3HVEA

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
216
Chain Sequence
SDPQHAARLLRALSSFRERFCDAHLVLDGEEIPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLNDTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLERYVFEAVIRWIAHEIRKVHMKDVMSALWVSGLDSYLREQMLNEPLVREIVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
molecule keywords Gigaxonin
total genus 52
structure length 216
sequence length 240
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveA01
5BXDA 4W9LB 2OVPA 4B9KB 1EODA 3ZRCB 3LNMB 2Q81A 3ZUNB 3ZTDB 4CXTA 2P1NA 3ZTCB 3HQIA 4B9KE 1LM8C 1LDKD 2OVRA 1FS2B 2C9WC 4BKTB 2VPKA 1P22B 3BIMA 5BXBA 4B95B 4W9CB 3OGKA 4W9KB 3ZNGB 4WQOC 1VCBB 1S1GA 3ZKJB 5H7HA 3OHUA 4W9DB 4HS2A 4J8ZA 4EOZA 4HXIA 2E31B 4U2NA 1QDWA 4AJYC 4I6JC 3M52A 1HV2A 1A68A 4CRHA 3C6NA 3B84A 4UIJA 4JTDB 3I3NA 2P1QA 3HU6A 4CXJA 3GA1A 2A79B 1CS3A 4BGCA 5IBKA 4N9F5 2IZVC 2P1MA 2IF5A 2P1OA 4UYIA 1R29A 4CXIA 2YY9A 3HVEA 1EOEA 4AP2A 1EXBE 2VKPA 3OGMA 5BO4C 3MKSA 4JTCB 2I2RA 4JTAB 1T1DA 4W9HH 2FNJC 2P1PA 4U2MA 3LBZA 4U77A 5FTAA 3DCGB 1NEXA 3E4UA 2ASTA 1EOFA 5LLIB 3HTMA 3KVTA 1QDVA 1NN7A 2EQXA 5EUPA 2NN2A 4W9GB 2ASSA 5HYWB 2PPIA 3M8VA 3OGLA 4BKSB 4CP3A 2IHCA 4W9FB 3DRZA 3WSOB 3LUTB 5H7GA 2JZ3C 1FQVB 3M5BA 4W9HB 5A6RA 2E32B 1DSXA 3FKCA 3HVEB 1BUOA 3L2OA 1R2BA 5DAFA 5HZGC 1LQBB 4ZOUA 5DADA 1R28A 2OVQA 4W9JB 3OHVA 3C6OA 3M4TA 5BXHA 4APFA 1FS1B 2R9RB 4AWJB 2NZ0B 5A15A 3V7DA 2MA9C 2Z8HA 5JH5B 4JGHC 3C6PA 4W9EB 4W9IB 3ZRFB
chains in the Genus database with same CATH superfamily
2ETBA 2P9SG 4A3VA 1HH8A 4CGWA 3TXMA 4I17A 4NRHB 3FTWA 2QZAA 3FP3A 3UI2A 2OVRA 3UINC 4AY6A 4I2WA 4RG9A 4Z68A 4A63B 3E32A 3UT4A 2DIWA 3RU0A 4WQOC 3T5VA 3I4RB 3OHUA 5A7DB 2VSOE 2AW6A 2GRQB 4I6JC 2WXNA 4GTMA 3G2WA 4UIJA 3I3NA 2RD0A 2GROB 1DCEA 2IZVC 1EXBE 2OOEA 1BLXB 4F6RD 3PDNA 3CSTA 4O6FA 3CHOA 2Y1LE 2GRRB 2QC9A 1TNZA 3RO3A 1Z3YA 2XS1A 1ELRA 3DEOA 4K0RA 1E96B 2XGSA 3CHQA 3SO8A 3QK0A 2AXUA 1TNUA 2JEKA 4DX7D 4WAFA 3V79K 4FULA 3S7FA 2RFMA 3L08A 1R2BA 3ZYLA 4I6GA 2WMOA 4N2SA 3PREA 4KT6B 2KZTB 3W9FA 4HBDA 3MV2B 3HXBA 2MA9C 2WXHA 2WXKA 1TJFA 4N3BA 3ABKE 5KJLA 1K3ZD 4BETA 4TUUA 3UKUG 4DX6D 1ELWA 3UKRG 4NIKA 5JJTA 2LSUA 5M72A 1WG0A 2M63A 5AAOA 3BU8A 4HOSA 4GCOA 4MLPA 4U04A 4W9KB 3RAUA 5H7HA 2DZNA 3CR3A 2E31B 1OUVA 2R03A 5CECB 2C0LA 3EIQC 2IQCA 2LSVA 4BESA 2P1QA 4KZ0A 4KZCA 5AARA 2BUGA 5D2MC 1Z5SC 3GZSA 3HVEA 1OCCE 4U8HA 2FNJC 5JA4D 2Y4TA 3G2VA 4U2MA 3PZ3A 4I43A 3ASDA 1MX4A 5ITZF 3KVTA 3ESLA 2NN2A 3QWPA 4QQIA 3OGLA 2VYIA 1H2UA 2UY1B 3FTXA 5E75A 2YNQA 2HR2A 3EHNA 3D9PA 2MYOA 1KZPA 4UUCA 1OWLA 3D9NA 3BG0B 2BKKB 3JQ0A 3FU5A 2FEZA 5DIZA 5HZGC 2LXLA 3RJVA 1LQBB 5KJNA 1B89A 2R2LA 4YDEA 3MKQA 4ME2A 3NZSA 2BTDA 4WNEA 5C2YA 4JGHC 1EYHA 2RG8A 3QOUA 3NOCD 4CT4A 4ANWA 2YQ8A 4Q69A 5LFAA 3S7DA 3OAWA 5AYWD 1N4PA 3G2SA 4B8AA 2IU1A 5CHEE 3R9AB 4MRUA 1LM8C 3ZNGA 3ASHA 3ESKA 5G04J 4XX5A 1OY3D 2AXZA 3AAAC 1FVHA 4Y6WA 2XEEA 3CKCA 3ASFA 5B1AE 3P1UA 4XKCA 4JHRA 4JHKA 3FWVA 3UT8A 5AJDA 1NI1A 3E4BA 3CLJA 3GA1A 4XKBA 2ETAA 4LEUA 2LAIA 5IBKA 2C2LA 4UYIA 2P1MA 4BSXA 2AJAA 3QNKA 4N5QA 4U8VD 3AG1E 3HXFA 3LBZA 1YA0A 3E34A 1PC2A 2WXQA 2R05A 3WSOB 4HNAD 3C5RA 3D9IA 3MJWA 1WDYA 1H6OA 2WXRA 1EDUA 3FUMA 1DCQA 1FT2A 1SA4A 1FVFA 2Y3AA 4BERA 4AWJB 2WMNA 4LERA 5JH5B 5AQ9A 3DPDA 1D8EA 3APCA 4XIFA 4U95D 4B9KB 5T4YA 4PS7A 3D9OA 3TAXA 3LNMB 4GA2A 4HVBA 3ZVVA 5G05C 3SFZA 3LY9A 2KC7A 1LDKD 3FTUA 4PH4B 4HI8A 4BKTB 3V2XA 4JB8P 4JEHA 3OGKA 1OCRE 4N3AA 3LS8A 3DSXA 3MGBA 4HB5A 4BT8A 3LCAA 4I1AA 2A5UA 3PZ2A 1N9AA 3PS6A 4AJWA 3I5PA 1HS6A 2P9PG 2ONDA 1N0RA 4BGCA 4FJZA 1QNFA 1KT0A 3TWXA 3DSSA 1UJKA 4GA0A 3U9WA 4CXIA 4ANUA 5EILA 4OAVB 4U63A 2WXMA 4W9HH 1FPPA 1E7VA 2X6IA 4YVOA 1X5BA 3FH7A 4XI9A 3RKVA 5LLIB 2R5SA 3W9GA 5AQBA 4A55A 4WWPA 1BU9A 2ASSA 2PPIA 3DXMG 5JJ7A 3OTNA 3ZXSA 3CKBA 1E8ZA 3HVEB 3PNTB 4GZ5A 5DAFA 2R59A 4ILIA 4Y6CA 3GZ1A 3ONKA 5EYLA 1S63A 1E8YA 1OCOE 3LPZA 5ENPD 1ZU2A 4RSYA 3ZYKA 4DX1A 4HRMB 3ZUNB 4N3CA 3CQGB 3ZTCB 4OYSA 4U7EB 3PE3A 1A17A 4JW1A 1K1BA 1UW4B 2VJ8A 4URKA 3LVRE 2VPKA 1XNFA 1K1AA 4HFGA 3L13A 3ZEFA 1SZAA 1FT1A 4G8LA 5EX3A 4GU5A 2IONA 1HZ4A 2XPZA 3ASGA 3ASOE 3FHEA 2VGXB 1N54A 4J0UA 2NXPA 2GGFA 3TWSA 5H7PA 3DPYA 1E8XA 3ZGQA 3QWWA 1EF1C 3ZYMA 3KSLA 5FINA 2FI7A 1H2VC 5ANRA 3Q9UC 2XZDG 4XZ4A 5JHBA 2I9CA 4L9PA 5AN8A 3DRYA 4UI9K 4I6JA 3VTXA 4E6HA 3FH5A 1HO8A 5G55A 3FUNA 3ONLA 2HM8A 4B0ZA 4HOTA 3HHMA 3TWRA 1O1TA 5HQ8A 1NA0A 3CSFA 2IO3C 5BXHA 4KYOB 1FS1B 1SVXA 3RSEG 1GW6A 4ILGA 4AY5A 1TR4A 1HX8A 1Q2ZA 3ZXPA 5J08A 4C48B 2Q81A 5KCMA 5EDSA 3HDXA 1AWCB 4ANXA 4TV3A 1UOHA 4FA6A 3CK8A 2X6KA 4JL0A 2H6GA 2C9WC 5FJYA 3FTZA 4CDRA 2ZGDA 3L22A 1OWNA 2P9UG 3JUIA 1BPOA 4U0ZA 3FU0A 4DUIA 1IHBA 4K5BA 4NQ0A 4AJYC 1TN7A 2AWIA 1A68A 5CCMA 4MKTA 3LDZA 1DC2A 1QYMA 4KVMA 4UWKA 1KT1A 3S7JA 5AQ7A 4GTQA 4G25A 2YINA 1EOEA 5ENQD 4JTAB 1DVPA 4KBQA 3EUVA 4H7XA 4FC8A 1UN8A 5EIBE 2ZIRA 4GTRA 3LKUA 1O5MA 1XGWA 5CEAA 2XGOA 5ENRD 3T8KA 4FU3A 4J8FA 1LF8A 3FKCA 3BG1B 1N4RA 2X38A 4IN3B 4GTVA 4AOFA 3MKQB 1S70B 4DLOA 3IV0A 2FF4A 2LNIA 4ABNA 3PZDA 4CEMA 2OVQA 3M4TA 3FUHA 4APFA 1P5QA 5KJMA 3EIJA 4JXTA 1UG3A 4F3VA 1MQSA 4U8YD 2WXPA 3U3WA 3SHFA 4TXQA 4RQIA 3TG4A 5G05J 3F6QA 3S2AA 4F1SA 4P29A 3AG4E 1E8WA 4GTPA 2FULA 3ZN3A 3EJNA 4B89A 1OWOA 1JCSA 3FUEA 4DX2A 2EILE 3IHYA 3EDTB 3D9MA 4EZKA 3CVPA 3ENEA 3HG0D 3DRAA 1S0PA 2CFUA 4JA9A 1TN8A 4I9CA 4GYYA 4JTDB 3ABLE 4GYWA 4PS8A 3L16A 3U4TA 3OXGA 5EX0A 3ZRFB 3EHQA 4AP2A 1JWFA 3MKSA 3FTVA 3LY7A 5CMYA 3ASNE 3E4UA 4N39A 3SBTB 1EOFA 4B94A 3JCKC 4XEIG 2F8YA 1H2TC 2V4HC 4G8KA 2XS8A 5H7GA 4HI9A 1FQVB 4JEUA 2KZTA 2X6FA 4GB9A 2P9LG 3ZPJA 3RRMB 2L0TB 