3HVEA

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
216
Chain Sequence
SDPQHAARLLRALSSFRERFCDAHLVLDGEEIPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLNDTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLERYVFEAVIRWIAHEIRKVHMKDVMSALWVSGLDSYLREQMLNEPLVREIVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, ligase
molecule keywords Gigaxonin
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 216
sequence length 240
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveA01
2YY9A 4W9HH 4CXIA 3DCGB 4U77A 4W9LB 4WQOC 3HQIA 4U2MA 5BXDA 3ZRCB 1EOEA 3GA1A 4B9KE 4AWJB 3OGKA 1HV2A 2P1NA 4W9FB 4HS2A 1QDVA 3C6NA 3ZKJB 2IHCA 4U2NA 4CXTA 1CS3A 2VKPA 4BKTB 2Q81A 3HVEA 4UIJA 2C9WC 2P1OA 2A79B 3ZTDB 4W9IB 2ASTA 3ZTCB 5LLIB 1R28A 3ZUNB 4I6JC 3LNMB 2IZVC 3M4TA 4AJYC 5H7GA 5HYWB 1QDWA 3M8VA 5BXHA 1T1DA 4BKSB 4BGCA 2Z8HA 2ASSA 1FQVB 4CP3A 4APFA 4JTCB 2OVPA 2E31B 4JGHC 1A68A 4W9CB 5FTAA 1R29A 4ZOUA 1FS2B 4JTAB 3HVEB 1FS1B 2JZ3C 2OVQA 3B84A 5DAFA 5HZGC 2R9RB 4JTDB 1DSXA 1LQBB 4W9JB 2IF5A 2I2RA 3C6PA 2VPKA 5H7HA 3MKSA 4AP2A 1NN7A 5BO4C 1NEXA 1S1GA 2MA9C 3BIMA 2P1MA 3I3NA 4EOZA 3ZRFB 5EUPA 1R2BA 5JH5B 1EOFA 5BXBA 4J8ZA 2NN2A 3WSOB 3ZNGB 1BUOA 3OHUA 3V7DA 5A6RA 1EODA 4B9KB 4N9F5 3OGLA 4W9KB 4CRHA 4UYIA 2FNJC 3E4UA 1EXBE 1LDKD 2P1PA 5DADA 4W9HB 3C6OA 4W9GB 2P1QA 4CXJA 3LBZA 4HXIA 1VCBB 2E32B 3M5BA 1LM8C 2OVRA 4W9EB 3OHVA 4B95B 3L2OA 5IBKA 2NZ0B 5A15A 2EQXA 3HU6A 3HTMA 2PPIA 3LUTB 3DRZA 3FKCA 3OGMA 4W9DB 3M52A 3KVTA 1P22B
chains in the Genus database with same CATH superfamily
3CEQA 3CGHA 5HS0A 2ZGDA 5EKQD 2AW6A 4BKTB 3FH8A 3FUEA 1D8DA 3C3RA 2P1OA 4DPRA 2VQ2A 3QDNA 4AJWA 1HO8A 2PZIA 3NQPA 2LAHA 1WG0A 4V3IA 1N52A 5HI7A 3KD7A 1QDWA 2Y4TA 3AJIA 3SFYA 3ULYA 4DI3A 3P1UA 3CIAA 3HYMB 2CHWA 2AVPA 4GCOA 2WXFA 1Z3XA 4W9RA 4PDXA 4Q69A 3ENEA 3DXMG 1H19A 1TNUA 4GZ6A 4FP7A 3OTNA 4FHKA 3RKVA 3Q47B 1N4QA 4XEIG 3ZYMA 1FCHA 2CG3A 3BIMA 5C1DA 4FLBA 2WB2A 4KVOA 4CEMA 4DX7D 2V5FA 2I9CA 4K0RA 2VGXB 2L6JA 2VSOE 4I17A 4HORA 4QQIA 4I6EA 1N4SA 5A6RA 1GW6A 3I5PA 1O1SA 3ULEG 3UM1A 1HS6A 3CVLA 3QWWA 1LM8C 2WQ6A 1KPSB 1FVFA 4XKBA 3B7RL 3FTSA 2WMOA 2J8SD 1HU3A 4DI4A 3CVPA 2J49A 2Y4UA 3QAQA 2YINA 1MX2A 2OEWA 5G2NA 3E30A 1DCQA 1K1AA 4DUIA 2XRZA 4WUYA 3CQGB 1JCSA 3ZEFA 3TWWA 3E37A 2ASTA 1DVPA 1HXIA 5HYWB 4F1SA 4BKSB 2X6IA 2Z8HA 4JZYA 1H2UA 3OXFA 4I1AA 5KCMA 3HG0D 5LFAA 2LO6A 2VGXA 5FQ4A 5DAFA 1MZCA 4N39A 2QY7A 4M3OA 2Q7FA 1XNFA 4XI9A 3FTZA 3LS8A 4HOSA 5AQAA 3V2OA 1NA3A 1UG3A 2J4BA 1MHQA 1TNYA 4CGWA 1MYOA 3CVWA 2WXNA 4U0SA 5BXBA 2NSZA 4GYWA 3ZNGB 4CRHA 3FFLA 2R59A 5FT9A 4J7WA 4YDWA 4BEPA 1NI1A 4UWGA 1NZNA 2ETCA 4KVMA 3FU6A 2V5QC 3L9TA 4H7YA 2P9IG 4HNAD 1VCBB 3UINC 2MYOA 4ATGA 2WXRA 4JB8P 4LNUD 3AG1E 2NZ0B 5FQ8A 2EQXA 4U8YD 5DIZA 3FKCA 1KZOA 5EYPF 3PNLB 4FC8A 4HLEA 4A55A 3IBEA 4AOFA 1SW6A 3HXEA 1KZPA 4I9CA 4U04A 3IHYA 2VKPA 4HQDA 2Q81A 2I2OA 2KCLA 3ZTDB 4KBQA 3DBSA 2H6FA 3K9IA 5E75A 4ACKA 3QWPA 3ZIMA 4JA9A 4KYOB 1E8WA 3Q7FA 4DJAA 3LY7A 3C5RA 4LNBA 1R29A 5HRYA 2JZ3C 4LSZE 3HXCA 2OVQA 2P9KG 3D9KA 3C3OA 4OAVB 1AP7A 4X8QA 4G26A 4Y6WA 3NB2A 2QC9A 4L23A 3EHRA 1FVHA 4HI9A 4DX5D 4F6RD 3OGLA 4HOQA 4UYIA 3CHQA 3LVQE 3HHMA 4UQXA 4U0ZA 3UKRG 4TUMA 1TNOA 3ZYQA 2ZU6B 3M5BA 4YDEA 1KT0A 2R03A 4NACA 1G3NB 2WQHA 4EZLA 4B89A 1FPPA 4K5CA 2XS8A 4GZCA 3KSQA 1OWNA 3TG5A 3IXEA 4RQIA 3SFZA 1KT1A 3CR3A 1E90A 1HV2A 2YHEA 1IQUA 2AXUA 3ASOE 4L2YA 4U2NA 3VTXA 4TV3A 3DSWA 5CMWA 2J07A 1JPLA 5BXUA 1SZAA 1HF8A 5CBNA 4DLQA 4O6FA 2XCBA 1D8EA 1H6OA 2WXPA 3LEWA 2L0TB 4CT4A 2XCCA 3M8VA 1T1DA 1TJCA 2V8SE 1OWMA 4EPZA 3N71A 1OWOA 1RZ4A 3CV0A 4ANVA 3TAXA 4MRUA 5EIBE 2X6HA 3ABLE 3CVYA 2IF5A 5JA4D 3TXMA 3MEKA 1N95A 2XRYA 1X5BA 3UUXA 1H2VC 3QWVA 3QNKA 3FEXA 3T9KA 2BUGA 3UI2A 2YNQA 3CVNA 4G2VA 2P9SG 4UI9K 3GZSA 3R7QA 1EF1C 2XENA 3RO2A 3UMVA 2FI7A 4AEZC 2P1QA 1EDUA 3LJNA 4WNFA 2HR2A 3LKUA 2E32B 2Y69E 3QARA 4GTPA 5BNWA 2VGEA 3L2OA 3E34A 3Q73A 4BY6A 3ZN3A 5ENTD 3CKBA 4LERA 3UTMA 2X6FA 3GYZA 4LRZA 1P22B 3TWQA 1DCEA 3L6AA 1ELWA 2WMNA 4BETA 3JUEA 4U2MA 2EINE 3Q49B 5KJMA 4KT6B 4MBGA 1E7VA 1QDVA 3ZKJB 2NC9A 3CHSA 1BI7B 5AAOA 4JVSA 2KZTB 4XI0A 3CVXA 2XPYA 4UWFA 4WWPA 4AVXA 3L17A 2XS1A 1RW2A 5G04J 3EHMA 3DSVA 3I4RB 2ZIRA 1FQVB 5CEDB 2PL2A 3FWVA 1YCSB 3SBSA 2E2EA 2YQ8A 5KJNA 1FS1B 3U3WA 3MJWA 5ENPD 3E32A 2X6JA 2R9RB 4MLPA 2CG2A 2VSNA 3KAEA 5BV1A 4HLLA 4TRQA 1K8KG 3FUDA 3CK8A 4GTRA 2Y3AA 4GA2A 3ZYKA 4B94A 2ETAA 3AG3E 4I2WA 1UOHA 4C9BB 3PZ3A 3PEUB 1EODA 3L22A 4UQZA 1EXBE 3BG0B 4W9HB 3S7BA 2GRNB 1K1BA 2FEZA 4GTVA 2OVRA 4U96D 3ZKJA 5E76A 2LAIA 3QJZA 3IKOB 3MKQB 4M7CA 4BSZB 5FWQA 3NBNB 4GPMA 2KZTA 2MOWA 5KWDA 4H7XA 3D3MA 4ILHB 4I6JA 2A4ZA 2RFAA 4GU5A 3HXBA 3Q75A 4FA6A 3UXGA 3WXXA 3AAAC 1PAQA 5JHBA 5ENOD 3FTUA 4J8EA 4UI9J 4XZ4A 2ETBA 2XHEA 4GMRA 3TXNA 1HH8A 4DLOA 2XPZA 4GMLA 4RVBA 4I6JC 1MX6A 4AJYC 2IQCA 2EIME 5BXHA 4CT0A 4HBDA 4APFA 2WM9A 2CFZA 5HZGC 4G8KA 1N0RA 3DPYA 3KEZA 5T4YA 3G2WA 1WAO1 3G2VA 4U8HA 3B7UX 1N0QA 3PRZA 5BPPA 2AXVA 3CVVA 1HE8A 2GRPB 1TJFA 3CKCA 3CVQA 4CGVA 4GTOA 3MKQA 2V4LA 2J08A 3FH7A 2WXOA 2CHXA 3ULQA 3QB2A 4N9F5 2DVWA 3B7SA 3CHOA 4YVQC 1IHGA 3TWVA 1LD8A 2KC7A 4JHKA 3NF1A 1HX8A 3FEYA 4HXIA 3AU4A 1OUVA 3V30A 3OHVA 4U0UA 2I1JA 3FDHA 4JEHA 2GROB 2R05A 3ASNE 3LUTB 3DRZA 2XEVA 2LXLA 1S64A 2A5EA 3CSFA 1NFIE 3HQIA 3ASFA 1E8XA 1E8YA 4B9KE 4O60A 2VJ8A 3LYAA 4J8DA 2L9BA 1CS3A 2IFUA 3CQCB 3T5VA 4FJZA 2FO7A 2P9PG 2QYJA 2IF4A 2KCVA 2F0YA 1IYGA 1O1TA 5A23A 3LNMB 2IZVC 3FY4A 5CERB 4JA7A 3FU0A 2J4DA 3WG7E 3SHFA 1N94A 4JTCB 1FS2B 2WQ7A 3SF4A 2DZNA 4GZ5A 3B84A 4B8AA 2OEVA 2IY0C 3RK6A 4TXRA 2KXPC 3S7FA 4YDYA 3FH5A 4ZGCA 1HG2A 