3PE3A 4GMJA 2XEVA 4MLPA 3QC1A 1FS1B 3RO3A 3MGBA 3ZRHA 5CERB 1QNFA 3LJ3A 5AQ7A 2EILE 4NRHB 3APCA 3RJVA 3Q9UC 2X6KA 4YDYA 2R2LA 1LDKD 3LY9A 3QDNA 1JWFA 3MKSA 4I17A 5E75A 2PNNA 3Q9NC 3LS8A 4QQIA 4ZFHA 3ZRFB 4HXIA 3T9KA 1QDVA 5FTPA 3HIZA 3IHYA 5B3SE 3C6NA 3D9LA 3C3RA 3ZFWA 4L2YA 2KATA 3RSEG 4F3VA 2NC9A 2X6JA 2DIWA 3P2BA 3CVPA 4B95B 3M8VA 4NACA 1IXVA 2RFAA 3CHQA 2C9WC 2A4ZA 5BPPA 3PUJA 4A3VA 3WXXA 3OAWA 4WNEA 3S7BA 4I1MA 2JEKA 5ENSD 4GMRA 2XPZA 2VSYA 3D9MA 3U4TA 4DX5D 3SI5A 5FWQA 4ZHBA 2IOLA 3TWXA 3ZXPA 4I1AA 1V55E 3ZKJB 1HFAA 2I9CA 1QBQA 2LO6A 3L13A 3UX4A 3ABME 1G3NB 4ZOUA 3O48A 3DSXA 3L6AA 5EUPA 3M52A 3KVTA 1UW4B 1SVXA 2E31B 5HQ8A 1TNZA 3SF4A 4U8HA 2L6BA 4AV7A 4WNDA 1TNYA 4G1TA 2KCKA 3PZDA 1LF8A 2BTDA 5BV1A 3DEOA 2X6FA 2P9PG 3FTXA 4APFA 3TWUA 4LSZE 4LNBA 2NN2A 3L2OA 3UT4A 2H6FA 4BTAA 3BUAA 1KZPA 1QYMA 3DWLG 3UTMA 3U66A 4GAAA 3HTMA 1MYOA 2X3MA 4YDOA 1FVHA 4I6JC 2IY0C 3DSTA 5G04J 4AM9A 5CRUA 2F8YA 1DVPA 4A55A 5JHAA 3ISMC 4W9FB 2QFCA 3PZ2A 2IOSA 1S70B 3C72A 1Z3YA 3SZ7A 4GA0A 4GU5A 3UMVA 2VJ8A 3LJNA 4M3OA 2FULA 1LTXA 4YY8A 1DCEA 2UWJG 2VQ2A 3Q49B 4WWNA 3PEUB 3B7UX 4GMLA 2OVQA 2P58C 4U0ZA 1Z5SC 5ARFA 4APOA 3EU5A 5LFAA 3TL5A 3ULEG 3KD7A 2UY1A 4XKCA 3URZA 3P1UA 4JTDB 5BT1A 3UUXA 2XGSA 5KJLA 4RVBA 4GZ3A 2Y69E 1BU9A 4TV3A 3LYAA 4YDWA 5HI7A 3HXCA 1LM8C 4I43A 3JQ0A 2WVIA 3FUHA 5BXBA 2J4DA 2YNQA 5EIDA 3PREA 4H7XA 1HX8A 2FO7A 2OVRA 1FCHA 1HXIA 5CBOA 3E33A 5G2NA 4JGHC 2GRNB 4ABNA 5ENRD 4GB9A 4J8SA 4FLBA 4UI9K 5FQ4A 1LD7A 4GTVA 3VTXA 1HE8A 3AU5A 4KT6B 4K03A 4A1GA 3QWVA 1QDWA 5D0OD 4F6RD 3EUVA 2DZNA 2XGOA 3FP3A 3CVVA 3SGHA 3LPZA 1EODA 2R5SA 2UY1B 2YINA 2P9IG 2WMNA 3AAAC 4Y6WA 1TNBA 4B89A 3UKUG 5BXUA 2OVBA 3MKRA 3FUIA 2Z8HA 3LVQE 1N95A 3KS2A 3K9IA 2EQXA 4DLQA 1Q2ZA 4GZ6A 3ML8A 3ZN3A 3CK9A 2KCVA 2HE0A 5CMWA 3UPVA 1VCBB 5DAFA 3UKRG 3UM3A 1D8EA 4WQOC 3PDNA 3D9HA 1KPSB 2I6HA 3CHMA 2WXIA 4EBAG 3PVLA 3UQ3A 2RD0A 1N94A 1A17A 3FUJA 3NF1A 1EOEA 3VTYA 3CV0A 5FTAA 1OCCE 1QZ2A 3ZNGA 5D2MC 5J08A 2P1MA 1O1SA 4BKSB 4AY5A 2CHZA 5CRVA 1TNOA 3W9GA 2A5UA 1OWLA 3DBSA 3V2XA 2Q81A 2MOWA 1E8ZA 3B95A 3KEZA 3EHRA 3J5QB 1H2VC 5LLIB 5G05J 3FTVA 2BKKB 1N0RA 4CP3A 2V8SE 1JCRA 1EDUA 4HBDA 3MZLB 3QNKA 3HXBA 2XPIA 4GTMA 3MKQA 4OVUA 2QYJA 2WXHA 3FUFA 3HG0D 3L08A 1AWCB 4H7YA 3M4TA 4JXTA 4JA9A 4PDXA 4DX6D 5ANRA 3EHQA 3IV0A 5ENQD 3ZNGB 3EIJA 3E37A 4A3TA 2IF5A 1BLXB 4UWHA 3UT7A 3NQPA 4U2NA 4K5AB 3DXKG 3FU6A 4D10C 4ILHB 5EKQD 2ONDA 4GYYA 5AQBA 4B94A 3UIOC 4P29A 3ASGA 4LEUA 5CCMA 1OT8A 4F1SA 2L0TB 3L82A 1WAO1 3MEKA 5CEAA 4RQIA 4J8YA 5KJNA 1JCQA 4GA2A 4HFGA 3Q4AB 2CFZA 4OVVA 3CHRA 1OXJA 3UXGA 5LCWC 3MKQB 3RO2A 4BX8A 3DXMG 5H7HA 4N3BA 2VGYA 3U3WA 3TWSA 4J6IA 4Q96A 4HI9A 5A6RA 4EOZA 4L7TA 5CCLA 3HU6A 3NZSA 2IFUA 5CHEE 4G23A 4TXRA 2PZIA 4ACKA 1H2TC 3RRUA 2WQ7A 3PUKA 4CDMA 4G11A 3S7FA 3TXMA 2EIJE 4HRMB 1KT0A 3ZTCB 3LY8A 3LUTB 2WXGA 1TJFA 5KBAA 2AXZA 2FEZA 3ESLA 5IBKA 3NAWA 4OAUC 2PPIA 2KC7A 4LRZA 3TJPA 3NOGD 3FUKA 1HO8A 4EHMA 4OAVB 4CRWA 2RKKA 1OWNA 5AIJA 1FT1A 1GW6A 3RKVA 5A7DB 3ASNE 1H6KA 1O5MA 2KXPC 1H6OA 3EDTB 2KBXA 2MYOA 2OCCE 4W9GB 3J5PA 1MX6A 1WG0A 4NQ0A 1FS2B 1R28A 3Q78A 2IJGX 3AS4A 4DUIA 3VLEA 4B8AA 4DRXE 1RW2A 4B0ZA 5ENOD 4HOSA 1UJJA 3RU0A 1AP7A 3HXDA 5LP0A 4WNFA 3FUDA 3SQVA 2P2CP 2GRLA 2XENA 5B1AE 4URKA 3HYMB 3U64A 4Z68A 1E8YA 2OOEA 4HNAD 5JH5B 2P9UG 3MYVA 3OXLA 4DK5A 3CQCB 1N11A 3HDXA 4XE0A 3FH8A 3DRZA 1HS6A 4N3AA 3SFXA 4FP7A 3SD5A 2VGEA 4DLOA 4GZ5A 3ZKJA 2YHCA 2ETBA 1VDYA 3GZSA 1UOHA 2AXUA 3SBSA 2B6CA 5ANLA 4GZCA 5T4YA 3B84A 4GA1A 3ZGQA 1PC2A 3CVLA 3ZYQA 2J08A 1K1BA 1IYGA 3QWPA 4I2WA 3ZXSA 2QZAA 4WAFA 2R59A 1WM5A 4X8QA 1P5QA 2J8SD 3JXIA 2FNJC 3AJIA 1MQSA 2P1QA 2R03A 2GROB 1FVFA 3D9PA 4RLYA 4CZ2D 3E32A 3TWTA 3CHOA 3D3MA 3HHMA 3PZ4A 3IKOB 5ITZF 2VTBB 2HR2A 4BX9A 4GPMA 4MKTA 4AJYC 1LD8A 4DX2A 4V3IA 2QY7A 1K8KG 4XI0A 3OGMA 4C9BB 1YYHA 1O1TA 4JHJA 3QWWA 2OEVA 1DNPA 1U2VG 4U8YD 1WY6A 3MV2B 1MX2A 5AN8A 4G25A 3C98A 3RRNB 4PH4B 1OWPA 3E4BA 2XGMA 3EHNA 1O1RA 3TGOA 4W9JB 4W9HB 3EU9A 2EIKE 2VSOE 5FQ8A 1IQRA 2PM6A 4DX7D 3Q47B 4RG9A 1HG2A 4U63A 3V7DA 2YHEA 1A5EA 4GTOA 5G04C 2WXRA 1DSXA 3AG3E 4PS3A 3W9FA 2P9SG 5KJKA 1BPOA 3UM2A 1MZCA 2FBNA 2CHXA 3FWVA 1MJ0A 4LG6A 2WQHA 2DZOA 2V0PA 1SA4A 4JHKA 3DSSA 2I1KA 4I9CA 4UQZA 2P9LG 3MCXA 4KBQA 5JHBA 3APFA 3PNTB 2LXMA 1W3BA 3ASHA 4F1PA 3D9KA 3RRMB 3QJZA 3SY2A 3E4UA 4G8LA 4HLLA 3SO8A 3E30A 3FHEA 5HKPA 3LXUX 4EECA 4KZCA 5HS0A 4UWLA 2R02A 3ZTDB 4FJYA 3UM0A 5J90A 1E7VA 5FQ6A 3CHPA 2IO3C 4TXQA 3I4RB 3L22A 4L1BA 3DPYA 4JEHA 1Y6IA 1OCOE 4O60A 4KMOA 2FO1E 2J09A 1BI7B 2AWIA 2ZIRA 4N5QA 3BU8A 5JJ7A 3FTWA 3FTYA 1V54E 3VLDA 5EYLA 2R17C 4CGWA 3PEVB 2WXPA 4HOQA 4J7WA 4FADA 4U95D 4BT9A 4AEZC 1TR4A 1PAQA 2CG3A 5JJ6A 2WXLA 4ACLA 1BD8A 4XKBA 2B0OE 3ZHEB 4ATZD 1XNFA 1OCRE 4J0UA 5D0QD 3UINC 4KVMA 3FU3A 3U9WA 3CVXA 1N9AA 4BERA 2GW1A 1H19A 4AWJB 3B7SA 3I3NA 4BT8A 3ZYKA 2XS1A 4CDNA