3TGOA 2PL2A 3ZHEA 4YY8A 3KS2A 1JUQA 2F8XK 3UM3A 4TXPA 2WQ6A 5G04C 4GMJA 1BI7B 3SNXA 5ARFA 4W9LB 2C0MA 1EODA 3ZRCB 2NC9A 4CXTA 2WPVA 2J08A 4UQZA 4EPZA 3D3MA 4V3IA 2DZOA 1FCHA 3PEVB 1YCSB 2EINE 2BEDA 3UPVA 5KNHD 1BI8B 1P22B 1HF8A 3CHPA 4HLEA 3DBSA 4I1MA 1V54E 3MZLB 4BEPA 4AV7A 4I2ZA 4FLBA 2P2CP 4O1PA 3UM0A 2L6BA 4WWNA 3UX4A 4CRHA 2I1JA 3UT7A 3BEEA 1WM5A 2WXJA 2VTBA 3TJPA 2P1OA 3UM2A 3P2BA 4F7AA 3OXLA 5FQ7A 3CK9A 2IOSA 4OVVA 3TL5A 4GTSA 3CVVA 3UQ3A 2UWJG 4YDWA 3B7RL 4A3TA 4FADA 3T8MA 2MRIA 1IQRA 3R7QA 4W9FB 4ATGA 4G23A 2LO6A 4K5CA 5EN5D 1BUOA 2XEHA 4YVQC 4IYPA 3FULA 3OHVA 3UTMA 3PNLB 5A15A 4BTBA 1NA3A 3Q9NC 3FEYA 3B95A 5HKPA 3DSTA 2V5QC 3JQ1A 2ZU6B 4BFRA 1ELKA 3BUAA 4JC8A 5CRVA 3Q49B 4GPMA 4X8QA 3G2TA 2B0OE 4IRUA 4FLHA 3ULYA 2VGXA 3DXKG 4HS2A 3ML8A 2E0IA 4F53A 4RVBA 3M52A 3FH8A 3S7BA 3QB2A 3VLFA 3FUDA 3Q15A 5JHAA 1CS3A 5T3RA 4E85A 3D9HA 3UUXA 3VLEA 4OAUC 4B8CB 3PE4A 4EZJA 3O48A 1JCQA 4U77A 5JJ6A 2YHCA 4AEZC 3PVLA 5FZQA 5BXUA 1E7UA 3C98A 4W9GB 4BKSB 1Y8MA 2IHCA 3DRZA 3TWTA 4UWGA 2EIKE 2A4ZA 2GRNB 2ILRA 3SFXA 3L82A 4ZOUA 2WVIA 3AS8A 1TN6A 3SF4A 2IJGX 4HOQA 3TWVA 4GTOA 4AM9A 2R9RB 3FU3A 3JXIA 1ZBPA 4K5AB 4DK5A 4J6IA 4WUYA 1HU3A 3UMVA 2CG2A 2NYJA 4I6EA 3D9JA 4DRXE 1MJ0A 2J9QA 4LG6A 3Q5MA 4G2VA 3JXJA 4LRZA 3BQOA 4GYOA 3LEWA 3HXCA 3B7UX 4UQXA 4B95B 3AU4A 1IQUA 4G1TA 3ZYQA 2LUHA 4J8ZA 3CIAA 4BT9A 4GZ6A 1RZ4A 2VSXE 4NURA 4HRNA 1WY6A 3NQPA 4KVOA 1NFIE 3IEGA 2L0IA 2IY0C 4CDMA 2VKPA 3N71A 1O1RA 1X81A 2EIJE 4L23A 4HRLA 3CEQA 4K03A 4LNBA 3U64A 3MKRA 3ZUVB 3QARA 3MEKA 3LXUX 4NACA 5ENNA 2X6JA 3L9TA 4JPSA 3B7BA 4LNUD 5FZSA 3M5BA 4J8DA 4DPRA 2XRZA 2WXFA 3CVQA 5ARGA 2DBAA 3WXXA 4C0EA 4DI3A 4PUCA 1HXIA 3IHVA 2V0PA 2Z8HA 3J5QB 2HYZA 4HORA 5BV0A 2GW1A 5BXOA 3HXDA 5LCWC 3UIPC 2J4DA 3APDA 3EU9A 4JVSA 4CCAA 3GZ2A 2P9IG 2RKKA 5AQAA 1TNYA 3GYZA 3QWVA 2VGYA 3MX3A 2WXGA 2Q7FA 3C3OA 3DWLG 1TYQG 5EIDA 3L17A 1S1GA 3ZKJB 3KAEA 4A1GA 3UM1A 2J8SD 3CV0A 1MX2A 3CHMA 3NAWA 4GMRA 3B84A 3HXEA 3HU6A 4GMLA 1RW2A 3AG3E 4WNDA 5ENOD 1Y6IA 1HG5A 1Z6TA 2DCPA 5E76A 5BO4C 4JTCB 3AJIA 3FUIA 3UIOC 4EBAG 4UI9J 4U0SA 3IXEA 5CRUA 2Y69E 1LD7A 3NBNB 2ASTA 2J09A 3HTMA 2JABA 5C1DA 3CGHA 2EQXA 5HS0A 2E2EA 2JLBA 3QAQA 3CVXA 4CP3A 1D8DA 2RFAA 3IBEA 5FWQA 4UWLA 2H6HA 3LUTB 2OCCE 5A6RA 4CYMD 4OVUA 5B1BE 4L2YA 1KLXA 3L2OA 2XRYA 2XHEA 1JCRA 2XCBA 5BW8C 5DADA 3Q47B 3Q7FA 4IULA 2VGEA 1R28A 5ENTD 4J8SA 3ISMC 5BNWA 5AENA 3E33A 4YDYA 2OVPA 1QBQA 3I4GA 3L6AA 4ATZD 2XCCA 4FJYA 2QYJA 4J8EA 1IKND 1HFAA 5LP0A 1H19A 5DBKA 1N94A 3EHMA 1LD8A 3U66A 5BXBA 3BIMA 3KEZA 3SD5A 3ABME 4AXHA 4BX9A 1VCBB 5KBAA 3QC1A 4UWFA 2V4LA 1Z3XA 2LXMA 4CRWA 5FQ8A 4U2NA 2PQRA 2XZTG 5BUZA 3CVWA 4ZGCA 2VTBB 1TJCA 2AXVA 3C6NA 4I9EA 4GTTA 1IYGA 2PM6A 4GZCA 1BD8A 2A79B 4KMOA 3GW4A 4N9F5 1SZ9A 2IF5A 2XENA 1W3BA 4XE0A 2YY9A 4R7LA 1H6PA 1T1DA 2WXLA 1E90A 1OWPA 5T8IA 5CBOA 3SBSA 3DCGB 5FQ6A 1INZA 3FTSA 2OVFA 2R17C 4HOUA 3LVQE 4D10C 2DVWA 2PM7A 3DSVA 1DSXA 5D0QD 2IO2C 3LJ3A 2P9KG 3Q7AA 1ZB1A 3SGHA 4H7YA 2HE0A 1N11A 4N2QA 4BTAA 2QFCA 3B7TA 5IY5E 2Y4UA 1H6KA 2IOLA 3QJZA 1PAQA 1MZCA 1NL4A 1TNOA 2KBXA 2Y0BG 5B3SE 4W9EB 4W9IB 4Q94A 4GAAA 2XQ0A 3QDNA 3E30A 2WXIA 3JUEA 1N52A 3C3QA 2MOWA 2I6HA 4LCTA 2PQNA 1MYOA 1YYHA 1O1SA 3TWQA 2KCVA 4EQFA 4FHKA 1QQEA 3LY8A 3SZ7A 3QKYA 1DNPA 4HXIA 3R9MA 1KZOA 3PH0C 4J7WA 1NP7A 4RLYA 1HV2A 5LOZA 3FUKA 4G26A 4QFVA 3FY4A 4EHMA 4AIFA 1JWGA 1U3DA 5HI7A 4MBGA 3SFYA 3HIZA 1AP7A 1SW6A 3OGMA 5FTAA 5A6CA 1JPLA 1NEXA 3ULQA 2IFUA 1UN9A 3O4ZA 2GRPB 1SQMA 1NN7A 3SQVA 3RK6A 4L7TA 2WB2A 5JMND 4YNDA 5J90A 3V31A 3B13A 1YMPA 5CERB 5BPPA 3PEUB 4W9HB 4L2LA 4XI0A 3NOGD 3MCXA 4C9BB 1UJJA 4TRQA 4PS3A 5KWDA 3B7SA 3AU5A 3RO2A 3ZW3A 3C6OA 3J5PA 2NZ0B 4GZDA 1SA5A 3NB2A 2J49A 3DEPA 2IF4A 3C6PA 2ETCA 4J8YA 3AS5A 4N5CA 2V8SE 3DSWA 3FEXA 4O1OA 4CT0A 4JZYA 4ZFHA 4LNGA 3ZTDB 2KCLA 2J07A 3FTYA 2DYSE 5D66A 3HQIA 2EIME 3MV3B 4LSZE 2I1KA 1FS2B 3CVUA 4DLQA 1OT8A 2WQ7A 3TG5A 3KSQA 4WWOA 1TNBA 2H6IA 3TWUA 4W9RA 3ZU7B 4LUNU 1D9SA 3Q75A 4TUMA 3AS4A 2HO1A 5BV1A 2A5EA 4G24A 2ZGGA 3AG2E 2BF0X 1PY1A 4U07A 4BX8A 2AVPA 4YDOA 3UXGA 3TWWA 3HRAA 4ACKA 4JA7A 5A23A 1S64A 1TEZA 2XEVA 3L54A 3FDHA 4HLLA 2KXPC 1OXJA 2F0YA 4M7CA 2CFZA 5EUPA 5HYWB 1G3NB 2WM9A 5BT1A 5ENSD 3X2QE 2DWZA 2WXOA 4U0UA 2OVBA 3Q78A 2X6HA 2OV8A 1HG2A 5FTPA 3PZ4A 5CEDB 1WAO1 2VQ2A 2R02A 2FO7A 4AVXA 3PUKA 3IKOB 5CBNA 3V7DA 3MA5A 2XPIA 5KJKA 1H0AA 2WQHA 3FU6A 2XPYA 3CQCB 4ACLA 2P1NA 2V5FA 4CGVA 2CHWA 4B9KE 5KNGA 1EPUA 2ZISA 3G2UA 3PUJA 2IEJA 3TXNA 3R7RA 2GRMA 3DSUA 4CDNA 3DRXA 3ZNGB 2CHXA 5AJLA 1V55E 2CHZA 3V30A 4W9DB 4I1OB 3KD7A 3RRNB 3RRUA 2P9NG 1QDWA 1K8KG 4L1BA 3FUJA 3ZKJA 3Q79A 4PDXA 3CVLA 3ZIMA 3URZA 3C3RA 3EU5A 4GCNA 3VTYA 1N0QA 4C0MA 4EECA 3RIBA 4F1PA 4U96D 3ZHEB 2QY7A 4UI9C 5G2NA 3T9KA 4JHJA 1QDVA 2BKGA 4A1SA 3SY2A 5CCLA 2OEVA 4G11A 1HE8A 3D9LA 1QZ2A 2JZ3C 2J4BA 4APOA 1N4QA 4UQYA 3LYAA 4M3OA 5FIOA 4B93B 1KPSB 1IHGA 2KATA 3ULEG 3PRZA 4TXRA 2YHEA 4ZHBA 2VSYA 2KM4A 4BWRA 2PNNA 2VSNA 5CMWA 4EZLA 5HRYA 3FFLA 4EBAA 5BXDA 1VDYA 4KXKB 2MHKA 3V2OA 1N4SA 2CG3A 3OXFA 2L6JA 5LCWJ 4GZ3A 1OCZE 3Q4AB 2FBNA 4WNFA 3ZFWA 5EKQD 2XGMA 4W9CB 4GA1A 4BSZB 4DX5D 2F37A 1LTXA 4FP7A 4EOZA 2LAHA 4CZ2D 4DI4A 2GRLA 2I2OA 2NSZA 1IXVA 1L5JA 3SI5A 1U3CA 5FQ4A 4UWHA 3E37A 5FZRA 2OEWA 3WG7E 3T5XA 3CHSA 4CXJA 2H6FA 2UY1A 4WNGA 5EYPF 1R29A 3ZRHA 3CHRA 5ANLA 5AIJA 2I2RA 1OWMA 2X3MA 4O60A 3Q73A 2P1PA 3JYSA 3NF1A 2FO1E 2DYRE 3VLDA 3EHRA 4MS6A 2ZXWE 3ML9A 3HYMB 3NZUA 2P58C 4Q96A 3M8VA 2KCKA 3C72A 4JD2G 4ANVA 1A5EA 3MYVA 4DJAA 1NZNA 3D9KA 4RG6A 2E32B 3PZ1A 3LJNA 2L9BA 3CK7A 5FT9A 1MX6A 1N95A 5LX8A 2QYUA 3APFA 2B6CA 4ILHB 1MHQA 4BY6A 3CVYA 4GPKA 4W9JB 3K9IA 2PZIA 5D0OD 4FHJA 4HQDA 3FUFA 3KEAA 3CVNA 1U2VG