3URZA 1Z6TA 3J5PA 1R2BA 3KSLA 4MKTA 4U7EB 4EBAG 1S70B 3CK7A 3TL5A 5D2MC 3OHUA 3SGHA 4K5AB 4F1PA 3V79K 5LCWJ 4W9GB 4CXJA 4CZ2D 1H6PA 3DEPA 1QYMA 4BSXA 5IBKA 4IYPA 2CHZA 3SI5A 3LY9A 2PM6A 4U07A 2LNIA 3HTMA 2AWIA 1IKND 4HRLA 4ABNA 4LG6A 5FIOA 3G2UA 2VTBB 4MS6A 3PEVB 4N3AA 5FZSA 3TWSA 2H6IA 4W9LB 5BV0A 4I6GA 3D9IA 3FULA 2I6HA 2IHCA 4HVBA 2V0PA 4CXTA 3L54A 1OCZE 5AYWD 4UIJA 4ANWA 3LCAA 5DBKA 5LLIB 2JEKA 2BTDA 5AQBA 2R02A 3EDTB 1DC2A 3CSTA 2IU1A 2ASSA 4BT8A 1BU9A 3ZXSA 4BERA 5ENSD 5FTAA 5FZRA 3UT4A 3HVEB 1EPUA 4EBAA 1NL4A 5EYLA 4GZDA 5B3SE 4BX9A 1N4PA 1Y8MA 3UM2A 1L5JA 2ONDA 3T5XA 4OVUA 5CBOA 5G05C 3FUKA 4BWRA 2P1MA 3DRXA 2XEHA 3BEEA 4J8SA 3ZRFB 3OAWA 4YNDA 2P58C 3AG4E 2AXZA 4J8ZA 3UPVA 4A1GA 4G25A 4PS8A 2VTBA 3B13A 3ML9A 1LDKD 3BU8A 3J5QB 5DADA 1FT2A 3AS4A 3LDZA 2KBXA 5ENNA 1UJJA 3HXFA 2HO1A 3FUJA 1Z3YA 3UKUG 3V31A 4ATZD 5J90A 3E4BA 5HQ8A 4GB9A 3CVUA 2OVFA 3I4GA 2IEJA 2R2LA 1OWPA 5H7PA 2QZAA 3ABKE 3B7TA 3G2SA 4JL0A 4TUUA 2AJAA 1EOEA 3D9HA 3JCKC 3GA1A 5AENA 3C6NA 3BUAA 3JYSA 3VLFA 4JXTA 1V55E 5AJDA 3HVEA 3MZLB 1YA0A 3SBTB 3SD5A 4W9IB 3LVRE 4HB5A 1HFAA 1A5EA 5KJLA 2P9UG 4AM9A 3EHNA 4WNEA 4NIKA 3SZ7A 4GTTA 4KMOA 2V4HC 5A7DB 2VYIA 1INZA 2WXKA 5LX8A 2P2CP 3UX4A 4U95D 4J6IA 1SA4A 4Q94A 1ZB1A 3EU5A 1NEXA 1DNPA 4N2SA 2R17C 1ZU2A 5CRVA 3VLEA 3PUKA 1OXJA 3RRNB 5JMND 3D9NA 4DRXE 3FU5A 5CEAA 4Z68A 1S0PA 4PH4B 2J09A 2NYJA 2KM4A 1D9SA 5FINA 4L2LA 5BUZA 3PNTB 3QKYA 3G2TA 4F3VA 3C3QA 4XE0A 4B95B 2X3MA 4EQFA 4LCTA 4CCAA 1IHBA 4RLYA 3RIBA 1NA0A 1E7UA 2GRQB 4CYMD 3QC1A 3PS6A 3D9PA 4ANXA 4U77A 4NRHB 3TGOA 4C0EA 5BXDA 4DX2A 4AWJB 3ZHEB 4W9FB 4ILGA 3MX3A 3UQ3A 4IRUA 1OCCE 3ESKA 3SQVA 2JABA 1SQMA 1WM5A 1TN7A 3EIJA 4UI9C 3BG1B 3FTVA 2L0IA 4B8CB 2UWJG 1QBQA 3M4TA 2ZISA 2RG8A 2DYSE 5BXOA 3FTWA 4BX8A 4JD2G 3NZSA 1OT8A 1BD8A 5D0OD 2CFUA 4ME2A 3PZ1A 1UJKA 4B0ZA 1PC2A 2IO2C 5JJTA 2FF4A 2LSVA 3U4TA 3U66A 3ISMC 3JQ0A 3RJVA 1WY6A 4PUCA 1S1GA 1QNFA 1SZ9A 2XPIA 4BTBA 2MA9C 2GRRB 2P9NG 2BEDA 4FJYA 2UY1A 4N5QA 3MCXA 5B1AE 1A17A 3F6QA 3PREA 3WSOB 3MV2B 1FT1A 5HKPA 4JPSA 3DRAA 2ZGGA 2B6CA 2XGSA 4OVVA 2XZTG 5CCLA 5B1BE 3T8KA 3DPDA 3ZHEA 3ZFWA 4I2ZA 2FBNA 3NOGD 4FU3A 3DSXA 3GZ2A 3RRMB 4EECA 1S63A 2F8YA 3LPZA 3TWUA 4E6HA 3MYVA 4W9DB 3KVTA 3DCGB 3OXLA 1HZ4A 3JXIA 4D10C 3D9JA 4RSYA 3FTXA 3ZRCB 3HXDA 1BI8B 2XZDG 2WXIA 1JCQA 5AQ7A 2B0OE 3Q15A 3JQ1A 4ANUA 2C9WC 1ELKA 5CRUA 5G55A 3B7BA 4GCNA 4GTMA 3SO8A 3ZTCB 4BTAA 2FO1E 4TXQA 1U3CA 3IEGA 3FUNA 1N54A 3D9OA 5T3RA 3PZDA 3BQOA 2IOSA 4P29A 2Y0BG 5ENRD 1JUQA 4A63B 3Q7AA 4HOUA 1UN9A 4Y6CA 4JTDB 3C6PA 2F37A 5BO4C 5EN5D 3W9GA 3UM3A 4EOZA 2WXQA 4XX5A 4L1BA 3DRYA 3R9AB 2NN2A 1IXVA 1IQRA 4N5CA 2JLBA 3APCA 2RFMA 2FNJC 3CHPA 2P1PA 2NXPA 4WWNA 3LBZA 3T8MA 1E96B 5A6CA 3QK0A 5LCWC 3V2XA 3S7JA 1MJ0A 2PM7A 4WWOA 3VTYA 5KNGA 2KCKA 3ASDA 4KXKB 3OGMA 2WXJA 3CHRA 1Y6IA 4EHMA 1JWFA 5JHAA 4AIFA 2BKGA 1OCRE 4XKCA 4IULA 2R5SA 2FULA 4G23A 5KJKA 1U3DA 3HIZA 3DSTA 5EILA 4TXPA 2PQNA 4LEUA 2DIWA 2KATA 1NP7A 4GTQA 3FU3A 3TWXA 3MKRA 4RG6A 1YYHA 3ZYLA 2GRLA 1H6KA 4CP3A 1OWLA 3PE3A 4WAFA 5T8IA 1A68A 4W9CB 2BKKB 3PE4A 2LSUA 2XGMA 4JTAB 4A3VA 5FTPA 1DSXA 1TN8A 4UQYA 3MKSA 4AP2A 1UN8A 4APOA 5FQ7A 3APDA 3SY2A 1QQEA 4URKA 3Q79A 2QFCA 4G1TA 1V54E 2LUHA 1O5MA 1LTXA 2HE0A 2F8XK 5JJ6A 3E33A 2X38A 4CDNA 3ASHA 2XQ0A 3NOCD 3O4ZA 4CDMA 3AU5A 3ZW3A 3UT7A 3PUJA 3FHEA 5EDSA 3D9MA 4EZJA 4JC8A 2A5UA 3HU6A 2YHCA 1BPOA 3AG2E 4UWKA 3RO3A 1K3ZD 1B89A 3Q78A 2GW1A 2YY9A 4W9HH 4CXIA 4F53A 3KS2A 3PZ2A 1TR4A 5ARFA 2LXMA 4I43A 2OVBA 3FP3A 1JCRA 2Y1LE 4KZCA 4PS7A 5ANLA 3P2BA 4K03A 4DK5A 4DX6D 4HI8A 5LP0A 4FHJA 4A3TA 3L16A 1JWGA 2VSXE 2EIJE 3Q9NC 3VLDA 4JEUA 4YVOA 1SVXA 1N9AA 3DXKG 4FADA 2J9QA 4GYOA 2L6BA 1N11A 2X6KA 1KLXA 4W9JB 5JJ7A 1WDYA 4NURA 4ZFHA 2GGFA 3QOUA 3AS5A 1EYHA 4GAAA 3MGBA 3FTYA 5FZQA 3RRUA 5M72A 4C0MA 3I3NA 5KNHD 4AY6A 3CLJA 5JH5B 3UT8A 5AARA 1EOFA 3ZPJA 2DCPA 4G24A 3R9MA 2HYZA 3ZVVA 1BUOA 4B9KB 1QZ2A 2VGYA 3HRAA 3C72A 2ZXWE 1LD7A 4EZKA 4L9PA 1H0AA 3JUIA 3U9WA 2IJGX 2C0MA 5KBAA 3KEAA 4J8YA 3ZXPA 2HM8A 2PQRA 2H6GA 4NQ0A 1TNZA 5AIJA 3SFXA 4BFRA 1E8ZA 4I9EA 3RU0A 2XEEA 5IY5E 3MA5A 4PS3A 5ITZF 3RSEG 4HS2A 1W3BA 2MRIA 4G11A 4JW1A 2MHKA 4AY5A 4OAUC 2QYUA 3ZNGA 1ELRA 2DWZA 3IHVA 3ZRHA 5CHEE 1R28A 4GYYA 1PY1A 3W9FA 4E85A 3PH0C 3EHQA 4J8FA 1OCOE 2M63A 4JGHC 1N4RA 3O48A 3IV0A 3TWTA 2I2RA 2WXHA 2VPKA 4GZ3A 4ILIA 4O1OA 3ASGA 1Z5SC 1TN6A 4N3BA 1VDYA 5G04C 3ML8A 4UUCA 3S7DA 5ANRA 2EILE 5EIDA 3FUIA 3Q9UC 2E0IA 2DYRE 3JXJA 4W9KB 2DZOA 4U8VD 3MV3B 4KZ0A 4LUNU 3C6OA 5EX0A 4W9EB 3FUHA 1XGWA 2OOEA 4R7LA 2WXGA 1AWCB 3S2AA 3OXGA 4DX1A 3LXUX 2PPIA 4AXHA 3EU9A 4WNGA 4C48B 4JHRA 3RAUA 4IN3B 4WQOC 2C2LA 1LF8A 3AS8A 3OGKA 3CHMA 3NAWA 2EIKE 3ZUVB 5BT1A 2UY1B 2IONA 1OY3D 1TYQG 4OYSA 2A79B 4RG9A 5CECB 1MX4A 3ZGQA 5G05J 4N2QA 4GA0A 3ESLA 3UIOC 5CCMA 4ZHBA 2WPVA 3DEOA 4BGCA 4LNGA 3Q4AB 2E31B 2WXMA 5BW8C 1H2TC 3LJ3A 4UWLA 3ONKA 1LQBB 3DSUA 3EIQC 2OCCE 3CK9A 5FQ6A 3L82A 2BF0X 4A1SA 4BT9A 1X81A 5CMYA 2P9LG 1ZBPA 2XGOA 3DSSA 1UW4B 4JHJA 4HFGA 5EUPA 3X2QE 4FULA 5D0QD 3SNXA 3FUMA 2PNNA 2C0LA 3FUFA 3V7DA 4U63A 4GA1A 4BESA 3ZU7B 5J08A 2RD0A 4FLHA 3ONLA 1TEZA 1Q2ZA 4N3CA 3R7RA 1SA5A 4WNDA 2I1KA 1HG5A 5LOZA 3L13A 3TWRA 5ENQD 3M52A 3HDXA 5ARGA 4CDRA 4QFVA 3B95A 4J0UA 4AV7A 2ILRA 2P1NA 5EX3A 4Q96A 2IO3C 2IOLA 4XIFA 5C2YA 3ZUNB 4O1PA 4ACLA 4GPKA 4HOTA 5H7GA 5FJYA 2VSYA 4GTSA 3C98A 4I1MA 1YMPA 5AJLA 2OVPA 1MQSA 2H6HA 4L7TA 4ZOUA 4YY8A 3U64A 2GRMA 2OV8A 3TG4A 3PZ4A 3UIPC 5H7HA 1NN7A 5AN8A 3UM0A 1O1RA 3GZ1A 4HRNA 1TNBA 4GMJA 3NZUA 3ABME 1BLXB 3D9LA 3EJNA 3DWLG 2WXLA 3GW4A 4B93B 4I1OB 4YDOA 4K5BA 3E4UA 4HRMB 3Q5MA 4CRWA 3LY8A 5D66A 3L08A 3PDNA 3APFA 2WVIA 3TJPA 2DBAA 2RKKA 5A15A 1U2VG 3PVLA 4G8LA 5AQ9A 4F7AA 1P5QA 4UWHA 3EUVA