chains in the Genus database with same CATH topology
4JXTA 3MV3B 4GCOA 1SQMA 4JA9A 2IHCA 4PDXA 4A1SA 4EZLA 5ANRA 5HZGC 2VSXE 3B7TA 3IV0A 3ZNGB 1N52A 2VYIA 3EIJA 3FEYA 3QAQA 4A3TA 5C2YA 2IF5A 2IZVC 2BF0X 4W9RA 3CEQA 4UWHA 3UT7A 2KCLA 2PM7A 4CT0A 4OYSA 4ILIA 3TAXA 3FTUA 2YY9A 4F7AA 3OGLA 2WXFA 3NQPA 1CS3A 3CK8A 3O4ZA 5HYWB 4MS6A 4U2NA 3WSOB 4PS7A 3PE3A 4GMJA 2XEVA 4MLPA 2IF4A 3QC1A 3SHFA 3APDA 3FU6A 4D10C 4ILHB 5EKQD 2ONDA 4Q94A 3R7RA 5BUZA 1FS1B 3HVEA 4GYYA 3RO3A 2OV8A 1S0PA 3MGBA 3T5XA 3ZRHA 4UIJA 2WXOA 1QNFA 3LJ3A 4KXKB 4B94A 2HYZA 4NRHB 2L6JA 3ZHEA 3APCA 4P29A 3ASGA 4LEUA 3RJVA 5CCMA 3L16A 2KZTA 4F1SA 2X6KA 2L0TB 3SFZA 3M5BA 3DRXA 1WAO1 4F53A 2LAHA 3MEKA 5LX8A 1LDKD 2E0IA 5KJNA 4CDNA 2CFUA 2WM9A 5LOZA 4GA2A 1OWMA 3LY9A 3QDNA 1JWFA 2AVPA 3G2VA 4HFGA 3MKSA 3Q4AB 4I17A 4CXIA 2CFZA 5E75A 4OVVA 2WMOA 2ILRA 3FU0A 5H7GA 2P1NA 1EXBE 3LS8A 3CHRA 3ZIMA 4FLHA 3ZRFB 4HXIA 3I5PA 3LY7A 4J8DA 5LCWC 1QDVA 3MKQB 4N2SA 5FTPA 2MRIA 4C0MA 3RO2A 4ANWA 4BX8A 4CT4A 1E8WA 2I1JA 4FJZA 5H7HA 3CVQA 2PQRA 3HIZA 3IHYA 3C6NA 3FDHA 3JYSA 4N3BA 4CDRA 2J4BA 2VGYA 3U3WA 3D9LA 3G2UA 4J6IA 4Q96A 4L2YA 3ZFWA 2KATA 4F3VA 4FA6A 1BUOA 2NC9A 2X6JA 5A6RA 4AP2A 4L7TA 5CCLA 4N2QA 4EOZA 4KYOB 3HU6A 3NZSA 2IFUA 5CHEE 4G23A 2DIWA 4CRHA 2J07A 2MA9C 3P2BA 3CVPA 1T1DA 1XGWA 3BEEA 4B95B 3M8VA 4NACA 5EDSA 3GZ2A 4L23A 4UI9J 2PZIA 3ASDA 4J8EA 1H2TC 5BW8C 5G05C 3RRUA 4ACKA 4BTBA 2WQ7A 4AY6A 3PUKA 3CHQA 4JTCB 2C9WC 2A4ZA 4CDMA 1ZBPA 5T8IA 3TG5A 4G11A 5BPPA 3PUJA 4ANVA 3S7FA 3TXMA 2OVPA 2Q7FA 4A3VA 4J8ZA 1KT0A 1E7UA 1SZ9A 3ZTCB 3LY8A 3S7DA 3LUTB 2WXGA 1TJFA 3Q15A 2AXZA 4W9EB 4FU3A 3WXXA 3OAWA 3DPDA 2FEZA 3ESLA 3HVEB 3PNLB 5IBKA 2PPIA 1A68A 4WNEA 2KC7A 4LRZA 4YVOA 3TJPA 3S7BA 4I1MA 4WNGA 1Z6TA 3FEXA 2JEKA 1HZ4A 4HVBA 3D9IA 2XPZA 2VSYA 4JVSA 3FUKA 5A6CA 3D9MA 3U4TA 3ZYLA 1QQEA 4LUNU 1HO8A 2KZTB 4IRUA 4ANXA 2P1OA 4YVQC 1UN9A 3FTSA 5FWQA 3CKBA 2IOLA 3SI5A 4CRWA 2RG8A 1NA3A 5BXHA 1OWNA 5AIJA 5E76A 1GW6A 2HO1A 3RKVA 4HLEA 5A7DB 4W9CB 4CCAA 4N3CA 4I1AA 3ZKJB 1HFAA 1Z3XA 2I9CA 2XHEA 1H6KA 3CIAA 3RIBA 2LO6A 3L13A 1HF8A 3UX4A 3EDTB 2I2OA 4ZOUA 3O48A 3OGKA 3L6AA 3EHMA 5EUPA 5FZRA 3M52A 3KVTA 4EPZA 1UW4B 2E31B 2IONA 1LQBB 1HH8A 2C0LA 4AXHA 5HQ8A 5FJYA 4W9GB 3SF4A 4U8HA 3CVWA 4NQ0A 4ATGA 2WXKA 4AV7A 1FS2B 1R28A 3JQ1A 3ONLA 4WNDA 3OHUA 4G1TA 2IJGX 2KCKA 3PZDA 2Y4UA 4BWRA 3AS4A 1LF8A 4B9KE 3LCAA 3VLEA 3IBEA 3M4TA 4G26A 4B8AA 2BTDA 1H2UA 5KCMA 3LEWA 5BV1A 2E32B 2X6FA 3CLJA 4AIFA 1EOFA 1ZU2A 4XIFA 4B0ZA 4HOSA 2XQ0A 1U3DA 1UJJA 3FTXA 3RU0A 4APFA 4PUCA 3FFLA 4IYPA 4JC8A 4UWFA 3SNXA 5LP0A 4WNFA 3FUDA 3IEGA 4FULA 3ZVVA 3S7JA 2GRLA 1HU3A 4HORA 4ME2A 4URKA 3QKYA 2NN2A 1KT1A 3BG0B 3BG1B 3L2OA 3HYMB 4IN3B 3UT4A 3ZRCB 3I4GA 2V5FA 1E8YA 3U64A 4BTAA 5FQ7A 2OOEA 4PS8A 5JH5B 3MYVA 3OXLA 4DK5A 2NZ0B 2GGFA 5JJTA 3U66A 4GAAA 3HTMA 2X3MA 5AENA 3OXGA 3CQCB 3Q5MA 1FVHA 3HDXA 4FC8A 4XE0A 3FUEA 4YNDA 4I6JC 1IHGA 1NP7A 3FH8A 5G04J 3DRZA 1HS6A 4N3AA 4FP7A 4NURA 3R7QA 3SD5A 1JPLA 4AM9A 3FUNA 4DLOA 4GZ5A 4UYIA 4MRUA 4JA7A 2YHCA 1DVPA 4A55A 5JHAA 4W9FB 4XZ4A 1VDYA 3GZSA 5BV0A 2QFCA 4HOTA 2IOSA 2AXUA 3SBSA 1N54A 1R29A 4E6HA 3DRYA 5ANLA 1JUQA 3ENEA 1IQUA 1Z3YA 3LBZA 5EX0A 4U2MA 4GZCA 1Y8MA 5T4YA 3SZ7A 2VPKA 4GA0A 4GA1A 1MHQA 2OVFA 4GU5A 3UMVA 3ZGQA 2VJ8A 1PC2A 3CVLA 4CGVA 3KAEA 3FKCA 3GA1A 4M3OA 2FULA 5AYWD 4YY8A 2LAIA 3ZYQA 4CXTA 2UWJG 2VQ2A 2J08A 4JHRA 4UI9C 1IYGA 1HV2A 3QWPA 3Q49B 4I1OB 4ILGA 4I2WA 1EF1C 4CXJA 3ZXSA 4WWNA 3PEUB 4EBAA 3RK6A 4U07A 3ESKA 3CR3A 4WAFA 4GCNA 2R59A 3B7UX 2WPVA 1WM5A 4TUUA 4AJWA 2VKPA 4GMLA 2L9BA 5A23A 2OVQA 3CGHA 2P58C 4W9HH 1EYHA 4U0ZA 1P5QA 4L2LA 5AJLA 2FNJC 3AS5A 5ARFA 2P1QA 1MQSA 2DBAA 4I6JA 4U0SA 4APOA 5LFAA 1TEZA 5G55A 1FVFA 1ELRA 3TL5A 1E90A 2NSZA 3AU4A 3D9PA 4G24A 3KD7A 1EPUA 5ARGA 4EZJA 2UY1A 1NA0A 3LKUA 4XKCA 3URZA 4DJAA 1OWOA 5DBKA 4Q69A 3P1UA 3HQIA 2NXPA 4U0UA 3CHOA 3D3MA 3HHMA 5AJDA 5BT1A 4JTDB 3UUXA 2XGSA 5KJLA 4RVBA 3IKOB 4GZ3A 3CQGB 4WWPA 4TV3A 2PL2A 2VTBB 2HR2A 3EJNA 3LYAA 4BY6A 3FTZA 4BX9A 4ZGCA 1E96B 3IHVA 4MKTA 5HI7A 4AJYC 4V3IA 2QY7A 3D9NA 4WWOA 3OTNA 3MA5A 5T3RA 1KLXA 4IULA 4XI0A 1LM8C 3FH7A 3OGMA 4C9BB 3T5VA 4I43A 3NZUA 3CSFA 2XCCA 4C0EA 3JQ0A 4JHJA 1L5JA 2VGXA 1UG3A 3JCKC 3QWWA 1DNPA 3QOUA 3SBTB 3CVUA 2C2LA 1NZNA 1WY6A 2WVIA 3FUHA 3JUIA 3MV2B 5BXBA 1U3CA 2J4DA 4W9KB 1YA0A 2YNQA 4UQXA 3PREA 4E85A 1NN7A 2PQNA 2X6IA 4G25A 4H7XA 3C98A 4UQYA 3C6PA 1HX8A 2FO7A 3CKCA 3RRNB 2OVRA 3B7RL 3D9JA 1FCHA 1X5BA 2DCPA 1HXIA 4PH4B 3G2SA 1OWPA 5G2NA 2WXJA 2XGMA 3E4BA 4UWGA 3EHNA 3FU5A 1TJCA 2FI7A 4KZ0A 4BFRA 2L0IA 3TGOA 3VLFA 4JGHC 4W9JB 4ABNA 3CSTA 4W9HB 4GB9A 4J8SA 4FLBA 3PE4A 4UI9K 4AOFA 2VSOE 5FQ8A 5CMYA 5FQ4A 3G2TA 3VTXA 1IQRA 1HE8A 1HG5A 5M72A 3TXNA 3AU5A 2PM6A 3Q47B 4KT6B 4K03A 