3HVEA

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
216
Chain Sequence
SDPQHAARLLRALSSFRERFCDAHLVLDGEEIPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLNDTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLERYVFEAVIRWIAHEIRKVHMKDVMSALWVSGLDSYLREQMLNEPLVREIVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gigaxonin
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
total genus 52
structure length 216
sequence length 240
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveA01
2IZVC 3C6PA 3M4TA 2IHCA 2I2RA 4W9IB 5IBKA 3HQIA 2EQXA 5JH5B 1EOEA 4J8ZA 1DSXA 2C9WC 3LBZA 4N9F5 4W9KB 3M8VA 5FTAA 1QDWA 3ZUNB 2OVRA 3OHVA 4U2NA 1QDVA 2R9RB 2NN2A 1FS1B 2JZ3C 4EOZA 4HXIA 4BKTB 2VPKA 3OGLA 5LLIB 4W9LB 2FNJC 1CS3A 1HV2A 4I6JC 2A79B 4UYIA 1NN7A 1FQVB 1LQBB 4UIJA 3WSOB 2E31B 1R29A 1FS2B 3OGKA 3BIMA 5BXDA 2P1QA 1BUOA 4W9FB 1T1DA 4APFA 3FKCA 4JTCB 2NZ0B 2PPIA 4CXTA 3L2OA 3ZTDB 1LDKD 4W9HB 4W9HH 4W9CB 2P1OA 3M52A 5HZGC 3KVTA 3V7DA 3MKSA 5H7GA 5H7HA 3ZRFB 1EXBE 3OGMA 4W9GB 3ZTCB 3HU6A 2P1MA 4HS2A 3M5BA 4JGHC 4JTDB 1R2BA 4AWJB 4WQOC 4B9KB 1NEXA 4U77A 3ZNGB 1P22B 3LUTB 4W9JB 3C6NA 3LNMB 3I3NA 2VKPA 3GA1A 2YY9A 5EUPA 2E32B 4AJYC 5A6RA 3DCGB 2ASSA 4CP3A 3DRZA 3E4UA 4B95B 1A68A 2OVPA 4CXIA 5DAFA 4BGCA 4W9DB 5BXHA 3B84A 4BKSB 2IF5A 5BO4C 1EODA 1S1GA 1EOFA 4JTAB 3HVEA 4ZOUA 4CRHA 4CXJA 3HVEB 3OHUA 2P1PA 2Q81A 4AP2A 2Z8HA 3ZRCB 5BXBA 1R28A 2MA9C 1VCBB 2ASTA 4W9EB 4U2MA 1LM8C 3C6OA 2OVQA 2P1NA 5A15A 5DADA 3ZKJB 5HYWB 3HTMA 4B9KE
chains in the Genus database with same CATH superfamily
3PNLB 2CHWA 5FINA 4W9IB 4Q94A 3ABME 2UY1A 4ANWA 4JZYA 3W9FA 5M72A 3GZ1A 3ONKA 1B89A 5ENQD 2R2LA 3L6AA 3MYVA 4J8YA 2KCVA 1NN7A 4O6FA 4N39A 1FPPA 2CG3A 5FTPA 4GB9A 4FLBA 4IULA 3T8MA 1N9AA 3I5PA 4CXTA 3ZTDB 4A3TA 2KBXA 4TUMA 3RRMB 3GZ2A 4GZ3A 3M52A 2IU1A 4CDNA 2RD0A 1NFIE 1VDYA 3FH8A 3JUIA 3B13A 4ZFHA 4ANVA 4CEMA 3QNKA 4U77A 3ZNGB 5CRUA 3SFXA 3T9KA 4YNDA 3P1UA 5KJNA 2PL2A 4LCTA 1MQSA 1OT8A 3LVQE 4U95D 1KLXA 4NIKA 3HYMB 4B94A 4XKBA 1BD8A 1EODA 1V55E 4LG6A 1EOFA 2YINA 2BKGA 3HVEB 2Q81A 5HKPA 3WG7E 4D10C 1VCBB 1K3ZD 2ASTA 1OWOA 1OY3D 2CG2A 3R9MA 2QY7A 1LD7A 3VTYA 1OCRE 2I2RA 3PUKA 4TRQA 5KJLA 1Z3YA 2VSYA 3ZN3A 3ZPJA 3ZUNB 5E76A 4U2NA 4RQIA 2LXLA 1IQRA 2XS1A 2FBNA 3C3OA 5LLIB 3E32A 4YY8A 4I6JC 2V5FA 1O5MA 4UYIA 2BTDA 3NOCD 3SNXA 2ZU6B 3LCAA 1QBQA 1SA5A 1WM5A 2BEDA 1R29A 1UN8A 4I43A 3DRYA 1MX2A 4F6RD 3Q49B 2XGOA 3SFZA 3UQ3A 2XHEA 2WXGA 4ANUA 2PNNA 3KAEA 5D0QD 2P9UG 4JEUA 4WWNA 1NA3A 5G2NA 1R2BA 2LNIA 3TWUA 2ILRA 1NA0A 1G3NB 3T5XA 5A6RA 2QC9A 4WNFA 1EDUA 2WXRA 2IF5A 1S1GA 4WNDA 4Q69A 3MKQA 3ZFWA 3HXFA 3R7RA 3G2WA 1OWMA 2WXMA 5T4YA 3LDZA 3CVNA 2XGMA 3RRNB 5G05C 4FJZA 4U0UA 1E7UA 4I6EA 2ETCA 3FTXA 3M8VA 5FTAA 3BUAA 3PH0C 5H7PA 4J8DA 2J07A 3AU4A 3TWSA 2J4BA 3DSUA 5ARGA 4FC8A 3MV3B 2WXKA 3CKBA 3WSOB 3SZ7A 4EPZA 2H6FA 4UI9K 1S70B 3AJIA 3RK6A 4W9CB 5H7HA 3VTXA 3DPDA 2VGXB 2ZXWE 4HRNA 3PE3A 2QFCA 4H7XA 2P9PG 5BXOA 1MX6A 3CGHA 2A5EA 1KPSB 2J08A 1D9SA 3ZKJA 1NI1A 2ETAA 3E4UA 3QAQA 2HE0A 4UWLA 4WNEA 4AIFA 1MX4A 3QK0A 5HI7A 2UWJG 3CV0A 3RKVA 4DX5D 5BNWA 5AN8A 2Y3AA 1LD8A 2XS8A 3D9MA 1N94A 5A15A 3CR3A 5ARFA 4JPSA 3V30A 3ZXSA 2MYOA 2IOSA 3DRAA 4KZCA 2EQXA 2V8SE 4J8ZA 5FQ7A 3CHSA 3C5RA 1ELWA 2RFAA 2PM7A 1QDVA 2NN2A 3FFLA 4GYOA 4NURA 3HDXA 4TXQA 4HXIA 4FHKA 4F1PA 5G04J 4GA1A 4I17A 4HQDA 5JHBA 4YVOA 3RO3A 2I9CA 3CQCB 1N11A 5FQ4A 3FTSA 3ZXPA 1UJKA 1FS2B 3UT4A 2I1JA 2AXUA 3AG1E 4BY6A 3OTNA 1N4QA 2H6HA 1TNOA 4EZKA 1H2TC 3ASDA 2Y4UA 5BUZA 3TXMA 3HU6A 4KVMA 5AAOA 2WM9A 3U66A 2EIME 1YMPA 5IY5E 2OVBA 1FT1A 4B9KB 1OXJA 4BETA 5EILA 1NEXA 2OV8A 3ZIMA 4W9JB 2DYRE 3FUJA 2KCLA 2YY9A 5KJKA 4DJAA 4U63A 4WWPA 4FA6A 4CXIA 3PEVB 5KCMA 2YQ8A 4BKSB 2KC7A 4ILHB 4CXJA 3UTMA 5BXBA 3ZU7B 4W9RA 5EIBE 4ILGA 3V79K 3NZUA 1E8ZA 4JEHA 1LM8C 2I6HA 1UW4B 4GA0A 4GYYA 4WWOA 1TR4A 1HG2A 2M63A 5JH5B 1EOEA 1W3BA 2DBAA 3Q9UC 2P9LG 2VSNA 4OAUC 3FEYA 1QDWA 3OHVA 1FS1B 3FTYA 1NZNA 1QNFA 3BEEA 1FVFA 4JD2G 3ZYKA 3QC1A 3OXLA 5EKQD 1FQVB 5EN5D 1DCEA 4JB8P 4U8YD 2VGYA 4U0SA 4UIJA 1BUOA 1TNZA 4U7EB 4U8VD 3QARA 3KD7A 3V2XA 4UQZA 1L5JA 1KT0A 2WXQA 4U8HA 2X6JA 4J7WA 4PS7A 4LRZA 2CFUA 5FT9A 2X38A 4HRMB 3PDNA 4HOQA 4WAFA 3FHEA 1ZU2A 3FY4A 5FJYA 4CZ2D 5LCWJ 5FZSA 3GA1A 2P58C 3KEZA 4IRUA 3DCGB 4N3AA 3FUFA 4F3VA 1N0RA 2OVPA 4Y6CA 5BXHA 4CRWA 3SY2A 4NRHB 3SF4A 3L82A 5HRYA 5J08A 4AP2A 4C48B 3BQOA 2X3MA 4GCNA 3RSEG 3JQ1A 5ITZF 1UN9A 1K1AA 4W9EB 4U96D 5AARA 3C6OA 3GYZA 3SBSA 5ENOD 2B0OE 1SZ9A 2XPZA 2IZVC 2F8XK 4MBGA 4I1OB 3ZHEA 4K5BA 1UOHA 2AVPA 5C1DA 4HI9A 2XZDG 2C9WC 5G04C 2XZTG 2ZGDA 4O1PA 3HG0D 3RRUA 3O48A 1HF8A 3HRAA 3C72A 2LSUA 3CHOA 5LFAA 2IF4A 4H7YA 4JHKA 4JA7A 3FUKA 3C98A 1V54E 3L22A 3J5QB 1YCSB 4G1TA 2KCKA 3LXUX 3EU9A 1X81A 4TUUA 5G05J 4G11A 3LYAA 1OWNA 3MKSA 4KT6B 1IHBA 2Y0BG 2KXPC 2WXIA 5EYLA 2L0TB 3FH7A 3P2BA 2DZOA 4B8AA 3B7SA 2VGEA 2VTBA 4AWJB 4DLOA 5EUPA 4AJYC 4OVVA 1O1TA 3B7UX 4K03A 3UIPC 5CCLA 3FULA 3MJWA 2AXZA 4N5CA 3ENEA 4A1GA 3TG5A 2KZTA 4DX1A 2H6GA 3UI2A 2Y1LE 3S7BA 5DADA 4GZCA 4YDEA 4ATGA 4DX6D 3C6PA 4GTTA 4FHJA 1PAQA 3ZHEB 1OCOE 4HVBA 3ULYA 2MOWA 5BV1A 3CSFA 4G8LA 2OVRA 4HOUA 3EDTB 4ZGCA 4XEIG 3S7DA 5HQ8A 2DIWA 3EHRA 3IXEA 3UT8A 3PNTB 1HV2A 1TN6A 2XEHA 4EZJA 1LQBB 4DI4A 2E31B 2JABA 2JLBA 5AJLA 5B1AE 3ZYQA 3OXGA 4KVOA 3FKCA 2UY1B 3U64A 4N2QA 4W9HB 1H6KA 3LS8A 2EIKE 1IXVA 5FZQA 5KNHD 3I4RB 1EXBE 4LNUD 5LCWC 3Q75A 1AWCB 3KEAA 5A23A 4BFRA 4KBQA 4ACLA 3JYSA 2P2CP 2VKPA 5KWDA 5CEDB 3TL5A 3EIQC 3MV2B 3QWVA 4DPRA 4QFVA 2P9IG 2WXJA 3ML9A 4BT9A 3HHMA 2VSOE 3B7BA 4JXTA 3OXFA 1H0AA 3AS4A 3ASGA 1O1RA 4UQXA 4J0UA 3CVWA 3PE4A 2KZTB 