3HVEA

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
216
Chain Sequence
SDPQHAARLLRALSSFRERFCDAHLVLDGEEIPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLNDTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLERYVFEAVIRWIAHEIRKVHMKDVMSALWVSGLDSYLREQMLNEPLVREIVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
molecule keywords Gigaxonin
total genus 52
structure length 216
sequence length 240
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveA01
4W9HH 5A6RA 3OGLA 2VPKA 1P22B 4W9CB 4EOZA 3E4UA 5BO4C 5EUPA 5DADA 3LNMB 5BXDA 4WQOC 1NEXA 3FKCA 3V7DA 3WSOB 5H7HA 1VCBB 4N9F5 4W9IB 2FNJC 2P1MA 1EXBE 1T1DA 4HXIA 3M4TA 3LUTB 2Q81A 4CRHA 2A79B 3HQIA 4CXIA 3ZTCB 2ASTA 1CS3A 3L2OA 2P1QA 3ZNGB 2OVQA 1EODA 3OGKA 4W9JB 5A15A 3C6NA 1BUOA 1QDVA 4HS2A 2MA9C 3OHUA 4CXTA 1DSXA 3MKSA 2NZ0B 5HYWB 1EOEA 2EQXA 2P1NA 2I2RA 3BIMA 1QDWA 4JTDB 1NN7A 2E31B 4AJYC 1A68A 5JH5B 3LBZA 1EOFA 3ZRFB 2NN2A 3M8VA 3B84A 5HZGC 3M5BA 3HVEB 3OGMA 2IF5A 5H7GA 5BXHA 4J8ZA 3M52A 2Z8HA 5LLIB 5DAFA 4U77A 4U2MA 2ASSA 4JTAB 2IZVC 4W9KB 3HU6A 2E32B 4U2NA 3I3NA 4CP3A 4W9LB 4BKTB 2P1OA 1FS1B 1LM8C 3HVEA 4B95B 2OVRA 4B9KB 2P1PA 4JGHC 2IHCA 4W9HB 1LDKD 3KVTA 5BXBA 3DRZA 4JTCB 4BKSB 5FTAA 1LQBB 3ZKJB 1R28A 4B9KE 4AWJB 2VKPA 3DCGB 1R29A 2PPIA 1FS2B 2JZ3C 4UYIA 4W9FB 2R9RB 3ZTDB 3OHVA 4I6JC 3ZUNB 3GA1A 1HV2A 1FQVB 4W9GB 3C6PA 1S1GA 2C9WC 5IBKA 3HTMA 4AP2A 4APFA 3C6OA 4W9DB 4CXJA 4W9EB 2YY9A 3ZRCB 4BGCA 1R2BA 4UIJA 4ZOUA 2OVPA
chains in the Genus database with same CATH superfamily
1WM5A 5BNWA 5A6RA 5ANLA 3RIBA 1N54A 2VPKA 3PZ4A 4U04A 3P2BA 2P9UG 2EILE 5H7HA 4G25A 1N11A 5DIZA 1OCOE 4UUCA 3LYAA 1HG2A 3HXEA 4LG6A 2J4BA 3D3MA 1QYMA 3L2OA 2XRZA 1UJJA 2XCBA 4ATZD 2H6HA 3EDTB 1BUOA 2M63A 4HS2A 3FP3A 1QQEA 5AARA 3S7BA 5CCLA 2R02A 3FUDA 3SFZA 1A68A 3X2QE 4AV7A 1MX4A 1SW6A 3J5PA 