chains in the Genus database with same CATH topology
4Q94A 3JQ1A 4GAAA 4A3VA 1ZU2A 2XQ0A 2ZU6B 1HH8A 4RSYA 4BFRA 3QDNA 4CGWA 3ZYKA 2WXIA 3TXMA 4I17A 1ELKA 4NRHB 3ZUNB 1N52A 4N3CA 3CQGB 4JC8A 3ZTCB 3FTWA 3Q49B 4OYSA 3PE3A 3FP3A 1A17A 2MOWA 4JW1A 2I6HA 1UW4B 2VJ8A 4LCTA 4URKA 2OVRA 3LVRE 2PQNA 2VPKA 4AY6A 3G2TA 1XNFA 4IRUA 4FLHA 4I2WA 4HFGA 3L13A 4RG9A 3ZEFA 1SZAA 3UT4A 2DIWA 2KCVA 4EQFA 4FHKA 1QQEA 2VGXA 3LY8A 5EX3A 3RU0A 3I4RB 4GU5A 3T5VA 3OHUA 2IONA 1HZ4A 3SZ7A 4HS2A 2XPZA 5A7DB 3ASGA 3ML8A 2E0IA 3QKYA 1DNPA 2VSOE 3FHEA 4HXIA 2AW6A 4F53A 2VGXB 3PH0C 4RVBA 4I6JC 1NP7A 3M52A 1HV2A 3FH8A 2WXNA 5LOZA 1N54A 3FUKA 4J0UA 2NXPA 3S7BA 3QB2A 4G26A 3VLFA 4QFVA 2GGFA 3G2WA 3FUDA 4UIJA 3FY4A 3I3NA 2RD0A 3Q15A 4AIFA 1JWGA 1U3DA 5JHAA 1CS3A 5T3RA 1E8XA 5HI7A 4E85A 3ZGQA 2IZVC 3QWWA 3UUXA 3VLEA 1EF1C 3HIZA 3ZYMA 1EXBE 3OGMA 2FI7A 4B8CB 2OOEA 3PE4A 4EZJA 3O48A 1H2VC 3PDNA 3CSTA 4O6FA 4U77A 5JJ6A 5A6CA 5FTAA 5ANRA 1JPLA 1NEXA 2YHCA 4AEZC 3PVLA 3CHOA 2IFUA 3ULQA 1UN9A 5FZQA 3O4ZA 4XZ4A 1SQMA 5JHBA 2I9CA 1NN7A 1E7UA 3C98A 3DRYA 3RK6A 3RO3A 4W9GB 4L7TA 1Z3YA 4UI9K 2WB2A 4YNDA 5J90A 4I6JA 1ELRA 4K0RA 1E96B 4BKSB 2XGSA 3B13A 3CHQA 1Y8MA 3QK0A 2AXUA 3VTXA 4E6HA 3FH5A 5BPPA 2JEKA 2IHCA 3DRZA 1HO8A 4UWGA 3PEUB 4WAFA 4L2LA 4XI0A 4W9HB 2A4ZA 4FULA 3MCXA 2ILRA 5G55A 3S7FA 3FUNA 3ONLA 4C9BB 1UJJA 2HM8A 3L08A 4B0ZA 1R2BA 3ZYLA 4TRQA 4HOTA 3HHMA 4I6GA 2WMOA 4N2SA 4PS3A 4ZOUA 5HQ8A 3B7SA 3PREA 2WVIA 4KT6B 3AS8A 2KZTB 3AU5A 1NA0A 3MV2B 3CSFA 3SF4A 3RO2A 3ZW3A 3C6OA 5BXHA 2IJGX 4HOQA 4KYOB 1FS1B 4AM9A 2R9RB 2NZ0B 4GZDA 2MA9C 2WXHA 3FU3A 1GW6A 1ZBPA 2IF4A 2J49A 4ILGA 2WXKA 3C6PA 4AY5A 4DK5A 4J6IA 4WUYA 1HU3A 3UMVA 1HX8A 1TJFA 4N3BA 3AS5A 5KJLA 2CG2A 4N5CA 5J08A 2V8SE 3FEXA 4CT0A 4I6EA 4TUUA 2Q81A 4JZYA 3D9JA 5KCMA 5EDSA 3ZTDB 1ELWA 3HDXA 2J9QA 2KCLA 4ANXA 5JJTA 3Q5MA 2LSUA 4G2VA 2J07A 4LRZA 4TV3A 2M63A 3FTYA 4GYOA 5M72A 3LEWA 4FA6A 3HQIA 3CK8A 3MV3B 2X6KA 4HOSA 4GCOA 4MLPA 3B7UX 2I1KA 4JL0A 4U04A 1FS2B 2C9WC 3CVUA 4UQXA 4DLQA 5FJYA 3FTZA 4CDRA 4B95B 3AU4A 3L22A 2WQ7A 3TG5A 1IQUA 1OWNA 4W9KB 4G1TA 4WWOA 3JUIA 5H7HA 3ZYQA 3CR3A 4W9RA 1BPOA 4LUNU 4U0ZA 4J8ZA 3FU0A 3CIAA 3AS4A 2E31B 4BT9A 4GZ6A 4NQ0A 2HO1A 2VSXE 5BV1A 4AJYC 5LFAA 1OUVA 4NURA 2AWIA 1A68A 4G24A 4MKTA 3LDZA 5CCMA 2BF0X 2C0LA 4KVMA 1PY1A 1WY6A 4U07A 3EIQC 2IQCA 2LSVA 3NQPA 4KVOA 4UWKA 2P1QA 4KZ0A 4KZCA 4BX8A 1KT1A 2AVPA 3S7JA 2BUGA 3IEGA 4G25A 2L0IA 2YINA 3GZSA 3HVEA 1EOEA 4CDMA 2VKPA 4ACKA 4U8HA 3N71A 4JTAB 1DVPA 4JA7A 2FNJC 5A23A 4KBQA 2Y4TA 3G2VA 4H7XA 4L23A 4I43A 4U2MA 4FC8A 3CEQA 1TEZA 3ASDA 1UN8A 2XEVA 4K03A 3L54A 3U64A 3FDHA 3MKRA 3QARA 3KVTA 3ESLA 2CFZA 3MEKA 5EUPA 2NN2A 3LKUA 3LXUX 3QWPA 4NACA 2WM9A 2X6JA 5ENNA 1XGWA 5HYWB 3OGLA 2VYIA 2XGOA 1H2UA 5BT1A 2UY1B 3FTXA 5E75A 4JPSA 2YNQA 2HR2A 3EHNA 4FU3A 2WXOA 3D9PA 5FZSA 4J8FA 4U0UA 3M5BA 1LF8A 4J8DA 3FKCA 3BG1B 2OVBA 1OWLA 3D9NA 2X38A 3BG0B 2X6HA 4IN3B 3JQ0A 2OV8A 4AOFA 3MKQB 1HG2A 5FTPA 4DPRA 3FU5A 2FEZA 2WXFA 2XRZA 3CVQA 5ARGA 2DBAA 3IV0A 5DIZA 4DLOA 5HZGC 3RJVA 1LQBB 1WAO1 3WXXA 2FF4A 5KJNA 2VQ2A 2LNIA 4ABNA 1B89A 3PZDA 4C0EA 4CEMA 4DI3A 2OVQA 2FO7A 4PUCA 4AVXA 3FUHA 3M4TA 1HXIA 3PUKA 3IKOB 3MKQA 4ME2A 4APFA 1P5QA 3IHVA 5KJMA 3V7DA 3NZSA 3MA5A 2V0PA 2Z8HA 3EIJA 2BTDA 2XPIA 4JXTA 4WNEA 1UG3A 5C2YA 4F3VA 1MQSA 1EYHA 5KJKA 4JGHC 1H0AA 2RG8A 3QOUA 2WXPA 2WQHA 2HYZA 3SHFA 3U3WA 4HORA 3FU6A 4CT4A 4ANWA 5BV0A 2YQ8A 3TG4A 2GW1A 2XPYA 5G05J 5LCWC 2J4DA 3APDA 3CQCB 4JVSA 3S2AA 4ACLA 3S7DA 4Q69A 4P29A 3OAWA 4F1SA 1E8WA 4CCAA 3GZ2A 2P1NA 5AYWD 2FULA 2V5FA 3G2SA 4CGVA 4B8AA 2IU1A 5CHEE 2CHWA 3R9AB 4MRUA 3GYZA 3QWVA 3ZN3A 4B9KE 1LM8C 2VGYA 3EJNA 3MX3A 3ASHA 2WXGA 3ESKA 4B89A 2Q7FA 5G04J 1EPUA 3G2UA 3PUJA 1OWOA 4XX5A 3TXNA 3R7RA 2GRMA 4CDNA 3DRXA 3ZNGB 3L17A 3FUEA 2CHXA 5AJLA 1S1GA 2AXZA 3IHYA 3ZKJB 2CHZA 3EDTB 3KAEA 4A1GA 1FVHA 3D9MA 4I1OB 4Y6WA 4EZKA 3KD7A 4W9DB 3CVPA 3ENEA 3RRNB 3RRUA 3CKCA 1QDWA 3CV0A 4L1BA 1S0PA 3FUJA 3CHMA 3ASFA 2CFUA 3P1UA 4JA9A 4XKCA 4JHRA 4JHKA 3FWVA 4PDXA 3B84A 4I9CA 3CVLA 3ZIMA 4GYYA 3UT8A 4JTDB 5AJDA 3E4BA 4GYWA 3URZA 3CLJA 3HU6A 4PS8A 3GA1A 3L16A 4XKBA 4LEUA 2LAIA 3U4TA 5IBKA 4GCNA 3OXGA 2C2LA 4GMLA 3VTYA 4UYIA 4WNDA 2P1MA 5EX0A 4BSXA 1Y6IA 1HG5A 1Z6TA 2DCPA 3QNKA 1JWFA 5E76A 4AP2A 4C0MA 3MKSA 4EECA 3FTVA 3LY7A 5CMYA 3FUIA 3RIBA 4JTCB 4EBAG 4UI9J 3ZHEB 2QY7A 4U0SA 4UI9C 3LBZA 5G2NA 1YA0A 3E4UA 4N39A 3SBTB 2ASTA 1EOFA 2J09A 4B94A 3JCKC 3HTMA 4JHJA 5C1DA 1QDVA 3CGHA 2EQXA 4A1SA 2E2EA 2JLBA 1H2TC 1PC2A 5CCLA 2WXQA 4G11A 1HE8A 3QAQA 3D9LA 3CVXA 4CP3A 1QZ2A 3IBEA 5FWQA 4UWLA 3WSOB 3LUTB 5H7GA 2JZ3C 1FQVB 5A6RA 2J4BA 4OVUA 4APOA 4JEUA 2KZTA 4L2YA 4UQYA 2X6FA 1KLXA 4GB9A 3D9IA 2XRYA 3LYAA 2XHEA 3MJWA 4M3OA 3RRMB 3ZPJA 3L2OA 2L0TB 3TGOA 2PL2A 3ZHEA 1IHGA 2XCBA 5BW8C 4YY8A 2KATA 2WXRA 1EDUA 5DADA 3FUMA 3Q47B 3PRZA 2YHEA 3KS2A 4IULA 1R28A 1JUQA 2VSYA 2KM4A 1FVFA 4BWRA 2Y3AA 4AWJB 2VSNA 2WQ6A 4J8SA 2WMNA 5G04C 5CMWA 5BO4C 4LERA 5JH5B 4EZLA 5BNWA 4GMJA 5AENA 3FFLA 4EBAA 3DPDA 3APCA 3SNXA 5BXDA 5ARFA 1VDYA 4XIFA 4W9LB 4KXKB 2MHKA 2OVPA 4B9KB 2C0MA 3I4GA 3L6AA 5T4YA 4PS7A 1EODA 3ZRCB 3D9OA 2XCCA 2CG3A 4GA2A 3TAXA 2NC9A 3LNMB 4FJYA 4CXTA 4HVBA 4J8EA 2WPVA 2J08A 2L6JA 3OXFA 4UQZA 1HFAA 5G05C 3SFZA 3ZVVA 4EPZA 5LCWJ 3D3MA 4V3IA 4GZ3A 5LP0A 1H19A 3LY9A 3Q4AB 2KC7A 1FCHA 2FBNA 5DBKA 3PEVB 3EHMA 3FTUA 4WNFA 4PH4B 1LDKD 3ZFWA 3U66A 4BKTB 3UPVA 5BXBA 1P22B 3BIMA 3KEZA 1HF8A 3SD5A 5EKQD 2XGMA 3CHPA 4W9CB 4JEHA 4HLEA 3OGKA 4AXHA 4GA1A 3LS8A 4N3AA 4BX9A 1VCBB 3DBSA 4I1MA 3QC1A 