4A1GA 4RG9A 4W9LB 1HG2A 3QWVA 4U63A 1QDWA 2FF4A 2YHEA 3V7DA 4EZKA 4CEMA 4RSYA 3G2WA 4N9F5 4AVXA 4W9DB 5G04C 5D0OD 4FHKA 2WXRA 4GPKA 1DSXA 3ONKA 3OXFA 4PS3A 2XGOA 3FP3A 3ML9A 3CVVA 3SGHA 3LPZA 3MJWA 2R5SA 4DI4A 1EODA 3EIQC 2UY1B 1PY1A 3S2AA 2VTBA 5KJKA 2YINA 1BPOA 3ZEFA 3TG4A 2WMNA 4N5CA 2FBNA 4U04A 2ASTA 2CHXA 3FWVA 2E2EA 2M63A 3FULA 3LVRE 2WQHA 3CVNA 3N71A 4TRQA 2V0PA 4Y6WA 3CVYA 4B89A 4JHKA 1P22B 4I2ZA 2OVBA 4XI9A 3MKRA 4BSXA 2I1KA 3FUIA 3DCGB 4I9CA 3QK0A 2Z8HA 4JPSA 4XX5A 4UQZA 3AS8A 4JZYA 4I6GA 3LVQE 2A79B 1H0AA 3MCXA 3KS2A 4KBQA 5JHBA 3APFA 3PNTB 5EX3A 3B84A 2CG2A 1W3BA 2CHWA 3ASHA 3FY4A 3K9IA 3R9AB 4B9KB 2EQXA 2J9QA 4Y6CA 2XRYA 1E8XA 3D9KA 4DLQA 4W9IB 3RRMB 3GYZA 4GZ6A 2GRMA 3ML8A 4JL0A 3ZN3A 2LSVA 3CK9A 1ELWA 3QJZA 2VGXB 3ASFA 1FQVB 2WXNA 1INZA 2KCVA 3E4UA 5CMWA 4N39A 1JWGA 3UPVA 3C6OA 1UJKA 4GZDA 1VCBB 4GYWA 5DAFA 2X38A 4WQOC 4BKTB 3FHEA 3FUMA 3LXUX 4EECA 3BIMA 3PDNA 4JEUA 4KZCA 4UWLA 2YQ8A 3B13A 1B89A 2Y4TA 4KVOA 5DIZA 2I6HA 3CHMA 2MHKA 3ULQA 2WXIA 3ZTDB 4FJYA 4EBAG 4ANUA 4K0RA 5J90A 2VSNA 1S1GA 1R2BA 1E7VA 3PVLA 4FHJA 5FQ6A 4B8CB 3CHPA 3UQ3A 4JW1A 1SZAA 2RD0A 3I4RB 3L22A 3L17A 1A17A 2WXQA 3FUJA 4L1BA 4RG6A 3NF1A 1Y6IA 4JEHA 3VTYA 1EOEA 4KMOA 3D9OA 2JLBA 3CV0A 2J09A 4LCTA 4J8FA 4U77A 2AWIA 5FTAA 2BUGA 1UN8A 1QZ2A 4BGCA 5ENNA 5J08A 3FTWA 5JJ7A 2P1MA 5BNWA 2LNIA 5LCWJ 4WUYA 3L54A 4BKSB 3FTYA 4AY5A 3ZW3A 2WB2A 2CHZA 3GW4A 2IQCA 2X6HA 4GYOA 3PS6A 4HOUA 3VLDA 2R17C 4CGWA 3PH0C 2A5UA 3PEVB 3CHSA 1OWLA 2ZU6B 2AXVA 4I9EA 3DBSA 3QARA 2WXPA 3ZPJA 2Q81A 2P1PA 3ZUNB 2MOWA 4HOQA 1E8ZA 5FZSA 4HS2A 2XRZA 4FADA 3KEZA 5FZQA 4BT9A 5A15A 2J49A 4AEZC 2Y3AA 2WQ6A 3MX3A 1H2VC 1PAQA 2CG3A 5JJ6A 2WXLA 5LLIB 4ACLA 5G05J 4JTAB 3FTVA 3PRZA 5BO4C 4XKBA 2KM4A 3ZHEB 5C1DA 3LNMB 4CP3A 5BXDA 4EQFA 5FT9A 1XNFA 2V8SE 3GZ1A 4J0UA 3ZYMA 1EDUA 5D0QD 4DI3A 5KJMA 4KVMA 1ELKA 2IU1A 3FU3A 3QB2A 3U9WA 2R9RB 2HM8A 3MZLB 3QNKA 3CVXA 3LDZA 4I6EA 4O6FA 2LSUA 2XPIA 2I2RA 2C0MA 5DADA 4G2VA 3OHVA 3MKQA 4OVUA 2GW1A 3CK7A 4R7LA 1H19A 4AWJB 3B7SA 4QFVA 2XPYA 1OUVA 3I3NA 2V4LA 1NEXA 2WXHA 2WXMA 4UWKA 4BT8A 3FH5A 3FUFA 3L08A 4LERA 3T8MA 3UT8A 3ZYKA 2AW6A 4H7YA 2JZ3C 2ASSA 2XCBA 4DPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9K B;  2VKP A;  2EQX A;  2IHC A;  2OVQ A;  4W9H H;  2P1O A;  4W9I B;  5HZG C;  5BXH A;  2FNJ C;  1FQV B;  3ZNG B;  2P1Q A;  3E4U A;  3C6O A;  4W9C B;  2IF5 A;  2IZV C;  1VCB B;  3ZKJ B;  5DAF A;  4WQO C;  4BKT B;  2YY9 A;  3HQI A;  3OGL A;  3BIM A;  4ZOU A;  1CS3 A;  5HYW B;  4JTD B;  4U2N A;  3OGK A;  3WSO B;  5EUP A;  3M52 A;  3KVT A;  1FS1 B;  3ZTD B;  2E31 B;  3HVE A;  4W9G B;  1LQB B;  4UIJ A;  1S1G A;  1R2B A;  4AJY C;  1FS2 B;  1R28 A;  3OHU A;  1LM8 C;  1EOE A;  3OGM A;  4B9K E;  3M5B A;  5FTA A;  4U77 A;  2E32 B;  4BGC A;  1EOF A;  2P1M A;  1LDK D;  4APF A;  4BKS B;  5BXB A;  4W9K B;  4CXI A;  3MKS A;  1NN7 A;  5H7G A;  2P1N A;  1EXB E;  3C6P A;  2NN2 A;  3ZRC B;  3L2O A;  2OVR A;  4HXI A;  3ZRF B;  1QDV A;  3ZUN B;  5JH5 B;  2Q81 A;  2P1P A;  2NZ0 B;  4JGH C;  3HTM A;  4W9J B;  4HS2 A;  5H7H A;  4W9H B;  4I6J C;  3C6N A;  3DRZ A;  1BUO A;  5LLI B;  5A6R A;  4JTA B;  4AP2 A;  4W9L B;  4EOZ A;  4UYI A;  5BO4 C;  1QDW A;  3HU6 A;  3V7D A;  3LNM B;  4CP3 A;  5BXD A;  4N9F 5;  4W9D B;  4CRH A;  4W9F B;  2MA9 C;  1T1D A;  4B95 B;  1DSX A;  3M8V A;  1R29 A;  3LBZ A;  2R9R B;  4U2M A;  2VPK A;  1EOD A;  3B84 A;  5A15 A;  4JTC B;  2C9W C;  2I2R A;  3FKC A;  3GA1 A;  5DAD A;  2OVP A;  4J8Z A;  3OHV A;  3ZTC B;  2AST A;  4CXT A;  3LUT B;  4AWJ B;  1HV2 A;  4W9E B;  1P22 B;  3HVE B;  5IBK A;  2PPI A;  1A68 A;  4CXJ A;  3I3N A;  3DCG B;  2Z8H A;  1NEX A;  2A79 B;  2JZ3 C;  2ASS A;  3M4T A; 
#chains in the Genus database with same CATH topology
 2Y0B G;  5CEC B;  3MV3 B;  4GCO A;  1YMP A;  4A1S A;  2OEW A;  3B7T A;  3FEY A;  3KSL A;  5C2Y A;  4CT0 A;  2F8X K;  3FTU A;  4F7A A;  2ZGG A;  2WXF A;  3CK8 A;  3O4Z A;  4PS7 A;  3SHF A;  3APD A;  5BUZ A;  4Q94 A;  3R7R A;  4BEP A;  3HVE A;  3Q79 A;  2WXO A;  2HYZ A;  3SFZ A;  4F53 A;  3Q7F A;  5ENT D;  3TWV A;  2E0I A;  2CFU A;  2WM9 A;  2XEE A;  2AVP A;  4CXI A;  4K5B A;  2WMO A;  5H7G A;  1EXB E;  3ZIM A;  3LY7 A;  4J8D A;  4YDE A;  4N2S A;  4ANW A;  4FJZ A;  2PQR A;  1FPP A;  3NBN B;  4FA6 A;  1BUO A;  1OY3 D;  1WDY A;  2EIN E;  4KYO B;  5KWD A;  2J07 A;  1T1D A;  4A63 B;  5EDS A;  3GZ2 A;  4UI9 J;  3R9M A;  3ASD A;  5G05 C;  4AY6 A;  4JTC B;  5T8I A;  2OVP A;  4J8Z A;  2Q7F A;  1SZ9 A;  1E7U A;  4XEI G;  3Q15 A;  4W9E B;  3PNL B;  3HVE B;  1A68 A;  4MBG A;  3HXF A;  1Z6T A;  3D9I A;  4JVS A;  1QQE A;  4JB8 P;  4LUN U;  2P1O A;  4YVQ C;  4U8V D;  1UN9 A;  3NOC D;  2RG8 A;  5KNH D;  5BXH A;  4GTT A;  5E76 A;  2XS8 A;  4W9C B;  4N3C A;  2XHE A;  1NI1 A;  