4L23A 2IQCA 3ZRCB 5KJMA 4LERA 3AS8A 3G2VA 1FCHA 1HO8A 3T5VA 3FUDA 4OAVB 1SW6A 4DRXE 2X6KA 3EIJA 2IFUA 4G2VA 1N52A 3C3QA 1DSXA 1DC2A 1N0QA 3ASHA 4C9BB 3APDA 1U3CA 4EOZA 3OGLA 1MJ0A 2L6BA 3NF1A 3ASOE 5A7DB 2XPYA 2GGFA 5CERB 1E8WA 1SVXA 3ISMC 5CMYA 5FQ6A 2DYSE 4U07A 2NZ0B 4M3OA 3DXMG 2GRLA 3CQGB 2ZGGA 1S64A 2X6HA 4MRUA 2DCPA 2IJGX 4CGVA 2XRZA 4XI0A 4N3BA 2ETBA 3Q5MA 2LUHA 3MZLB 2BF0X 4HS2A 3D9JA 4QQIA 4F7AA 1HG5A 2Y4TA 2Y69E 4A1SA 1INZA 1NP7A 5G55A 3B7RL 4B93B 3UM2A 3SBTB 3FUNA 3UXGA 1A17A 1EPUA 3AS5A 2Q7FA 4GTVA 3DSWA 2P9SG 3ONLA 1WG0A 5AQ9A 2E2EA 3F6QA 4I1AA 4PDXA 4E6HA 4JC8A 3DWLG 4XX5A 2V0PA 3FP3A 3PZ1A 4A55A 2IO2C 4U2MA 1TJFA 4LNBA 3U4TA 2LSVA 3CVUA 3I4GA 3FU6A 3TWTA 1Y6IA 3PZDA 3ASNE 1ELRA 3RAUA 2R59A 4UWFA 3HIZA 3MCXA 3MKQB 5CCMA 1MYOA 2WXOA 2R05A 2V4HC 2DVWA 4J6IA 2PQRA 2J49A 5CBNA 1ZB1A 3BU8A 3CVQA 3CK7A 5CRVA 5CECB 2GRPB 2L0IA 3RO2A 2P1QA 3KSLA 2A4ZA 4JTCB 2C0LA 2EILE 3IHVA 3DSTA 2I1KA 4XE0A 5LP0A 4DX7D 1BPOA 4GMRA 2P1MA 4GMJA 4JTDB 2PM6A 4JHRA 2CFZA 1P22B 3CSTA 1SA4A 2IEJA 2OOEA 2C0MA 2R5SA 2RG8A 2E32B 3IV0A 4BTBA 1E96B 2MHKA 4CP3A 4AV7A 4B95B 1A68A 5AQAA 1QZ2A 5FZRA 4KZ0A 1IKND 1QQEA 4PH4B 2BKKB 1H2UA 4BEPA 5JJTA 2WXNA 4ZHBA 2X6IA 3MX3A 3TAXA 4EHMA 4LSZE 4JW1A 1K8KG 3C3RA 3ZKJB 3UKUG 4CYMD 4EBAA 4G26A 4MLPA 2GRQB 4FP7A 3IEGA 3TJPA 4N9F5 3L08A 4W9KB 2FO7A 2R9RB 3QDNA 4WUYA 2H6IA 3N71A 1OUVA 3UMVA 2V5QC 2FNJC 1YYHA 3TWVA 1HH8A 3DRXA 2BUGA 3AU5A 4XKCA 1E7VA 3V31A 1DVPA 4GZ6A 4JA9A 4P29A 3IHYA 3B7TA 2PQNA 1P5QA 3ESKA 4RVBA 3ZGQA 3DPYA 4W9HH 2KM4A 5AIJA 3CHMA 4AOFA 1HS6A 1ELKA 2WXFA 3HXEA 2IONA 4HI8A 5HS0A 3PEUB 4FU3A 4V3IA 4WQOC 3TXNA 2MRIA 2VSXE 1BLXB 2WMNA 3Q15A 2LAIA 1X5BA 5A6CA 4GTRA 1TNBA 3AG3E 1UG3A 5JHAA 1H2VC 3UT7A 3D9KA 3FWVA 1TN8A 2E0IA 2XENA 3G2SA 3NAWA 5KNGA 1QYMA 4CRHA 4L2YA 1N4SA 1BI7B 2GRMA 1SZAA 3JXJA 3NZSA 4AY5A 4KMOA 5JJ7A 2VYIA 1HU3A 2OVFA 4U0ZA 4CGWA 3X2QE 2FF4A 4BERA 4DUIA 3L9TA 3ULQA 2P9KG 3R9AB 3QKYA 4TXPA 5ANRA 3LKUA 3SD5A 2DZNA 4Z68A 3QWWA 2NC9A 4BKTB 2VPKA 3GZSA 1TN7A 4ACKA 4I9EA 1CS3A 3D9HA 5BW8C 3E33A 2C2LA 3UM1A 3J5PA 4UI9J 4FULA 4HBDA 4CDRA 2WQ6A 1MZCA 5BXDA 4GA2A 3T8KA 2PPIA 3RJVA 5AYWD 3JXIA 3RIBA 1SQMA 4MS6A 2FULA 5HZGC 3FTWA 4XZ4A 5H7GA 1TYQG 3CHRA 1K1BA 3HXCA 4F53A 3M5BA 1E90A 3ZEFA 4DX2A 2IOLA 3DEOA 3C6NA 3I3NA 2OCCE 2ZIRA 5FIOA 4EQFA 3TWWA 3FU5A 3ULEG 3L54A 1PC2A 4GTQA 5B3SE 3ZYMA 4JTAB 3VLEA 3OAWA 1IHGA 3E37A 4LEUA 4ILIA 3RU0A 3Q79A 3E34A 1TEZA 3L16A 1JCRA 4UWGA 1U2VG 4AXHA 4BSXA 2RFMA 2HR2A 4HORA 4TV3A 4PS8A 2IO3C 4OVUA 2EIJE 3R7QA 4FJYA 3MEKA 4GPKA 2FO1E 2J4DA 5JMND 5JA4D 3TGOA 3QJZA 2QYJA 2X6FA 2HO1A 2XCBA 2DWZA 3AAAC 1E8XA 2RKKA 1HZ4A 3D9NA 4G25A 4I1MA 4BESA 3WXXA 3FTVA 4YVQC 3APCA 3BIMA 2F8YA 4W9FB 5D66A 4AVXA 3FUIA 3L2OA 3L17A 5BV0A 2FI7A 2A5UA 3V2OA 3KVTA 3V7DA 3SFYA 2XRYA 3OGMA 1D8DA 4PUCA 1H6PA 5FWQA 5AQ7A 3FU0A 3EHNA 2R17C 3SHFA 2R02A 4R7LA 4JHJA 3Q73A 3LUTB 3CVPA 4NQ0A 4HFGA 1JWGA 5BXUA 3TWXA 3E4BA 3CK9A 4JL0A 1WY6A 4G8KA 3BG0B 5ENSD 4N5QA 1OCZE 1Y8MA 2XEVA 3KS2A 1WAO1 2HYZA 4AJWA 4HRLA 3EHMA 4ZOUA 3ZRHA 4HLEA 3QOUA 2VTBB 5LX8A 1FT2A 1R28A 4G23A 5ENRD 4CT0A 3CVLA 4TXRA 3IBEA 1TNYA 2I2OA 4FADA 3M4TA 1Z5SC 3CVYA 5LOZA 1OWPA 3CK8A 1S63A 1S0PA 1HXIA 5CMWA 4GYWA 1N4RA 1N95A 3ABKE 2XQ0A 3FTZA 3SO8A 2EINE 4G24A 4UI9C 3CKCA 2VGXA 3UINC 3JQ0A 4UUCA 4ME2A 3EUVA 3FUEA 4GTOA 2JEKA 5EYPF 4BT8A 3NB2A 4RG9A 4EBAG 2ONDA 2NYJA 2F0YA 1LDKD 3G2TA 3VLFA 3ZRFB 1PY1A 4W9GB 2WQ7A 5T3RA 3S2AA 4ABNA 4FLHA 2XEEA 3CHPA 2WXPA 1KT1A 3LY9A 3Q7FA 3FTUA 2LAHA 1OCCE 4IN3B 2YNQA 4W9DB 3D9OA 4U04A 5CEAA 3D3MA 2WQHA 3SQVA 3W9GA 3PREA 2AJAA 2Z8HA 4YDOA 3IKOB 2WB2A 2F37A 3ASFA 5ANLA 3FUHA 4HOTA 1NL4A 1LTXA 3Q7AA 5C2YA 2NXPA 2IHCA 1N4PA 4J8FA 5BPPA 5IBKA 3HQIA 4I9CA 3LPZA 3PS6A 3EHQA 2GRRB 4BWRA 3QB2A 3O4ZA 3AG2E 5E75A 4UQYA 3CLJA 5AQBA 1HE8A 3TWQA 5AENA 4HNAD 4GTSA 3FEXA 3APFA 3FH5A 2WXHA 4MKTA 4ANXA 5KBAA 2CHZA 4WNGA 2IY0C 3K9IA 2XGSA 2XCCA 1H19A 3DSSA 4CDMA 4GZDA 4AEZC 3CHQA 1JCQA 4LNGA 4EECA 1KZOA 1TNUA 4I2ZA 4L2LA 2WMOA 2GRNB 2ZISA 3U9WA 5CHEE 1DCQA 3URZA 2VQ2A 4XI9A 2AWIA 3TG4A 3CIAA 4HLLA 4APOA 4URKA 4K5AB 4DK5A 2ASSA 4PS3A 5AJDA 4UWKA 3JUEA 3LY8A 2WPVA 4BGCA 3JCKC 3FU3A 2YHEA 1JUQA 3DSVA 4J8SA 2CHXA 1Z3XA 2FEZA 4K5CA 4Q96A 3S7FA 4CCAA 2QYUA 4RG6A 3LVRE 2NSZA 1RW2A 1UJJA 4GMLA 4K0RA 3D9LA 2J09A 3PVLA 1BI8B 5HYWB 2P1NA 3HTMA 3L13A 1AP7A 4Y6WA 1N54A 3ZYLA 1D8EA 3UPVA 3DBSA 3EU5A 4L1BA 5B1BE 1KZPA 5CBOA 4HOSA 3LBZA 3MKRA 5J90A 3QWPA 2JZ3C 4F1SA 3NBNB 1YA0A 3CEQA 4W9LB 4O60A 4I6JA 2L6JA 1XGWA 3UM0A 4ATZD 4CT4A 5FQ8A 4N3CA 5D0OD 4L7TA 4N2SA 1HFAA 5D2MC 4GU5A 1A5EA 3VLDA 3OGKA 5EX0A 2V4LA 4B89A 1T1DA 4EZLA 4B0ZA 3ZUVB 3CVXA 5DBKA 3SGHA 2P1OA 4GTMA 1ZBPA 3Q47B 3NOGD 4GCOA 3PRZA 3LJNA 3ZTCB 2GROB 3FDHA 1E8YA 3TWRA 3PUJA 1MHQA 4BSZB 1JWFA 1RZ4A 2AXVA 3ESLA 4JGHC 5ENTD 1Z6TA 2J9QA 3KSQA 1LF8A 3EJNA 5ENNA 1XNFA 3UKRG 3LEWA 3SI5A 3DRZA 4X8QA 3B84A 4XIFA 3DEPA 5BO4C 3CVVA 4GZ5A 1TJCA 1FVHA 3HXDA 3OHUA 2YHCA 4A63B 3PZ2A 1DNPA 4O1OA 4M7CA 3UX4A 1BU9A 1H6OA 4I2WA 3AG4E 2AW6A 2XPIA 2PZIA 1IYGA 4GTPA 3PZ3A 2LXMA 4B9KE 5T8IA 3E30A 2WXLA 4C0MA 4HB5A 4RSYA 4GPMA 2J8SD 2B6CA 5DIZA 4E85A 3Q9NC 4AM9A 3PZ4A 4OYSA 3UIOC 5JJ6A 4UWHA 5ENPD 1IQUA 1GW6A 4B8CB 3ZVVA 3Q4AB 4DI3A 3ABLE 2A79B 4KXKB 3LJ3A 5BT1A 3ML8A 1EF1C 3UUXA 3U3WA 5EDSA 4IYPA 3BG1B 4NACA 3D9IA 4APFA 3DSXA 1Q2ZA 4C0EA 4JVSA 2KATA 3B95A 1HX8A 4DLQA 4RLYA 3S7JA 4BTAA 4AY6A 3UM3A 3G2UA 3NQPA 3D9PA 2L9BA 3FUMA 2WVIA 3GW4A 2OEVA 3ZNGA 4A3VA 3Q78A 3LNMB 2QZAA 4GAAA 4KYOB 5EIDA 2P9NG 3LY7A 1WDYA 5EX3A 4BX9A 5DAFA 2VJ8A 2LO6A 2OEWA 4BX8A 1U3DA 3ZW3A 2R03A 1JPLA 1EYHA 3HVEA 3MGBA 2HM8A 3HXBA 2P1PA 4J8EA 4I6GA 3DXKG 4LUNU 1OWLA 2MA9C 1JCSA 3MA5A 4L9PA 1O1SA 4YDWA 2OVQA 2GW1A 4YDYA