chains in the Genus database with same CATH topology
1OWPA 2GW1A 2YY9A 3L6AA 4W9HH 1ELWA 2WMNA 4CXIA 3B7TA 3G2SA 4JL0A 4F53A 3CEQA 4TUUA 3KS2A 4U2MA 3Q49B 3CGHA 1EOEA 3JCKC 3GA1A 5KJMA 5ARFA 4I43A 4KT6B 2OVBA 1E7VA 5AENA 3FP3A 2NC9A 1QDVA 4KZCA 3C6NA 3ZKJB 4PS7A 5ANLA 5EKQD 3JYSA 2AW6A 3VLFA 4JXTA 4BKTB 3P2BA 3CHSA 4K03A 3FH8A 3FUEA 5AJDA 4DK5A 3HVEA 3MZLB 1YA0A 2P1OA 4DPRA 4JVSA 2KZTB 2VQ2A 4XI0A 3QDNA 3SBTB 4AJWA 2XPYA 5LP0A 4FHJA 1HO8A 2PZIA 3SD5A 4W9FB 3NQPA 4W9IB 4UWFA 3LVRE 4A3TA 2LAHA 4WWPA 1HFAA 4V3IA 5KJLA 4AM9A 1N52A 4AVXA 3EHNA 3L16A 5HI7A 1JWGA 3L17A 2VSXE 3KD7A 4WNEA 3VLDA 1QDWA 4JEUA 2Y4TA 4YVOA 5G04J 3EHMA 3I4RB 4DI3A 3P1UA 3CIAA 3SZ7A 3HYMB 1FQVB 2CHWA 2AVPA 4GCOA 4KMOA 5A7DB 2VYIA 2PL2A 1INZA 4FADA 2WXFA 3OHVA 3FWVA 1Z3XA 2WXKA 5LX8A 2J9QA 4W9RA 4GYOA 2E2EA 4PDXA 3SBSA 4Q69A 2YQ8A 5KJNA 1FS1B 3U3WA 3ENEA 3MJWA 3UX4A 2X6JA 2R9RB 1H19A 2X6KA 4GZ6A 4FP7A 1KLXA 3OTNA 4J6IA 4MLPA 4W9JB 2CG2A 2VSNA 3KAEA 4FHKA 4Q94A 3RKVA 5BV1A 4NURA 5JJ7A 3Q47B 1NEXA 2GGFA 3ZYMA 3QOUA 1FCHA 2CG3A 1DNPA 1EYHA 3AS5A 4TRQA 5C1DA 4N2SA 3BIMA 4GAAA 3FUDA 4FLBA 3CK8A 2R17C 3FTYA 3MGBA 1ZU2A 2Y3AA 5FZQA 4GA2A 3RRUA 2WB2A 3ZYKA 4B94A 5M72A 3VLEA 4KVOA 4C0MA 3I3NA 3PUKA 4CEMA 4I2WA 4AY6A 2V5FA 3CLJA 2I9CA 4K0RA 3RRNB 4C9BB 3UT8A 5JH5B 1EOFA 3ZPJA 2VGXB 2DCPA 2L6JA 2VSOE 3D9NA 4G24A 4I17A 2HYZA 3FU5A 4HORA 3ZVVA 3PEUB 1S0PA 1BUOA 4I6EA 4PH4B 5A6RA 1EODA 4B9KB 2J09A 1QZ2A 1GW6A 2VGYA 3L22A 3I5PA 4UQZA 1EXBE 2KM4A 3BG0B 4W9HB 3S7BA 1HS6A 2FEZA 4L2LA 5BUZA 3CVLA 3PNTB 3QWWA 3QKYA 3G2TA 4F3VA 4EZKA 1LM8C 2OVRA 1H0AA 3JUIA 4XE0A 2WQ6A 3U9WA 5E76A 2X3MA 2IJGX 4EQFA 4B95B 2C0MA 4LCTA 2LAIA 4CCAA 3QJZA 3IKOB 3MKQB 5FWQA 2HM8A 3RIBA 1NA0A 1FVFA 2PQRA 4XKBA 3B7RL 2KZTA 4NQ0A 1E7UA 3FTSA 2MOWA 2WMOA 4H7XA 1HU3A 3D3MA 4ILHB 4DI4A 3CVPA 2J49A 3QC1A 5AIJA 3PS6A 4I6JA 2A4ZA 2Y4UA 3D9PA 4GU5A 4ANXA 4BFRA 4U77A 1E8ZA 4NRHB 4FA6A 4I9EA 3QAQA 2YINA 3RU0A 3WXXA 4C0EA 3TGOA 5BXDA 3MA5A 4AWJB 4PS3A 3ZHEB 1PAQA 4ILGA 3MX3A 4HS2A 3UQ3A 1W3BA 2MRIA 4G11A 4IRUA 5G2NA 5JHBA 4JW1A 2MHKA 4AY5A 3ESKA 3FTUA 4J8EA 2XRZA 1SQMA 1WM5A 4UI9J 4WUYA 4XZ4A 3CQGB 2XHEA 3EIJA 4UI9C 3BG1B 3FTVA 2L0IA 3TXNA 3ZEFA 4B8CB 1HH8A 4DLOA 1ELRA 3IHVA 2ASTA 2UWJG 2XPZA 3ZRHA 5CHEE 1DVPA 1R28A 4GYYA 1PY1A 4GMLA 4RVBA 4I6JC 3M4TA 4E85A 1HXIA 4AJYC 2IQCA 5HYWB 3PH0C 2RG8A 3FTWA 4BX8A 5BXHA 4F1SA 4BKSB 4CT0A 3NZSA 2X6IA 2Z8HA 4J8FA 4JZYA 4APFA 1H2UA 2M63A 5D0OD 3OXFA 4I1AA 2CFUA 4ME2A 5KCMA 4JGHC 5LFAA 1UJKA 2LO6A 2VGXA 3O48A 5FQ4A 4B0ZA 1PC2A 2WM9A 5JJTA 2CFZA 5DAFA 5HZGC 3IV0A 4N39A 2FF4A 3KEZA 2LSVA 3U4TA 3U66A 2QY7A 4M3OA 5T4YA 3G2WA 2Q7FA 2WXHA 2I2RA 3JQ0A 1WAO1 1XNFA 4GZ3A 4ILIA 4XI9A 2VPKA 3FTZA 1WY6A 3G2VA 3LS8A 4U8HA 4PUCA 3B7UX 3RJVA 1S1GA 1QNFA 1SZ9A 4HOSA 2XPIA 4BTBA 2MA9C 3PRZA 3ASGA 1NA3A 1UG3A 2J4BA 1MHQA 5BPPA 2AXVA 3CVVA 4N3BA 1HE8A 4FJYA 2UY1A 1TJFA 3CKCA 1VDYA 4CGWA 3CVQA 5G04C 4CGVA 3MKQA 3MCXA 2V4LA 3ML8A 3CVWA 3S7DA 5ANRA 1A17A 2WXNA 4U0SA 5BXBA 3PREA 2J08A 3FUIA 2NSZA 4GYWA 2E0IA 3FH7A 3MV2B 2WXOA 3WSOB 3ZNGB 2CHXA 4JPSA 3ULQA 3QB2A 4N9F5 4W9KB 4CRHA 3FFLA 2R59A 5FT9A 3B7SA 3CHOA 3MV3B 4YVQC 1IHGA 4UWGA 2XGSA 2KC7A 4KZ0A 4JHKA 3NF1A 1HX8A 1NZNA 4LUNU 4OVVA 3FEYA 3C6OA 5CCLA 4KVMA 3FU6A 4H7YA 4HXIA 1VCBB 3AU4A 3DPDA 5EX0A 1OUVA 4I2ZA 3ZFWA 3ZHEA 4W9EB 2FBNA 2WXRA 4FU3A 3GZ2A 3FUHA 4U0UA 1XGWA 2OOEA 3RRMB 4ATGA 4EECA 4R7LA 2I1JA 3FDHA 2WXGA 2NZ0B 4JEHA 5FQ8A 2EQXA 3S2AA 3OXGA 5DIZA 3LPZA 3LXUX 4E6HA 2PPIA 3MYVA 4AXHA 3DRZA 3FKCA 3LUTB 2XEVA 4W9DB 3PNLB 3KVTA 4FC8A 4WNGA 4HLEA 3CSFA 4JHRA 4A55A 3DCGB 3OXLA 1HZ4A 3IBEA 4AOFA 4IN3B 4D10C 4WQOC 3D9JA 4RSYA 2C2LA 1LF8A 3HQIA 3ASFA 3AS8A 3FTXA 4I9CA 3ZRCB 1E8XA 1E8YA 4B9KE 3OGKA 3CHMA 2WXIA 4U04A 2VJ8A 3LYAA 4J8DA 5BT1A 2L9BA 3Q15A 2UY1B 3IHYA 1CS3A 2VKPA 2IFUA 3CQCB 2Q81A 3JQ1A 4ANUA 3T5VA 2C9WC 4FJZA 1ELKA 2FO7A 2IONA 2I2OA 2IF4A 4OYSA 5G55A 2A79B 2KCLA 4RG9A 3ZTDB 2KCVA 4GCNA 1IYGA 3ZGQA 3ZTCB 4BTAA 5G05J 5A23A 4N2QA 4GA0A 4KBQA 3DBSA 3ESLA 2IZVC 3LNMB 3K9IA 3FY4A 5E75A 4ACKA 1U3CA 3QWPA 3IEGA 3FUNA 4JA7A 3ZIMA 5CCMA 3FU0A 2J4DA 1N54A 3D9OA 4JA9A 4KYOB 2WPVA 3PZDA 5T3RA 3SHFA 4BGCA 3Q4AB 2IOSA 1E8WA 4P29A 4DJAA 3LY7A 4JTCB 1JUQA 2E31B 2WXMA 5BW8C 1R29A 4HOUA 1FS2B 1UN9A 2WQ7A 3SF4A 2JZ3C 4GZ5A 4Y6CA 2OVQA 3B84A 1H2TC 3LJ3A 4UWLA 4JTDB 4B8AA 3ONKA 3D9KA 1LQBB 3EIQC 3CK9A 3C6PA 5FQ6A 5BO4C 3RK6A 3S7FA 2BF0X 4A1SA 4G26A 4BT9A 4Y6WA 1P22B 3FH5A 4ZGCA 4L23A 5CMYA 1ZBPA 2XGOA 1UW4B 1HG2A 3URZA 4JHJA 4HFGA 4EOZA 2WXQA 4XX5A 4L1BA 3DRYA 1FVHA 1Z6TA 5EUPA 1R2BA 4FULA 5D0QD 3SNXA 4MKTA 3R9AB 3FUMA 4EBAG 3CK7A 3TL5A 2NN2A 2C0LA 3FUFA 1IQRA 3V7DA 3OHUA 3SGHA 4U63A 4N5CA 2JLBA 3APCA 3OGLA 4HOQA 4UYIA 2FNJC 4GA1A 3CHQA 3LVQE 3CHPA 5J08A 2RD0A 2P1PA 3HHMA 2NXPA 4U0ZA 4UQXA 4FLHA 3ONLA 5LCWJ 4W9GB 4CXJA 1TEZA 4WWNA 3ZYQA 3T8MA 3LBZA 2ZU6B 3M5BA 1E96B 1KT0A 3QK0A 4N3CA 3R7RA 5A6CA 5LCWC 4BSXA 4WNDA 2I1KA 1HG5A 5LOZA 3S7JA 4IYPA 2CHZA 4NACA 2PM7A 2PM6A 3LY9A 4WWOA 3SI5A 5IBKA 3VTYA 2KCKA 2LNIA 4U07A 3ASDA 2WQHA 3L13A 4EZLA 3HTMA 4KXKB 4B89A 2AWIA 3OGMA 4ABNA 2WXJA 3M52A 3HDXA 3G2UA 3CHRA 1Y6IA 4GZCA 2VTBB 4MS6A 5ARGA 4CDRA 3PEVB 1JWFA 1OWNA 4N3AA 4QFVA 5FZSA 4W9LB 3TG5A 5BV0A 4J0UA 4AV7A 4AIFA 5JHAA 4I6GA 3D9IA 3CVXA 4XKCA 3SFZA 1KT1A 2ILRA 1E90A 3CR3A 1HV2A 2P1NA 2YHEA 5EX3A 1IQUA 4IULA 2AXUA 2R5SA 3FULA 2I6HA 4L2YA 4Q96A 2FULA 4HVBA 2IHCA 2V0PA 4U2NA 4G23A 3VTXA 3L54A 4CXTA 5KJKA 4TV3A 1U3DA 5AYWD 3HIZA 4UIJA 4ANWA 5CMWA 2PQNA 2J07A 1JPLA 3LCAA 5DBKA 