3RIB A;  3OGK A;  3EHM A;  4HQD A;  3V2O A;  3HRA A;  1RZ4 A;  2C0L A;  5FJY A;  4TUM A;  2XZD G;  4ATG A;  2P9N G;  3ULY A;  3JQ1 A;  3ONL A;  4BWR A;  2Y4U A;  4B9K E;  3IBE A;  1DCQ A;  4G26 A;  3LEW A;  2E32 B;  1ZU2 A;  2XQ0 A;  3F6Q A;  3FFL A;  4JC8 A;  3ZVV A;  3S7J A;  4HOR A;  3QKY A;  1KT1 A;  3ZRC B;  4IN3 B;  5FQ7 A;  4PS8 A;  2GGF A;  5JJT A;  4LNG A;  5AEN A;  1JCS A;  3OXG A;  4FC8 A;  4YND A;  3FUE A;  1IHG A;  4DX1 A;  4HB5 A;  4NUR A;  3R7Q A;  1JPL A;  4MRU A;  4XZ4 A;  2ETA A;  2XEH A;  1R29 A;  3DEP A;  3ENE A;  1IQU A;  5EX0 A;  5A15 A;  4CGV A;  2LAI A;  1HV2 A;  2F37 A;  4I1O B;  2XZT G;  1TNU A;  4ILG A;  4CXJ A;  1EF1 C;  4EBA A;  3TWQ A;  4U07 A;  3CR3 A;  2VKP A;  2L9B A;  3CGH A;  4W9H H;  1EYH A;  4L2L A;  5H7P A;  3AS5 A;  2DBA A;  1TEZ A;  5G55 A;  1E90 A;  3AU4 A;  4G24 A;  1EPU A;  5ARG A;  4EZJ A;  4DJA A;  5DBK A;  2BKG A;  3B7B A;  4GTQ A;  3CQG B;  2PL2 A;  4BY6 A;  1E96 B;  3D9N A;  4WWO A;  5T3R A;  1KLX A;  5IY5 E;  3FH7 A;  3T5V A;  3NZU A;  2XCC A;  1L5J A;  1N4P A;  2VGX A;  1ZB1 A;  3SBT B;  2C2L A;  4W9K B;  4UQX A;  4GTR A;  2PQN A;  2X6I A;  4K5C A;  3C6P A;  3B7R L;  3D9J A;  2DCP A;  3G2S A;  3ASO E;  2WXJ A;  4UWG A;  3FU5 A;  4KZ0 A;  1TJC A;  2FI7 A;  4BFR A;  3VLF A;  3DSW A;  3CST A;  3PE4 A;  3G2T A;  1HG5 A;  3TXN A;  4W9L B;  4RSY A;  4N9F 5;  4TXP A;  4AVX A;  4W9D B;  2LUH A;  3L9T A;  3AG2 E;  3OXF A;  3UIP C;  1PY1 A;  2VTB A;  3ZEF A;  3TG4 A;  4U04 A;  2AST A;  2E2E A;  2M63 A;  3FUL A;  3AG4 E;  3CVN A;  3N71 A;  1K1A A;  3CVY A;  4XI9 A;  3QK0 A;  4JPS A;  4XX5 A;  2A79 B;  3AS8 A;  4JZY A;  2Y1L E;  2ZGD A;  5EX3 A;  4B93 B;  3R9A B;  3FY4 A;  4Y6C A;  4W9I B;  4JL0 A;  1ELW A;  2VGX B;  4BET A;  1FQV B;  4N39 A;  1JWG A;  3C6O A;  4GZD A;  4BKT B;  3FUM A;  3BIM A;  5CBN A;  2YQ8 A;  3B13 A;  5DIZ A;  3ULQ A;  2MHK A;  4ANU A;  2VSN A;  1R2B A;  4C48 B;  3X2Q E;  3L17 A;  1BI8 B;  3Q73 A;  2A5E A;  3D9O A;  4U77 A;  4J8F A;  1UN8 A;  5BNW A;  4WUY A;  3L54 A;  2QYU A;  2IQC A;  4GYO A;  5AQA A;  3JUE A;  2H6H A;  5EIL A;  3JXJ A;  3CHS A;  2ZU6 B;  2AXV A;  4GTP A;  4I9E A;  5EIB E;  3ZUN B;  1SW6 A;  2P1P A;  1N4Q A;  4HS2 A;  5ENP D;  2ZXW E;  5FZQ A;  2Y3A A;  2WQ6 A;  2ETC A;  4JTA B;  3PRZ A;  3WG7 E;  5BO4 C;  2KM4 A;  5C1D A;  2QC9 A;  4EQF A;  3GZ1 A;  5JMN D;  1ELK A;  1TN8 A;  1YCS B;  2R9R B;  2HM8 A;  3LDZ A;  5JA4 D;  2LSU A;  2C0M A;  5DAD A;  3OHV A;  1N4S A;  4QFV A;  2EIM E;  2AJA A;  1OUV A;  1NEX A;  4L9P A;  2WXM A;  3ZUV B;  3FH5 A;  4LER A;  3T8M A;  1IKN D;  2ASS A;  4DPR A;  3PZ3 A;  2IHC A;  5FIO A;  5HZG C;  2VSX E;  1FT2 A;  1N52 A;  2ZIS A;  2JAB A;  2KCL A;  2PM7 A;  2YY9 A;  2GRP B;  1CS3 A;  5HYW B;  4MS6 A;  3WSO B;  1KZO A;  2IF4 A;  4HI8 A;  3C3O A;  3V79 K;  2OV8 A;  1S0P A;  3T5X A;  4UIJ A;  4KXK B;  2L6J A;  3ZHE A;  1IHB A;  3L16 A;  2KZT A;  2V4H C;  3M5B A;  3DRX A;  3UI2 A;  2LAH A;  5LX8 A;  5KNG A;  5LOZ A;  1OWM A;  3G2V A;  3FU0 A;  2ILR A;  2P1N A;  4FLH A;  3I5P A;  1DC2 A;  3DSV A;  2MRI A;  4C0M A;  4CT4 A;  1E8W A;  2I1J A;  3CVQ A;  3FDH A;  3JYS A;  4CDR A;  2J4B A;  3NB2 A;  3G2U A;  3DRA A;  5HRY A;  4AP2 A;  4N2Q A;  4CRH A;  2MA9 C;  5BXO A;  1XGW A;  3BEE A;  4L23 A;  1TYQ G;  3ABK E;  4BTB A;  2IO2 C;  4J8E A;  5BW8 C;  5D66 A;  1ZBP A;  3TG5 A;  4ANV A;  4CYM D;  3S7D A;  5B1B E;  3ABL E;  4HRN A;  4FU3 A;  3DPD A;  4BSZ B;  4O1O A;  4YVO A;  2LXL A;  4WNG A;  3FEX A;  1HZ4 A;  4HVB A;  5A6C A;  3ZYL A;  2KZT B;  4IRU A;  4ANX A;  3FTS A;  3CKB A;  1NA3 A;  4HRL A;  2P9K G;  3KSQ A;  2HO1 A;  4HLE A;  4CCA A;  1Z3X A;  3CIA A;  1HF8 A;  1OCZ E;  2GRQ B;  2I2O A;  5FZR A;  4EPZ A;  2ION A;  1LQB B;  1HH8 A;  4AXH A;  3CVW A;  2WXK A;  3OHU A;  3HXE A;  3LCA A;  4JD2 G;  1H2U A;  5EN5 D;  5KCM A;  3CLJ A;  4AIF A;  1EOF A;  4XIF A;  2H6G A;  1U3D A;  4PUC A;  4IYP A;  4UWF A;  3SNX A;  4UUC A;  3IEG A;  4FUL A;  1HU3 A;  4ME2 A;  1N4R A;  3BG0 B;  3BG1 B;  3I4G A;  2V5F A;  2NZ0 B;  3Q5M A;  1NP7 A;  5AAR A;  4NIK A;  3FUN A;  4UYI A;  4JA7 A;  5BV0 A;  4HOT A;  1N54 A;  3DRY A;  4E6H A;  3LBZ A;  1JUQ A;  3C3Q A;  4U2M A;  2VPK A;  1Y8M A;  1MHQ A;  2OVF A;  3KAE A;  3FKC A;  3GA1 A;  3Q75 A;  5AYW D;  1K3Z D;  3UM1 A;  4CXT A;  4JHR A;  4UI9 C;  4G8K A;  1SA5 A;  3SFY A;  3RK6 A;  3DSU A;  3ESK A;  4GCN A;  4TUU A;  2WPV A;  4AJW A;  3IXE A;  5A23 A;  2H6I A;  5AJL A;  4I6J A;  4U0S A;  1S64 A;  1ELR A;  2NSZ A;  1NA0 A;  3LKU A;  1OWO A;  4Q69 A;  3HQI A;  2NXP A;  4U0U A;  5AJD A;  3ZU7 B;  4WWP A;  3EJN A;  4ZGC A;  3FTZ A;  3IHV A;  3TWR A;  3OTN A;  3MA5 A;  4IUL A;  1D9S A;  3RAU A;  5AAO A;  3CSF A;  4C0E A;  3E34 A;  1UG3 A;  3JCK C;  2R05 A;  