chains in the Genus database with same CATH topology
2I2OA 3PNLB 4FADA 4GYYA 3M4TA 2CHWA 3I4GA 4WWOA 3FU6A 3CVYA 4W9IB 1HG2A 1Y6IA 3PZDA 2M63A 1ELRA 1OWPA 4Q94A 5LOZA 3CK8A 2R59A 4UWFA 3HIZA 5JH5B 1EOEA 3MCXA 1S0PA 1W3BA 2DBAA 2UY1A 4ANWA 4JZYA 1HXIA 3MKQB 2VSNA 5M72A 5CMWA 3GZ1A 5CCMA 3FEYA 4GYWA 1QDWA 3ONKA 3OHVA 1FS1B 2XQ0A 1B89A 3FTZA 3FTYA 3L6AA 1QNFA 1NZNA 3BEEA 1FVFA 4G24A 4UI9C 3CKCA 2VGXA 2WXOA 3MYVA 3ZYKA 3QC1A 3JQ0A 3OXLA 5EKQD 2KCVA 1NN7A 1FQVB 4O6FA 4N39A 4J6IA 2PQRA 4ME2A 3FUEA 2VGYA 2J49A 2JEKA 2CG3A 4U0SA 3CVQA 5FTPA 3CK7A 4UIJA 4GB9A 4BT8A 4FLBA 4IULA 2L0IA 3T8MA 3RO2A 2P1QA 1BUOA 2A4ZA 3QARA 3KD7A 4RG9A 4JTCB 4EBAG 3I5PA 4CXTA 2ONDA 3ZTDB 2C0LA 4UQZA 3IHVA 4A3TA 1LDKD 1L5JA 3G2TA 1KT0A 3GZ2A 3RRMB 2WXQA 2I1KA 4GZ3A 3M52A 4U8HA 2X6JA 4XE0A 3VLFA 2IU1A 4LRZA 2CFUA 4PS7A 2X38A 5FT9A 5LP0A 3ZRFB 1PY1A 4CDNA 2RD0A 3FH8A 1VDYA 4W9GB 3JUIA 2WQ7A 3PDNA 1BPOA 4HOQA 4WAFA 3FHEA 3B13A 5T3RA 2P1MA 3S2AA 4GMJA 4ABNA 4ANVA 4CEMA 4FLHA 4JTDB 3CHPA 2PM6A 2WXPA 1ZU2A 4JHRA 1KT1A 3FY4A 2CFZA 3QNKA 5FJYA 3LY9A 5FZSA 5LCWJ 4U77A 3ZNGB 1P22B 3CSTA 3FTUA 3GA1A 4YNDA 2LAHA 2P58C 3KEZA 2OOEA 2C0MA 2R5SA 2RG8A 3P1UA 4IRUA 5KJNA 2E32B 3IV0A 2PL2A 4BTBA 4LCTA 1E96B 3DCGB 4IN3B 2MHKA 1MQSA 4N3AA 4CP3A 3FUFA 4AV7A 3LVQE 4F3VA 4B95B 1KLXA 1A68A 2OVPA 2YNQA 4Y6CA 4W9DB 3HYMB 4B94A 5BXHA 4CRWA 1QZ2A 4XKBA 4KZ0A 5FZRA 1EODA 3D9OA 4U04A 3D3MA 1QQEA 4NRHB 4PH4B 3SF4A 1EOFA 1H2UA 2YINA 2WQHA 3HVEB 3PREA 5J08A 2Q81A 4AP2A 2X3MA 4D10C 4GCNA 5JJTA 2Z8HA 2WXNA 3IKOB 3JQ1A 2WB2A 1VCBB 2X6IA 3MX3A 1UN9A 2ASTA 3ASFA 3TAXA 5ANLA 4W9EB 1OWOA 3FUHA 4HOTA 4JW1A 3C6OA 3GYZA 3ZKJB 3SBSA 2CG2A 4EBAA 4G26A 1SZ9A 2XPZA 5C2YA 2QY7A 2IZVC 4MLPA 2NXPA 3VTYA 2IHCA 4I1OB 4J8FA 5BPPA 2I2RA 3ZHEA 3PUKA 4FP7A 3IEGA 3HQIA 4I9CA 4TRQA 3LPZA 5KJLA 5IBKA 1Z3YA 2AVPA 2VSYA 5C1DA 3TJPA 2C9WC 3PS6A 4N9F5 3L08A 4W9KB 4BWRA 5G04C 3ZN3A 3QB2A 3ZPJA 2FO7A 3O4ZA 3ZUNB 5E76A 5E75A 4U2NA 2R9RB 3QDNA 4UQYA 4WUYA 3N71A 1OUVA 3UMVA 1IQRA 3RRUA 2FBNA 3CLJA 3O48A 1HF8A 5LLIB 1HE8A 4YY8A 2FNJC 5AENA 1HH8A 4I6JC 2LSUA 2V5FA 3CHOA 5LFAA 3DRXA 4UYIA 2BTDA 2BUGA 3AU5A 2IF4A 3FEXA 4XKCA 1E7VA 1DVPA 3SNXA 2ZU6B 4H7YA 4JHKA 3LCAA 3APFA 3FH5A 4JA7A 2WXHA 3FUKA 4GZ6A 4JA9A 3C98A 4P29A 3IHYA 4MKTA 4ANXA 1WM5A 1R29A 3B7TA 1UN8A 2PQNA 2CHZA 1P5QA 3L22A 4I43A 4WNGA 3ESKA 4RVBA 4G1TA 3K9IA 3ZGQA 2KCKA 3DRYA 3LXUX 2XGSA 4TUUA 5G05J 2XCCA 4G11A 1H19A 4W9HH 3LYAA 3Q49B 2KM4A 5AIJA 2XGOA 1OWNA 3CHMA 4CDMA 4AOFA 1HS6A 4GZDA 3SFZA 3MKSA 4KT6B 1ELKA 4AEZC 2WXFA 3UQ3A 3CHQA 2XHEA 2WXGA 2WXIA 4ANUA 4EECA 2IONA 3KAEA 2L0TB 5D0QD 3FH7A 3P2BA 4I2ZA 4L2LA 2WMOA 3PEUB 4B8AA 4JEUA 4FU3A 4WWNA 3B7SA 1NA3A 5CHEE 5G2NA 4V3IA 2LNIA 2VQ2A 3U9WA 3URZA 2VTBA 1R2BA 4DLOA 4WQOC 4AWJB 3TXNA 4XI9A 2AWIA 2MRIA 3TG4A 3CIAA 2VSXE 4APOA 2ILRA 4URKA 2WMNA 3Q15A 1NA0A 5EUPA 2LAIA 4OVVA 3T5XA 5A6RA 4AJYC 1X5BA 5A6CA 4DK5A 2ASSA 1UG3A 5JHAA 4PS3A 5AJDA 4UWKA 3B7UX 4K03A 1H2VC 3LY8A 3UT7A 2WPVA 3D9KA 3FWVA 4WNFA 5CCLA 3FULA 4BGCA 1EDUA 2E0IA 3G2SA 2WXRA 3JCKC 3FU3A 3MJWA 2IF5A 2AXZA 2YHEA 4N5CA 1S1GA 4WNDA 3ENEA 1JUQA 4A1GA 3TG5A 4Q69A 4J8SA 3MKQA 2KZTA 2CHXA 1Z3XA 4L2YA 3ZFWA 4CRHA 2FEZA 2GRMA 4Q96A 3S7FA 4CCAA 3R7RA 4RG6A 1SZAA 3G2WA 3LVRE 2NSZA 1OWMA 1UJJA 2WXMA 4GMLA 3NZSA 4AY5A 4K0RA 3D9LA 5T4YA 3S7BA 4KMOA 2J09A 3LDZA 3PVLA 5JJ7A 2VYIA 2P1NA 5HYWB 5DADA 3CVNA 3HTMA 3L13A 2OVFA 1HU3A 4GZCA 4Y6WA 4U0ZA 2XGMA 4ATGA 3C6PA 1N54A 3RRNB 4CGWA 3ZYLA 2FF4A 4FHJA 5G05C 3DBSA 3UPVA 3ULQA 3R9AB 1PAQA 3QKYA 4L1BA 3ZHEB 4FJZA 4U0UA 4HVBA 5ANRA 4HOSA 1E7UA 3LBZA 2MOWA 4I6EA 5BV1A 3FTXA 3LKUA 3M8VA 5FTAA 3SD5A 3MKRA 3CSFA 5J90A 2OVRA 3PH0C 4HOUA 3QWWA 3QWPA 3EDTB 2JZ3C 2NC9A 4J8DA 4F1SA 4BKTB 2VPKA 2J07A 3GZSA 4ZGCA 1YA0A 3CEQA 4W9LB 3AU4A 3S7DA 2J4BA 4ACKA 2DIWA 5ARGA 3UT8A 5HQ8A 3PNTB 4I9EA 1CS3A 1HV2A 4FC8A 5BW8C 2C2LA 4I6JA 3MV3B 4EZJA 2L6JA 1XGWA 1LQBB 4CT4A 2WXKA 4DI4A 3CKBA 4UI9J 5FQ8A 4N3CA 5D0OD 4L7TA 4FULA 4N2SA 1HFAA 4CDRA 4GU5A 3WSOB 3SZ7A 3VLDA 4EPZA 2E31B 2WQ6A 2JLBA 5AJLA 3OGKA 5BXDA 4UI9K 3ZYQA 5EX0A 3OXGA 4GA2A 2V4LA 4KVOA 4B89A 1T1DA 2UY1B 2PPIA 3FKCA 3RJVA 3U64A 4EZLA 5AYWD 4B0ZA 4N2QA 3RK6A 1H6KA 3RIBA 3LS8A 1SQMA 3CVXA 4W9HB 4MS6A 4W9CB 5DBKA 3SGHA 2FULA 2P1OA 5HZGC 5FZQA 3FTWA 4XZ4A 1ZBPA 5H7GA 5H7HA 3I4RB 3VTXA 1EXBE 3Q47B 3CHRA 3DPDA 2VGXB 4GCOA 3PRZA 3ZTCB 5LCWC 4F53A 3PE3A 3FDHA 1E8YA 3PUJA 1MHQA 1JWFA 3M5BA 2AXVA 3ESLA 4JGHC 1E90A 2QFCA 3ZEFA 4H7XA 5A23A 1Z6TA 2J9QA 2IOLA 1LF8A 4BFRA 4KBQA 4ACLA 3CGHA 3EJNA 3JYSA 3C6NA 3I3NA 2VKPA 5ENNA 1XNFA 2J08A 3TL5A 3LEWA 3EIQC 3MV2B 3SI5A 3DRZA 3QWVA 4DPRA 3E4UA 4QFVA 3QAQA 2WXJA 4UWLA 3ML9A 4BT9A 3HHMA 4WNEA 2VSOE 4AIFA 4EQFA 4JXTA 3OXFA 3FU5A 3B84A 3L54A 3QK0A 1PC2A 4XIFA 5HI7A 2UWJG 3CV0A 3RKVA 5BO4C 1H0AA 3CVVA 3AS4A 4GZ5A 3ASGA 1TJCA 3ZYMA 3VLEA 3OAWA 4J0UA 4UQXA 4JTAB 1FVHA 3CVWA 3PE4A 1IHGA 2KZTB 4LEUA 5BNWA 2YHCA 3OHUA 4ILIA 2Y3AA 1DNPA 2IQCA 4L23A 3RU0A 3ZRCB 3UX4A 1TEZA 3L16A 4UWGA 4I2WA 4AXHA 5KJMA 4LERA 4BSXA 2AW6A 2XPIA 3AS8A 1FCHA 3G2VA 2PZIA 1HO8A 2HR2A 3D9MA 1IYGA 4HORA 5A15A 4TV3A 3CR3A 5ARFA 4JPSA 4PS8A 4B9KE 3ZXSA 3T5VA 2IOSA 5T8IA 4OVUA 3FUDA 4KZCA 2WXLA 4C0MA 2X6KA 4RSYA 3EIJA 3R7QA 2EQXA 2IFUA 4G2VA 4FJYA 3MEKA 2V8SE 4GPKA 1N52A 2J4DA 5DIZA 4J8ZA 4E85A 5FQ7A 1DSXA 3CHSA 4AM9A 4OYSA 1ELWA 2PM7A 3ASHA 4C9BB 3APDA 1QDVA 5JJ6A 4UWHA 3FFLA 4GYOA 2NN2A 3TGOA 4NURA 1U3CA 3QJZA 3HDXA 4EOZA 4HXIA 4FHKA 3OGLA 1IQUA 5G04J 1GW6A 2X6FA 4B8CB 4GA1A 4I17A 2HO1A 3ZVVA 3Q4AB 3NF1A 