5ARGA 2JABA 4HOTA 2QFCA 3KEZA 3U4TA 3D9NA 1FS1B 3D9PA 2P1PA 3OTNA 1EPUA 4RG6A 4JTCB 2IOSA 3SI5A 2YHCA 3ABKE 5FTAA 1OXJA 4UQXA 4F6RD 1OCCE 3CVXA 5KCMA 1ZBPA 3ZXSA 4C0EA 3ZTDB 3FUFA 1EDUA 3FTZA 4HRNA 5D0OD 5E75A 3TJPA 3NBNB 5IBKA 4XKBA 2CG3A 1AP7A 3C6OA 1S63A 5CBOA 5JHAA 3F6QA 3Q7AA 1JCRA 5FJYA 3ZRCB 4TUMA 4WNGA 3PS6A 3ASNE 3KSLA 5AQBA 3QB2A 3MKRA 5D0QD 4W9CB 1HU3A 3LNMB 1OY3D 2FO7A 2WXHA 3DRAA 4KMOA 1EXBE 2VSNA 2CHWA 1LF8A 5G05C 2MYOA 3GW4A 3ASDA 3B7TA 3CHQA 3W9FA 2XPZA 4C9BB 1SZ9A 3U66A 3CSTA 5KNHD 1NZNA 3DSUA 4EZJA 2J07A 2GW1A 2HE0A 1E8YA 3PUJA 2BKGA 1W3BA 3ONLA 4DK5A 4KXKB 2L6BA 4MKTA 4YVOA 2Z8HA 3UT8A 4TXQA 3AS4A 5EYPF 5CEAA 2WM9A 3RRNB 4HLEA 1E8XA 2WQ7A 4CDMA 3LY8A 1MJ0A 3CKCA 3DSWA 4HB5A 2WXGA 1QZ2A 4OYSA 2MHKA 3CHPA 4J8YA 3ZU7B 5CBNA 3VLEA 2WXPA 1UW4B 2HYZA 5HQ8A 4BTBA 4U8VD 5FTPA 1JWGA 5ENNA 1A17A 4AY6A 2WMNA 4BX9A 4RG9A 5G55A 3EHNA 3ASHA 4GTPA 2XS8A 2YHEA 2F8XK 4ZOUA 1YYHA 5ENRD 2IO3C 2RFAA 3E4UA 5CHEE 1LTXA 3V31A 4N2SA 4J8SA 4ANUA 2R59A 3TG5A 1KLXA 1N4RA 2LO6A 4YDWA 2GRQB 5AJLA 4CRHA 3HQIA 1JWFA 3S2AA 2I2OA 3ZTCB 2P1QA 4NRHB 3LVRE 3Q9NC 2DVWA 2PQRA 4G8KA 2MA9C 4N2QA 5HS0A 4CT0A 3CHOA 4K5AB 4QQIA 2J49A 2ONDA 3DXMG 4GA2A 4UWKA 4HRMB 2NN2A 5A7DB 4JEUA 3VLDA 4ZGCA 2IU1A 3M52A 1MYOA 3UM2A 2F37A 2V4HC 3JUEA 3HU6A 2XQ0A 3CV0A 2P1OA 5FQ4A 1TN6A 5FIOA 3HRAA 3ESLA 1JCSA 2KM4A 4I9EA 4PUCA 5CERB 1DCQA 2VKPA 2VSYA 4GMLA 4UWFA 4A3TA 5KBAA 1LD8A 1Z5SC 1TNUA 5AENA 1S70B 2A4ZA 5AYWD 5AN8A 4FLHA 3PZ1A 4N3AA 4IYPA 2L0TB 4CXJA 4ILIA 2P2CP 4G8LA 5HI7A 4ZHBA 4NURA 3OGLA 4ABNA 5BO4C 3CVVA 3CVWA 2DWZA 4I17A 2CG2A 4N9F5 3U9WA 4HOUA 3SY2A 4MLPA 2VGYA 1IYGA 2Q81A 5ENPD 3DXKG 5EDSA 3FH7A 5ENQD 3C72A 4GCNA 3EHRA 4EBAG 4CGVA 1L5JA 4PDXA 5HYWB 5JA4D 4EQFA 1OWNA 1HS6A 2DIWA 2XEHA 4OAVB 5JH5B 5G2NA 4DI3A 1FPPA 3UI2A 1SZAA 3E32A 4JL0A 1HZ4A 2IQCA 3JYSA 3HIZA 