3QOU A;  3CVU A;  1NZN A;  3JUI A;  1U3C A;  3V31 A;  1YA0 A;  4E85 A;  1NN7 A;  4UQY A;  3C5R A;  3CKC A;  1X5B A;  2XRZ A;  1H6P A;  2L0I A;  1MX4 A;  4AOF A;  4GTS A;  5CMY A;  5M72 A;  5FIN A;  2FF4 A;  4EZK A;  4U96 D;  4CEM A;  3G2W A;  1D8D A;  4FHK A;  4GPK A;  4M7C A;  3ONK A;  3ML9 A;  3MJW A;  4DI4 A;  3EIQ C;  3S2A A;  1NL4 A;  2DYR E;  4N5C A;  3LVR E;  4TRQ A;  1P22 B;  4I2Z A;  4BSX A;  3DCG B;  4I6G A;  1H0A A;  2CG2 A;  2CHW A;  4B9K B;  2J9Q A;  2XRY A;  1E8X A;  3GYZ A;  2GRM A;  2LSV A;  3ASF A;  2WXN A;  1INZ A;  1UJK A;  5CED B;  4GYW A;  2X38 A;  3T8K A;  4JEU A;  2IEJ A;  1B89 A;  2Y4T A;  4KVO A;  2F0Y A;  4K0R A;  1S1G A;  4FHJ A;  4B8C B;  4JW1 A;  1SZA A;  5EYP F;  2WXQ A;  4RG6 A;  4U7E B;  2JLB A;  4LCT A;  2DYS E;  2BUG A;  4BGC A;  5ENN A;  2LNI A;  5LCW J;  3ZW3 A;  2WB2 A;  3GW4 A;  4BES A;  2X6H A;  3PS6 A;  4HOU A;  3PH0 C;  3ZPJ A;  3QAR A;  2DVW A;  5FZS A;  1TN7 A;  2J49 A;  3TWW A;  3MX3 A;  3V30 A;  3Q7A A;  2GRR B;  3LNM B;  5BXD A;  1TN6 A;  5FT9 A;  1N0Q A;  5AQ9 A;  2RFM A;  3KEA A;  3ZYM A;  4DI3 A;  5KJM A;  2IU1 A;  3QB2 A;  4LNU D;  4I6E A;  4O1P A;  4O6F A;  2I2R A;  4G2V A;  3CK7 A;  3PZ1 A;  4R7L A;  3AG1 E;  2BED A;  1X81 A;  2XPY A;  2V4L A;  4UWK A;  3UT8 A;  2AW6 A;  2JZ3 C;  1S63 A;  2XCB A;  2DWZ A;  2V5Q C;  1SQM A;  3BQO A;  4EZL A;  2VYI A;  3QAQ A;  2IZV C;  2BF0 X;  4W9R A;  2NYJ A;  3CEQ A;  4OYS A;  4ILI A;  3TAX A;  3OGL A;  1NFI E;  3PE3 A;  4GMJ A;  2XEV A;  4MLP A;  3QC1 A;  1FS1 B;  3RO3 A;  3MGB A;  3ZRH A;  5CER B;  1QNF A;  3LJ3 A;  5AQ7 A;  2EIL E;  4NRH B;  3APC A;  3RJV A;  3Q9U C;  2X6K A;  4YDY A;  2R2L A;  1LDK D;  3LY9 A;  3QDN A;  1JWF A;  3MKS A;  4I17 A;  5E75 A;  2PNN A;  3Q9N C;  3LS8 A;  4QQI A;  4ZFH A;  3ZRF B;  4HXI A;  3T9K A;  1QDV A;  5FTP A;  3HIZ A;  3IHY A;  5B3S E;  3C6N A;  3D9L A;  3C3R A;  3ZFW A;  4L2Y A;  2KAT A;  3RSE G;  4F3V A;  2NC9 A;  2X6J A;  2DIW A;  3P2B A;  3CVP A;  4B95 B;  3M8V A;  4NAC A;  1IXV A;  2RFA A;  3CHQ A;  2C9W C;  2A4Z A;  5BPP A;  3PUJ A;  4A3V A;  3WXX A;  3OAW A;  4WNE A;  3S7B A;  4I1M A;  2JEK A;  5ENS D;  4GMR A;  2XPZ A;  2VSY A;  3D9M A;  3U4T A;  4DX5 D;  3SI5 A;  5FWQ A;  4ZHB A;  2IOL A;  3TWX A;  3ZXP A;  4I1A A;  1V55 E;  3ZKJ B;  1HFA A;  2I9C A;  1QBQ A;  2LO6 A;  3L13 A;  3UX4 A;  3ABM E;  1G3N B;  4ZOU A;  3O48 A;  3DSX A;  3L6A A;  5EUP A;  3M52 A;  3KVT A;  1UW4 B;  1SVX A;  2E31 B;  5HQ8 A;  1TNZ A;  3SF4 A;  4U8H A;  2L6B A;  4AV7 A;  4WND A;  1TNY A;  4G1T A;  2KCK A;  3PZD A;  1LF8 A;  2BTD A;  5BV1 A;  3DEO A;  2X6F A;  2P9P G;  3FTX A;  4APF A;  3TWU A;  4LSZ E;  4LNB A;  2NN2 A;  3L2O A;  3UT4 A;  2H6F A;  4BTA A;  3BUA A;  1KZP A;  1QYM A;  3DWL G;  3UTM A;  3U66 A;  4GAA A;  3HTM A;  1MYO A;  2X3M A;  4YDO A;  1FVH A;  4I6J C;  2IY0 C;  3DST A;  5G04 J;  4AM9 A;  5CRU A;  2F8Y A;  1DVP A;  4A55 A;  5JHA A;  3ISM C;  4W9F B;  2QFC A;  3PZ2 A;  2IOS A;  1S70 B;  3C72 A;  1Z3Y A;  3SZ7 A;  4GA0 A;  4GU5 A;  3UMV A;  2VJ8 A;  3LJN A;  4M3O A;  2FUL A;  1LTX A;  4YY8 A;  1DCE A;  2UWJ G;  2VQ2 A;  3Q49 B;  4WWN A;  3PEU B;  3B7U X;  4GML A;  2OVQ A;  2P58 C;  4U0Z A;  1Z5S C;  5ARF A;  4APO A;  3EU5 A;  5LFA A;  3TL5 A;  3ULE G;  3KD7 A;  2UY1 A;  4XKC A;  3URZ A;  3P1U A;  4JTD B;  5BT1 A;  3UUX A;  2XGS A;  5KJL A;  4RVB A;  4GZ3 A;  2Y69 E;  1BU9 A;  4TV3 A;  3LYA A;  4YDW A;  5HI7 A;  3HXC A;  1LM8 C;  4I43 A;  3JQ0 A;  2WVI A;  3FUH A;  5BXB A;  2J4D A;  2YNQ A;  5EID A;  3PRE A;  4H7X A;  1HX8 A;  2FO7 A;  2OVR A;  1FCH A;  1HXI A;  5CBO A;  3E33 A;  5G2N A;  4JGH C;  2GRN B;  4ABN A;  5ENR D;  4GB9 A;  4J8S A;  4FLB A;  4UI9 K;  5FQ4 A;  1LD7 A;  4GTV A;  3VTX A;  1HE8 A;  3AU5 A;  4KT6 B;  4K03 A;  4A1G A;  3QWV A;  1QDW A;  5D0O D;  4F6R D;  3EUV A;  2DZN A;  2XGO A;  3FP3 A;  3CVV A;  3SGH A;  3LPZ A;  1EOD A;  2R5S A;  2UY1 B;  2YIN A;  2P9I G;  2WMN A;  3AAA C;  4Y6W A;  1TNB A;  4B89 A;  3UKU G;  5BXU A;  2OVB A;  3MKR A;  3FUI A;  2Z8H A;  3LVQ E;  1N95 A;  3KS2 A;  3K9I A;  2EQX A;  4DLQ A;  1Q2Z A;  4GZ6 A;  3ML8 A;  3ZN3 A;  3CK9 A;  2KCV A;  2HE0 A;  5CMW A;  3UPV A;  1VCB B;  5DAF A;  3UKR G;  3UM3 A;  1D8E A;  4WQO C;  3PDN A;  3D9H A;  1KPS B;  2I6H A;  3CHM A;  2WXI A;  4EBA G;  3PVL A;  3UQ3 A;  2RD0 A;  1N94 A;  1A17 A;  3FUJ A;  3NF1 A;  1EOE A;  3VTY A;  3CV0 A;  5FTA A;  1OCC E;  1QZ2 A;  3ZNG A;  5D2M C;  5J08 A;  2P1M A;  1O1S A;  4BKS B;  4AY5 A;  2CHZ A;  5CRV A;  1TNO A;  3W9G A;  2A5U A;  1OWL A;  3DBS A;  3V2X A;  2Q81 A;  2MOW A;  1E8Z A;  3B95 A;  3KEZ A;  3EHR A;  3J5Q B;  1H2V C;  5LLI B;  5G05 J;  3FTV A;  2BKK B;  1N0R A;  4CP3 A;  2V8S E;  1JCR A;  1EDU A;  4HBD A;  3MZL B;  3QNK A;  3HXB A;  