4DI3A 2A79B 4KXKB 5JHBA 5A7DB 3LJ3A 2XCBA 4YVOA 3RO3A 2I9CA 3CQCB 5BT1A 2XPYA 3ML8A 1EF1C 1E8XA 2GGFA 5FQ4A 3UUXA 3U3WA 1HZ4A 1E8WA 5CMYA 3D9NA 3FTSA 4G25A 4I1MA 1UJKA 5EDSA 3WXXA 3FTVA 4IYPA 3APCA 3BG1B 4YVQC 5FQ6A 3UT4A 2I1JA 1FS2B 4NACA 2AXUA 4U07A 3BIMA 4W9FB 3D9IA 4APFA 4AVXA 3FUIA 4BY6A 2NZ0B 4M3OA 3L2OA 2GRLA 3OTNA 3L17A 3CQGB 5BV0A 2FI7A 4C0EA 2A5UA 2X6HA 4JVSA 4MRUA 2DCPA 2IJGX 3KVTA 4CGVA 2KATA 3V7DA 4EZKA 1H2TC 2XRZA 3ASDA 1HX8A 4DLQA 2XRYA 3S7JA 4XI0A 2Y4UA 5BUZA 4N3BA 3OGMA 3Q5MA 4PUCA 3MZLB 3TXMA 4BTAA 5FWQA 4AY6A 4KVMA 2BF0X 3HU6A 2WM9A 3FU0A 4HS2A 3D9JA 3G2UA 3NQPA 3U66A 4F7AA 3D9PA 3EHNA 2L9BA 1HG5A 2R17C 2Y4TA 3FUMA 2WVIA 3GW4A 2OVBA 3SHFA 4A1SA 4B9KB 4R7LA 4A3VA 4JHJA 1INZA 2OV8A 1NP7A 5G55A 3ZIMA 1NEXA 3B7RL 3LUTB 3FUJA 4W9JB 3CVPA 3LNMB 2KCLA 3SBTB 2YY9A 3FUNA 5KJKA 4NQ0A 4HFGA 4GAAA 4KYOB 1JWGA 1A17A 3E4BA 1EPUA 3CK9A 4DJAA 4JL0A 3AS5A 3LY7A 4U63A 2Q7FA 4WWPA 1WY6A 5EX3A 4BX9A 4FA6A 3BG0B 5DAFA 4CXIA 2VJ8A 3ONLA 3PEVB 2LO6A 4BX8A 5KCMA 2YQ8A 4BKSB 1Y8MA 2E2EA 2KC7A 2XEVA 1U3DA 4PDXA 3KS2A 4I1AA 4ILHB 1WAO1 2HYZA 4AJWA 4JC8A 3EHMA 3ZW3A 1JPLA 4E6HA 1EYHA 3HVEA 4ZOUA 3MGBA 4CXJA 3ZRHA 4HLEA 4XX5A 2V0PA 2HM8A 3FP3A 2P1PA 3QOUA 4J8EA 2VTBB 5LX8A 4I6GA 4LUNU 5BXBA 4W9RA 1OWLA 4G23A 4A55A 1R28A 2MA9C 3MA5A 4CT0A 4ILGA 4U2MA 1TJFA 3NZUA 1E8ZA 4JEHA 3U4TA 1LM8C 3CVLA 3IBEA 2OVQA 2GW1A 2I6HA 2LSVA 1UW4B 4GA0A 3CVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZV C;  3C6P A;  3M4T A;  2IHC A;  2I2R A;  4W9I B;  5IBK A;  3HQI A;  2EQX A;  5JH5 B;  1EOE A;  4J8Z A;  1DSX A;  2C9W C;  3LBZ A;  4N9F 5;  4W9K B;  3M8V A;  5FTA A;  1QDW A;  3ZUN B;  2OVR A;  3OHV A;  4U2N A;  1QDV A;  2R9R B;  2NN2 A;  1FS1 B;  2JZ3 C;  4EOZ A;  4HXI A;  4BKT B;  2VPK A;  3OGL A;  5LLI B;  4W9L B;  2FNJ C;  1CS3 A;  1HV2 A;  4I6J C;  2A79 B;  4UYI A;  1NN7 A;  1FQV B;  1LQB B;  4UIJ A;  3WSO B;  2E31 B;  1R29 A;  1FS2 B;  3OGK A;  3BIM A;  5BXD A;  2P1Q A;  1BUO A;  4W9F B;  1T1D A;  4APF A;  3FKC A;  4JTC B;  2NZ0 B;  2PPI A;  4CXT A;  3L2O A;  3ZTD B;  1LDK D;  4W9H B;  4W9H H;  4W9C B;  2P1O A;  3M52 A;  5HZG C;  3KVT A;  3V7D A;  3MKS A;  5H7G A;  5H7H A;  3ZRF B;  1EXB E;  3OGM A;  4W9G B;  3ZTC B;  3HU6 A;  2P1M A;  4HS2 A;  3M5B A;  4JGH C;  4JTD B;  1R2B A;  4AWJ B;  4WQO C;  4B9K B;  1NEX A;  4U77 A;  3ZNG B;  1P22 B;  3LUT B;  4W9J B;  3C6N A;  3LNM B;  3I3N A;  2VKP A;  3GA1 A;  2YY9 A;  5EUP A;  2E32 B;  4AJY C;  5A6R A;  3DCG B;  2ASS A;  4CP3 A;  3DRZ A;  3E4U A;  4B95 B;  1A68 A;  2OVP A;  4CXI A;  5DAF A;  4BGC A;  4W9D B;  5BXH A;  3B84 A;  4BKS B;  2IF5 A;  5BO4 C;  1EOD A;  1S1G A;  1EOF A;  4JTA B;  3HVE A;  4ZOU A;  4CRH A;  4CXJ A;  3HVE B;  3OHU A;  2P1P A;  2Q81 A;  4AP2 A;  2Z8H A;  3ZRC B;  5BXB A;  1R28 A;  2MA9 C;  1VCB B;  2AST A;  4W9E B;  4U2M A;  1LM8 C;  3C6O A;  2OVQ A;  2P1N A;  5A15 A;  5DAD A;  3ZKJ B;  5HYW B;  3HTM A;  4B9K E; 
#chains in the Genus database with same CATH topology
 3PNL B;  2CHW A;  5FIN A;  4W9I B;  4Q94 A;  3ABM E;  2UY1 A;  4ANW A;  4JZY A;  3W9F A;  5M72 A;  3GZ1 A;  3ONK A;  1B89 A;  5ENQ D;  2R2L A;  3L6A A;  3MYV A;  4J8Y A;  2KCV A;  1NN7 A;  4O6F A;  4N39 A;  1FPP A;  2CG3 A;  5FTP A;  4GB9 A;  4FLB A;  4IUL A;  3T8M A;  1N9A A;  3I5P A;  4CXT A;  3ZTD B;  4A3T A;  2KBX A;  4TUM A;  3RRM B;  3GZ2 A;  4GZ3 A;  3M52 A;  2IU1 A;  4CDN A;  2RD0 A;  1NFI E;  1VDY A;  3FH8 A;  3JUI A;  3B13 A;  4ZFH A;  4ANV A;  4CEM A;  3QNK A;  4U77 A;  3ZNG B;  5CRU A;  3SFX A;  3T9K A;  4YND A;  3P1U A;  5KJN A;  2PL2 A;  4LCT A;  1MQS A;  1OT8 A;  3LVQ E;  4U95 D;  1KLX A;  4NIK A;  3HYM B;  4B94 A;  4XKB A;  1BD8 A;  1EOD A;  1V55 E;  4LG6 A;  1EOF A;  2YIN A;  2BKG A;  3HVE B;  2Q81 A;  5HKP A;  3WG7 E;  4D10 C;  1VCB B;  1K3Z D;  2AST A;  1OWO A;  1OY3 D;  2CG2 A;  3R9M A;  2QY7 A;  1LD7 A;  3VTY A;  1OCR E;  2I2R A;  3PUK A;  4TRQ A;  5KJL A;  1Z3Y A;  2VSY A;  3ZN3 A;  3ZPJ A;  3ZUN B;  5E76 A;  4U2N A;  4RQI A;  2LXL A;  1IQR A;  2XS1 A;  2FBN A;  3C3O A;  5LLI B;  3E32 A;  4YY8 A;  4I6J C;  2V5F A;  1O5M A;  4UYI A;  2BTD A;  3NOC D;  3SNX A;  2ZU6 B;  3LCA A;  1QBQ A;  1SA5 A;  1WM5 A;  2BED A;  1R29 A;  1UN8 A;  4I43 A;  3DRY A;  1MX2 A;  4F6R D;  3Q49 B;  2XGO A;  3SFZ A;  3UQ3 A;  2XHE A;  2WXG A;  4ANU A;  2PNN A;  3KAE A;  5D0Q D;  2P9U G;  4JEU A;  4WWN A;  1NA3 A;  5G2N A;  1R2B A;  2LNI A;  3TWU A;  2ILR A;  1NA0 A;  1G3N B;  3T5X A;  5A6R A;  2QC9 A;  4WNF A;  1EDU A;  2WXR A;  2IF5 A;  1S1G A;  4WND A;  4Q69 A;  3MKQ A;  3ZFW A;  3HXF A;  3R7R A;  3G2W A;  1OWM A;  2WXM A;  5T4Y A;  3LDZ A;  3CVN A;  2XGM A;  3RRN B;  5G05 C;  4FJZ A;  4U0U A;  1E7U A;  4I6E A;  2ETC A;  3FTX A;  3M8V A;  5FTA A;  3BUA A;  3PH0 C;  5H7P A;  4J8D A;  2J07 A;  3AU4 A;  3TWS A;  2J4B A;  3DSU A;  5ARG A;  4FC8 A;  3MV3 B;  2WXK A;  3CKB A;  3WSO B;  3SZ7 A;  4EPZ A;  2H6F A;  4UI9 K;  1S70 B;  3AJI A;  3RK6 A;  4W9C B;  5H7H A;  3VTX A;  3DPD A;  2VGX B;  2ZXW E;  4HRN A;  3PE3 A;  2QFC A;  4H7X A;  2P9P G;  5BXO A;  1MX6 A;  3CGH A;  2A5E A;  1KPS B;  2J08 A;  1D9S A;  3ZKJ A;  1NI1 A;  2ETA A;  3E4U A;  3QAQ A;  2HE0 A;  4UWL A;  4WNE A;  4AIF A;  1MX4 A;  3QK0 A;  5HI7 A;  2UWJ G;  3CV0 A;  3RKV A;  4DX5 D;  5BNW A;  5AN8 A;  2Y3A A;  1LD8 A;  2XS8 A;  3D9M A;  1N94 A;  5A15 A;  3CR3 A;  5ARF A;  4JPS A;  3V30 A;  3ZXS A;  2MYO A;  2IOS A;  3DRA A;  4KZC A;  2EQX A;  2V8S E;  4J8Z A;  5FQ7 A;  3CHS A;  3C5R A;  1ELW A;  2RFA A;  2PM7 A;  1QDV A;  2NN2 A;  3FFL A;  4GYO A;  4NUR A;  3HDX