1Z6TA 1X81A 3E30A 5M72A 3KVTA 2HO1A 3E37A 3ZKJB 5EX0A 3EUVA 2XZTG 3DCGB 3ML9A 4I2WA 4OAUC 3ZUNB 3HDXA 3CK8A 2X6FA 3TWRA 1E7VA 4WAFA 3BU8A 1N0QA 1OWOA 1X5BA 4RVBA 4W9EB 1XGWA 5FZQA 3EHMA 3CVLA 4BGCA 3FUNA 3L82A 4E85A 3PEVB 4WWOA 4XX5A 4EHMA 4AIFA 5EIBE 4ANVA 2P1MA 3FHEA 3E34A 4ILHB 3B7RL 3MV3B 2BEDA 2KZTB 4B94A 3PRZA 2X6JA 1SQMA 2V8SE 3AG4E 3V2OA 5HKPA 1NFIE 3PH0C 5JMND 1BI8B 1YA0A 2B6CA 3CVYA 3LKUA 3IBEA 2B0OE 5G04J 5E76A 2IF5A 4GB9A 2FI7A 3KS2A 3DBSA 4J8ZA 5FZRA 3MX3A 2L9BA 4U2MA 4LUNU 3T5VA 3CK9A 3Q9UC 1OWLA 4BKTB 4X8QA 5G05J 1LM8C 3B95A 3CVPA 1ELWA 5AQ9A 3DRZA 4K5CA 2GRNB 4LNGA 1N52A 1ELKA 2J09A 4DX1A 2FF4A 3C98A 2OEVA 1YCSB 4F1SA 4I6JC 5BXOA 5LOZA 4KZCA 1K1AA 4FU3A 3ZYKA 3FEYA 3WG7E 2KCKA 4AOFA 3FU5A 2FEZA 3CKBA 1LD7A 3QDNA 3T8MA 2LNIA 3EU9A 3L13A 4I2ZA 1OWPA 3BUAA 3G2WA 2KBXA 5FINA 3FKCA 2A5EA 3IKOB 1WAO1 4O60A 2HM8A 1CS3A 3Q15A 3OGKA 4FC8A 4N3BA 4XEIG 4CZ2D 3B13A 3FWVA 5CMWA 5LP0A 1KZOA 3ZYLA 4LEUA 4U8HA 2P9SG 4NIKA 4L2LA 1N4PA 4U95D 4UI9K 4U07A 4A1SA 4XZ4A 3PUKA 1E7UA 3T9KA 1VDYA 1DVPA 1IXVA 3B84A 2WMOA 3LVQE 2QZAA 2VGEA 3ABLE 3CVQA 1BPOA 5DAFA 2L0IA 3NZUA 2ASSA 3HVEA 4A3VA 5KJNA 5JJ7A 2P9KG 2XHEA 2YNQA 2AW6A 3TWQA 1H6PA 4GZ5A 4CDRA 2J8SD 3TXMA 2XPYA 2R9RB 3IXEA 5AQAA 2GROB 2IJGX 2XS1A 4JD2G 4WWPA 3D9LA 4F3VA 2VGXB 4Y6WA 3Q47B 3FDHA 3GZSA 4ILGA 3LJNA 4G26A 3DRYA 3DSSA 1IQUA 4IN3B 2OVPA 3DEOA 3LPZA 2P9LG 5CRVA 4EOZA 1PY1A 3UT7A 4UI9J 3D9OA 2GGFA 3JQ0A 1T1DA 4BY6A 3EIJA 1SVXA 3CHRA 4UWLA 1RZ4A 3QWPA 1D8DA 2ASTA 2F0YA 4WWNA 3ZNGB 3O4ZA 5KWDA 4ATGA 3IEGA 3ZFWA 4MRUA 4B8CB 3FU3A 4WUYA 4GYOA 4WNFA 3Q78A 2WXKA 3AS8A 1O5MA 4P29A 5BUZA 3BIMA 1EOFA 3M8VA 5EN5D 3M5BA 5CEDB 1NA3A 1DNPA 1E96B 2CFUA 3RO3A 4U77A 4GCOA 2RD0A 3PVLA 4U2NA 2X38A 1FT1A 4JA7A 3ZYQA 3LY7A 4JXTA 4OVVA 3TWTA 1S0PA 1TJCA 3U3WA 2ETAA 3EU5A 2V0PA 4I6JA 4AWJB 1SA5A 1E90A 2QC9A 