3MGBA 4BT8A 3LCAA 3MZLB 4UWFA 4I1AA 4FP7A 2A5UA 2LAHA 2V4LA 4EOZA 1Z3XA 3PS6A 4I2ZA 4AV7A 4CRWA 5FQ8A 4FLBA 4U2NA 2PQRA 5BUZA 3CVWA 4DI4A 2GRLA 4WWNA 4AJWA 2I2OA 2NSZA 1TJCA 2AXVA 3I5PA 1HS6A 3UX4A 2VTBB 4ZGCA 4CRHA 1L5JA 2I1JA 3SI5A 3C6NA 1U3CA 4I9EA 5FQ4A 4UWHA 5FZRA 1IYGA 2ONDA 3T5XA 3UT7A 3BEEA 3CHSA 4CXJA 2UY1A 2PM6A 4GZCA 2A79B 1WM5A 4KMOA 2WXJA 3GW4A 4FJZA 2VTBA 4BGCA 1QNFA 4N9F5 1KT0A 1SZ9A 4WNGA 3TJPA 2IF5A 2P1OA 1UJKA 4GA0A 3U9WA 1R29A 1W3BA 3P2BA 4CXIA 4ANUA 4XE0A 2YY9A 3ZRHA 3CHRA 5ANLA 4F7AA 3OXLA 4R7LA 5FQ7A 5AIJA 3CK9A 4U63A 2WXMA 2I2RA 1T1DA 4W9HH 2IOSA 2WXLA 1E90A 1E7VA 1OWPA 1OWMA 2X3MA 5T8IA 2X6IA 4OVVA 2P1PA 3JYSA 3NF1A 3SBSA 4YVOA 3TL5A 3CVVA 1X5BA 3FH7A 3DCGB 3VLDA 5FQ6A 4MS6A 1INZA 3FTSA 3ML9A 4XI9A 3RKVA 3HYMB 2OVFA 3NZUA 5LLIB 2R5SA 2R17C 3UQ3A 2UWJG 4HOUA 2P58C 4Q96A 4A55A 3LVQE 4WWPA 2ASSA 2PPIA 3M8VA 3B7RL 2KCKA 4A3TA 4D10C 5JJ7A 3OTNA 4FADA 3T8MA 4WQOC 2MRIA 1IQRA 3R7QA 3ZXSA 2PM7A 4ANVA 3MYVA 4W9FB 4ATGA 1NZNA 3D9KA 4DJAA 3CKBA 4G23A 4RG6A 1E8ZA 1DSXA 2E32B 2LO6A 3HVEB 5D0QD 1BUOA 2L9BA 3PNTB 4GZ5A 3CK7A 3LJ3A 5FT9A 4YVQC 5DAFA 2R59A 4ILIA 3SGHA 4H7YA 4Y6CA 4IYPA 5LX8A 3APFA 3GZ1A 4N2QA 4ILHB 3FULA 3ONKA 4BTAA 2QFCA 3B7TA 1MHQA 2Y4UA 4BY6A 3CVYA 1H6KA 2IOLA 4GPKA 3OHVA 3K9IA 4W9JB 3QJZA 1PAQA 3PNLB 5A15A 4BTBA 1NA3A 2PZIA 5D0OD 1E8YA 4FHJA 3FUFA 3FEYA 3LPZA 3CVNA 4W9EB 4W9IB 3ZRFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXD A;  4W9L B;  2OVP A;  4B9K B;  1EOD A;  3ZRC B;  3LNM B;  2Q81 A;  3ZUN B;  3ZTD B;  4CXT A;  2P1N A;  3ZTC B;  3HQI A;  4B9K E;  1LM8 C;  1LDK D;  2OVR A;  1FS2 B;  2C9W C;  4BKT B;  2VPK A;  1P22 B;  3BIM A;  5BXB A;  4B95 B;  4W9C B;  3OGK A;  4W9K B;  3ZNG B;  4WQO C;  1VCB B;  1S1G A;  3ZKJ B;  5H7H A;  3OHU A;  4W9D B;  4HS2 A;  4J8Z A;  4EOZ A;  4HXI A;  2E31 B;  4U2N A;  1QDW A;  4AJY C;  4I6J C;  3M52 A;  1HV2 A;  1A68 A;  4CRH A;  3C6N A;  3B84 A;  4UIJ A;  4JTD B;  3I3N A;  2P1Q A;  3HU6 A;  4CXJ A;  3GA1 A;  2A79 B;  1CS3 A;  4BGC A;  5IBK A;  4N9F 5;  2IZV C;  2P1M A;  2IF5 A;  2P1O A;  4UYI A;  1R29 A;  4CXI A;  2YY9 A;  3HVE A;  1EOE A;  4AP2 A;  1EXB E;  2VKP A;  3OGM A;  5BO4 C;  3MKS A;  4JTC B;  2I2R A;  4JTA B;  1T1D A;  4W9H H;  2FNJ C;  2P1P A;  4U2M A;  3LBZ A;  4U77 A;  5FTA A;  3DCG B;  1NEX A;  3E4U A;  2AST A;  1EOF A;  5LLI B;  3HTM A;  3KVT A;  1QDV A;  1NN7 A;  2EQX A;  5EUP A;  2NN2 A;  4W9G B;  2ASS A;  5HYW B;  2PPI A;  3M8V A;  3OGL A;  4BKS B;  4CP3 A;  2IHC A;  4W9F B;  3DRZ A;  3WSO B;  3LUT B;  5H7G A;  2JZ3 C;  1FQV B;  3M5B A;  4W9H B;  5A6R A;  2E32 B;  1DSX A;  3FKC A;  3HVE B;  1BUO A;  3L2O A;  1R2B A;  5DAF A;  5HZG C;  1LQB B;  4ZOU A;  5DAD A;  1R28 A;  2OVQ A;  4W9J B;  3OHV A;  3C6O A;  3M4T A;  5BXH A;  4APF A;  1FS1 B;  2R9R B;  4AWJ B;  2NZ0 B;  5A15 A;  3V7D A;  2MA9 C;  2Z8H A;  5JH5 B;  4JGH C;  3C6P A;  4W9E B;  4W9I B;  3ZRF B; 
#chains in the Genus database with same CATH topology
 2ETB A;  2P9S G;  4A3V A;  1HH8 A;  4CGW A;  3TXM A;  4I17 A;  4NRH B;  3FTW A;  2QZA A;  3FP3 A;  3UI2 A;  2OVR A;  3UIN C;  4AY6 A;  4I2W A;  4RG9 A;  4Z68 A;  4A63 B;  3E32 A;  3UT4 A;  2DIW A;  3RU0 A;  4WQO C;  3T5V A;  3I4R B;  3OHU A;  5A7D B;  2VSO E;  2AW6 A;  2GRQ B;  4I6J C;  2WXN A;  4GTM A;  3G2W A;  4UIJ A;  3I3N A;  2RD0 A;  2GRO B;  1DCE A;  2IZV C;  1EXB E;  2OOE A;  1BLX B;  4F6R D;  3PDN A;  3CST A;  4O6F A;  3CHO A;  2Y1L E;  2GRR B;  2QC9 A;  1TNZ A;  3RO3 A;  1Z3Y A;  2XS1 A;  1ELR A;  3DEO A;  4K0R A;  1E96 B;  2XGS A;  3CHQ A;  3SO8 A;  3QK0 A;  2AXU A;  1TNU A;  2JEK A;  4DX7 D;  4WAF A;  3V79 K;  4FUL A;  3S7F A;  2RFM A;  3L08 A;  1R2B A;  3ZYL A;  4I6G A;  2WMO A;  4N2S A;  3PRE A;  4KT6 B;  2KZT B;  3W9F A;  4HBD A;  3MV2 B;  3HXB A;  2MA9 C;  2WXH A;  2WXK A;  1TJF A;  4N3B A;  3ABK E;  5KJL A;  1K3Z D;  4BET A;  4TUU A;  3UKU G;  4DX6 D;  1ELW A;  3UKR G;  4NIK A;  5JJT A;  2LSU A;  5M72 A;  1WG0 A;  2M63 A;  5AAO A;  3BU8 A;  4HOS A;  4GCO A;  4MLP A;  4U04 A;  4W9K B;  3RAU A;  5H7H A;  2DZN A;  3CR3 A;  2E31 B;  1OUV A;  2R03 A;  5CEC B;  2C0L A;  3EIQ C;  2IQC A;  2LSV A;  4BES A;  2P1Q A;  4KZ0 A;  4KZC A;  5AAR A;  2BUG A;  5D2M C;  1Z5S C;  3GZS A;  3HVE A;  1OCC E;  4U8H A;  2FNJ C;  5JA4 D;  2Y4T A;  3G2V A;  4U2M A;  3PZ3 A;  4I43 A;  3ASD A;  1MX4 A;  5ITZ F;  3KVT A;  3ESL A;  2NN2 A;  3QWP A;  4QQI A;  3OGL A;  2VYI A;  1H2U A;  2UY1 B;  3FTX A;  5E75 A;  2YNQ A;  2HR2 A;  3EHN A;  3D9P A;  2MYO A;  1KZP A;  4UUC A;  1OWL A;  3D9N A;  3BG0 B;  2BKK B;  3JQ0 A;  3FU5 A;  2FEZ A;  5DIZ A;  5HZG C;  2LXL A;  3RJV A;  1LQB B;  5KJN A;  1B89 A;  2R2L A;  4YDE A;  3MKQ A;  4ME2 A;  3NZS A;  2BTD A;  4WNE A;  5C2Y A;  4JGH C;  1EYH A;  2RG8 A;  3QOU A;  3NOC D;  4CT4 A;  4ANW A;  2YQ8 A;  4Q69 A;  5LFA A;  3S7D A;  3OAW A;  5AYW D;  1N4P A;  3G2S A;  4B8A A;  2IU1 A;  5CHE E;  3R9A B;  4MRU A;  1LM8 C;  3ZNG A;  3ASH A;  3ESK A;  5G04 J;  4XX5 A;  1OY3 D;  2AXZ A;  3AAA C;  1FVH A;  4Y6W A;  2XEE A;  3CKC A;  3ASF A;  5B1A E;  3P1U A;  4XKC A;  4JHR A;  4JHK A;  3FWV A;  3UT8 A;  5AJD A;  1NI1 A;  3E4B A;  3CLJ A;  3GA1 A;  4XKB A;  2ETA A;  4LEU A;  2LAI A;  5IBK A;  2C2L A;  4UYI A;  2P1M A;  4BSX A;  2AJA A;  3QNK A;  4N5Q A;  4U8V D;  3AG1 E;  3HXF A;  3LBZ A;  1YA0 A;  3E34 A;  1PC2 A;  2WXQ A;  2R05 A;  3WSO B;  4HNA D;  3C5R A;  3D9I A;  3MJW A;  1WDY A;  1H6O A;  2WXR A;  1EDU A;  3FUM A;  1DCQ A;  1FT2 A;  1SA4 A;  1FVF A;  2Y3A A;  4BER A;  4AWJ B;  2WMN A;  4LER A;  5JH5 B;  5AQ9 A;  3DPD