A;  4TXQ A;  4HXI A;  4FHK A;  4F1P A;  5G04 J;  4GA1 A;  4I17 A;  4HQD A;  5JHB A;  4YVO A;  3RO3 A;  2I9C A;  3CQC B;  1N11 A;  5FQ4 A;  3FTS A;  3ZXP A;  1UJK A;  1FS2 B;  3UT4 A;  2I1J A;  2AXU A;  3AG1 E;  4BY6 A;  3OTN A;  1N4Q A;  2H6H A;  1TNO A;  4EZK A;  1H2T C;  3ASD A;  2Y4U A;  5BUZ A;  3TXM A;  3HU6 A;  4KVM A;  5AAO A;  2WM9 A;  3U66 A;  2EIM E;  1YMP A;  5IY5 E;  2OVB A;  1FT1 A;  4B9K B;  1OXJ A;  4BET A;  5EIL A;  1NEX A;  2OV8 A;  3ZIM A;  4W9J B;  2DYR E;  3FUJ A;  2KCL A;  2YY9 A;  5KJK A;  4DJA A;  4U63 A;  4WWP A;  4FA6 A;  4CXI A;  3PEV B;  5KCM A;  2YQ8 A;  4BKS B;  2KC7 A;  4ILH B;  4CXJ A;  3UTM A;  5BXB A;  3ZU7 B;  4W9R A;  5EIB E;  4ILG A;  3V79 K;  3NZU A;  1E8Z A;  4JEH A;  1LM8 C;  2I6H A;  1UW4 B;  4GA0 A;  4GYY A;  4WWO A;  1TR4 A;  1HG2 A;  2M63 A;  5JH5 B;  1EOE A;  1W3B A;  2DBA A;  3Q9U C;  2P9L G;  2VSN A;  4OAU C;  3FEY A;  1QDW A;  3OHV A;  1FS1 B;  3FTY A;  1NZN A;  1QNF A;  3BEE A;  1FVF A;  4JD2 G;  3ZYK A;  3QC1 A;  3OXL A;  5EKQ D;  1FQV B;  5EN5 D;  1DCE A;  4JB8 P;  4U8Y D;  2VGY A;  4U0S A;  4UIJ A;  1BUO A;  1TNZ A;  4U7E B;  4U8V D;  3QAR A;  3KD7 A;  3V2X A;  4UQZ A;  1L5J A;  1KT0 A;  2WXQ A;  4U8H A;  2X6J A;  4J7W A;  4PS7 A;  4LRZ A;  2CFU A;  5FT9 A;  2X38 A;  4HRM B;  3PDN A;  4HOQ A;  4WAF A;  3FHE A;  1ZU2 A;  3FY4 A;  5FJY A;  4CZ2 D;  5LCW J;  5FZS A;  3GA1 A;  2P58 C;  3KEZ A;  4IRU A;  3DCG B;  4N3A A;  3FUF A;  4F3V A;  1N0R A;  2OVP A;  4Y6C A;  5BXH A;  4CRW A;  3SY2 A;  4NRH B;  3SF4 A;  3L82 A;  5HRY A;  5J08 A;  4AP2 A;  4C48 B;  3BQO A;  2X3M A;  4GCN A;  3RSE G;  3JQ1 A;  5ITZ F;  1UN9 A;  1K1A A;  4W9E B;  4U96 D;  5AAR A;  3C6O A;  3GYZ A;  3SBS A;  5ENO D;  2B0O E;  1SZ9 A;  2XPZ A;  2IZV C;  2F8X K;  4MBG A;  4I1O B;  3ZHE A;  4K5B A;  1UOH A;  2AVP A;  5C1D A;  4HI9 A;  2XZD G;  2C9W C;  5G04 C;  2XZT G;  2ZGD A;  4O1P A;  3HG0 D;  3RRU A;  3O48 A;  1HF8 A;  3HRA A;  3C72 A;  2LSU A;  3CHO A;  5LFA A;  2IF4 A;  4H7Y A;  4JHK A;  4JA7 A;  3FUK A;  3C98 A;  1V54 E;  3L22 A;  3J5Q B;  1YCS B;  4G1T A;  2KCK A;  3LXU X;  3EU9 A;  1X81 A;  4TUU A;  5G05 J;  4G11 A;  3LYA A;  1OWN A;  3MKS A;  4KT6 B;  1IHB A;  2Y0B G;  2KXP C;  2WXI A;  5EYL A;  2L0T B;  3FH7 A;  3P2B A;  2DZO A;  4B8A A;  3B7S A;  2VGE A;  2VTB A;  4AWJ B;  4DLO A;  5EUP A;  4AJY C;  4OVV A;  1O1T A;  3B7U X;  4K03 A;  3UIP C;  5CCL A;  3FUL A;  3MJW A;  2AXZ A;  4N5C A;  3ENE A;  4A1G A;  3TG5 A;  2KZT A;  4DX1 A;  2H6G A;  3UI2 A;  2Y1L E;  3S7B A;  5DAD A;  4GZC A;  4YDE A;  4ATG A;  4DX6 D;  3C6P A;  4GTT A;  4FHJ A;  1PAQ A;  3ZHE B;  1OCO E;  4HVB A;  3ULY A;  2MOW A;  5BV1 A;  3CSF A;  4G8L A;  2OVR A;  4HOU A;  3EDT B;  4ZGC A;  4XEI G;  3S7D A;  5HQ8 A;  2DIW A;  3EHR A;  3IXE A;  3UT8 A;  3PNT B;  1HV2 A;  1TN6 A;  2XEH A;  4EZJ A;  1LQB B;  4DI4 A;  2E31 B;  2JAB A;  2JLB A;  5AJL A;  5B1A E;  3ZYQ A;  3OXG A;  4KVO A;  3FKC A;  2UY1 B;  3U64 A;  4N2Q A;  4W9H B;  1H6K A;  3LS8 A;  2EIK E;  1IXV A;  5FZQ A;  5KNH D;  3I4R B;  1EXB E;  4LNU D;  5LCW C;  3Q75 A;  1AWC B;  3KEA A;  5A23 A;  4BFR A;  4KBQ A;  4ACL A;  3JYS A;  2P2C P;  2VKP A;  5KWD A;  5CED B;  3TL5 A;  3EIQ C;  3MV2 B;  3QWV A;  4DPR A;  4QFV A;  2P9I G;  2WXJ A;  3ML9 A;  4BT9 A;  3HHM A;  2VSO E;  3B7B A;  4JXT A;  3OXF A;  1H0A A;  3AS4 A;  3ASG A;  1O1R A;  4UQX A;  4J0U A;  3CVW A;  3PE4 A;  2KZT B;  4L23 A;  2IQC A;  3ZRC B;  5KJM A;  4LER A;  3AS8 A;  3G2V A;  1FCH A;  1HO8 A;  3T5V A;  3FUD A;  4OAV B;  1SW6 A;  4DRX E;  2X6K A;  3EIJ A;  2IFU A;  4G2V A;  1N52 A;  3C3Q A;  1DSX A;  1DC2 A;  1N0Q A;  3ASH A;  4C9B B;  3APD A;  1U3C A;  4EOZ A;  3OGL A;  1MJ0 A;  2L6B A;  3NF1 A;  3ASO E;  5A7D B;  2XPY A;  2GGF A;  5CER B;  1E8W A;  1SVX A;  3ISM C;  5CMY A;  5FQ6 A;  2DYS E;  4U07 A;  2NZ0 B;  4M3O A;  3DXM G;  2GRL A;  3CQG B;  2ZGG A;  1S64 A;  2X6H A;  4MRU A;  2DCP A;  2IJG X;  4CGV A;  2XRZ A;  4XI0 A;  4N3B A;  2ETB A;  3Q5M A;  2LUH A;  3MZL B;  2BF0 X;  4HS2 A;  3D9J A;  4QQI A;  4F7A A;  1HG5 A;  2Y4T A;  2Y69 E;  4A1S A;  1INZ A;  1NP7 A;  5G55 A;  3B7R L;  4B93 B;  3UM2 A;  3SBT B;  3FUN A;  3UXG A;  1A17 A;  1EPU A;  3AS5 A;  2Q7F A;  4GTV A;  3DSW A;  2P9S G;  3ONL A;  1WG0 A;  5AQ9 A;  2E2E A;  3F6Q A;  4I1A A;  4PDX A;  4E6H A;  4JC8 A;  3DWL G;  4XX5 A;  2V0P A;  3FP3 A;  3PZ1 A;  4A55 A;  2IO2 C;  4U2M A;  1TJF A;  4LNB A;  3U4T A;  2LSV A;  3CVU A;  3I4G A;  3FU6 A;  3TWT A;  1Y6I A;  3PZD A;  3ASN E;  1ELR A;  3RAU A;  2R59 A;  4UWF A;  3HIZ A;  3MCX A;  3MKQ B;  5CCM A;  1MYO A;  2WXO A;  2R05 A;  2V4H C;  2DVW A;  4J6I A;  2PQR A;  2J49 A;  5CBN A;  1ZB1 A;  3BU8 A;  3CVQ A;  3CK7 A;  5CRV A;  5CEC B;  2GRP B;  2L0I A;  3RO2 A;  2P1Q A;  3KSL A;  2A4Z A;  4JTC B;  2C0L A;  2EIL E;  3IHV A;  3DST A;  2I1K A;  4XE0 A;  5LP0 A;  4DX7 D;  1BPO A;  4GMR A;  2P1M A;  4GMJ A;  4JTD B;  2PM6 A;  4JHR A;  2CFZ A;  1P22 B;  3CST A;  1SA4 A;  2IEJ A;  2OOE A;  2C0M A;  2R5S A;  2RG8 A;  2E32 B;  3IV0 A;  4BTB A;  1E96 B;  2MHK A;  4CP3 A;  4AV7 A;  4B95 B;  1A68 A;  5AQA A;  1QZ2 A;  5FZR A;  4KZ0 A;  1IKN D;  1QQE A;  4PH4 B;  2BKK B;  1H2U A;  4BEP A;  5JJT A;  2WXN A;  4ZHB A;  2X6I A;  3MX3 A;  3TAX A;  4EHM A;  4LSZ E;  4JW1 A;  1K8K G;  3C3R A;  3ZKJ B;  3UKU G;  4CYM D;  4EBA A;  4G26 A;  4MLP A;  2GRQ B;  4FP7 A;  3IEG A;  3TJP A;  4N9F 5;  3L08 A;  4W9K B;  2FO7 A;  2R9R B;  3QDN A;  4WUY A;  2H6I A;  3N71 A;  1OUV A;  3UMV A;  2V5Q C;  2FNJ C;  1YYH A;  3TWV A;  1HH8 A;  3DRX A;  2BUG A;  