3BQOA 2ZISA 3FUJA 3MV2B 4BEPA 4U0UA 2KC7A 5B3SE 1GW6A 4L1BA 1TN8A 1V54E 4I6EA 3HTMA 2PNNA 2AWIA 5FWQA 1E8WA 3OXGA 3NB2A 3DRXA 1EF1C 4YDYA 2PQNA 4W9HH 4I6GA 1HF8A 4C0MA 4FHKA 3ZEFA 2MOWA 3IHVA 4W9IB 3AAAC 2GRRB 3R9AB 1WDYA 2CHZA 1MX6A 2WPVA 3G2UA 4GPKA 1HXIA 4A1GA 4W9JB 4EZLA 3FH8A 1N4SA 4NQ0A 1BU9A 3ZKJA 5JJ6A 4JA9A 2I1KA 3WXXA 4JC8A 5CECB 1KPSB 1N4QA 1EOEA 3C3QA 1JPLA 1V55E 3ASGA 4GMRA 2WXOA 3PE4A 3ULEG 2VSOE 2XENA 2HR2A 1TN7A 3RK6A 3ZVVA 3FEXA 5EILA 2JLBA 3R7RA 1UN8A 3MGBA 1NA0A 5KJMA 3CR3A 2C0MA 3UKRG 3DSXA 5LCWJ 2DBAA 4MS6A 2H6GA 2UY1B 4O1PA 3D9JA 3RRMB 2OV8A 1OWMA 2ETCA 4IULA 3JXIA 4GAAA 3C6PA 3HYMB 4UWHA 4BSXA 4K03A 2XGOA 2ZGDA 3S7JA 1G3NB 2Y69E 5ENOD 4UIJA 3APFA 3ABME 4YDOA 3SQVA 3FUKA 4TUUA 3NAWA 4YNDA 4J8EA 3QAQA 5KJKA 4BFRA 3PEUB 3MKQA 1N9AA 4N39A 4YDEA 4DX2A 3TG4A 3FU6A 3PNLB 3MYVA 4L9PA 1EODA 4IRUA 3U64A 3C6NA 5B1BE 1QNFA 1HFAA 4B0ZA 4ME2A 1QDVA 2ZXWE 4JPSA 4FADA 3UINC 2Y3AA 4PS8A 3ZYMA 1QDWA 3UM3A 3KSQA 3RO2A 3ZRFB 3NOCD 1Q2ZA 4CDNA 2IF4A 3DWLG 4XI9A 4I9CA 4HORA 5EYLA 1K3ZD 1ZB1A 2QY7A 3RRUA 4CP3A 4W9LB 4HBDA 3TWUA 3ZGQA 3Q5MA 1TNBA 4GA0A 4RQIA 2R2LA 3CQGB 1HE8A 4XE0A 4GTQA 4BKSB 4U96D 1LQBB 4Y6CA 3DSVA 3VLFA 2DYSE 4HOQA 4A63B 4UYIA 3R9MA 4ACLA 1FVFA 3ULYA 1H6KA 3QJZA 4TXPA 1JCQA 3ESKA 3GYZA 4DLQA 2PM7A 2H6IA 3OXFA 3FUEA 1K8KG 1EYHA 4NACA 2OOEA 2NXPA 3CVNA 4CRWA 3QWVA 5CMYA 3M4TA 3L54A 3NOGD 4Q96A 2PM6A 2LXMA 1IHBA 2YINA 3L16A 3CIAA 2WXMA 2QYUA 2WXIA 4RLYA 1INZA 3AJIA 3L22A 3E4BA 4GPMA 1DSXA 2WQ6A 3K9IA 4JHJA 2I2RA 3QWWA 3DEPA 3TWVA 3L9TA 5FT9A 3L6AA 4AJYC 3URZA 3FULA 4I1AA 2P9PG 5H7PA 3VTXA 4GTMA 3Q49B 4URKA 1N94A 3ENEA 2E32B 4XI0A 3SF4A 3DSTA 1AWCB 2OEWA 5T8IA 3ONKA 2NC9A 1MZCA 3C5RA 4JHKA 1O1SA 3I4GA 4KVOA 1QBQA 2OVFA 2V5QC 4HQDA 3G2TA 3UKUG 2EIKE 3T8KA 4EZKA 3AU4A 1UG3A 3ZUVB 2Y4UA 3UPVA 2YQ8A 4G23A 4BSZB 2F8YA 3D9MA 