A;  1D8E A;  3APC A;  4XIF A;  4U95 D;  4B9K B;  5T4Y A;  4PS7 A;  3D9O A;  3TAX A;  3LNM B;  4GA2 A;  4HVB A;  3ZVV A;  5G05 C;  3SFZ A;  3LY9 A;  2KC7 A;  1LDK D;  3FTU A;  4PH4 B;  4HI8 A;  4BKT B;  3V2X A;  4JB8 P;  4JEH A;  3OGK A;  1OCR E;  4N3A A;  3LS8 A;  3DSX A;  3MGB A;  4HB5 A;  4BT8 A;  3LCA A;  4I1A A;  2A5U A;  3PZ2 A;  1N9A A;  3PS6 A;  4AJW A;  3I5P A;  1HS6 A;  2P9P G;  2OND A;  1N0R A;  4BGC A;  4FJZ A;  1QNF A;  1KT0 A;  3TWX A;  3DSS A;  1UJK A;  4GA0 A;  3U9W A;  4CXI A;  4ANU A;  5EIL A;  4OAV B;  4U63 A;  2WXM A;  4W9H H;  1FPP A;  1E7V A;  2X6I A;  4YVO A;  1X5B A;  3FH7 A;  4XI9 A;  3RKV A;  5LLI B;  2R5S A;  3W9G A;  5AQB A;  4A55 A;  4WWP A;  1BU9 A;  2ASS A;  2PPI A;  3DXM G;  5JJ7 A;  3OTN A;  3ZXS A;  3CKB A;  1E8Z A;  3HVE B;  3PNT B;  4GZ5 A;  5DAF A;  2R59 A;  4ILI A;  4Y6C A;  3GZ1 A;  3ONK A;  5EYL A;  1S63 A;  1E8Y A;  1OCO E;  3LPZ A;  5ENP D;  1ZU2 A;  4RSY A;  3ZYK A;  4DX1 A;  4HRM B;  3ZUN B;  4N3C A;  3CQG B;  3ZTC B;  4OYS A;  4U7E B;  3PE3 A;  1A17 A;  4JW1 A;  1K1B A;  1UW4 B;  2VJ8 A;  4URK A;  3LVR E;  2VPK A;  1XNF A;  1K1A A;  4HFG A;  3L13 A;  3ZEF A;  1SZA A;  1FT1 A;  4G8L A;  5EX3 A;  4GU5 A;  2ION A;  1HZ4 A;  2XPZ A;  3ASG A;  3ASO E;  3FHE A;  2VGX B;  1N54 A;  4J0U A;  2NXP A;  2GGF A;  3TWS A;  5H7P A;  3DPY A;  1E8X A;  3ZGQ A;  3QWW A;  1EF1 C;  3ZYM A;  3KSL A;  5FIN A;  2FI7 A;  1H2V C;  5ANR A;  3Q9U C;  2XZD G;  4XZ4 A;  5JHB A;  2I9C A;  4L9P A;  5AN8 A;  3DRY A;  4UI9 K;  4I6J A;  3VTX A;  4E6H A;  3FH5 A;  1HO8 A;  5G55 A;  3FUN A;  3ONL A;  2HM8 A;  4B0Z A;  4HOT A;  3HHM A;  3TWR A;  1O1T A;  5HQ8 A;  1NA0 A;  3CSF A;  2IO3 C;  5BXH A;  4KYO B;  1FS1 B;  1SVX A;  3RSE G;  1GW6 A;  4ILG A;  4AY5 A;  1TR4 A;  1HX8 A;  1Q2Z A;  3ZXP A;  5J08 A;  4C48 B;  2Q81 A;  5KCM A;  5EDS A;  3HDX A;  1AWC B;  4ANX A;  4TV3 A;  1UOH A;  4FA6 A;  3CK8 A;  2X6K A;  4JL0 A;  2H6G A;  2C9W C;  5FJY A;  3FTZ A;  4CDR A;  2ZGD A;  3L22 A;  1OWN A;  2P9U G;  3JUI A;  1BPO A;  4U0Z A;  3FU0 A;  4DUI A;  1IHB A;  4K5B A;  4NQ0 A;  4AJY C;  1TN7 A;  2AWI A;  1A68 A;  5CCM A;  4MKT A;  3LDZ A;  1DC2 A;  1QYM A;  4KVM A;  4UWK A;  1KT1 A;  3S7J A;  5AQ7 A;  4GTQ A;  4G25 A;  2YIN A;  1EOE A;  5ENQ D;  4JTA B;  1DVP A;  4KBQ A;  3EUV A;  4H7X A;  4FC8 A;  1UN8 A;  5EIB E;  2ZIR A;  4GTR A;  3LKU A;  1O5M A;  1XGW A;  5CEA A;  2XGO A;  5ENR D;  3T8K A;  4FU3 A;  4J8F A;  1LF8 A;  3FKC A;  3BG1 B;  1N4R A;  2X38 A;  4IN3 B;  4GTV A;  4AOF A;  3MKQ B;  1S70 B;  4DLO A;  3IV0 A;  2FF4 A;  2LNI A;  4ABN A;  3PZD A;  4CEM A;  2OVQ A;  3M4T A;  3FUH A;  4APF A;  1P5Q A;  5KJM A;  3EIJ A;  4JXT A;  1UG3 A;  4F3V A;  1MQS A;  4U8Y D;  2WXP A;  3U3W A;  3SHF A;  4TXQ A;  4RQI A;  3TG4 A;  5G05 J;  3F6Q A;  3S2A A;  4F1S A;  4P29 A;  3AG4 E;  1E8W A;  4GTP A;  2FUL A;  3ZN3 A;  3EJN A;  4B89 A;  1OWO A;  1JCS A;  3FUE A;  4DX2 A;  2EIL E;  3IHY A;  3EDT B;  3D9M A;  4EZK A;  3CVP A;  3ENE A;  3HG0 D;  3DRA A;  1S0P A;  2CFU A;  4JA9 A;  1TN8 A;  4I9C A;  4GYY A;  4JTD B;  3ABL E;  4GYW A;  4PS8 A;  3L16 A;  3U4T A;  3OXG A;  5EX0 A;  3ZRF B;  3EHQ A;  4AP2 A;  1JWF A;  3MKS A;  3FTV A;  3LY7 A;  5CMY A;  3ASN E;  3E4U A;  4N39 A;  3SBT B;  1EOF A;  4B94 A;  3JCK C;  4XEI G;  2F8Y A;  1H2T C;  2V4H C;  4G8K A;  2XS8 A;  5H7G A;  4HI9 A;  1FQV B;  4JEU A;  2KZT A;  2X6F A;  4GB9 A;  2P9L G;  3ZPJ A;  3RRM B;  2L0T B;  3TGO A;  2PL2 A;  3ZHE A;  4YY8 A;  3KS2 A;  1JUQ A;  2F8X K;  3UM3 A;  4TXP A;  2WQ6 A;  5G04 C;  4GMJ A;  1BI7 B;  3SNX A;  5ARF A;  4W9L B;  2C0M A;  1EOD A;  3ZRC B;  2NC9 A;  4CXT A;  2WPV A;  2J08 A;  4UQZ A;  4EPZ A;  3D3M A;  4V3I A;  2DZO A;  1FCH A;  3PEV B;  1YCS B;  2EIN E;  2BED A;  3UPV A;  5KNH D;  1BI8 B;  1P22 B;  1HF8 A;  3CHP A;  4HLE A;  3DBS A;  4I1M A;  1V54 E;  3MZL B;  4BEP A;  4AV7 A;  4I2Z A;  4FLB A;  2P2C P;  4O1P A;  3UM0 A;  2L6B A;  4WWN A;  3UX4 A;  4CRH A;  2I1J A;  3UT7 A;  3BEE A;  1WM5 A;  2WXJ A;  2VTB A;  3TJP A;  2P1O A;  3UM2 A;  3P2B A;  4F7A A;  3OXL A;  5FQ7 A;  3CK9 A;  2IOS A;  4OVV A;  3TL5 A;  4GTS A;  3CVV A;  3UQ3 A;  2UWJ G;  4YDW A;  3B7R L;  4A3T A;  4FAD A;  3T8M A;  2MRI A;  1IQR A;  3R7Q A;  4W9F B;  4ATG A;  4G23 A;  2LO6 A;  4K5C A;  5EN5 D;  1BUO A;  2XEH A;  4YVQ C;  4IYP A;  3FUL A;  3OHV A;  3UTM A;  3PNL B;  5A15 A;  4BTB A;  1NA3 A;  3Q9N C;  3FEY A;  3B95 A;  5HKP A;  3DST A;  2V5Q C;  3JQ1 A;  2ZU6 B;  4BFR A;  1ELK A;  3BUA A;  4JC8 A;  5CRV A;  3Q49 B;  4GPM A;  4X8Q A;  3G2T A;  2B0O E;  4IRU A;  4FLH A;  3ULY A;  2VGX A;  3DXK G;  4HS2 A;  3ML8 A;  2E0I A;  4F53 A;  4RVB A;  3M52 A;  3FH8 A;  3S7B A;  3QB2 A;  3VLF A;  3FUD A;  3Q15 A;  5JHA A;  1CS3 A;  5T3R A;  4E85 A;  3D9H A;  3UUX A;  3VLE A;  4OAU C;  4B8C B;  3PE4 A;  4EZJ A;  3O48 A;  1JCQ A;  4U77 A;  5JJ6 A;  2YHC A;  4AEZ C;  3PVL A;  5FZQ A;  5BXU A;  1E7U A;  3C98 A;  4W9G B;  4BKS B;  1Y8M A;  2IHC A;  3DRZ A;  3TWT A;  4UWG A;  2EIK E;  2A4Z A;  2GRN B;  2ILR A;  3SFX A;  3L82 A;  4ZOU A;  2WVI A;  3AS8 A;  1TN6 A;  3SF4 A;  2IJG X;  4HOQ A;  3TWV A;  4GTO A;  4AM9 A;  2R9R B;  3FU3 A;  3JXI A;  1ZBP A;  4K5A B;  4DK5 A;  4J6I A;  4WUY A;  1HU3 A;  3UMV A;  2CG2 A;  2NYJ A;  4I6E A;  3D9J A;  4DRX E;  1MJ0 A;  2J9Q A;  4LG6 A;  3Q5M A;  4G2V A;  3JXJ A;  4LRZ A;  3BQO A;  4GYO A;  3LEW A;  3HXC A;  3B7U X;  4UQX A;  4B95 B;  3AU4 A;  1IQU A;  4G1T A;  3ZYQ A;  2LUH A;  4J8Z A;  3CIA A;  4BT9 A;  4GZ6 A;  1RZ4 A;  2VSX E;  4NUR A;  4HRN A;  1WY6 A;  3NQP