3AU5 A;  4XKC A;  1E7V A;  3V31 A;  1DVP A;  4GZ6 A;  4JA9 A;  4P29 A;  3IHY A;  3B7T A;  2PQN A;  1P5Q A;  3ESK A;  4RVB A;  3ZGQ A;  3DPY A;  4W9H H;  2KM4 A;  5AIJ A;  3CHM A;  4AOF A;  1HS6 A;  1ELK A;  2WXF A;  3HXE A;  2ION A;  4HI8 A;  5HS0 A;  3PEU B;  4FU3 A;  4V3I A;  4WQO C;  3TXN A;  2MRI A;  2VSX E;  1BLX B;  2WMN A;  3Q15 A;  2LAI A;  1X5B A;  5A6C A;  4GTR A;  1TNB A;  3AG3 E;  1UG3 A;  5JHA A;  1H2V C;  3UT7 A;  3D9K A;  3FWV A;  1TN8 A;  2E0I A;  2XEN A;  3G2S A;  3NAW A;  5KNG A;  1QYM A;  4CRH A;  4L2Y A;  1N4S A;  1BI7 B;  2GRM A;  1SZA A;  3JXJ A;  3NZS A;  4AY5 A;  4KMO A;  5JJ7 A;  2VYI A;  1HU3 A;  2OVF A;  4U0Z A;  4CGW A;  3X2Q E;  2FF4 A;  4BER A;  4DUI A;  3L9T A;  3ULQ A;  2P9K G;  3R9A B;  3QKY A;  4TXP A;  5ANR A;  3LKU A;  3SD5 A;  2DZN A;  4Z68 A;  3QWW A;  2NC9 A;  4BKT B;  2VPK A;  3GZS A;  1TN7 A;  4ACK A;  4I9E A;  1CS3 A;  3D9H A;  5BW8 C;  3E33 A;  2C2L A;  3UM1 A;  3J5P A;  4UI9 J;  4FUL A;  4HBD A;  4CDR A;  2WQ6 A;  1MZC A;  5BXD A;  4GA2 A;  3T8K A;  2PPI A;  3RJV A;  5AYW D;  3JXI A;  3RIB A;  1SQM A;  4MS6 A;  2FUL A;  5HZG C;  3FTW A;  4XZ4 A;  5H7G A;  1TYQ G;  3CHR A;  1K1B A;  3HXC A;  4F53 A;  3M5B A;  1E90 A;  3ZEF A;  4DX2 A;  2IOL A;  3DEO A;  3C6N A;  3I3N A;  2OCC E;  2ZIR A;  5FIO A;  4EQF A;  3TWW A;  3FU5 A;  3ULE G;  3L54 A;  1PC2 A;  4GTQ A;  5B3S E;  3ZYM A;  4JTA B;  3VLE A;  3OAW A;  1IHG A;  3E37 A;  4LEU A;  4ILI A;  3RU0 A;  3Q79 A;  3E34 A;  1TEZ A;  3L16 A;  1JCR A;  4UWG A;  1U2V G;  4AXH A;  4BSX A;  2RFM A;  2HR2 A;  4HOR A;  4TV3 A;  4PS8 A;  2IO3 C;  4OVU A;  2EIJ E;  3R7Q A;  4FJY A;  3MEK A;  4GPK A;  2FO1 E;  2J4D A;  5JMN D;  5JA4 D;  3TGO A;  3QJZ A;  2QYJ A;  2X6F A;  2HO1 A;  2XCB A;  2DWZ A;  3AAA C;  1E8X A;  2RKK A;  1HZ4 A;  3D9N A;  4G25 A;  4I1M A;  4BES A;  3WXX A;  3FTV A;  4YVQ C;  3APC A;  3BIM A;  2F8Y A;  4W9F B;  5D66 A;  4AVX A;  3FUI A;  3L2O A;  3L17 A;  5BV0 A;  2FI7 A;  2A5U A;  3V2O A;  3KVT A;  3V7D A;  3SFY A;  2XRY A;  3OGM A;  1D8D A;  4PUC A;  1H6P A;  5FWQ A;  5AQ7 A;  3FU0 A;  3EHN A;  2R17 C;  3SHF A;  2R02 A;  4R7L A;  4JHJ A;  3Q73 A;  3LUT B;  3CVP A;  4NQ0 A;  4HFG A;  1JWG A;  5BXU A;  3TWX A;  3E4B A;  3CK9 A;  4JL0 A;  1WY6 A;  4G8K A;  3BG0 B;  5ENS D;  4N5Q A;  1OCZ E;  1Y8M A;  2XEV A;  3KS2 A;  1WAO 1;  2HYZ A;  4AJW A;  4HRL A;  3EHM A;  4ZOU A;  3ZRH A;  4HLE A;  3QOU A;  2VTB B;  5LX8 A;  1FT2 A;  1R28 A;  4G23 A;  5ENR D;  4CT0 A;  3CVL A;  4TXR A;  3IBE A;  1TNY A;  2I2O A;  4FAD A;  3M4T A;  1Z5S C;  3CVY A;  5LOZ A;  1OWP A;  3CK8 A;  1S63 A;  1S0P A;  1HXI A;  5CMW A;  4GYW A;  1N4R A;  1N95 A;  3ABK E;  2XQ0 A;  3FTZ A;  3SO8 A;  2EIN E;  4G24 A;  4UI9 C;  3CKC A;  2VGX A;  3UIN C;  3JQ0 A;  4UUC A;  4ME2 A;  3EUV A;  3FUE A;  4GTO A;  2JEK A;  5EYP F;  4BT8 A;  3NB2 A;  4RG9 A;  4EBA G;  2OND A;  2NYJ A;  2F0Y A;  1LDK D;  3G2T A;  3VLF A;  3ZRF B;  1PY1 A;  4W9G B;  2WQ7 A;  5T3R A;  3S2A A;  4ABN A;  4FLH A;  2XEE A;  3CHP A;  2WXP A;  1KT1 A;  3LY9 A;  3Q7F A;  3FTU A;  2LAH A;  1OCC E;  4IN3 B;  2YNQ A;  4W9D B;  3D9O A;  4U04 A;  5CEA A;  3D3M A;  2WQH A;  3SQV A;  3W9G A;  3PRE A;  2AJA A;  2Z8H A;  4YDO A;  3IKO B;  2WB2 A;  2F37 A;  3ASF A;  5ANL A;  3FUH A;  4HOT A;  1NL4 A;  1LTX A;  3Q7A A;  5C2Y A;  2NXP A;  2IHC A;  1N4P A;  4J8F A;  5BPP A;  5IBK A;  3HQI A;  4I9C A;  3LPZ A;  3PS6 A;  3EHQ A;  2GRR B;  4BWR A;  3QB2 A;  3O4Z A;  3AG2 E;  5E75 A;  4UQY A;  3CLJ A;  5AQB A;  1HE8 A;  3TWQ A;  5AEN A;  4HNA D;  4GTS A;  3FEX A;  3APF A;  3FH5 A;  2WXH A;  4MKT A;  4ANX A;  5KBA A;  2CHZ A;  4WNG A;  2IY0 C;  3K9I A;  2XGS A;  2XCC A;  1H19 A;  3DSS A;  4CDM A;  4GZD A;  4AEZ C;  3CHQ A;  1JCQ A;  4LNG A;  4EEC A;  1KZO A;  1TNU A;  4I2Z A;  4L2L A;  2WMO A;  2GRN B;  2ZIS A;  3U9W A;  5CHE E;  1DCQ A;  3URZ A;  2VQ2 A;  4XI9 A;  2AWI A;  3TG4 A;  3CIA A;  4HLL A;  4APO A;  4URK A;  4K5A B;  4DK5 A;  2ASS A;  4PS3 A;  5AJD A;  4UWK A;  3JUE A;  3LY8 A;  2WPV A;  4BGC A;  3JCK C;  3FU3 A;  2YHE A;  1JUQ A;  3DSV A;  4J8S A;  2CHX A;  1Z3X A;  2FEZ A;  4K5C A;  4Q96 A;  3S7F A;  4CCA A;  2QYU A;  4RG6 A;  3LVR E;  2NSZ A;  1RW2 A;  1UJJ A;  4GML A;  4K0R A;  3D9L A;  2J09 A;  3PVL A;  1BI8 B;  5HYW B;  2P1N A;  3HTM A;  3L13 A;  1AP7 A;  4Y6W A;  1N54 A;  3ZYL A;  1D8E A;  3UPV A;  3DBS A;  3EU5 A;  4L1B A;  5B1B E;  1KZP A;  5CBO A;  4HOS A;  3LBZ A;  3MKR A;  5J90 A;  3QWP A;  2JZ3 C;  4F1S A;  3NBN B;  1YA0 A;  3CEQ A;  4W9L B;  4O60 A;  4I6J A;  2L6J A;  1XGW A;  3UM0 A;  4ATZ D;  4CT4 A;  5FQ8 A;  4N3C A;  5D0O D;  4L7T A;  4N2S A;  1HFA A;  5D2M C;  4GU5 A;  1A5E A;  3VLD A;  3OGK A;  5EX0 A;  2V4L A;  4B89 A;  1T1D A;  4EZL A;  4B0Z A;  3ZUV B;  3CVX A;  5DBK A;  3SGH A;  2P1O A;  4GTM A;  1ZBP A;  3Q47 B;  3NOG D;  4GCO A;  3PRZ A;  3LJN A;  3ZTC B;  2GRO B;  3FDH A;  1E8Y A;  3TWR A;  3PUJ A;  1MHQ A;  4BSZ B;  1JWF A;  1RZ4 A;  2AXV A;  3ESL A;  4JGH C;  5ENT D;  1Z6T A;  2J9Q A;  3KSQ A;  1LF8 A;  3EJN A;  5ENN A;  1XNF A;  3UKR G;  3LEW A;  3SI5 A;  3DRZ A;  4X8Q A;  3B84 A;  4XIF A;  3DEP A;  5BO4 C;  3CVV A;  4GZ5 A;  1TJC A;  1FVH A;  3HXD A;  3OHU A;  2YHC A;  4A63 B;  3PZ2 A;  1DNP A;  4O1O A;  4M7C A;  3UX4 A;  1BU9 A;  1H6O A;  4I2W A;  3AG4 E;  2AW6 A;  2XPI A;  2PZI A;  1IYG A;  4GTP A;  3PZ3 A;  2LXM A;  4B9K E;  5T8I A;  3E30 A;  2WXL A;  4C0M A;  4HB5 A;  4RSY A;  4GPM A;  2J8S D;  2B6C A;  5DIZ A;  4E85 A;  3Q9N C;  4AM9 A;  3PZ4 A;  4OYS A;  3UIO C;  5JJ6 A;  4UWH A;  5ENP D;  1IQU A;  1GW6 A;  4B8C B;  3ZVV A;  3Q4A B;  4DI3 A;  3ABL E;  2A79 B;  4KXK B;  3LJ3 A;  5BT1 A;  3ML8 A;  1EF1 C;  3UUX A;  3U3W A;  5EDS A;  4IYP A;  3BG1 B;  4NAC A;  3D9I A;  4APF A;  3DSX A;  1Q2Z A;  4C0E A;  4JVS A;  2KAT A;  3B95 A;  1HX8 A;  4DLQ A;  4RLY A;  3S7J A;  4BTA A;  4AY6 A;  3UM3 A;  3G2U A;  3NQP A;  3D9P A;  2L9B A;  3FUM A;  2WVI A;  3GW4 A;  2OEV A;  3ZNG A;  4A3V A;  3Q78 A;  3LNM B;  2QZA A;  4GAA A;  4KYO B;  5EID A;  2P9N G;  3LY7 A;  1WDY A;  5EX3 A;  4BX9 A;  5DAF A;  2VJ8 A;  2LO6 A;  2OEW A;  4BX8 A;  1U3D A;  3ZW3 A;  2R03 A;  1JPL A;  1EYH A;  3HVE A;  3MGB A;  2HM8 A;  3HXB A;  2P1P A;  4J8E A;  4I6G A;  3DXK G;  4LUN U;  1OWL A;  2MA9 C;  1JCS A;  3MA5 A;  4L9P A;  1O1S A;  4YDW A;  2OVQ A;  2GW1 A;  4YDY A; 