2XPI A;  4GTM A;  3MKQ A;  4OVU A;  2QYJ A;  2WXH A;  3FUF A;  3HG0 D;  3L08 A;  1AWC B;  4H7Y A;  3M4T A;  4JXT A;  4JA9 A;  4PDX A;  4DX6 D;  5ANR A;  3EHQ A;  3IV0 A;  5ENQ D;  3ZNG B;  3EIJ A;  3E37 A;  4A3T A;  2IF5 A;  1BLX B;  4UWH A;  3UT7 A;  3NQP A;  4U2N A;  4K5A B;  3DXK G;  3FU6 A;  4D10 C;  4ILH B;  5EKQ D;  2OND A;  4GYY A;  5AQB A;  4B94 A;  3UIO C;  4P29 A;  3ASG A;  4LEU A;  5CCM A;  1OT8 A;  4F1S A;  2L0T B;  3L82 A;  1WAO 1;  3MEK A;  5CEA A;  4RQI A;  4J8Y A;  5KJN A;  1JCQ A;  4GA2 A;  4HFG A;  3Q4A B;  2CFZ A;  4OVV A;  3CHR A;  1OXJ A;  3UXG A;  5LCW C;  3MKQ B;  3RO2 A;  4BX8 A;  3DXM G;  5H7H A;  4N3B A;  2VGY A;  3U3W A;  3TWS A;  4J6I A;  4Q96 A;  4HI9 A;  5A6R A;  4EOZ A;  4L7T A;  5CCL A;  3HU6 A;  3NZS A;  2IFU A;  5CHE E;  4G23 A;  4TXR A;  2PZI A;  4ACK A;  1H2T C;  3RRU A;  2WQ7 A;  3PUK A;  4CDM A;  4G11 A;  3S7F A;  3TXM A;  2EIJ E;  4HRM B;  1KT0 A;  3ZTC B;  3LY8 A;  3LUT B;  2WXG A;  1TJF A;  5KBA A;  2AXZ A;  2FEZ A;  3ESL A;  5IBK A;  3NAW A;  4OAU C;  2PPI A;  2KC7 A;  4LRZ A;  3TJP A;  3NOG D;  3FUK A;  1HO8 A;  4EHM A;  4OAV B;  4CRW A;  2RKK A;  1OWN A;  5AIJ A;  1FT1 A;  1GW6 A;  3RKV A;  5A7D B;  3ASN E;  1H6K A;  1O5M A;  2KXP C;  1H6O A;  3EDT B;  2KBX A;  2MYO A;  2OCC E;  4W9G B;  3J5P A;  1MX6 A;  1WG0 A;  4NQ0 A;  1FS2 B;  1R28 A;  3Q78 A;  2IJG X;  3AS4 A;  4DUI A;  3VLE A;  4B8A A;  4DRX E;  1RW2 A;  4B0Z A;  5ENO D;  4HOS A;  1UJJ A;  3RU0 A;  1AP7 A;  3HXD A;  5LP0 A;  4WNF A;  3FUD A;  3SQV A;  2P2C P;  2GRL A;  2XEN A;  5B1A E;  4URK A;  3HYM B;  3U64 A;  4Z68 A;  1E8Y A;  2OOE A;  4HNA D;  5JH5 B;  2P9U G;  3MYV A;  3OXL A;  4DK5 A;  3CQC B;  1N11 A;  3HDX A;  4XE0 A;  3FH8 A;  3DRZ A;  1HS6 A;  4N3A A;  3SFX A;  4FP7 A;  3SD5 A;  2VGE A;  4DLO A;  4GZ5 A;  3ZKJ A;  2YHC A;  2ETB A;  1VDY A;  3GZS A;  1UOH A;  2AXU A;  3SBS A;  2B6C A;  5ANL A;  4GZC A;  5T4Y A;  3B84 A;  4GA1 A;  3ZGQ A;  1PC2 A;  3CVL A;  3ZYQ A;  2J08 A;  1K1B A;  1IYG A;  3QWP A;  4I2W A;  3ZXS A;  2QZA A;  4WAF A;  2R59 A;  1WM5 A;  4X8Q A;  1P5Q A;  2J8S D;  3JXI A;  2FNJ C;  3AJI A;  1MQS A;  2P1Q A;  2R03 A;  2GRO B;  1FVF A;  3D9P A;  4RLY A;  4CZ2 D;  3E32 A;  3TWT A;  3CHO A;  3D3M A;  3HHM A;  3PZ4 A;  3IKO B;  5ITZ F;  2VTB B;  2HR2 A;  4BX9 A;  4GPM A;  4MKT A;  4AJY C;  1LD8 A;  4DX2 A;  4V3I A;  2QY7 A;  1K8K G;  4XI0 A;  3OGM A;  4C9B B;  1YYH A;  1O1T A;  4JHJ A;  3QWW A;  2OEV A;  1DNP A;  1U2V G;  4U8Y D;  1WY6 A;  3MV2 B;  1MX2 A;  5AN8 A;  4G25 A;  3C98 A;  3RRN B;  4PH4 B;  1OWP A;  3E4B A;  2XGM A;  3EHN A;  1O1R A;  3TGO A;  4W9J B;  4W9H B;  3EU9 A;  2EIK E;  2VSO E;  5FQ8 A;  1IQR A;  2PM6 A;  4DX7 D;  3Q47 B;  4RG9 A;  1HG2 A;  4U63 A;  3V7D A;  2YHE A;  1A5E A;  4GTO A;  5G04 C;  2WXR A;  1DSX A;  3AG3 E;  4PS3 A;  3W9F A;  2P9S G;  5KJK A;  1BPO A;  3UM2 A;  1MZC A;  2FBN A;  2CHX A;  3FWV A;  1MJ0 A;  4LG6 A;  2WQH A;  2DZO A;  2V0P A;  1SA4 A;  4JHK A;  3DSS A;  2I1K A;  4I9C A;  4UQZ A;  2P9L G;  3MCX A;  4KBQ A;  5JHB A;  3APF A;  3PNT B;  2LXM A;  1W3B A;  3ASH A;  4F1P A;  3D9K A;  3RRM B;  3QJZ A;  3SY2 A;  3E4U A;  4G8L A;  4HLL A;  3SO8 A;  3E30 A;  3FHE A;  5HKP A;  3LXU X;  4EEC A;  4KZC A;  5HS0 A;  4UWL A;  2R02 A;  3ZTD B;  4FJY A;  3UM0 A;  5J90 A;  1E7V A;  5FQ6 A;  3CHP A;  2IO3 C;  4TXQ A;  3I4R B;  3L22 A;  4L1B A;  3DPY A;  4JEH A;  1Y6I A;  1OCO E;  4O60 A;  4KMO A;  2FO1 E;  2J09 A;  1BI7 B;  2AWI A;  2ZIR A;  4N5Q A;  3BU8 A;  5JJ7 A;  3FTW A;  3FTY A;  1V54 E;  3VLD A;  5EYL A;  2R17 C;  4CGW A;  3PEV B;  2WXP A;  4HOQ A;  4J7W A;  4FAD A;  4U95 D;  4BT9 A;  4AEZ C;  1TR4 A;  1PAQ A;  2CG3 A;  5JJ6 A;  2WXL A;  4ACL A;  1BD8 A;  4XKB A;  2B0O E;  3ZHE B;  4ATZ D;  1XNF A;  1OCR E;  4J0U A;  5D0Q D;  3UIN C;  4KVM A;  3FU3 A;  3U9W A;  3CVX A;  1N9A A;  4BER A;  2GW1 A;  1H19 A;  4AWJ B;  3B7S A;  3I3N A;  4BT8 A;  3ZYK A;  2XS1 A;  4CDN A; 
#chains in the Genus database with same CATH homology
 4JXT A;  3MV3 B;  4GCO A;  1SQM A;  4JA9 A;  2IHC A;  4PDX A;  4A1S A;  4EZL A;  5ANR A;  5HZG C;  2VSX E;  3B7T A;  3IV0 A;  3ZNG B;  1N52 A;  2VYI A;  3EIJ A;  3FEY A;  3QAQ A;  4A3T A;  5C2Y A;  2IF5 A;  2IZV C;  2BF0 X;  4W9R A;  3CEQ A;  4UWH A;  3UT7 A;  2KCL A;  2PM7 A;  4CT0 A;  4OYS A;  4ILI A;  3TAX A;  3FTU A;  2YY9 A;  4F7A A;  3OGL A;  2WXF A;  3NQP A;  1CS3 A;  3CK8 A;  3O4Z A;  5HYW B;  4MS6 A;  4U2N A;  3WSO B;  4PS7 A;  3PE3 A;  4GMJ A;  2XEV A;  4MLP A;  2IF4 A;  3QC1 A;  3SHF A;  3APD A;  3FU6 A;  4D10 C;  4ILH B;  5EKQ D;  2OND A;  4Q94 A;  3R7R A;  5BUZ A;  1FS1 B;  3HVE A;  4GYY A;  3RO3 A;  2OV8 A;  1S0P A;  3MGB A;  3T5X A;  3ZRH A;  4UIJ A;  2WXO A;  1QNF A;  3LJ3 A;  4KXK B;  4B94 