A;  4KVO A;  1NFI E;  3IEG A;  2L0I A;  2IY0 C;  4CDM A;  2VKP A;  3N71 A;  1O1R A;  1X81 A;  2EIJ E;  4L23 A;  4HRL A;  3CEQ A;  4K03 A;  4LNB A;  3U64 A;  3MKR A;  3ZUV B;  3QAR A;  3MEK A;  3LXU X;  4NAC A;  5ENN A;  2X6J A;  3L9T A;  4JPS A;  3B7B A;  4LNU D;  5FZS A;  3M5B A;  4J8D A;  4DPR A;  2XRZ A;  2WXF A;  3CVQ A;  5ARG A;  2DBA A;  3WXX A;  4C0E A;  4DI3 A;  4PUC A;  1HXI A;  3IHV A;  2V0P A;  2Z8H A;  3J5Q B;  2HYZ A;  4HOR A;  5BV0 A;  2GW1 A;  5BXO A;  3HXD A;  5LCW C;  3UIP C;  2J4D A;  3APD A;  3EU9 A;  4JVS A;  4CCA A;  3GZ2 A;  2P9I G;  2RKK A;  5AQA A;  1TNY A;  3GYZ A;  3QWV A;  2VGY A;  3MX3 A;  2WXG A;  2Q7F A;  3C3O A;  3DWL G;  1TYQ G;  5EID A;  3L17 A;  1S1G A;  3ZKJ B;  3KAE A;  4A1G A;  3UM1 A;  2J8S D;  3CV0 A;  1MX2 A;  3CHM A;  3NAW A;  4GMR A;  3B84 A;  3HXE A;  3HU6 A;  4GML A;  1RW2 A;  3AG3 E;  4WND A;  5ENO D;  1Y6I A;  1HG5 A;  1Z6T A;  2DCP A;  5E76 A;  5BO4 C;  4JTC B;  3AJI A;  3FUI A;  3UIO C;  4EBA G;  4UI9 J;  4U0S A;  3IXE A;  5CRU A;  2Y69 E;  1LD7 A;  3NBN B;  2AST A;  2J09 A;  3HTM A;  2JAB A;  5C1D A;  3CGH A;  2EQX A;  5HS0 A;  2E2E A;  2JLB A;  3QAQ A;  3CVX A;  4CP3 A;  1D8D A;  2RFA A;  3IBE A;  5FWQ A;  4UWL A;  2H6H A;  3LUT B;  2OCC E;  5A6R A;  4CYM D;  4OVU A;  5B1B E;  4L2Y A;  1KLX A;  3L2O A;  2XRY A;  2XHE A;  1JCR A;  2XCB A;  5BW8 C;  5DAD A;  3Q47 B;  3Q7F A;  4IUL A;  2VGE A;  1R28 A;  5ENT D;  4J8S A;  3ISM C;  5BNW A;  5AEN A;  3E33 A;  4YDY A;  2OVP A;  1QBQ A;  3I4G A;  3L6A A;  4ATZ D;  2XCC A;  4FJY A;  2QYJ A;  4J8E A;  1IKN D;  1HFA A;  5LP0 A;  1H19 A;  5DBK A;  1N94 A;  3EHM A;  1LD8 A;  3U66 A;  5BXB A;  3BIM A;  3KEZ A;  3SD5 A;  3ABM E;  4AXH A;  4BX9 A;  1VCB B;  5KBA A;  3QC1 A;  4UWF A;  2V4L A;  1Z3X A;  2LXM A;  4CRW A;  5FQ8 A;  4U2N A;  2PQR A;  2XZT G;  5BUZ A;  3CVW A;  4ZGC A;  2VTB B;  1TJC A;  2AXV A;  3C6N A;  4I9E A;  4GTT A;  1IYG A;  2PM6 A;  4GZC A;  1BD8 A;  2A79 B;  4KMO A;  3GW4 A;  4N9F 5;  1SZ9 A;  2IF5 A;  2XEN A;  1W3B A;  4XE0 A;  2YY9 A;  4R7L A;  1H6P A;  1T1D A;  2WXL A;  1E90 A;  1OWP A;  5T8I A;  5CBO A;  3SBS A;  3DCG B;  5FQ6 A;  1INZ A;  3FTS A;  2OVF A;  2R17 C;  4HOU A;  3LVQ E;  4D10 C;  2DVW A;  2PM7 A;  3DSV A;  1DSX A;  5D0Q D;  2IO2 C;  3LJ3 A;  2P9K G;  3Q7A A;  1ZB1 A;  3SGH A;  4H7Y A;  2HE0 A;  1N11 A;  4N2Q A;  4BTA A;  2QFC A;  3B7T A;  5IY5 E;  2Y4U A;  1H6K A;  2IOL A;  3QJZ A;  1PAQ A;  1MZC A;  1NL4 A;  1TNO A;  2KBX A;  2Y0B G;  5B3S E;  4W9E B;  4W9I B;  4Q94 A;  4GAA A;  2XQ0 A;  3QDN A;  3E30 A;  2WXI A;  3JUE A;  1N52 A;  3C3Q A;  2MOW A;  2I6H A;  4LCT A;  2PQN A;  1MYO A;  1YYH A;  1O1S A;  3TWQ A;  2KCV A;  4EQF A;  4FHK A;  1QQE A;  3LY8 A;  3SZ7 A;  3QKY A;  1DNP A;  4HXI A;  3R9M A;  1KZO A;  3PH0 C;  4J7W A;  1NP7 A;  4RLY A;  1HV2 A;  5LOZ A;  3FUK A;  4G26 A;  4QFV A;  3FY4 A;  4EHM A;  4AIF A;  1JWG A;  1U3D A;  5HI7 A;  4MBG A;  3SFY A;  3HIZ A;  1AP7 A;  1SW6 A;  3OGM A;  5FTA A;  5A6C A;  1JPL A;  1NEX A;  3ULQ A;  2IFU A;  1UN9 A;  3O4Z A;  2GRP B;  1SQM A;  1NN7 A;  3SQV A;  3RK6 A;  4L7T A;  2WB2 A;  5JMN D;  4YND A;  5J90 A;  3V31 A;  3B13 A;  1YMP A;  5CER B;  5BPP A;  3PEU B;  4W9H B;  4L2L A;  4XI0 A;  3NOG D;  3MCX A;  4C9B B;  1UJJ A;  4TRQ A;  4PS3 A;  5KWD A;  3B7S A;  3AU5 A;  3RO2 A;  3ZW3 A;  3C6O A;  3J5P A;  2NZ0 B;  4GZD A;  1SA5 A;  3NB2 A;  2J49 A;  3DEP A;  2IF4 A;  3C6P A;  2ETC A;  4J8Y A;  3AS5 A;  4N5C A;  2V8S E;  3DSW A;  3FEX A;  4O1O A;  4CT0 A;  4JZY A;  4ZFH A;  4LNG A;  3ZTD B;  2KCL A;  2J07 A;  3FTY A;  2DYS E;  5D66 A;  3HQI A;  2EIM E;  3MV3 B;  4LSZ E;  2I1K A;  1FS2 B;  3CVU A;  4DLQ A;  1OT8 A;  2WQ7 A;  3TG5 A;  3KSQ A;  4WWO A;  1TNB A;  2H6I A;  3TWU A;  4W9R A;  3ZU7 B;  4LUN U;  1D9S A;  3Q75 A;  4TUM A;  3AS4 A;  2HO1 A;  5BV1 A;  2A5E A;  4G24 A;  2ZGG A;  3AG2 E;  2BF0 X;  1PY1 A;  4U07 A;  4BX8 A;  2AVP A;  4YDO A;  3UXG A;  3TWW A;  3HRA A;  4ACK A;  4JA7 A;  5A23 A;  1S64 A;  1TEZ A;  2XEV A;  3L54 A;  3FDH A;  4HLL A;  2KXP C;  1OXJ A;  2F0Y A;  4M7C A;  2CFZ A;  5EUP A;  5HYW B;  1G3N B;  2WM9 A;  5BT1 A;  5ENS D;  3X2Q E;  2DWZ A;  2WXO A;  4U0U A;  2OVB A;  3Q78 A;  2X6H A;  2OV8 A;  1HG2 A;  5FTP A;  3PZ4 A;  5CED B;  1WAO 1;  2VQ2 A;  2R02 A;  2FO7 A;  4AVX A;  3PUK A;  3IKO B;  5CBN A;  3V7D A;  3MA5 A;  2XPI A;  5KJK A;  1H0A A;  2WQH A;  3FU6 A;  2XPY A;  3CQC B;  4ACL A;  2P1N A;  2V5F A;  4CGV A;  2CHW A;  4B9K E;  5KNG A;  1EPU A;  2ZIS A;  3G2U A;  3PUJ A;  2IEJ A;  3TXN A;  3R7R A;  2GRM A;  3DSU A;  4CDN A;  3DRX A;  3ZNG B;  2CHX A;  5AJL A;  1V55 E;  2CHZ A;  3V30 A;  4W9D B;  4I1O B;  3KD7 A;  3RRN B;  3RRU A;  2P9N G;  1QDW A;  1K8K G;  4L1B A;  3FUJ A;  3ZKJ A;  3Q79 A;  4PDX A;  3CVL A;  3ZIM A;  3URZ A;  3C3R A;  3EU5 A;  4GCN A;  3VTY A;  1N0Q A;  4C0M A;  4EEC A;  3RIB A;  4F1P A;  4U96 D;  3ZHE B;  2QY7 A;  4UI9 C;  5G2N A;  3T9K A;  4JHJ A;  1QDV A;  2BKG A;  4A1S A;  3SY2 A;  5CCL A;  2OEV A;  4G11 A;  1HE8 A;  3D9L A;  1QZ2 A;  2JZ3 C;  2J4B A;  4APO A;  1N4Q A;  4UQY A;  3LYA A;  4M3O A;  5FIO A;  4B93 B;  1KPS B;  1IHG A;  2KAT A;  3ULE G;  3PRZ A;  4TXR A;  2YHE A;  4ZHB A;  2VSY A;  2KM4 A;  4BWR A;  2PNN A;  2VSN A;  5CMW A;  4EZL A;  5HRY A;  3FFL A;  4EBA A;  5BXD A;  1VDY A;  4KXK B;  2MHK A;  3V2O A;  1N4S A;  2CG3 A;  3OXF A;  2L6J A;  5LCW J;  4GZ3 A;  1OCZ E;  3Q4A B;  2FBN A;  4WNF A;  3ZFW A;  5EKQ D;  2XGM A;  4W9C B;  4GA1 A;  4BSZ B;  4DX5 D;  2F37 A;  1LTX A;  4FP7 A;  4EOZ A;  2LAH A;  4CZ2 D;  4DI4 A;  2GRL A;  2I2O A;  2NSZ A;  1IXV A;  1L5J A;  3SI5 A;  1U3C A;  5FQ4 A;  4UWH A;  3E37 A;  5FZR A;  2OEW A;  3WG7 E;  3T5X A;  3CHS A;  4CXJ A;  2H6F A;  2UY1 A;  4WNG A;  5EYP F;  1R29 A;  3ZRH A;  3CHR A;  5ANL A;  5AIJ A;  2I2R A;  1OWM A;  2X3M A;  4O60 A;  3Q73 A;  2P1P A;  3JYS A;  3NF1 A;  2FO1 E;  2DYR E;  3VLD A;  3EHR A;  4MS6 A;  2ZXW E;  3ML9 A;  3HYM B;  3NZU A;  2P58 C;  4Q96 A;  3M8V A;  2KCK A;  3C72 A;  4JD2 G;  4ANV A;  1A5E A;  3MYV A;  4DJA A;  1NZN A;  3D9K A;  4RG6 A;  2E32 B;  3PZ1 A;  3LJN A;  2L9B A;  3CK7 A;  5FT9 A;  1MX6 A;  1N95 A;  5LX8 A;  2QYU A;  3APF A;  2B6C A;  4ILH B;  1MHQ A;  4BY6 A;  3CVY A;  4GPK A;  4W9J B;  3K9I A;  2PZI A;  5D0O D;  4FHJ A;  4HQD A;  3FUF A;  3KEA A;  3CVN A;  1U2V G; 