#chains in the Genus database with same CATH homology
 2I2O A;  3PNL B;  4FAD A;  4GYY A;  3M4T A;  2CHW A;  3I4G A;  4WWO A;  3FU6 A;  3CVY A;  4W9I B;  1HG2 A;  1Y6I A;  3PZD A;  2M63 A;  1ELR A;  1OWP A;  4Q94 A;  5LOZ A;  3CK8 A;  2R59 A;  4UWF A;  3HIZ A;  5JH5 B;  1EOE A;  3MCX A;  1S0P A;  1W3B A;  2DBA A;  2UY1 A;  4ANW A;  4JZY A;  1HXI A;  3MKQ B;  2VSN A;  5M72 A;  5CMW A;  3GZ1 A;  5CCM A;  3FEY A;  4GYW A;  1QDW A;  3ONK A;  3OHV A;  1FS1 B;  2XQ0 A;  1B89 A;  3FTZ A;  3FTY A;  3L6A A;  1QNF A;  1NZN A;  3BEE A;  1FVF A;  4G24 A;  4UI9 C;  3CKC A;  2VGX A;  2WXO A;  3MYV A;  3ZYK A;  3QC1 A;  3JQ0 A;  3OXL A;  5EKQ D;  2KCV A;  1NN7 A;  1FQV B;  4O6F A;  4N39 A;  4J6I A;  2PQR A;  4ME2 A;  3FUE A;  2VGY A;  2J49 A;  2JEK A;  2CG3 A;  4U0S A;  3CVQ A;  5FTP A;  3CK7 A;  4UIJ A;  4GB9 A;  4BT8 A;  4FLB A;  4IUL A;  2L0I A;  3T8M A;  3RO2 A;  2P1Q A;  1BUO A;  2A4Z A;  3QAR A;  3KD7 A;  4RG9 A;  4JTC B;  4EBA G;  3I5P A;  4CXT A;  2OND A;  3ZTD B;  2C0L A;  4UQZ A;  3IHV A;  4A3T A;  1LDK D;  1L5J A;  3G2T A;  1KT0 A;  3GZ2 A;  3RRM B;  2WXQ A;  2I1K A;  4GZ3 A;  3M52 A;  4U8H A;  2X6J A;  4XE0 A;  3VLF A;  2IU1 A;  4LRZ A;  2CFU A;  4PS7 A;  2X38 A;  5FT9 A;  5LP0 A;  3ZRF B;  1PY1 A;  4CDN A;  2RD0 A;  3FH8 A;  1VDY A;  4W9G B;  3JUI A;  2WQ7 A;  3PDN A;  1BPO A;  4HOQ A;  4WAF A;  3FHE A;  3B13 A;  5T3R A;  2P1M A;  3S2A A;  4GMJ A;  4ABN A;  4ANV A;  4CEM A;  4FLH A;  4JTD B;  3CHP A;  2PM6 A;  2WXP A;  1ZU2 A;  4JHR A;  1KT1 A;  3FY4 A;  2CFZ A;  3QNK A;  5FJY A;  3LY9 A;  5FZS A;  5LCW J;  4U77 A;  3ZNG B;  1P22 B;  3CST A;  3FTU A;  3GA1 A;  4YND A;  2LAH A;  2P58 C;  3KEZ A;  2OOE A;  2C0M A;  2R5S A;  2RG8 A;  3P1U A;  4IRU A;  5KJN A;  2E32 B;  3IV0 A;  2PL2 A;  4BTB A;  4LCT A;  1E96 B;  3DCG B;  4IN3 B;  2MHK A;  1MQS A;  4N3A A;  4CP3 A;  3FUF A;  4AV7 A;  3LVQ E;  4F3V A;  4B95 B;  1KLX A;  1A68 A;  2OVP A;  2YNQ A;  4Y6C A;  4W9D B;  3HYM B;  4B94 A;  5BXH A;  4CRW A;  1QZ2 A;  4XKB A;  4KZ0 A;  5FZR A;  1EOD A;  3D9O A;  4U04 A;  3D3M A;  1QQE A;  4NRH B;  4PH4 B;  3SF4 A;  1EOF A;  1H2U A;  2YIN A;  2WQH A;  3HVE B;  3PRE A;  5J08 A;  2Q81 A;  4AP2 A;  2X3M A;  4D10 C;  4GCN A;  5JJT A;  2Z8H A;  2WXN A;  3IKO B;  3JQ1 A;  2WB2 A;  1VCB B;  2X6I A;  3MX3 A;  1UN9 A;  2AST A;  3ASF A;  3TAX A;  5ANL A;  4W9E B;  1OWO A;  3FUH A;  4HOT A;  4JW1 A;  3C6O A;  3GYZ A;  3ZKJ B;  3SBS A;  2CG2 A;  4EBA A;  4G26 A;  1SZ9 A;  2XPZ A;  5C2Y A;  2QY7 A;  2IZV C;  4MLP A;  2NXP A;  3VTY A;  2IHC A;  4I1O B;  4J8F A;  5BPP A;  2I2R A;  3ZHE A;  3PUK A;  4FP7 A;  3IEG A;  3HQI A;  4I9C A;  4TRQ A;  3LPZ A;  5KJL A;  5IBK A;  1Z3Y A;  2AVP A;  2VSY A;  5C1D A;  3TJP A;  2C9W C;  3PS6 A;  4N9F 5;  3L08 A;  4W9K B;  4BWR A;  5G04 C;  3ZN3 A;  3QB2 A;  3ZPJ A;  2FO7 A;  3O4Z A;  3ZUN B;  5E76 A;  5E75 A;  4U2N A;  2R9R B;  3QDN A;  4UQY A;  4WUY A;  3N71 A;  1OUV A;  3UMV A;  1IQR A;  3RRU A;  2FBN A;  3CLJ A;  3O48 A;  1HF8 A;  5LLI B;  1HE8 A;  4YY8 A;  2FNJ C;  5AEN A;  1HH8 A;  4I6J C;  2LSU A;  2V5F A;  3CHO A;  5LFA A;  3DRX A;  4UYI A;  2BTD A;  2BUG A;  3AU5 A;  2IF4 A;  3FEX A;  4XKC A;  1E7V A;  1DVP A;  3SNX A;  2ZU6 B;  4H7Y A;  4JHK A;  3LCA A;  3APF A;  3FH5 A;  4JA7 A;  2WXH A;  3FUK A;  4GZ6 A;  4JA9 A;  3C98 A;  4P29 A;  3IHY A;  4MKT A;  4ANX A;  1WM5 A;  1R29 A;  3B7T A;  1UN8 A;  2PQN A;  2CHZ A;  1P5Q A;  3L22 A;  4I43 A;  4WNG A;  3ESK A;  4RVB A;  4G1T A;  3K9I A;  3ZGQ A;  2KCK A;  3DRY A;  3LXU X;  2XGS A;  4TUU A;  5G05 J;  2XCC A;  4G11 A;  1H19 A;  4W9H H;  3LYA A;  3Q49 B;  2KM4 A;  5AIJ A;  2XGO A;  1OWN A;  3CHM A;  4CDM A;  4AOF A;  1HS6 A;  4GZD A;  3SFZ A;  3MKS A;  4KT6 B;  1ELK A;  4AEZ C;  2WXF A;  3UQ3 A;  3CHQ A;  2XHE A;  2WXG A;  2WXI A;  4ANU A;  4EEC A;  2ION A;  3KAE A;  2L0T B;  5D0Q D;  3FH7 A;  3P2B A;  4I2Z A;  4L2L A;  2WMO A;  3PEU B;  4B8A A;  4JEU A;  4FU3 A;  4WWN A;  3B7S A;  1NA3 A;  5CHE E;  5G2N A;  4V3I A;  2LNI A;  2VQ2 A;  3U9W A;  3URZ A;  2VTB A;  1R2B A;  4DLO A;  4WQO C;  4AWJ B;  3TXN A;  4XI9 A;  2AWI A;  2MRI A;  3TG4 A;  3CIA A;  2VSX E;  4APO A;  2ILR A;  4URK A;  2WMN A;  3Q15 A;  1NA0 A;  5EUP A;  2LAI A;  4OVV A;  3T5X A;  5A6R A;  4AJY C;  1X5B A;  5A6C A;  4DK5 A;  2ASS A;  1UG3 A;  5JHA A;  4PS3 A;  5AJD A;  4UWK A;  3B7U X;  4K03 A;  1H2V C;  3LY8 A;  3UT7 A;  2WPV A;  3D9K A;  3FWV A;  4WNF A;  5CCL A;  3FUL A;  4BGC A;  1EDU A;  2E0I A;  3G2S A;  2WXR A;  3JCK C;  3FU3 A;  3MJW A;  2IF5 A;  2AXZ A;  2YHE A;  4N5C A;  1S1G A;  4WND A;  3ENE A;  1JUQ A;  4A1G A;  3TG5 A;  4Q69 A;  4J8S A;  3MKQ A;  2KZT A;  2CHX A;  1Z3X A;  4L2Y A;  3ZFW A;  4CRH A;  2FEZ A;  2GRM A;  4Q96 A;  3S7F A;  4CCA A;  