4LEUA 1SZAA 2DIWA 2IOLA 2KATA 1NP7A 4XIFA 1HF8A 3FU3A 4DLQA 5LLIB 4O6FA 2XCBA 5C2YA 3ZUNB 2JEKA 3MKRA 2BTDA 2WXPA 3EDTB 3LEWA 2L0TB 4ACLA 4CT4A 4RG6A 2XCCA 4GPKA 4HOTA 3M8VA 5H7GA 5FJYA 3ZYLA 1T1DA 1TJCA 2V8SE 2VSYA 3CSTA 1OWMA 2IU1A 2GRLA 1H6KA 3C98A 2ASSA 4CP3A 1OWLA 4BT8A 4I1MA 3PE3A 4WAFA 5AJLA 5T8IA 2OVPA 3ZXSA 4EPZA 1MQSA 3N71A 1OWOA 1A68A 4W9CB 5FZRA 5FTAA 3PE4A 4L7TA 3CV0A 2LSUA 3UT4A 2XGMA 4JTAB 3HVEB 1EPUA 3U64A 4ZOUA 4YY8A 4EBAA 4A3VA 2GRMA 2OV8A 4ANVA 5FTPA 3TAXA 4GZDA 4MRUA 1DSXA 4BX9A 3TG4A 2X6HA 1Y8MA 3CVYA 2IF5A 4UQYA 1L5JA 3MKSA 4AP2A 2ONDA 3T5XA 1UN8A 4OVUA 1NN7A 5H7HA 4APOA 5FQ7A 3GZ1A 3TXMA 3APDA 5G05C 3MEKA 4GMJA 3NZUA 3FUKA 4BWRA 2XRYA 3D9LA 3EJNA 2P1MA 3DRXA 3BEEA 1X5BA 1QQEA 4J8SA 4URKA 3ZRFB 3OAWA 3UUXA 1H2VC 2QFCA 3QWVA 4G1TA 3QNKA 2WXLA 2P58C 3FEXA 4YNDA 2BUGA 3GW4A 2AXZA 4J8ZA 2YNQA 3UPVA 3CVNA 4A1GA 5JJ6A 4G25A 4I1OB 2X38A 4CDNA 4PS8A 4G2VA 4UI9K 3ASHA 3B13A 2VTBA 3ML9A 3E4UA 3GZSA 2XQ0A 3O4ZA 3R7QA 1LDKD 1EF1C 3RO2A 3UMVA 2FI7A 3Q5MA 5DADA 4AEZC 4CDMA 3LY8A 3AS4A 3AU5A 1EDUA 4CRWA 2P1QA 4WNFA 3ZW3A 2HR2A 3LDZA 3LKUA 3PUJA 3QARA 3UT7A 2E32B 3FHEA 5ENNA 5BNWA 5EDSA 1UJJA 3D9MA 4EZJA 3L08A 3PDNA 4JC8A 3APFA 2HO1A 2WVIA 3TJPA 3L2OA 3FUJA 1Z3YA 2A5UA 4BY6A 3ZN3A 2DBAA 5A15A 3CKBA 3PVLA 5J90A 2YHCA 3E4BA 4LERA 3HU6A 5HQ8A 4GB9A 1BPOA 4F7AA 2OVFA 3CVUA 1P5QA 2X6FA 3I4GA 4UWKA 3RO3A 4UWHA 1B89A 3GYZA 4LRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YY9 A;  4W9H H;  4CXI A;  3DCG B;  4U77 A;  4W9L B;  4WQO C;  3HQI A;  4U2M A;  5BXD A;  3ZRC B;  1EOE A;  3GA1 A;  4B9K E;  4AWJ B;  3OGK A;  1HV2 A;  2P1N A;  4W9F B;  4HS2 A;  1QDV A;  3C6N A;  3ZKJ B;  2IHC A;  4U2N A;  4CXT A;  1CS3 A;  2VKP A;  4BKT B;  2Q81 A;  3HVE A;  4UIJ A;  2C9W C;  2P1O A;  2A79 B;  3ZTD B;  4W9I B;  2AST A;  3ZTC B;  5LLI B;  1R28 A;  3ZUN B;  4I6J C;  3LNM B;  2IZV C;  3M4T A;  4AJY C;  5H7G A;  5HYW B;  1QDW A;  3M8V A;  5BXH A;  1T1D A;  4BKS B;  4BGC A;  2Z8H A;  2ASS A;  1FQV B;  4CP3 A;  4APF A;  4JTC B;  2OVP A;  2E31 B;  4JGH C;  1A68 A;  4W9C B;  5FTA A;  1R29 A;  4ZOU A;  1FS2 B;  4JTA B;  3HVE B;  1FS1 B;  2JZ3 C;  2OVQ A;  3B84 A;  5DAF A;  5HZG C;  2R9R B;  4JTD B;  1DSX A;  1LQB B;  4W9J B;  2IF5 A;  2I2R A;  3C6P A;  2VPK A;  5H7H A;  3MKS A;  4AP2 A;  1NN7 A;  5BO4 C;  1NEX A;  1S1G A;  2MA9 C;  3BIM A;  2P1M A;  3I3N A;  4EOZ A;  3ZRF B;  5EUP A;  1R2B A;  5JH5 B;  1EOF A;  5BXB A;  4J8Z A;  2NN2 A;  3WSO B;  3ZNG B;  1BUO A;  3OHU A;  3V7D A;  5A6R A;  1EOD A;  4B9K B;  4N9F 5;  3OGL A;  4W9K B;  4CRH A;  4UYI A;  2FNJ C;  3E4U A;  1EXB E;  1LDK D;  2P1P A;  5DAD A;  4W9H B;  3C6O A;  4W9G B;  2P1Q A;  4CXJ A;  3LBZ A;  4HXI A;  1VCB B;  2E32 B;  3M5B A;  1LM8 C;  2OVR A;  4W9E B;  3OHV A;  4B95 B;  3L2O A;  5IBK A;  2NZ0 B;  5A15 A;  2EQX A;  3HU6 A;  3HTM A;  2PPI A;  3LUT B;  3DRZ A;  3FKC A;  3OGM A;  4W9D B;  3M52 A;  3KVT A;  1P22 B; 
#chains in the Genus database with same CATH topology
 3CEQ A;  3CGH A;  5HS0 A;  2ZGD A;  5EKQ D;  2AW6 A;  4BKT B;  3FH8 A;  3FUE A;  1D8D A;  3C3R A;  2P1O A;  4DPR A;  2VQ2 A;  3QDN A;  4AJW A;  1HO8 A;  2PZI A;  3NQP A;  2LAH A;  1WG0 A;  4V3I A;  1N52 A;  5HI7 A;  3KD7 A;  1QDW A;  2Y4T A;  3AJI A;  3SFY A;  3ULY A;  4DI3 A;  3P1U A;  3CIA A;  3HYM B;  2CHW A;  2AVP A;  4GCO A;  2WXF A;  1Z3X A;  4W9R A;  4PDX A;  4Q69 A;  3ENE A;  3DXM G;  1H19 A;  1TNU A;  4GZ6 A;  4FP7 A;  3OTN A;  4FHK A;  3RKV A;  3Q47 B;  1N4Q A;  4XEI G;  3ZYM A;  1FCH A;  2CG3 A;  3BIM A;  5C1D A;  4FLB A;  2WB2 A;  4KVO A;  4CEM A;  4DX7 D;  2V5F A;  2I9C A;  4K0R A;  2VGX B;  2L6J A;  2VSO E;  4I17 A;  4HOR A;  4QQI A;  4I6E A;  1N4S A;  5A6R A;  1GW6 A;  3I5P A;  1O1S A;  3ULE G;  3UM1 A;  1HS6 A;  3CVL A;  3QWW A;  1LM8 C;  2WQ6 A;  1KPS B;  1FVF A;  4XKB A;  3B7R L;  3FTS A;  2WMO A;  2J8S D;  1HU3 A;  4DI4 A;  3CVP A;  2J49 A;  2Y4U A;  3QAQ A;  2YIN A;  1MX2 A;  2OEW A;  5G2N A;  3E30 A;  1DCQ A;  1K1A A;  4DUI A;  2XRZ A;  4WUY A;  3CQG B;  1JCS A;  3ZEF A;  3TWW A;  3E37 A;  2AST A;  1DVP A;  1HXI A;  5HYW B;  4F1S A;  4BKS B;  2X6I A;  2Z8H A;  4JZY A;  1H2U A;  3OXF A;  4I1A A;  5KCM A;  3HG0 D;  5LFA A;  2LO6 A;  2VGX A;  5FQ4 A;  5DAF A;  1MZC A;  4N39 A;  2QY7 A;  4M3O A;  2Q7F A;  1XNF A;  4XI9 A;  3FTZ A;  3LS8 A;  4HOS A;  5AQA A;  3V2O A;  1NA3 A;  1UG3 A;  2J4B A;  1MHQ A;  1TNY A;  4CGW A;  1MYO A;  3CVW A;  2WXN A;  4U0S A;  5BXB A;  2NSZ A;  4GYW A;  3ZNG B;  4CRH A;  3FFL A;  2R59 A;  5FT9 A;  4J7W A;  4YDW A;  4BEP A;  1NI1 A;  4UWG A;  1NZN A;  2ETC A;  4KVM A;  3FU6 A;  2V5Q C;  3L9T A;  4H7Y A;  2P9I G;  4HNA D;  1VCB B;  3UIN C;  2MYO A;  4ATG A;  2WXR A;  4JB8 P;  4LNU D;  3AG1 E;  2NZ0 B;  5FQ8 A;  2EQX A;  4U8Y D;  5DIZ A;  3FKC A;  1KZO A;  5EYP F;  3PNL B;  4FC8 A;  4HLE A;  4A55 A;  3IBE A;  4AOF A;  1SW6 A;  3HXE A;  1KZP A;  4I9C A;  4U04 A;  3IHY A;  2VKP A;  4HQD A;  2Q81 A;  2I2O A;  2KCL A;  3ZTD B;  4KBQ A;  3DBS A;  2H6F A;  3K9I A;  5E75 A;  4ACK A;  3QWP A;  3ZIM A;  4JA9 A;  4KYO B;  1E8W A;  3Q7F A;  4DJA A;  3LY7 A;  3C5R A;  4LNB A;  1R29 A;  5HRY A;  2JZ3 C;  4LSZ E;  3HXC A;  2OVQ A;  2P9K G;  3D9K A;  3C3O A;  4OAV B;  1AP7 A;  4X8Q A;  4G26 A;  4Y6W A;  3NB2 A;  2QC9 A;  4L23 A;  3EHR A;  1FVH A;  4HI9 A;  4DX5 D;  4F6R D;  3OGL A;  4HOQ A;  4UYI A;  3CHQ A;  3LVQ E;  3HHM A;  4UQX A;  4U0Z A;  3UKR G;  4TUM A;  1TNO A;  3ZYQ A;  2ZU6 B;  3M5B A;  4YDE A;  1KT0 A;  2R03 A;  4NAC A;  1G3N B;  2WQH A;  4EZL A;  4B89 A;  1FPP A;  4K5C A;  2XS8 