A;  2HYZ A;  4NRH B;  2L6J A;  3ZHE A;  3APC A;  4P29 A;  3ASG A;  4LEU A;  3RJV A;  5CCM A;  3L16 A;  2KZT A;  4F1S A;  2X6K A;  2L0T B;  3SFZ A;  3M5B A;  3DRX A;  1WAO 1;  4F53 A;  2LAH A;  3MEK A;  5LX8 A;  1LDK D;  2E0I A;  5KJN A;  4CDN A;  2CFU A;  2WM9 A;  5LOZ A;  4GA2 A;  1OWM A;  3LY9 A;  3QDN A;  1JWF A;  2AVP A;  3G2V A;  4HFG A;  3MKS A;  3Q4A B;  4I17 A;  4CXI A;  2CFZ A;  5E75 A;  4OVV A;  2WMO A;  2ILR A;  3FU0 A;  5H7G A;  2P1N A;  1EXB E;  3LS8 A;  3CHR A;  3ZIM A;  4FLH A;  3ZRF B;  4HXI A;  3I5P A;  3LY7 A;  4J8D A;  5LCW C;  1QDV A;  3MKQ B;  4N2S A;  5FTP A;  2MRI A;  4C0M A;  3RO2 A;  4ANW A;  4BX8 A;  4CT4 A;  1E8W A;  2I1J A;  4FJZ A;  5H7H A;  3CVQ A;  2PQR A;  3HIZ A;  3IHY A;  3C6N A;  3FDH A;  3JYS A;  4N3B A;  4CDR A;  2J4B A;  2VGY A;  3U3W A;  3D9L A;  3G2U A;  4J6I A;  4Q96 A;  4L2Y A;  3ZFW A;  2KAT A;  4F3V A;  4FA6 A;  1BUO A;  2NC9 A;  2X6J A;  5A6R A;  4AP2 A;  4L7T A;  5CCL A;  4N2Q A;  4EOZ A;  4KYO B;  3HU6 A;  3NZS A;  2IFU A;  5CHE E;  4G23 A;  2DIW A;  4CRH A;  2J07 A;  2MA9 C;  3P2B A;  3CVP A;  1T1D A;  1XGW A;  3BEE A;  4B95 B;  3M8V A;  4NAC A;  5EDS A;  3GZ2 A;  4L23 A;  4UI9 J;  2PZI A;  3ASD A;  4J8E A;  1H2T C;  5BW8 C;  5G05 C;  3RRU A;  4ACK A;  4BTB A;  2WQ7 A;  4AY6 A;  3PUK A;  3CHQ A;  4JTC B;  2C9W C;  2A4Z A;  4CDM A;  1ZBP A;  5T8I A;  3TG5 A;  4G11 A;  5BPP A;  3PUJ A;  4ANV A;  3S7F A;  3TXM A;  2OVP A;  2Q7F A;  4A3V A;  4J8Z A;  1KT0 A;  1E7U A;  1SZ9 A;  3ZTC B;  3LY8 A;  3S7D A;  3LUT B;  2WXG A;  1TJF A;  3Q15 A;  2AXZ A;  4W9E B;  4FU3 A;  3WXX A;  3OAW A;  3DPD A;  2FEZ A;  3ESL A;  3HVE B;  3PNL B;  5IBK A;  2PPI A;  1A68 A;  4WNE A;  2KC7 A;  4LRZ A;  4YVO A;  3TJP A;  3S7B A;  4I1M A;  4WNG A;  1Z6T A;  3FEX A;  2JEK A;  1HZ4 A;  4HVB A;  3D9I A;  2XPZ A;  2VSY A;  4JVS A;  3FUK A;  5A6C A;  3D9M A;  3U4T A;  3ZYL A;  1QQE A;  4LUN U;  1HO8 A;  2KZT B;  4IRU A;  4ANX A;  2P1O A;  4YVQ C;  1UN9 A;  3FTS A;  5FWQ A;  3CKB A;  2IOL A;  3SI5 A;  4CRW A;  2RG8 A;  1NA3 A;  5BXH A;  1OWN A;  5AIJ A;  5E76 A;  1GW6 A;  2HO1 A;  3RKV A;  4HLE A;  5A7D B;  4W9C B;  4CCA A;  4N3C A;  4I1A A;  3ZKJ B;  1HFA A;  1Z3X A;  2I9C A;  2XHE A;  1H6K A;  3CIA A;  3RIB A;  2LO6 A;  3L13 A;  1HF8 A;  3UX4 A;  3EDT B;  2I2O A;  4ZOU A;  3O48 A;  3OGK A;  3L6A A;  3EHM A;  5EUP A;  5FZR A;  3M52 A;  3KVT A;  4EPZ A;  1UW4 B;  2E31 B;  2ION A;  1LQB B;  1HH8 A;  2C0L A;  4AXH A;  5HQ8 A;  5FJY A;  4W9G B;  3SF4 A;  4U8H A;  3CVW A;  4NQ0 A;  4ATG A;  2WXK A;  4AV7 A;  1FS2 B;  1R28 A;  3JQ1 A;  3ONL A;  4WND A;  3OHU A;  4G1T A;  2IJG X;  2KCK A;  3PZD A;  2Y4U A;  4BWR A;  3AS4 A;  1LF8 A;  4B9K E;  3LCA A;  3VLE A;  3IBE A;  3M4T A;  4G26 A;  4B8A A;  2BTD A;  1H2U A;  5KCM A;  3LEW A;  5BV1 A;  2E32 B;  2X6F A;  3CLJ A;  4AIF A;  1EOF A;  1ZU2 A;  4XIF A;  4B0Z A;  4HOS A;  2XQ0 A;  1U3D A;  1UJJ A;  3FTX A;  3RU0 A;  4APF A;  4PUC A;  3FFL A;  4IYP A;  4JC8 A;  4UWF A;  3SNX A;  5LP0 A;  4WNF A;  3FUD A;  3IEG A;  4FUL A;  3ZVV A;  3S7J A;  2GRL A;  1HU3 A;  4HOR A;  4ME2 A;  4URK A;  3QKY A;  2NN2 A;  1KT1 A;  3BG0 B;  3BG1 B;  3L2O A;  3HYM B;  4IN3 B;  3UT4 A;  3ZRC B;  3I4G A;  2V5F A;  1E8Y A;  3U64 A;  4BTA A;  5FQ7 A;  2OOE A;  4PS8 A;  5JH5 B;  3MYV A;  3OXL A;  4DK5 A;  2NZ0 B;  2GGF A;  5JJT A;  3U66 A;  4GAA A;  3HTM A;  2X3M A;  5AEN A;  3OXG A;  3CQC B;  3Q5M A;  1FVH A;  3HDX A;  4FC8 A;  4XE0 A;  3FUE A;  4YND A;  4I6J C;  1IHG A;  1NP7 A;  3FH8 A;  5G04 J;  3DRZ A;  1HS6 A;  4N3A A;  4FP7 A;  4NUR A;  3R7Q A;  3SD5 A;  1JPL A;  4AM9 A;  3FUN A;  4DLO A;  4GZ5 A;  4UYI A;  4MRU A;  4JA7 A;  2YHC A;  1DVP A;  4A55 A;  5JHA A;  4W9F B;  4XZ4 A;  1VDY A;  3GZS A;  5BV0 A;  2QFC A;  4HOT A;  2IOS A;  2AXU A;  3SBS A;  1N54 A;  1R29 A;  4E6H A;  3DRY A;  5ANL A;  1JUQ A;  3ENE A;  1IQU A;  1Z3Y A;  3LBZ A;  5EX0 A;  4U2M A;  4GZC A;  1Y8M A;  5T4Y A;  3SZ7 A;  2VPK A;  4GA0 A;  4GA1 A;  1MHQ A;  2OVF A;  4GU5 A;  3UMV A;  3ZGQ A;  2VJ8 A;  1PC2 A;  3CVL A;  4CGV A;  3KAE A;  3FKC A;  3GA1 A;  4M3O A;  2FUL A;  5AYW D;  4YY8 A;  2LAI A;  3ZYQ A;  4CXT A;  2UWJ G;  2VQ2 A;  2J08 A;  4JHR A;  4UI9 C;  1IYG A;  1HV2 A;  3QWP A;  3Q49 B;  4I1O B;  4ILG A;  4I2W A;  1EF1 C;  4CXJ A;  3ZXS A;  4WWN A;  3PEU B;  4EBA A;  3RK6 A;  4U07 A;  3ESK A;  3CR3 A;  4WAF A;  4GCN A;  2R59 A;  3B7U X;  2WPV A;  1WM5 A;  4TUU A;  4AJW A;  2VKP A;  4GML A;  2L9B A;  5A23 A;  2OVQ A;  3CGH A;  2P58 C;  4W9H H;  1EYH A;  4U0Z A;  1P5Q A;  4L2L A;  5AJL A;  2FNJ C;  3AS5 A;  5ARF A;  2P1Q A;  1MQS A;  2DBA A;  4I6J A;  4U0S A;  4APO A;  5LFA A;  1TEZ A;  5G55 A;  1FVF A;  1ELR A;  3TL5 A;  1E90 A;  2NSZ A;  3AU4 A;  3D9P A;  4G24 A;  3KD7 