3R7R A;  4RG6 A;  1SZA A;  3G2W A;  3LVR E;  2NSZ A;  1OWM A;  1UJJ A;  2WXM A;  4GML A;  3NZS A;  4AY5 A;  4K0R A;  3D9L A;  5T4Y A;  3S7B A;  4KMO A;  2J09 A;  3LDZ A;  3PVL A;  5JJ7 A;  2VYI A;  2P1N A;  5HYW B;  5DAD A;  3CVN A;  3HTM A;  3L13 A;  2OVF A;  1HU3 A;  4GZC A;  4Y6W A;  4U0Z A;  2XGM A;  4ATG A;  3C6P A;  1N54 A;  3RRN B;  4CGW A;  3ZYL A;  2FF4 A;  4FHJ A;  5G05 C;  3DBS A;  3UPV A;  3ULQ A;  3R9A B;  1PAQ A;  3QKY A;  4L1B A;  3ZHE B;  4FJZ A;  4U0U A;  4HVB A;  5ANR A;  4HOS A;  1E7U A;  3LBZ A;  2MOW A;  4I6E A;  5BV1 A;  3FTX A;  3LKU A;  3M8V A;  5FTA A;  3SD5 A;  3MKR A;  3CSF A;  5J90 A;  2OVR A;  3PH0 C;  4HOU A;  3QWW A;  3QWP A;  3EDT B;  2JZ3 C;  2NC9 A;  4J8D A;  4F1S A;  4BKT B;  2VPK A;  2J07 A;  3GZS A;  4ZGC A;  1YA0 A;  3CEQ A;  4W9L B;  3AU4 A;  3S7D A;  2J4B A;  4ACK A;  2DIW A;  5ARG A;  3UT8 A;  5HQ8 A;  3PNT B;  4I9E A;  1CS3 A;  1HV2 A;  4FC8 A;  5BW8 C;  2C2L A;  4I6J A;  3MV3 B;  4EZJ A;  2L6J A;  1XGW A;  1LQB B;  4CT4 A;  2WXK A;  4DI4 A;  3CKB A;  4UI9 J;  5FQ8 A;  4N3C A;  5D0O D;  4L7T A;  4FUL A;  4N2S A;  1HFA A;  4CDR A;  4GU5 A;  3WSO B;  3SZ7 A;  3VLD A;  4EPZ A;  2E31 B;  2WQ6 A;  2JLB A;  5AJL A;  3OGK A;  5BXD A;  4UI9 K;  3ZYQ A;  5EX0 A;  3OXG A;  4GA2 A;  2V4L A;  4KVO A;  4B89 A;  1T1D A;  2UY1 B;  2PPI A;  3FKC A;  3RJV A;  3U64 A;  4EZL A;  5AYW D;  4B0Z A;  4N2Q A;  3RK6 A;  1H6K A;  3RIB A;  3LS8 A;  1SQM A;  3CVX A;  4W9H B;  4MS6 A;  4W9C B;  5DBK A;  3SGH A;  2FUL A;  2P1O A;  5HZG C;  5FZQ A;  3FTW A;  4XZ4 A;  1ZBP A;  5H7G A;  5H7H A;  3I4R B;  3VTX A;  1EXB E;  3Q47 B;  3CHR A;  3DPD A;  2VGX B;  4GCO A;  3PRZ A;  3ZTC B;  5LCW C;  4F53 A;  3PE3 A;  3FDH A;  1E8Y A;  3PUJ A;  1MHQ A;  1JWF A;  3M5B A;  2AXV A;  3ESL A;  4JGH C;  1E90 A;  2QFC A;  3ZEF A;  4H7X A;  5A23 A;  1Z6T A;  2J9Q A;  2IOL A;  1LF8 A;  4BFR A;  4KBQ A;  4ACL A;  3CGH A;  3EJN A;  3JYS A;  3C6N A;  3I3N A;  2VKP A;  5ENN A;  1XNF A;  2J08 A;  3TL5 A;  3LEW A;  3EIQ C;  3MV2 B;  3SI5 A;  3DRZ A;  3QWV A;  4DPR A;  3E4U A;  4QFV A;  3QAQ A;  2WXJ A;  4UWL A;  3ML9 A;  4BT9 A;  3HHM A;  4WNE A;  2VSO E;  4AIF A;  4EQF A;  4JXT A;  3OXF A;  3FU5 A;  3B84 A;  3L54 A;  3QK0 A;  1PC2 A;  4XIF A;  5HI7 A;  2UWJ G;  3CV0 A;  3RKV A;  5BO4 C;  1H0A A;  3CVV A;  3AS4 A;  4GZ5 A;  3ASG A;  1TJC A;  3ZYM A;  3VLE A;  3OAW A;  4J0U A;  4UQX A;  4JTA B;  1FVH A;  3CVW A;  3PE4 A;  1IHG A;  2KZT B;  4LEU A;  5BNW A;  2YHC A;  3OHU A;  4ILI A;  2Y3A A;  1DNP A;  2IQC A;  4L23 A;  3RU0 A;  3ZRC B;  3UX4 A;  1TEZ A;  3L16 A;  4UWG A;  4I2W A;  4AXH A;  5KJM A;  4LER A;  4BSX A;  2AW6 A;  2XPI A;  3AS8 A;  1FCH A;  3G2V A;  2PZI A;  1HO8 A;  2HR2 A;  3D9M A;  1IYG A;  4HOR A;  5A15 A;  4TV3 A;  3CR3 A;  5ARF A;  4JPS A;  4PS8 A;  4B9K E;  3ZXS A;  3T5V A;  2IOS A;  5T8I A;  4OVU A;  3FUD A;  4KZC A;  2WXL A;  4C0M A;  2X6K A;  4RSY A;  3EIJ A;  3R7Q A;  2EQX A;  2IFU A;  4G2V A;  4FJY A;  3MEK A;  2V8S E;  4GPK A;  1N52 A;  2J4D A;  5DIZ A;  4J8Z A;  4E85 A;  5FQ7 A;  1DSX A;  3CHS A;  4AM9 A;  4OYS A;  1ELW A;  2PM7 A;  3ASH A;  4C9B B;  3APD A;  1QDV A;  5JJ6 A;  4UWH A;  3FFL A;  4GYO A;  2NN2 A;  3TGO A;  4NUR A;  1U3C A;  3QJZ A;  3HDX A;  4EOZ A;  4HXI A;  4FHK A;  3OGL A;  1IQU A;  5G04 J;  1GW6 A;  2X6F A;  4B8C B;  4GA1 A;  4I17 A;  2HO1 A;  3ZVV A;  3Q4A B;  3NF1 A;  4DI3 A;  2A79 B;  4KXK B;  5JHB A;  5A7D B;  3LJ3 A;  2XCB A;  4YVO A;  3RO3 A;  2I9C A;  3CQC B;  5BT1 A;  2XPY A;  3ML8 A;  1EF1 C;  1E8X A;  2GGF A;  5FQ4 A;  3UUX A;  3U3W A;  1HZ4 A;  1E8W A;  5CMY A;  3D9N A;  3FTS A;  4G25 A;  4I1M A;  1UJK A;  5EDS A;  3WXX A;  3FTV A;  4IYP A;  3APC A;  3BG1 B;  4YVQ C;  5FQ6 A;  3UT4 A;  2I1J A;  1FS2 B;  4NAC A;  2AXU A;  4U07 A;  3BIM A;  4W9F B;  3D9I A;  4APF A;  4AVX A;  3FUI A;  4BY6 A;  2NZ0 B;  4M3O A;  3L2O A;  2GRL A;  3OTN A;  3L17 A;  3CQG B;  5BV0 A;  2FI7 A;  4C0E A;  2A5U A;  2X6H A;  4JVS A;  4MRU A;  2DCP A;  2IJG X;  3KVT A;  4CGV A;  2KAT A;  3V7D A;  4EZK A;  1H2T C;  2XRZ A;  3ASD A;  1HX8 A;  4DLQ A;  2XRY A;  3S7J A;  4XI0 A;  2Y4U A;  5BUZ A;  4N3B A;  3OGM A;  3Q5M A;  4PUC A;  3MZL B;  3TXM A;  4BTA A;  5FWQ A;  4AY6 A;  4KVM A;  2BF0 X;  3HU6 A;  2WM9 A;  3FU0 A;  4HS2 A;  3D9J A;  3G2U A;  3NQP A;  3U66 A;  4F7A A;  3D9P A;  3EHN A;  2L9B A;  1HG5 A;  2R17 C;  2Y4T A;  3FUM A;  2WVI A;  3GW4 A;  2OVB A;  3SHF A;  4A1S A;  4B9K B;  4R7L A;  4A3V A;  4JHJ A;  1INZ A;  2OV8 A;  1NP7 A;  5G55 A;  3ZIM A;  1NEX A;  3B7R L;  3LUT B;  3FUJ A;  4W9J B;  3CVP A;  3LNM B;  2KCL A;  3SBT B;  2YY9 A;  3FUN A;  5KJK A;  4NQ0 A;  4HFG A;  4GAA A;  4KYO B;  1JWG A;  1A17 A;  3E4B A;  1EPU A;  3CK9 A;  4DJA A;  4JL0 A;  3AS5 A;  3LY7 A;  4U63 A;  2Q7F A;  4WWP A;  1WY6 A;  5EX3 A;  4BX9 A;  4FA6 A;  3BG0 B;  5DAF A;  4CXI A;  2VJ8 A;  3ONL A;  3PEV B;  2LO6 A;  4BX8 A;  5KCM A;  2YQ8 A;  4BKS B;  1Y8M A;  2E2E A;  2KC7 A;  2XEV A;  1U3D A;  4PDX A;  3KS2 A;  4I1A A;  4ILH B;  1WAO 1;  2HYZ A;  4AJW A;  4JC8 A;  3EHM A;  3ZW3 A;  1JPL A;  4E6H A;  1EYH A;  3HVE A;  4ZOU A;  3MGB A;  4CXJ A;  3ZRH A;  4HLE A;  4XX5 A;  2V0P A;  2HM8 A;  3FP3 A;  2P1P A;  3QOU A;  4J8E A;  2VTB B;  5LX8 A;  4I6G A;  4LUN U;  5BXB A;  4W9R A;  1OWL A;  4G23 A;  4A55 A;  1R28 A;  2MA9 C;  3MA5 A;  4CT0 A;  4ILG A;  4U2M A;  1TJF A;  3NZU A;  1E8Z A;  4JEH A;  3U4T A;  1LM8 C;  3CVL A;  3IBE A;  2OVQ A;  2GW1 A;  2I6H A;  2LSV A;  1UW4 B;  4GA0 A;  3CVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...