A;  4GZC A;  3KSQ A;  1OWN A;  3TG5 A;  3IXE A;  4RQI A;  3SFZ A;  1KT1 A;  3CR3 A;  1E90 A;  1HV2 A;  2YHE A;  1IQU A;  2AXU A;  3ASO E;  4L2Y A;  4U2N A;  3VTX A;  4TV3 A;  3DSW A;  5CMW A;  2J07 A;  1JPL A;  5BXU A;  1SZA A;  1HF8 A;  5CBN A;  4DLQ A;  4O6F A;  2XCB A;  1D8E A;  1H6O A;  2WXP A;  3LEW A;  2L0T B;  4CT4 A;  2XCC A;  3M8V A;  1T1D A;  1TJC A;  2V8S E;  1OWM A;  4EPZ A;  3N71 A;  1OWO A;  1RZ4 A;  3CV0 A;  4ANV A;  3TAX A;  4MRU A;  5EIB E;  2X6H A;  3ABL E;  3CVY A;  2IF5 A;  5JA4 D;  3TXM A;  3MEK A;  1N95 A;  2XRY A;  1X5B A;  3UUX A;  1H2V C;  3QWV A;  3QNK A;  3FEX A;  3T9K A;  2BUG A;  3UI2 A;  2YNQ A;  3CVN A;  4G2V A;  2P9S G;  4UI9 K;  3GZS A;  3R7Q A;  1EF1 C;  2XEN A;  3RO2 A;  3UMV A;  2FI7 A;  4AEZ C;  2P1Q A;  1EDU A;  3LJN A;  4WNF A;  2HR2 A;  3LKU A;  2E32 B;  2Y69 E;  3QAR A;  4GTP A;  5BNW A;  2VGE A;  3L2O A;  3E34 A;  3Q73 A;  4BY6 A;  3ZN3 A;  5ENT D;  3CKB A;  4LER A;  3UTM A;  2X6F A;  3GYZ A;  4LRZ A;  1P22 B;  3TWQ A;  1DCE A;  3L6A A;  1ELW A;  2WMN A;  4BET A;  3JUE A;  4U2M A;  2EIN E;  3Q49 B;  5KJM A;  4KT6 B;  4MBG A;  1E7V A;  1QDV A;  3ZKJ B;  2NC9 A;  3CHS A;  1BI7 B;  5AAO A;  4JVS A;  2KZT B;  4XI0 A;  3CVX A;  2XPY A;  4UWF A;  4WWP A;  4AVX A;  3L17 A;  2XS1 A;  1RW2 A;  5G04 J;  3EHM A;  3DSV A;  3I4R B;  2ZIR A;  1FQV B;  5CED B;  2PL2 A;  3FWV A;  1YCS B;  3SBS A;  2E2E A;  2YQ8 A;  5KJN A;  1FS1 B;  3U3W A;  3MJW A;  5ENP D;  3E32 A;  2X6J A;  2R9R B;  4MLP A;  2CG2 A;  2VSN A;  3KAE A;  5BV1 A;  4HLL A;  4TRQ A;  1K8K G;  3FUD A;  3CK8 A;  4GTR A;  2Y3A A;  4GA2 A;  3ZYK A;  4B94 A;  2ETA A;  3AG3 E;  4I2W A;  1UOH A;  4C9B B;  3PZ3 A;  3PEU B;  1EOD A;  3L22 A;  4UQZ A;  1EXB E;  3BG0 B;  4W9H B;  3S7B A;  2GRN B;  1K1B A;  2FEZ A;  4GTV A;  2OVR A;  4U96 D;  3ZKJ A;  5E76 A;  2LAI A;  3QJZ A;  3IKO B;  3MKQ B;  4M7C A;  4BSZ B;  5FWQ A;  3NBN B;  4GPM A;  2KZT A;  2MOW A;  5KWD A;  4H7X A;  3D3M A;  4ILH B;  4I6J A;  2A4Z A;  2RFA A;  4GU5 A;  3HXB A;  3Q75 A;  4FA6 A;  3UXG A;  3WXX A;  3AAA C;  1PAQ A;  5JHB A;  5ENO D;  3FTU A;  4J8E A;  4UI9 J;  4XZ4 A;  2ETB A;  2XHE A;  4GMR A;  3TXN A;  1HH8 A;  4DLO A;  2XPZ A;  4GML A;  4RVB A;  4I6J C;  1MX6 A;  4AJY C;  2IQC A;  2EIM E;  5BXH A;  4CT0 A;  4HBD A;  4APF A;  2WM9 A;  2CFZ A;  5HZG C;  4G8K A;  1N0R A;  3DPY A;  3KEZ A;  5T4Y A;  3G2W A;  1WAO 1;  3G2V A;  4U8H A;  3B7U X;  1N0Q A;  3PRZ A;  5BPP A;  2AXV A;  3CVV A;  1HE8 A;  2GRP B;  1TJF A;  3CKC A;  3CVQ A;  4CGV A;  4GTO A;  3MKQ A;  2V4L A;  2J08 A;  3FH7 A;  2WXO A;  2CHX A;  3ULQ A;  3QB2 A;  4N9F 5;  2DVW A;  3B7S A;  3CHO A;  4YVQ C;  1IHG A;  3TWV A;  1LD8 A;  2KC7 A;  4JHK A;  3NF1 A;  1HX8 A;  3FEY A;  4HXI A;  3AU4 A;  1OUV A;  3V30 A;  3OHV A;  4U0U A;  2I1J A;  3FDH A;  4JEH A;  2GRO B;  2R05 A;  3ASN E;  3LUT B;  3DRZ A;  2XEV A;  2LXL A;  1S64 A;  2A5E A;  3CSF A;  1NFI E;  3HQI A;  3ASF A;  1E8X A;  1E8Y A;  4B9K E;  4O60 A;  2VJ8 A;  3LYA A;  4J8D A;  2L9B A;  1CS3 A;  2IFU A;  3CQC B;  3T5V A;  4FJZ A;  2FO7 A;  2P9P G;  2QYJ A;  2IF4 A;  2KCV A;  2F0Y A;  1IYG A;  1O1T A;  5A23 A;  3LNM B;  2IZV C;  3FY4 A;  5CER B;  4JA7 A;  3FU0 A;  2J4D A;  3WG7 E;  3SHF A;  1N94 A;  4JTC B;  1FS2 B;  2WQ7 A;  3SF4 A;  2DZN A;  4GZ5 A;  3B84 A;  4B8A A;  2OEV A;  2IY0 C;  3RK6 A;  4TXR A;  2KXP C;  3S7F A;  4YDY A;  3FH5 A;  4ZGC A;  1HG2 A;  3URZ A;  1Z6T A;  3J5P A;  1R2B A;  3KSL A;  4MKT A;  4U7E B;  4EBA G;  1S70 B;  3CK7 A;  3TL5 A;  5D2M C;  3OHU A;  3SGH A;  4K5A B;  4F1P A;  3V79 K;  5LCW J;  4W9G B;  4CXJ A;  4CZ2 D;  1H6P A;  3DEP A;  1QYM A;  4BSX A;  5IBK A;  4IYP A;  2CHZ A;  3SI5 A;  3LY9 A;  2PM6 A;  4U07 A;  2LNI A;  3HTM A;  2AWI A;  1IKN D;  4HRL A;  4ABN A;  4LG6 A;  5FIO A;  3G2U A;  2VTB B;  4MS6 A;  3PEV B;  4N3A A;  5FZS A;  3TWS A;  2H6I A;  4W9L B;  5BV0 A;  4I6G A;  3D9I A;  3FUL A;  2I6H A;  2IHC A;  4HVB A;  2V0P A;  4CXT A;  3L54 A;  1OCZ E;  5AYW D;  4UIJ A;  4ANW A;  3LCA A;  5DBK A;  5LLI B;  2JEK A;  2BTD A;  5AQB A;  2R02 A;  3EDT B;  1DC2 A;  3CST A;  2IU1 A;  2ASS A;  4BT8 A;  1BU9 A;  3ZXS A;  4BER A;  5ENS D;  5FTA A;  5FZR A;  3UT4 A;  3HVE B;  1EPU A;  4EBA A;  1NL4 A;  5EYL A;  4GZD A;  5B3S E;  4BX9 A;  1N4P A;  1Y8M A;  3UM2 A;  1L5J A;  2OND A;  3T5X A;  4OVU A;  5CBO A;  5G05 C;  3FUK A;  4BWR A;  2P1M A;  3DRX A;  2XEH A;  3BEE A;  4J8S A;  3ZRF B;  3OAW A;  4YND A;  2P58 C;  3AG4 E;  2AXZ A;  4J8Z A;  3UPV A;  4A1G A;  4G25 A;  4PS8 A;  2VTB A;  3B13 A;  3ML9 A;  1LDK D;  3BU8 A;  3J5Q B;  5DAD A;  1FT2 A;  3AS4 A;  3LDZ A;  2KBX A;  5ENN A;  1UJJ A;  3HXF A;  2HO1 A;  3FUJ A;  1Z3Y A;  3UKU G;  3V31 A;  4ATZ D;  5J90 A;  3E4B A;  5HQ8 A;  4GB9 A;  3CVU A;  2OVF A;  3I4G A;  2IEJ A;  2R2L A;  1OWP A;  5H7P A;  2QZA A;  3ABK E;  3B7T A;  3G2S A;  4JL0 A;  4TUU A;  2AJA A;  1EOE A;  3D9H A;  3JCK C;  3GA1 A;  5AEN A;  3C6N A;  3BUA A;  3JYS A;  3VLF A;  4JXT A;  1V55 E;  5AJD A;  3HVE A;  3MZL B;  1YA0 A;  3SBT B;  3SD5 A;  4W9I B;  3LVR E;  4HB5 A;  1HFA A;  1A5E A;  5KJL A;  2P9U G;  4AM9 A;  3EHN A;  4WNE A;  4NIK A;  3SZ7 A;  4GTT A;  4KMO A;  2V4H C;  5A7D B;  2VYI A;  1INZ A;  2WXK A;  5LX8 A;  2P2C P;  3UX4 A;  4U95 D;  4J6I A;  1SA4 A;  4Q94 A;  1ZB1 A;  3EU5 A;  1NEX A;  1DNP A;  4N2S A;  2R17 C;  1ZU2 A;  5CRV A;  3VLE A;  3PUK A;  1OXJ A;  3RRN B;  5JMN D;  3D9N A;  4DRX E;  3FU5 A;  5CEA A;  4Z68 A;  1S0P A;  4PH4 B;  2J09 A;  2NYJ A;  2KM4 A;  1D9S A;  5FIN A;  4L2L A;  5BUZ A;  3PNT B;  3QKY A;  