1XNFA 3MEKA 3T5XA 3IV0A 2C9WC 1UOHA 1TYQG 3CHSA 4GMJA 3HXDA 3DPDA 2IONA 1H2VC 3KD7A 3UQ3A 4LCTA 4W9RA 4M7CA 3UMVA 1A5EA 5ARFA 2CFZA 4RSYA 2R5SA 4HI9A 5EIDA 3ZHEB 1VCBB 1P5QA 3ZXPA 5ITZF 5AJDA 5J90A 4GTOA 4HFGA 4DRXE 4Q69A 3NZSA 1MX2A 4DPRA 1Y6IA 3BG1B 5T4YA 2VJ8A 3MKSA 3CVUA 4HLLA 3I5PA 5T3RA 4G2VA 4D10C 4JB8P 4B89A 2IO2C 1ELRA 4KVMA 5BXUA 4U0ZA 1B89A 3HVEB 4DJAA 3EHQA 5H7GA 3Q75A 4HOSA 3DPYA 4MBGA 2KXPC 1YMPA 1HH8A 2OVBA 3HG0D 4J6IA 2BTDA 2V5FA 1BLXB 1LDKD 4M3OA 2XCCA 5ENTD 5FQ6A 4U63A 5C2YA 1DCEA 1K1BA 4WNDA 2LAIA 4B9KE 4B8AA 2PPIA 1FS2B 2JZ3C 3EJNA 5D2MC 2DCPA 5FQ7A 1H2UA 4LNBA 2AXUA 5LX8A 4LNUD 2GRPB 3R7QA 2IEJA 4FULA 4EECA 1OUVA 3BG0B 2XEVA 3PZDA 5J08A 3UM1A 2VQ2A 4L7TA 3LJ3A 4BX8A 5DADA 3OAWA 2R03A 3FY4A 3ZN3A 2P9NG 4H7YA 4BESA 3RAUA 3WSOB 5DBKA 2LSUA 3ZIMA 4YVQC 3SFXA 3LUTB 3FUIA 2WQHA 5EKQD 2XGMA 3UT4A 1BI7B 2J4DA 4LERA 1OT8A 5D66A 3D9KA 4JEHA 5KJLA 5LCWC 3B7BA 3D9HA 3SZ7A 3QNKA 4EBAA 3PNTB 2BF0X 4AXHA 4F1PA 4EPZA 3CEQA 4CCAA 1TEZA 2LUHA 4AJWA 4QFVA 3C3OA 5HZGC 3S7FA 2PZIA 3OGMA 4G24A 3TWXA 3KAEA 4JTAB 2EIME 3G2SA 2X6KA 3I3NA 3MZLB 2AVPA 3J5QB 4N3CA 2XGSA 4B95B 5BV0A 4W9HB 1NP7A 4HVBA 3UIPC 4CT4A 3CSFA 3PZ3A 3ZPJA 4BETA 4KT6B 3IHYA 5LFAA 2FULA 4BT9A 4ACKA 4JHRA 1FCHA 3GZ2A 3ASOE 2WVIA 4BWRA 1S1GA 3KEAA 3UTMA 3FUMA 4AP2A 1Z3YA 1PAQA 4GZ3A 1H19A 2WXFA 3FTSA 4Q94A 4DX6D 1P22B 2GRMA 4G1TA 4J7WA 3OXLA 3TWWA 4HXIA 5G04C 1HX8A 2PL2A 4UQZA 4N5QA 3V2XA 4DI4A 1IKND 3Q7FA 4CYMD 5C1DA 3FTWA 2P9IG 5B1AE 3RSEG 5BV1A 3AU5A 3OHUA 3V30A 2KCVA 2P1NA 4O1OA 1WY6A 2R05A 4I43A 4AM9A 2NSZA 3Q79A 3ML8A 2E31B 4AVXA 4KZ0A 1FT2A 2LAHA 5BXHA 3BEEA 1U2VG 5BT1A 4FA6A 1Z3XA 2XEEA 4PS7A 4DUIA 3SD5A 4K0RA 3FTXA 3B7UX 4XIFA 4U7EB 5EX3A 2OVRA 1NI1A 4DLOA 2IHCA 4JGHC 4PS3A 1ZU2A 4U0SA 3CK7A 3ISMC 5A6CA 2E2EA 4BT8A 1SA4A 1R28A 3Q73A 1MQSA 1R29A 4W9FB 1H2TC 1WG0A 