A;  1EPU A;  5ARG A;  4EZJ A;  2UY1 A;  1NA0 A;  3LKU A;  4XKC A;  3URZ A;  4DJA A;  1OWO A;  5DBK A;  4Q69 A;  3P1U A;  3HQI A;  2NXP A;  4U0U A;  3CHO A;  3D3M A;  3HHM A;  5AJD A;  5BT1 A;  4JTD B;  3UUX A;  2XGS A;  5KJL A;  4RVB A;  3IKO B;  4GZ3 A;  3CQG B;  4WWP A;  4TV3 A;  2PL2 A;  2VTB B;  2HR2 A;  3EJN A;  3LYA A;  4BY6 A;  3FTZ A;  4BX9 A;  4ZGC A;  1E96 B;  3IHV A;  4MKT A;  5HI7 A;  4AJY C;  4V3I A;  2QY7 A;  3D9N A;  4WWO A;  3OTN A;  3MA5 A;  5T3R A;  1KLX A;  4IUL A;  4XI0 A;  1LM8 C;  3FH7 A;  3OGM A;  4C9B B;  3T5V A;  4I43 A;  3NZU A;  3CSF A;  2XCC A;  4C0E A;  3JQ0 A;  4JHJ A;  1L5J A;  2VGX A;  1UG3 A;  3JCK C;  3QWW A;  1DNP A;  3QOU A;  3SBT B;  3CVU A;  2C2L A;  1NZN A;  1WY6 A;  2WVI A;  3FUH A;  3JUI A;  3MV2 B;  5BXB A;  1U3C A;  2J4D A;  4W9K B;  1YA0 A;  2YNQ A;  4UQX A;  3PRE A;  4E85 A;  1NN7 A;  2PQN A;  2X6I A;  4G25 A;  4H7X A;  3C98 A;  4UQY A;  3C6P A;  1HX8 A;  2FO7 A;  3CKC A;  3RRN B;  2OVR A;  3B7R L;  3D9J A;  1FCH A;  1X5B A;  2DCP A;  1HXI A;  4PH4 B;  3G2S A;  1OWP A;  5G2N A;  2WXJ A;  2XGM A;  3E4B A;  4UWG A;  3EHN A;  3FU5 A;  1TJC A;  2FI7 A;  4KZ0 A;  4BFR A;  2L0I A;  3TGO A;  3VLF A;  4JGH C;  4W9J B;  4ABN A;  3CST A;  4W9H B;  4GB9 A;  4J8S A;  4FLB A;  3PE4 A;  4UI9 K;  4AOF A;  2VSO E;  5FQ8 A;  5CMY A;  5FQ4 A;  3G2T A;  3VTX A;  1IQR A;  1HE8 A;  1HG5 A;  5M72 A;  3TXN A;  3AU5 A;  2PM6 A;  3Q47 B;  4KT6 B;  4K03 A;  4A1G A;  4RG9 A;  4W9L B;  1HG2 A;  3QWV A;  4U63 A;  1QDW A;  2FF4 A;  2YHE A;  3V7D A;  4EZK A;  4CEM A;  4RSY A;  3G2W A;  4N9F 5;  4AVX A;  4W9D B;  5G04 C;  5D0O D;  4FHK A;  2WXR A;  4GPK A;  1DSX A;  3ONK A;  3OXF A;  4PS3 A;  2XGO A;  3FP3 A;  3ML9 A;  3CVV A;  3SGH A;  3LPZ A;  3MJW A;  2R5S A;  4DI4 A;  1EOD A;  3EIQ C;  2UY1 B;  1PY1 A;  3S2A A;  2VTB A;  5KJK A;  2YIN A;  1BPO A;  3ZEF A;  3TG4 A;  2WMN A;  4N5C A;  2FBN A;  4U04 A;  2AST A;  2CHX A;  3FWV A;  2E2E A;  2M63 A;  3FUL A;  3LVR E;  2WQH A;  3CVN A;  3N71 A;  4TRQ A;  2V0P A;  4Y6W A;  3CVY A;  4B89 A;  4JHK A;  1P22 B;  4I2Z A;  2OVB A;  4XI9 A;  3MKR A;  4BSX A;  2I1K A;  3FUI A;  3DCG B;  4I9C A;  3QK0 A;  2Z8H A;  4JPS A;  4XX5 A;  4UQZ A;  3AS8 A;  4JZY A;  4I6G A;  3LVQ E;  2A79 B;  1H0A A;  3MCX A;  3KS2 A;  4KBQ A;  5JHB A;  3APF A;  3PNT B;  5EX3 A;  3B84 A;  2CG2 A;  1W3B A;  2CHW A;  3ASH A;  3FY4 A;  3K9I A;  3R9A B;  4B9K B;  2EQX A;  2J9Q A;  4Y6C A;  2XRY A;  1E8X A;  3D9K A;  4DLQ A;  4W9I B;  3RRM B;  3GYZ A;  4GZ6 A;  2GRM A;  3ML8 A;  4JL0 A;  3ZN3 A;  2LSV A;  3CK9 A;  1ELW A;  3QJZ A;  2VGX B;  3ASF A;  1FQV B;  2WXN A;  1INZ A;  2KCV A;  3E4U A;  5CMW A;  4N39 A;  1JWG A;  3UPV A;  3C6O A;  1UJK A;  4GZD A;  1VCB B;  4GYW A;  5DAF A;  2X38 A;  4WQO C;  4BKT B;  3FHE A;  3FUM A;  3LXU X;  4EEC A;  3BIM A;  3PDN A;  4JEU A;  4KZC A;  4UWL A;  2YQ8 A;  3B13 A;  1B89 A;  2Y4T A;  4KVO A;  5DIZ A;  2I6H A;  3CHM A;  2MHK A;  3ULQ A;  2WXI A;  3ZTD B;  4FJY A;  4EBA G;  4ANU A;  4K0R A;  5J90 A;  2VSN A;  1S1G A;  1R2B A;  1E7V A;  3PVL A;  4FHJ A;  5FQ6 A;  4B8C B;  3CHP A;  3UQ3 A;  4JW1 A;  1SZA A;  2RD0 A;  3I4R B;  3L22 A;  3L17 A;  1A17 A;  2WXQ A;  3FUJ A;  4L1B A;  4RG6 A;  3NF1 A;  1Y6I A;  4JEH A;  3VTY A;  1EOE A;  4KMO A;  3D9O A;  2JLB A;  3CV0 A;  2J09 A;  4LCT A;  4J8F A;  4U77 A;  2AWI A;  5FTA A;  2BUG A;  1UN8 A;  1QZ2 A;  4BGC A;  5ENN A;  5J08 A;  3FTW A;  5JJ7 A;  2P1M A;  5BNW A;  2LNI A;  5LCW J;  4WUY A;  3L54 A;  4BKS B;  3FTY A;  4AY5 A;  3ZW3 A;  2WB2 A;  2CHZ A;  3GW4 A;  2IQC A;  2X6H A;  4GYO A;  3PS6 A;  4HOU A;  3VLD A;  2R17 C;  4CGW A;  3PH0 C;  2A5U A;  3PEV B;  3CHS A;  1OWL A;  2ZU6 B;  2AXV A;  4I9E A;  3DBS A;  3QAR A;  2WXP A;  3ZPJ A;  2Q81 A;  2P1P A;  3ZUN B;  2MOW A;  4HOQ A;  1E8Z A;  5FZS A;  4HS2 A;  2XRZ A;  4FAD A;  3KEZ A;  5FZQ A;  4BT9 A;  5A15 A;  2J49 A;  4AEZ C;  2Y3A A;  2WQ6 A;  3MX3 A;  1H2V C;  1PAQ A;  2CG3 A;  5JJ6 A;  2WXL A;  5LLI B;  4ACL A;  5G05 J;  4JTA B;  3FTV A;  3PRZ A;  5BO4 C;  4XKB A;  2KM4 A;  3ZHE B;  5C1D A;  3LNM B;  4CP3 A;  5BXD A;  4EQF A;  5FT9 A;  1XNF A;  2V8S E;  3GZ1 A;  4J0U A;  3ZYM A;  1EDU A;  5D0Q D;  4DI3 A;  5KJM A;  4KVM A;  1ELK A;  2IU1 A;  3FU3 A;  3QB2 A;  3U9W A;  2R9R B;  2HM8 A;  3MZL B;  3QNK A;  3CVX A;  3LDZ A;  4I6E A;  4O6F A;  2LSU A;  2XPI A;  2I2R A;  2C0M A;  5DAD A;  4G2V A;  3OHV A;  3MKQ A;  4OVU A;  2GW1 A;  3CK7 A;  4R7L A;  1H19 A;  4AWJ B;  3B7S A;  4QFV A;  2XPY A;  1OUV A;  3I3N A;  2V4L A;  1NEX A;  2WXH A;  2WXM A;  4UWK A;  4BT8 A;  3FH5 A;  3FUF A;  3L08 A;  4LER A;  3T8M A;  3UT8 A;  3ZYK A;  2AW6 A;  4H7Y A;  2JZ3 C;  2ASS A;  2XCB A;  4DPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...