3G2T A;  4F3V A;  3C3Q A;  4XE0 A;  4B95 B;  2X3M A;  4EQF A;  4LCT A;  4CCA A;  1IHB A;  4RLY A;  3RIB A;  1NA0 A;  1E7U A;  2GRQ B;  4CYM D;  3QC1 A;  3PS6 A;  3D9P A;  4ANX A;  4U77 A;  4NRH B;  3TGO A;  4C0E A;  5BXD A;  4DX2 A;  4AWJ B;  3ZHE B;  4W9F B;  4ILG A;  3MX3 A;  3UQ3 A;  4IRU A;  1OCC E;  3ESK A;  3SQV A;  2JAB A;  1SQM A;  1WM5 A;  1TN7 A;  3EIJ A;  4UI9 C;  3BG1 B;  3FTV A;  2L0I A;  4B8C B;  2UWJ G;  1QBQ A;  3M4T A;  2ZIS A;  2RG8 A;  2DYS E;  5BXO A;  3FTW A;  4BX8 A;  4JD2 G;  3NZS A;  1OT8 A;  1BD8 A;  5D0O D;  2CFU A;  4ME2 A;  3PZ1 A;  1UJK A;  4B0Z A;  1PC2 A;  2IO2 C;  5JJT A;  2FF4 A;  2LSV A;  3U4T A;  3U66 A;  3ISM C;  3JQ0 A;  3RJV A;  1WY6 A;  4PUC A;  1S1G A;  1QNF A;  1SZ9 A;  2XPI A;  4BTB A;  2MA9 C;  2GRR B;  2P9N G;  2BED A;  4FJY A;  2UY1 A;  4N5Q A;  3MCX A;  5B1A E;  1A17 A;  3F6Q A;  3PRE A;  3WSO B;  3MV2 B;  1FT1 A;  5HKP A;  4JPS A;  3DRA A;  2ZGG A;  2B6C A;  2XGS A;  4OVV A;  2XZT G;  5CCL A;  5B1B E;  3T8K A;  3DPD A;  3ZHE A;  3ZFW A;  4I2Z A;  2FBN A;  3NOG D;  4FU3 A;  3DSX A;  3GZ2 A;  3RRM B;  4EEC A;  1S63 A;  2F8Y A;  3LPZ A;  3TWU A;  4E6H A;  3MYV A;  4W9D B;  3KVT A;  3DCG B;  3OXL A;  1HZ4 A;  3JXI A;  4D10 C;  3D9J A;  4RSY A;  3FTX A;  3ZRC B;  3HXD A;  1BI8 B;  2XZD G;  2WXI A;  1JCQ A;  5AQ7 A;  2B0O E;  3Q15 A;  3JQ1 A;  4ANU A;  2C9W C;  1ELK A;  5CRU A;  5G55 A;  3B7B A;  4GCN A;  4GTM A;  3SO8 A;  3ZTC B;  4BTA A;  2FO1 E;  4TXQ A;  1U3C A;  3IEG A;  3FUN A;  1N54 A;  3D9O A;  5T3R A;  3PZD A;  3BQO A;  2IOS A;  4P29 A;  2Y0B G;  5ENR D;  1JUQ A;  4A63 B;  3Q7A A;  4HOU A;  1UN9 A;  4Y6C A;  4JTD B;  3C6P A;  2F37 A;  5BO4 C;  5EN5 D;  3W9G A;  3UM3 A;  4EOZ A;  2WXQ A;  4XX5 A;  4L1B A;  3DRY A;  3R9A B;  2NN2 A;  1IXV A;  1IQR A;  4N5C A;  2JLB A;  3APC A;  2RFM A;  2FNJ C;  3CHP A;  2P1P A;  2NXP A;  4WWN A;  3LBZ A;  3T8M A;  1E96 B;  5A6C A;  3QK0 A;  5LCW C;  3V2X A;  3S7J A;  1MJ0 A;  2PM7 A;  4WWO A;  3VTY A;  5KNG A;  2KCK A;  3ASD A;  4KXK B;  3OGM A;  2WXJ A;  3CHR A;  1Y6I A;  4EHM A;  1JWF A;  5JHA A;  4AIF A;  2BKG A;  1OCR E;  4XKC A;  4IUL A;  2R5S A;  2FUL A;  4G23 A;  5KJK A;  1U3D A;  3HIZ A;  3DST A;  5EIL A;  4TXP A;  2PQN A;  4LEU A;  2DIW A;  2KAT A;  1NP7 A;  4GTQ A;  3FU3 A;  3TWX A;  3MKR A;  4RG6 A;  1YYH A;  3ZYL A;  2GRL A;  1H6K A;  4CP3 A;  1OWL A;  3PE3 A;  4WAF A;  5T8I A;  1A68 A;  4W9C B;  2BKK B;  3PE4 A;  2LSU A;  2XGM A;  4JTA B;  4A3V A;  5FTP A;  1DSX A;  1TN8 A;  4UQY A;  3MKS A;  4AP2 A;  1UN8 A;  4APO A;  5FQ7 A;  3APD A;  3SY2 A;  1QQE A;  4URK A;  3Q79 A;  2QFC A;  4G1T A;  1V54 E;  2LUH A;  1O5M A;  1LTX A;  2HE0 A;  2F8X K;  5JJ6 A;  3E33 A;  2X38 A;  4CDN A;  3ASH A;  2XQ0 A;  3NOC D;  3O4Z A;  4CDM A;  3AU5 A;  3ZW3 A;  3UT7 A;  3PUJ A;  3FHE A;  5EDS A;  3D9M A;  4EZJ A;  4JC8 A;  2A5U A;  3HU6 A;  2YHC A;  1BPO A;  3AG2 E;  4UWK A;  3RO3 A;  1K3Z D;  1B89 A;  3Q78 A;  2GW1 A;  2YY9 A;  4W9H H;  4CXI A;  4F53 A;  3KS2 A;  3PZ2 A;  1TR4 A;  5ARF A;  2LXM A;  4I43 A;  2OVB A;  3FP3 A;  1JCR A;  2Y1L E;  4KZC A;  4PS7 A;  5ANL A;  3P2B A;  4K03 A;  4DK5 A;  4DX6 D;  4HI8 A;  5LP0 A;  4FHJ A;  4A3T A;  3L16 A;  1JWG A;  2VSX E;  2EIJ E;  3Q9N C;  3VLD A;  4JEU A;  4YVO A;  1SVX A;  1N9A A;  3DXK G;  4FAD A;  2J9Q A;  4GYO A;  2L6B A;  1N11 A;  2X6K A;  1KLX A;  4W9J B;  5JJ7 A;  1WDY A;  4NUR A;  4ZFH A;  2GGF A;  3QOU A;  3AS5 A;  1EYH A;  4GAA A;  3MGB A;  3FTY A;  5FZQ A;  3RRU A;  5M72 A;  4C0M A;  3I3N A;  5KNH D;  4AY6 A;  3CLJ A;  5JH5 B;  3UT8 A;  5AAR A;  1EOF A;  3ZPJ A;  2DCP A;  4G24 A;  3R9M A;  2HYZ A;  3ZVV A;  1BUO A;  4B9K B;  1QZ2 A;  2VGY A;  3HRA A;  3C72 A;  2ZXW E;  1LD7 A;  4EZK A;  4L9P A;  1H0A A;  3JUI A;  3U9W A;  2IJG X;  2C0M A;  5KBA A;  3KEA A;  4J8Y A;  3ZXP A;  2HM8 A;  2PQR A;  2H6G A;  4NQ0 A;  1TNZ A;  5AIJ A;  3SFX A;  4BFR A;  1E8Z A;  4I9E A;  3RU0 A;  2XEE A;  5IY5 E;  3MA5 A;  4PS3 A;  5ITZ F;  3RSE G;  4HS2 A;  1W3B A;  2MRI A;  4G11 A;  4JW1 A;  2MHK A;  4AY5 A;  4OAU C;  2QYU A;  3ZNG A;  1ELR A;  2DWZ A;  3IHV A;  3ZRH A;  5CHE E;  1R28 A;  4GYY A;  1PY1 A;  3W9F A;  4E85 A;  3PH0 C;  3EHQ A;  4J8F A;  1OCO E;  2M63 A;  4JGH C;  1N4R A;  3O48 A;  3IV0 A;  3TWT A;  2I2R A;  2WXH A;  2VPK A;  4GZ3 A;  4ILI A;  4O1O A;  3ASG A;  1Z5S C;  1TN6 A;  4N3B A;  1VDY A;  5G04 C;  3ML8 A;  4UUC A;  3S7D A;  5ANR A;  2EIL E;  5EID A;  3FUI A;  3Q9U C;  2E0I A;  2DYR E;  3JXJ A;  4W9K B;  2DZO A;  4U8V D;  3MV3 B;  4KZ0 A;  4LUN U;  3C6O A;  5EX0 A;  4W9E B;  3FUH A;  1XGW A;  2OOE A;  4R7L A;  2WXG A;  1AWC B;  3S2A A;  3OXG A;  4DX1 A;  3LXU X;  2PPI A;  4AXH A;  3EU9 A;  4WNG A;  4C48 B;  4JHR A;  3RAU A;  4IN3 B;  4WQO C;  2C2L A;  1LF8 A;  3AS8 A;  3OGK A;  3CHM A;  3NAW A;  2EIK E;  3ZUV B;  5BT1 A;  2UY1 B;  2ION A;  1OY3 D;  1TYQ G;  4OYS A;  2A79 B;  4RG9 A;  5CEC B;  1MX4 A;  3ZGQ A;  5G05 J;  4N2Q A;  4GA0 A;  3ESL A;  3UIO C;  5CCM A;  4ZHB A;  2WPV A;  3DEO A;  4BGC A;  4LNG A;  3Q4A B;  2E31 B;  2WXM A;  5BW8 C;  1H2T C;  3LJ3 A;  4UWL A;  3ONK A;  1LQB B;  3DSU A;  3EIQ C;  2OCC E;  3CK9 A;  5FQ6 A;  3L82 A;  2BF0 X;  4A1S A;  4BT9 A;  1X81 A;  5CMY A;  2P9L G;  1ZBP A;  2XGO A;  3DSS A;  1UW4 B;  4JHJ A;  4HFG A;  5EUP A;  3X2Q E;  4FUL A;  5D0Q D;  3SNX A;  3FUM A;  2PNN A;  2C0L A;  3FUF A;  3V7D A;  4U63 A;  4GA1 A;  4BES A;  3ZU7 B;  5J08 A;  2RD0 A;  4FLH A;  3ONL A;  1TEZ A;  1Q2Z A;  4N3C A;  3R7R A;  1SA5 A;  4WND A;  2I1K A;  1HG5 A;  5LOZ A;  3L13 A;  3TWR A;  5ENQ D;  3M52 A;  3HDX A;  5ARG A;  4CDR A;  4QFV A;  3B95 A;  4J0U A;  4AV7 A;  2ILR A;  2P1N A;  5EX3 A;  4Q96 A;  2IO3 C;  2IOL A;  4XIF A;  5C2Y A;  3ZUN B;  4O1P A;  4ACL A;  4GPK A;  4HOT A;  5H7G A;  5FJY A;  2VSY A;  4GTS A;  3C98 A;  4I1M A;  1YMP A;  5AJL A;  2OVP A;  1MQS A;  2H6H A;  4L7T A;  4ZOU A;  4YY8 A;  3U64 A;  2GRM A;  2OV8 A;  3TG4 A;  3PZ4 A;  3UIP C;  5H7H A;  1NN7 A;  5AN8 A;  3UM0 A;  1O1R A;  3GZ1 A;  4HRN A;  1TNB A;  4GMJ A;  3NZU A;  3ABM E;  1BLX B;  3D9L A;  3EJN A;  3DWL G;  2WXL A;  3GW4 A;  4B93 B;  4I1O B;  4YDO A;  4K5B A;  3E4U A;  4HRM B;  3Q5M A;  4CRW A;  3LY8 A;  5D66 A;  3L08 A;  3PDN A;  3APF A;  2WVI A;  3TJP A;  2DBA A;  2RKK A;  5A15 A;  1U2V G;  3PVL A;  4G8L A;  5AQ9 A;  4F7A A;  1P5Q A;  4UWH A;  3EUV A; 