#chains in the Genus database with same CATH homology
 4Q94 A;  3JQ1 A;  4GAA A;  4A3V A;  1ZU2 A;  2XQ0 A;  2ZU6 B;  1HH8 A;  4RSY A;  4BFR A;  3QDN A;  4CGW A;  3ZYK A;  2WXI A;  3TXM A;  4I17 A;  1ELK A;  4NRH B;  3ZUN B;  1N52 A;  4N3C A;  3CQG B;  4JC8 A;  3ZTC B;  3FTW A;  3Q49 B;  4OYS A;  3PE3 A;  3FP3 A;  1A17 A;  2MOW A;  4JW1 A;  2I6H A;  1UW4 B;  2VJ8 A;  4LCT A;  4URK A;  2OVR A;  3LVR E;  2PQN A;  2VPK A;  4AY6 A;  3G2T A;  1XNF A;  4IRU A;  4FLH A;  4I2W A;  4HFG A;  3L13 A;  4RG9 A;  3ZEF A;  1SZA A;  3UT4 A;  2DIW A;  2KCV A;  4EQF A;  4FHK A;  1QQE A;  2VGX A;  3LY8 A;  5EX3 A;  3RU0 A;  3I4R B;  4GU5 A;  3T5V A;  3OHU A;  2ION A;  1HZ4 A;  3SZ7 A;  4HS2 A;  2XPZ A;  5A7D B;  3ASG A;  3ML8 A;  2E0I A;  3QKY A;  1DNP A;  2VSO E;  3FHE A;  4HXI A;  2AW6 A;  4F53 A;  2VGX B;  3PH0 C;  4RVB A;  4I6J C;  1NP7 A;  3M52 A;  1HV2 A;  3FH8 A;  2WXN A;  5LOZ A;  1N54 A;  3FUK A;  4J0U A;  2NXP A;  3S7B A;  3QB2 A;  4G26 A;  3VLF A;  4QFV A;  2GGF A;  3G2W A;  3FUD A;  4UIJ A;  3FY4 A;  3I3N A;  2RD0 A;  3Q15 A;  4AIF A;  1JWG A;  1U3D A;  5JHA A;  1CS3 A;  5T3R A;  1E8X A;  5HI7 A;  4E85 A;  3ZGQ A;  2IZV C;  3QWW A;  3UUX A;  3VLE A;  1EF1 C;  3HIZ A;  3ZYM A;  1EXB E;  3OGM A;  2FI7 A;  4B8C B;  2OOE A;  3PE4 A;  4EZJ A;  3O48 A;  1H2V C;  3PDN A;  3CST A;  4O6F A;  4U77 A;  5JJ6 A;  5A6C A;  5FTA A;  5ANR A;  1JPL A;  1NEX A;  2YHC A;  4AEZ C;  3PVL A;  3CHO A;  2IFU A;  3ULQ A;  1UN9 A;  5FZQ A;  3O4Z A;  4XZ4 A;  1SQM A;  5JHB A;  2I9C A;  1NN7 A;  1E7U A;  3C98 A;  3DRY A;  3RK6 A;  3RO3 A;  4W9G B;  4L7T A;  1Z3Y A;  4UI9 K;  2WB2 A;  4YND A;  5J90 A;  4I6J A;  1ELR A;  4K0R A;  1E96 B;  4BKS B;  2XGS A;  3B13 A;  3CHQ A;  1Y8M A;  3QK0 A;  2AXU A;  3VTX A;  4E6H A;  3FH5 A;  5BPP A;  2JEK A;  2IHC A;  3DRZ A;  1HO8 A;  4UWG A;  3PEU B;  4WAF A;  4L2L A;  4XI0 A;  4W9H B;  2A4Z A;  4FUL A;  3MCX A;  2ILR A;  5G55 A;  3S7F A;  3FUN A;  3ONL A;  4C9B B;  1UJJ A;  2HM8 A;  3L08 A;  4B0Z A;  1R2B A;  3ZYL A;  4TRQ A;  4HOT A;  3HHM A;  4I6G A;  2WMO A;  4N2S A;  4PS3 A;  4ZOU A;  5HQ8 A;  3B7S A;  3PRE A;  2WVI A;  4KT6 B;  3AS8 A;  2KZT B;  3AU5 A;  1NA0 A;  3MV2 B;  3CSF A;  3SF4 A;  3RO2 A;  3ZW3 A;  3C6O A;  5BXH A;  2IJG X;  4HOQ A;  4KYO B;  1FS1 B;  4AM9 A;  2R9R B;  2NZ0 B;  4GZD A;  2MA9 C;  2WXH A;  3FU3 A;  1GW6 A;  1ZBP A;  2IF4 A;  2J49 A;  4ILG A;  2WXK A;  3C6P A;  4AY5 A;  4DK5 A;  4J6I A;  4WUY A;  1HU3 A;  3UMV A;  1HX8 A;  1TJF A;  4N3B A;  3AS5 A;  5KJL A;  2CG2 A;  4N5C A;  5J08 A;  2V8S E;  3FEX A;  4CT0 A;  4I6E A;  4TUU A;  2Q81 A;  4JZY A;  3D9J A;  5KCM A;  5EDS A;  3ZTD B;  1ELW A;  3HDX A;  2J9Q A;  2KCL A;  4ANX A;  5JJT A;  3Q5M A;  2LSU A;  4G2V A;  2J07 A;  4LRZ A;  4TV3 A;  2M63 A;  3FTY A;  4GYO A;  5M72 A;  3LEW A;  4FA6 A;  3HQI A;  3CK8 A;  3MV3 B;  2X6K A;  4HOS A;  4GCO A;  4MLP A;  3B7U X;  2I1K A;  4JL0 A;  4U04 A;  1FS2 B;  2C9W C;  3CVU A;  4UQX A;  4DLQ A;  5FJY A;  3FTZ A;  4CDR A;  4B95 B;  3AU4 A;  3L22 A;  2WQ7 A;  3TG5 A;  1IQU A;  1OWN A;  4W9K B;  4G1T A;  4WWO A;  3JUI A;  5H7H A;  3ZYQ A;  3CR3 A;  4W9R A;  1BPO A;  4LUN U;  4U0Z A;  4J8Z A;  3FU0 A;  3CIA A;  3AS4 A;  2E31 B;  4BT9 A;  4GZ6 A;  4NQ0 A;  2HO1 A;  2VSX E;  5BV1 A;  4AJY C;  5LFA A;  1OUV A;  4NUR A;  2AWI A;  1A68 A;  4G24 A;  4MKT A;  3LDZ A;  5CCM A;  2BF0 X;  2C0L A;  4KVM A;  1PY1 A;  1WY6 A;  4U07 A;  3EIQ C;  2IQC A;  2LSV A;  3NQP A;  4KVO A;  4UWK A;  2P1Q A;  4KZ0 A;  4KZC A;  4BX8 A;  1KT1 A;  2AVP A;  3S7J A;  2BUG A;  3IEG A;  4G25 A;  2L0I A;  2YIN A;  3GZS A;  3HVE A;  1EOE A;  4CDM A;  2VKP A;  4ACK A;  4U8H A;  3N71 A;  4JTA B;  1DVP A;  4JA7 A;  2FNJ C;  5A23 A;  4KBQ A;  2Y4T A;  3G2V A;  4H7X A;  4L23 A;  4I43 A;  4U2M A;  4FC8 A;  3CEQ A;  1TEZ A;  3ASD A;  1UN8 A;  2XEV A;  4K03 A;  3L54 A;  3U64 A;  3FDH A;  3MKR A;  3QAR A;  3KVT A;  3ESL A;  2CFZ A;  3MEK A;  5EUP A;  2NN2 A;  3LKU A;  3LXU X;  3QWP A;  4NAC A;  2WM9 A;  2X6J A;  5ENN A;  1XGW A;  5HYW B;  3OGL A;  2VYI A;  2XGO A;  1H2U A;  5BT1 A;  2UY1 B;  3FTX A;  5E75 A;  4JPS A;  2YNQ A;  2HR2 A;  3EHN A;  4FU3 A;  2WXO A;  3D9P A;  5FZS A;  4J8F A;  4U0U A;  3M5B A;  1LF8 A;  4J8D A;  3FKC A;  3BG1 B;  2OVB A;  1OWL A;  3D9N A;  2X38 A;  3BG0 B;  2X6H A;  4IN3 B;  3JQ0 A;  2OV8 A;  4AOF A;  3MKQ B;  1HG2 A;  5FTP A;  4DPR A;  3FU5 A;  2FEZ A;  2WXF A;  2XRZ A;  3CVQ A;  5ARG A;  2DBA A;  3IV0 A;  5DIZ A;  4DLO A;  5HZG C;  3RJV A;  1LQB B;  1WAO 1;  3WXX A;  2FF4 A;  5KJN A;  2VQ2 A;  2LNI A;  4ABN A;  1B89 A;  3PZD A;  4C0E A;  4CEM A;  4DI3 A;  2OVQ A;  2FO7 A;  4PUC A;  4AVX A;  3FUH A;  3M4T A;  1HXI A;  3PUK A;  3IKO B;  3MKQ A;  4ME2 A;  4APF A;  1P5Q A;  3IHV A;  5KJM A;  