#chains in the Genus database with same CATH homology
 1OWP A;  2GW1 A;  2YY9 A;  3L6A A;  4W9H H;  1ELW A;  2WMN A;  4CXI A;  3B7T A;  3G2S A;  4JL0 A;  4F53 A;  3CEQ A;  4TUU A;  3KS2 A;  4U2M A;  3Q49 B;  3CGH A;  1EOE A;  3JCK C;  3GA1 A;  5KJM A;  5ARF A;  4I43 A;  4KT6 B;  2OVB A;  1E7V A;  5AEN A;  3FP3 A;  2NC9 A;  1QDV A;  4KZC A;  3C6N A;  3ZKJ B;  4PS7 A;  5ANL A;  5EKQ D;  3JYS A;  2AW6 A;  3VLF A;  4JXT A;  4BKT B;  3P2B A;  3CHS A;  4K03 A;  3FH8 A;  3FUE A;  5AJD A;  4DK5 A;  3HVE A;  3MZL B;  1YA0 A;  2P1O A;  4DPR A;  4JVS A;  2KZT B;  2VQ2 A;  4XI0 A;  3QDN A;  3SBT B;  4AJW A;  2XPY A;  5LP0 A;  4FHJ A;  1HO8 A;  2PZI A;  3SD5 A;  4W9F B;  3NQP A;  4W9I B;  4UWF A;  3LVR E;  4A3T A;  2LAH A;  4WWP A;  1HFA A;  4V3I A;  5KJL A;  4AM9 A;  1N52 A;  4AVX A;  3EHN A;  3L16 A;  5HI7 A;  1JWG A;  3L17 A;  2VSX E;  3KD7 A;  4WNE A;  3VLD A;  1QDW A;  4JEU A;  2Y4T A;  4YVO A;  5G04 J;  3EHM A;  3I4R B;  4DI3 A;  3P1U A;  3CIA A;  3SZ7 A;  3HYM B;  1FQV B;  2CHW A;  2AVP A;  4GCO A;  4KMO A;  5A7D B;  2VYI A;  2PL2 A;  1INZ A;  4FAD A;  2WXF A;  3OHV A;  3FWV A;  1Z3X A;  2WXK A;  5LX8 A;  2J9Q A;  4W9R A;  4GYO A;  2E2E A;  4PDX A;  3SBS A;  4Q69 A;  2YQ8 A;  5KJN A;  1FS1 B;  3U3W A;  3ENE A;  3MJW A;  3UX4 A;  2X6J A;  2R9R B;  1H19 A;  2X6K A;  4GZ6 A;  4FP7 A;  1KLX A;  3OTN A;  4J6I A;  4MLP A;  4W9J B;  2CG2 A;  2VSN A;  3KAE A;  4FHK A;  4Q94 A;  3RKV A;  5BV1 A;  4NUR A;  5JJ7 A;  3Q47 B;  1NEX A;  2GGF A;  3ZYM A;  3QOU A;  1FCH A;  2CG3 A;  1DNP A;  1EYH A;  3AS5 A;  4TRQ A;  5C1D A;  4N2S A;  3BIM A;  4GAA A;  3FUD A;  4FLB A;  3CK8 A;  2R17 C;  3FTY A;  3MGB A;  1ZU2 A;  2Y3A A;  5FZQ A;  4GA2 A;  3RRU A;  2WB2 A;  3ZYK A;  4B94 A;  5M72 A;  3VLE A;  4KVO A;  4C0M A;  3I3N A;  3PUK A;  4CEM A;  4I2W A;  4AY6 A;  2V5F A;  3CLJ A;  2I9C A;  4K0R A;  3RRN B;  4C9B B;  3UT8 A;  5JH5 B;  1EOF A;  3ZPJ A;  2VGX B;  2DCP A;  2L6J A;  2VSO E;  3D9N A;  4G24 A;  4I17 A;  2HYZ A;  3FU5 A;  4HOR A;  3ZVV A;  3PEU B;  1S0P A;  1BUO A;  4I6E A;  4PH4 B;  5A6R A;  1EOD A;  4B9K B;  2J09 A;  1QZ2 A;  1GW6 A;  2VGY A;  3L22 A;  3I5P A;  4UQZ A;  1EXB E;  2KM4 A;  3BG0 B;  4W9H B;  3S7B A;  1HS6 A;  2FEZ A;  4L2L A;  5BUZ A;  3CVL A;  3PNT B;  3QWW A;  3QKY A;  3G2T A;  4F3V A;  4EZK A;  1LM8 C;  2OVR A;  1H0A A;  3JUI A;  4XE0 A;  2WQ6 A;  3U9W A;  5E76 A;  2X3M A;  2IJG X;  4EQF A;  4B95 B;  2C0M A;  4LCT A;  2LAI A;  4CCA A;  3QJZ A;  3IKO B;  3MKQ B;  5FWQ A;  2HM8 A;  3RIB A;  1NA0 A;  1FVF A;  2PQR A;  4XKB A;  3B7R L;  2KZT A;  4NQ0 A;  1E7U A;  3FTS A;  2MOW A;  2WMO A;  4H7X A;  1HU3 A;  3D3M A;  4ILH B;  4DI4 A;  3CVP A;  2J49 A;  3QC1 A;  5AIJ A;  3PS6 A;  4I6J A;  2A4Z A;  2Y4U A;  3D9P A;  4GU5 A;  4ANX A;  4BFR A;  4U77 A;  1E8Z A;  4NRH B;  4FA6 A;  4I9E A;  3QAQ A;  2YIN A;  3RU0 A;  3WXX A;  4C0E A;  3TGO A;  5BXD A;  3MA5 A;  4AWJ B;  4PS3 A;  3ZHE B;  1PAQ A;  4ILG A;  3MX3 A;  4HS2 A;  3UQ3 A;  1W3B A;  2MRI A;  4G11 A;  4IRU A;  5G2N A;  5JHB A;  4JW1 A;  2MHK A;  4AY5 A;  3ESK A;  3FTU A;  4J8E A;  2XRZ A;  1SQM A;  1WM5 A;  4UI9 J;  4WUY A;  4XZ4 A;  3CQG B;  2XHE A;  3EIJ A;  4UI9 C;  3BG1 B;  3FTV A;  2L0I A;  3TXN A;  3ZEF A;  4B8C B;  1HH8 A;  4DLO A;  1ELR A;  3IHV A;  2AST A;  2UWJ G;  2XPZ A;  3ZRH A;  5CHE E;  1DVP A;  1R28 A;  4GYY A;  1PY1 A;  4GML A;  4RVB A;  4I6J C;  3M4T A;  4E85 A;  1HXI A;  4AJY C;  2IQC A;  5HYW B;  3PH0 C;  2RG8 A;  3FTW A;  4BX8 A;  5BXH A;  4F1S A;  4BKS B;  4CT0 A;  3NZS A;  2X6I A;  2Z8H A;  4J8F A;  4JZY A;  4APF A;  1H2U A;  2M63 A;  5D0O D;  3OXF A;  4I1A A;  2CFU A;  4ME2 A;  5KCM A;  4JGH C;  5LFA A;  1UJK A;  2LO6 A;  2VGX A;  3O48 A;  5FQ4 A;  4B0Z A;  1PC2 A;  2WM9 A;  5JJT A;  2CFZ A;  5DAF A;  5HZG C;  3IV0 A;  4N39 A;  2FF4 A;  3KEZ A;  2LSV A;  3U4T A;  3U66 A;  2QY7 A;  4M3O A;  5T4Y A;  3G2W A;  2Q7F A;  2WXH A;  2I2R A;  3JQ0 A;  1WAO 1;  1XNF A;  4GZ3 A;  4ILI A;  4XI9 A;  2VPK A;  3FTZ A;  1WY6 A;  3G2V A;  3LS8 A;  4U8H A;  4PUC A;  3B7U X;  3RJV A;  1S1G A;  1QNF A;  1SZ9 A;  4HOS A;  2XPI A;  4BTB A;  2MA9 C;  3PRZ A;  3ASG A;  1NA3 A;  1UG3 A;  2J4B A;  1MHQ A;  5BPP A;  2AXV A;  3CVV A;  4N3B A;  1HE8 A;  4FJY A;  2UY1 A;  1TJF A;  3CKC A;  1VDY A;  4CGW A;  3CVQ A;  5G04 C;  4CGV A;  3MKQ A;  3MCX A;  2V4L A;  3ML8 A;  3CVW A;  3S7D A;  5ANR A;  1A17 A;  2WXN A;  4U0S A;  5BXB A;  3PRE A;  2J08 A;  3FUI A;  2NSZ A;  4GYW A;  2E0I A;  3FH7 A;  3MV2 B;  2WXO A;  3WSO B;  3ZNG B;  2CHX A;  4JPS A;  3ULQ A;  3QB2 A;  4N9F 5;  4W9K B;  4CRH A;  3FFL A;  2R59 A;  5FT9 A;  3B7S A;  3CHO A;  3MV3 B;  4YVQ C;  1IHG A;  4UWG A;  2XGS A;  2KC7 A;  4KZ0 A;  4JHK A;  3NF1 A;  1HX8 A;  1NZN A;  4LUN U;  4OVV A;  3FEY A;  3C6O A;  5CCL A;  4KVM A;  3FU6 A;  4H7Y A;  4HXI A;  1VCB B;  3AU4 A;  3DPD A;  5EX0 A;  1OUV A;  4I2Z A;  3ZFW A;  3ZHE A;  4W9E B;  2FBN A;  2WXR A;  4FU3 A;  3GZ2 A;  3FUH A;  4U0U A;  1XGW A;  2OOE A;  3RRM B;  4ATG A;  4EEC A;  4R7L A;  2I1J A;  3FDH A;  2WXG A;  2NZ0 B;  4JEH A;  5FQ8 A;  2EQX A;  3S2A A;  3OXG A;  5DIZ A;  3LPZ A;  3LXU X;  4E6H A;  2PPI A;  3MYV A;  4AXH A;  3DRZ A;  3FKC A;  3LUT B;  2XEV A;  4W9D B;  3PNL B;  3KVT A;  4FC8 A;  4WNG A;  4HLE A;  3CSF A;  4JHR A;  4A55 A;  3DCG B;  3OXL A;  1HZ4 A;  3IBE A;  4AOF A;  4IN3 B;  4D10 C;  4WQO C;  3D9J A;  4RSY A;  2C2L A;  1LF8 A;  3HQI A;  3ASF A;  3AS8 A;  3FTX A;  4I9C A;  3ZRC B;  1E8X A;  1E8Y A;  4B9K E;  3OGK A;  3CHM A;  2WXI A;  4U04 A;  2VJ8 A;  3LYA A;  4J8D A;  5BT1 A;  2L9B A;  3Q15 A;  2UY1 B;  3IHY A;  1CS3 A;  2VKP A;  2IFU A;  3CQC B;  2Q81 A;  3JQ1 A;  4ANU A;  3T5V A;  2C9W C;  4FJZ A;  1ELK A;  2FO7 A;  2ION A;  2I2O A;  2IF4 A;  4OYS A;  5G55 A;  2A79 B;  2KCL A;  4RG9 A;  3ZTD B;  2KCV A;  4GCN A;  1IYG A;  3ZGQ A;  3ZTC B;  4BTA A;  5G05 J;  5A23 A;  4N2Q A;  4GA0 A;  4KBQ A;  3DBS A;  3ESL A;  2IZV C;  3LNM B;  3K9I A;  3FY4 A;  5E75 A;  4ACK A;  1U3C A;  3QWP A;  3IEG A;  3FUN A;  4JA7 A;  3ZIM A;  5CCM A;  3FU0 A;  2J4D A;  1N54 A;  3D9O A;  4JA9 A;  4KYO B;  2WPV A;  3PZD A;  5T3R A;  3SHF A;  4BGC A;  3Q4A B;  2IOS A;  1E8W A;  4P29 A;  4DJA A;  3LY7 A;  4JTC B;  1JUQ A;  2E31 B;  2WXM A;  5BW8 C;  1R29 A;  4HOU A;  1FS2 B;  1UN9 A;  2WQ7 A;  3SF4 A;  2JZ3 C;  4GZ5 A;  4Y6C A;  2OVQ A;  3B84 A;  1H2T C;  3LJ3 A;  4UWL A;  4JTD B;  4B8A A;  3ONK A;  3D9K A;  1LQB B;  3EIQ C;  3CK9 A;  3C6P A;  5FQ6 A;  5BO4 C;  3RK6 A;  3S7F A;  2BF0 X;  4A1S A;  4G26 A;  4BT9 A;  4Y6W A;  1P22 B;  3FH5 A;  4ZGC A;  4L23 A;  5CMY A;  1ZBP A;  2XGO A;  1UW4 B;  1HG2 A;  3URZ A;  4JHJ A;  4HFG A;  4EOZ A;  2WXQ A;  4XX5 A;  4L1B A;  3DRY A;  1FVH A;  1Z6T A;  5EUP A;  1R2B A;  4FUL A;  5D0Q D;  3SNX A;  4MKT A;  3R9A B;  3FUM A;  4EBA G;  3CK7 A;  3TL5 A;  2NN2 A;  2C0L A;  3FUF A;  1IQR A;  3V7D A;  3OHU A;  3SGH A;  4U63 A;  4N5C A;  2JLB A;  3APC A;  3OGL A;  4HOQ A;  4UYI A;  2FNJ C;  4GA1 A;  3CHQ A;  3LVQ E;  3CHP A;  5J08 A;  2RD0 A;  2P1P A;  3HHM A;  2NXP A;  4U0Z A;  4UQX A;  4FLH A;  3ONL A;  5LCW J;  4W9G B;  4CXJ A;  1TEZ A;  4WWN A;  3ZYQ A;  3T8M A;  3LBZ A;  2ZU6 B;  3M5B A;  1E96 B;  1KT0 A;  3QK0 A;  4N3C A;  3R7R A;  5A6C A;  5LCW C;  4BSX A;  4WND A;  2I1K A;  1HG5 A;  5LOZ A;  3S7J A;  4IYP A;  2CHZ A;  4NAC A;  2PM7 A;  2PM6 A;  3LY9 A;  4WWO A;  3SI5 A;  5IBK A;  3VTY A;  2KCK A;  2LNI A;  4U07 A;  3ASD A;  2WQH A;  3L13 A;  4EZL A;  3HTM A;  4KXK B;  4B89 A;  2AWI A;  3OGM A;  4ABN A;  2WXJ A;  3M52 A;  3HDX A;  3G2U A;  3CHR A;  1Y6I A;  4GZC A;  2VTB B;  4MS6 A;  5ARG A;  4CDR A;  3PEV B;  1JWF A;  1OWN A;  4N3A A;  4QFV A;  5FZS A;  4W9L B;  3TG5 A;  5BV0 A;  4J0U A;  4AV7 A;  4AIF A;  5JHA A;  4I6G A;  3D9I A;  3CVX A;  4XKC A;  3SFZ A;  1KT1 A;  2ILR A;  1E90 A;  3CR3 A;  1HV2 A;  2P1N A;  2YHE A;  5EX3 A;  1IQU A;  4IUL A;  2AXU A;  2R5S A;  3FUL A;  2I6H A;  4L2Y A;  4Q96 A;  2FUL A;  4HVB A;  2IHC A;  2V0P A;  4U2N A;  4G23 A;  3VTX A;  3L54 A;  4CXT A;  5KJK A;  4TV3 A;  1U3D A;  5AYW D;  3HIZ A;  4UIJ A;  4ANW A;  5CMW A;  2PQN A;  2J07 A;  1JPL A;  3LCA A;  5DBK A;  4LEU A;  1SZA A;  2DIW A;  2IOL A;  2KAT A;  1NP7 A;  4XIF A;  1HF8 A;  3FU3 A;  4DLQ A;  5LLI B;  4O6F A;  2XCB A;  5C2Y A;  3ZUN B;  2JEK A;  3MKR A;  2BTD A;  2WXP A;  3EDT B;  3LEW A;  2L0T B;  4ACL A;  4CT4 A;  4RG6 A;  2XCC A;  4GPK A;  4HOT A;  3M8V A;  5H7G A;  5FJY A;  3ZYL A;  1T1D A;  1TJC A;  2V8S E;  2VSY A;  3CST A;  1OWM A;  2IU1 A;  2GRL A;  1H6K A;  3C98 A;  2ASS A;  4CP3 A;  1OWL A;  4BT8 A;  4I1M A;  3PE3 A;  4WAF A;  5AJL A;  5T8I A;  2OVP A;  3ZXS A;  4EPZ A;  1MQS A;  3N71 A;  1OWO A;  1A68 A;  4W9C B;  5FZR A;  5FTA A;  3PE4 A;  4L7T A;  3CV0 A;  2LSU A;  3UT4 A;  2XGM A;  4JTA B;  3HVE B;  1EPU A;  3U64 A;  4ZOU A;  4YY8 A;  4EBA A;  4A3V A;  2GRM A;  2OV8 A;  4ANV A;  5FTP A;  3TAX A;  4GZD A;  4MRU A;  1DSX A;  4BX9 A;  3TG4 A;  2X6H A;  1Y8M A;  3CVY A;  2IF5 A;  4UQY A;  1L5J A;  3MKS A;  4AP2 A;  2OND A;  3T5X A;  1UN8 A;  4OVU A;  1NN7 A;  5H7H A;  4APO A;  5FQ7 A;  3GZ1 A;  3TXM A;  3APD A;  5G05 C;  3MEK A;  4GMJ A;  3NZU A;  3FUK A;  4BWR A;  2XRY A;  3D9L A;  3EJN A;  2P1M A;  3DRX A;  3BEE A;  1X5B A;  1QQE A;  4J8S A;  4URK A;  3ZRF B;  3OAW A;  3UUX A;  1H2V C;  2QFC A;  3QWV A;  4G1T A;  3QNK A;  2WXL A;  2P58 C;  3FEX A;  4YND A;  2BUG A;  3GW4 A;  2AXZ A;  4J8Z A;  2YNQ A;  3UPV A;  3CVN A;  4A1G A;  5JJ6 A;  4G25 A;  4I1O B;  2X38 A;  4CDN A;  4PS8 A;  4G2V A;  4UI9 K;  3ASH A;  3B13 A;  2VTB A;  3ML9 A;  3E4U A;  3GZS A;  2XQ0 A;  3O4Z A;  3R7Q A;  1LDK D;  1EF1 C;  3RO2 A;  3UMV A;  2FI7 A;  3Q5M A;  5DAD A;  4AEZ C;  4CDM A;  3LY8 A;  3AS4 A;  3AU5 A;  1EDU A;  4CRW A;  2P1Q A;  4WNF A;  3ZW3 A;  2HR2 A;  3LDZ A;  3LKU A;  3PUJ A;  3QAR A;  3UT7 A;  2E32 B;  3FHE A;  5ENN A;  5BNW A;  5EDS A;  1UJJ A;  3D9M A;  4EZJ A;  3L08 A;  3PDN A;  4JC8 A;  3APF A;  2HO1 A;  2WVI A;  3TJP A;  3L2O A;  3FUJ A;  1Z3Y A;  2A5U A;  4BY6 A;  3ZN3 A;  2DBA A;  5A15 A;  3CKB A;  3PVL A;  5J90 A;  2YHC A;  3E4B A;  4LER A;  3HU6 A;  5HQ8 A;  4GB9 A;  1BPO A;  4F7A A;  2OVF A;  3CVU A;  1P5Q A;  2X6F A;  3I4G A;  4UWK A;  3RO3 A;  4UWH A;  1B89 A;  3GYZ A;  4LRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...