3V7D A;  3NZS A;  3MA5 A;  2V0P A;  2Z8H A;  3EIJ A;  2BTD A;  2XPI A;  4JXT A;  4WNE A;  1UG3 A;  5C2Y A;  4F3V A;  1MQS A;  1EYH A;  5KJK A;  4JGH C;  1H0A A;  2RG8 A;  3QOU A;  2WXP A;  2WQH A;  2HYZ A;  3SHF A;  3U3W A;  4HOR A;  3FU6 A;  4CT4 A;  4ANW A;  5BV0 A;  2YQ8 A;  3TG4 A;  2GW1 A;  2XPY A;  5G05 J;  5LCW C;  2J4D A;  3APD A;  3CQC B;  4JVS A;  3S2A A;  4ACL A;  3S7D A;  4Q69 A;  4P29 A;  3OAW A;  4F1S A;  1E8W A;  4CCA A;  3GZ2 A;  2P1N A;  5AYW D;  2FUL A;  2V5F A;  3G2S A;  4CGV A;  4B8A A;  2IU1 A;  5CHE E;  2CHW A;  3R9A B;  4MRU A;  3GYZ A;  3QWV A;  3ZN3 A;  4B9K E;  1LM8 C;  2VGY A;  3EJN A;  3MX3 A;  3ASH A;  2WXG A;  3ESK A;  4B89 A;  2Q7F A;  5G04 J;  1EPU A;  3G2U A;  3PUJ A;  1OWO A;  4XX5 A;  3TXN A;  3R7R A;  2GRM A;  4CDN A;  3DRX A;  3ZNG B;  3L17 A;  3FUE A;  2CHX A;  5AJL A;  1S1G A;  2AXZ A;  3IHY A;  3ZKJ B;  2CHZ A;  3EDT B;  3KAE A;  4A1G A;  1FVH A;  3D9M A;  4I1O B;  4Y6W A;  4EZK A;  3KD7 A;  4W9D B;  3CVP A;  3ENE A;  3RRN B;  3RRU A;  3CKC A;  1QDW A;  3CV0 A;  4L1B A;  1S0P A;  3FUJ A;  3CHM A;  3ASF A;  2CFU A;  3P1U A;  4JA9 A;  4XKC A;  4JHR A;  4JHK A;  3FWV A;  4PDX A;  3B84 A;  4I9C A;  3CVL A;  3ZIM A;  4GYY A;  3UT8 A;  4JTD B;  5AJD A;  3E4B A;  4GYW A;  3URZ A;  3CLJ A;  3HU6 A;  4PS8 A;  3GA1 A;  3L16 A;  4XKB A;  4LEU A;  2LAI A;  3U4T A;  5IBK A;  4GCN A;  3OXG A;  2C2L A;  4GML A;  3VTY A;  4UYI A;  4WND A;  2P1M A;  5EX0 A;  4BSX A;  1Y6I A;  1HG5 A;  1Z6T A;  2DCP A;  3QNK A;  1JWF A;  5E76 A;  4AP2 A;  4C0M A;  3MKS A;  4EEC A;  3FTV A;  3LY7 A;  5CMY A;  3FUI A;  3RIB A;  4JTC B;  4EBA G;  4UI9 J;  3ZHE B;  2QY7 A;  4U0S A;  4UI9 C;  3LBZ A;  5G2N A;  1YA0 A;  3E4U A;  4N39 A;  3SBT B;  2AST A;  1EOF A;  2J09 A;  4B94 A;  3JCK C;  3HTM A;  4JHJ A;  5C1D A;  1QDV A;  3CGH A;  2EQX A;  4A1S A;  2E2E A;  2JLB A;  1H2T C;  1PC2 A;  5CCL A;  2WXQ A;  4G11 A;  1HE8 A;  3QAQ A;  3D9L A;  3CVX A;  4CP3 A;  1QZ2 A;  3IBE A;  5FWQ A;  4UWL A;  3WSO B;  3LUT B;  5H7G A;  2JZ3 C;  1FQV B;  5A6R A;  2J4B A;  4OVU A;  4APO A;  4JEU A;  2KZT A;  4L2Y A;  4UQY A;  2X6F A;  1KLX A;  4GB9 A;  3D9I A;  2XRY A;  3LYA A;  2XHE A;  3MJW A;  4M3O A;  3RRM B;  3ZPJ A;  3L2O A;  2L0T B;  3TGO A;  2PL2 A;  3ZHE A;  1IHG A;  2XCB A;  5BW8 C;  4YY8 A;  2KAT A;  2WXR A;  1EDU A;  5DAD A;  3FUM A;  3Q47 B;  3PRZ A;  2YHE A;  3KS2 A;  4IUL A;  1R28 A;  1JUQ A;  2VSY A;  2KM4 A;  1FVF A;  4BWR A;  2Y3A A;  4AWJ B;  2VSN A;  2WQ6 A;  4J8S A;  2WMN A;  5G04 C;  5CMW A;  5BO4 C;  4LER A;  5JH5 B;  4EZL A;  5BNW A;  4GMJ A;  5AEN A;  3FFL A;  4EBA A;  3DPD A;  3APC A;  3SNX A;  5BXD A;  5ARF A;  1VDY A;  4XIF A;  4W9L B;  4KXK B;  2MHK A;  2OVP A;  4B9K B;  2C0M A;  3I4G A;  3L6A A;  5T4Y A;  4PS7 A;  1EOD A;  3ZRC B;  3D9O A;  2XCC A;  2CG3 A;  4GA2 A;  3TAX A;  2NC9 A;  3LNM B;  4FJY A;  4CXT A;  4HVB A;  4J8E A;  2WPV A;  2J08 A;  2L6J A;  3OXF A;  4UQZ A;  1HFA A;  5G05 C;  3SFZ A;  3ZVV A;  4EPZ A;  5LCW J;  3D3M A;  4V3I A;  4GZ3 A;  5LP0 A;  1H19 A;  3LY9 A;  3Q4A B;  2KC7 A;  1FCH A;  2FBN A;  5DBK A;  3PEV B;  3EHM A;  3FTU A;  4WNF A;  4PH4 B;  1LDK D;  3ZFW A;  3U66 A;  4BKT B;  3UPV A;  5BXB A;  1P22 B;  3BIM A;  3KEZ A;  1HF8 A;  3SD5 A;  5EKQ D;  2XGM A;  3CHP A;  4W9C B;  4JEH A;  4HLE A;  3OGK A;  4AXH A;  4GA1 A;  3LS8 A;  4N3A A;  4BX9 A;  1VCB B;  3DBS A;  4I1M A;  3QC1 A;  3MGB A;  4BT8 A;  3LCA A;  3MZL B;  4UWF A;  4I1A A;  4FP7 A;  2A5U A;  2LAH A;  2V4L A;  4EOZ A;  1Z3X A;  3PS6 A;  4I2Z A;  4AV7 A;  4CRW A;  5FQ8 A;  4FLB A;  4U2N A;  2PQR A;  5BUZ A;  3CVW A;  4DI4 A;  2GRL A;  4WWN A;  4AJW A;  2I2O A;  2NSZ A;  1TJC A;  2AXV A;  3I5P A;  1HS6 A;  3UX4 A;  2VTB B;  4ZGC A;  4CRH A;  1L5J A;  2I1J A;  3SI5 A;  3C6N A;  1U3C A;  4I9E A;  5FQ4 A;  4UWH A;  5FZR A;  1IYG A;  2OND A;  3T5X A;  3UT7 A;  3BEE A;  3CHS A;  4CXJ A;  2UY1 A;  2PM6 A;  4GZC A;  2A79 B;  1WM5 A;  4KMO A;  2WXJ A;  3GW4 A;  4FJZ A;  2VTB A;  4BGC A;  1QNF A;  4N9F 5;  1KT0 A;  1SZ9 A;  4WNG A;  3TJP A;  2IF5 A;  2P1O A;  1UJK A;  4GA0 A;  3U9W A;  1R29 A;  1W3B A;  3P2B A;  4CXI A;  4ANU A;  4XE0 A;  2YY9 A;  3ZRH A;  3CHR A;  5ANL A;  4F7A A;  3OXL A;  4R7L A;  5FQ7 A;  5AIJ A;  3CK9 A;  4U63 A;  2WXM A;  2I2R A;  1T1D A;  4W9H H;  2IOS A;  2WXL A;  1E90 A;  1E7V A;  1OWP A;  1OWM A;  2X3M A;  5T8I A;  2X6I A;  4OVV A;  2P1P A;  3JYS A;  3NF1 A;  3SBS A;  4YVO A;  3TL5 A;  3CVV A;  1X5B A;  3FH7 A;  3DCG B;  3VLD A;  5FQ6 A;  4MS6 A;  1INZ A;  3FTS A;  3ML9 A;  4XI9 A;  3RKV A;  3HYM B;  2OVF A;  3NZU A;  5LLI B;  2R5S A;  2R17 C;  3UQ3 A;  2UWJ G;  4HOU A;  2P58 C;  4Q96 A;  4A55 A;  3LVQ E;  4WWP A;  2ASS A;  2PPI A;  3M8V A;  3B7R L;  2KCK A;  4A3T A;  4D10 C;  5JJ7 A;  3OTN A;  4FAD A;  3T8M A;  4WQO C;  2MRI A;  1IQR A;  3R7Q A;  3ZXS A;  2PM7 A;  4ANV A;  3MYV A;  4W9F B;  4ATG A;  1NZN A;  3D9K A;  4DJA A;  3CKB A;  4G23 A;  4RG6 A;  1E8Z A;  1DSX A;  2E32 B;  2LO6 A;  3HVE B;  5D0Q D;  1BUO A;  2L9B A;  3PNT B;  4GZ5 A;  3CK7 A;  3LJ3 A;  5FT9 A;  4YVQ C;  5DAF A;  2R59 A;  4ILI A;  3SGH A;  4H7Y A;  4Y6C A;  4IYP A;  5LX8 A;  3APF A;  3GZ1 A;  4N2Q A;  4ILH B;  3FUL A;  3ONK A;  4BTA A;  2QFC A;  3B7T A;  1MHQ A;  2Y4U A;  4BY6 A;  3CVY A;  1H6K A;  2IOL A;  4GPK A;  3OHV A;  3K9I A;  4W9J B;  3QJZ A;  1PAQ A;  3PNL B;  5A15 A;  4BTB A;  1NA3 A;  2PZI A;  5D0O D;  1E8Y A;  4FHJ A;  3FUF A;  3FEY A;  3LPZ A;  3CVN A;  4W9E B;  4W9I B;  3ZRF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...