3L17A 4J8DA 3SNXA 4GZ6A 2IOLA 1O1RA 3E33A 3APDA 1IHGA 4LSZE 3CLJA 1O1TA 2FO1E 5EUPA 5BXDA 4G11A 4WQOC 2WXLA 4DX5D 5IY5E 3RU0A 4FP7A 4J8FA 2RG8A 4DX7D 2NYJA 2A79B 2XZDG 1PC2A 2UY1A 3SBTB 3P1UA 1S64A 2AXVA 1OCRE 5AIJA 2WB2A 1MHQA 1TNOA 2Y4TA 3PZ2A 3FU0A 4A55A 3HXCA 4KYOB 3VTYA 3LDZA 3N71A 4CXTA 2RKKA 2EQXA 4FJZA 4V3IA 4FLBA 5CRUA 2KCLA 2X3MA 2X6IA 4L2YA 1NN7A 1TR4A 2WXQA 2IY0C 3MA5A 1D9SA 2R17C 1H0AA 1HO8A 2VSXE 3AG1E 2LXLA 4JVSA 1Y8MA 4W9KB 4FJYA 5KNGA 4I1OB 4GTSA 4K5BA 3CHMA 4R7LA 4HRLA 2WXRA 4FHJA 3SO8A 2Y1LE 2GRLA 3UIOC 3OHVA 2J9QA 3SGHA 2VYIA 3ASFA 3FFLA 3HXBA 3JCKC 3LEWA 4U8YD 2ILRA 4W9DB 1H6OA 5AQ7A 2ETBA 2XPIA 2WXJA 4JZYA 1R2BA 4CEMA 4HNAD 3UXGA 3TXNA 5JJTA 1N95A 3D9IA 5FZSA 1JUQA 3AS5A 2FBNA 2FNJC 4N5CA 5A23A 3ZHEA 3LY9A 3PDNA 4O6FA 2ZGGA 3PREA 4GTRA 3AG3E 2J08A 4BERA 4GTVA 2OVQA 5A15A 3APCA 4E6HA 3SBSA 3C3RA 3CQCB 2BUGA 4C48B 3QK0A 4TV3A 3NQPA 3Q4AB 3EIQC 4PH4B 3W9GA 2C0LA 4JTDB 3SFYA 5AAOA 2I6HA 3QOUA 5CCMA 3FTYA 2EIJE 3QKYA 2IFUA 2Y0BG 4YY8A 4F7AA 3LCAA 1UN9A 2V4LA 2X6HA 3TGOA 3ZW3A 2IZVC 3L08A 5FQ8A 4AEZC 4UI9C 4ANWA 3JUIA 3O48A 2UWJG 3LXUX 5BXBA 2XRYA 3LS8A 5JHBA 2E0IA 2VTBA 4I1MA 1UJKA 2VTBB 3JXJA 4OVUA 2EINE 2OCCE 3UUXA 4B93B 1U3CA 2BKKB 3PE3A 4F53A 2ZU6B 1HG5A 2I1JA 3MKQB 1KT0A 3B7SA 2I9CA 4JW1A 1D8EA 2MRIA 5HRYA 4APFA 4CGWA 3MJWA 4GTTA 4KBQA 4GZCA 3G2VA 1U3DA 4XKCA 2AJAA 3SHFA 4UQYA 2L6JA 2KZTA 3ULQA 1NEXA 4Z68A 1IQRA 3MCXA 5BW8C 3V7DA 3TL5A 4HI8A 2VGXA 2RFMA 3RKVA 1N0RA 1TNYA 4CXIA 1RW2A 1TNZA 5ENSD 4H7XA 3HHMA 2WXNA 1TJFA 3FTVA 1FVHA 3RJVA 4TXRA 2NZ0B 2DZNA 5ANRA 1KZPA 3CGHA 4ZFHA 3FUHA 3UM0A 4GU5A 3LBZA 3I4RB 3QC1A 3ZRHA 3UX4A 2LSVA 2KATA 2AXZA 3AG2E 1NL4A 3S7DA 4AY5A 1BD8A 5LLIB 2JEKA 3V79K 4J0UA 2DYRE 1DC2A 4GA1A 2QYJA 4GYYA 2P58C 4UWGA 4B9KB 4L23A 3GZ1A 2Q7FA 3HXFA 3TWSA 1E8ZA 2CHXA 3FTUA 4GYWA 2H6FA 4ANXA 3JQ1A 2DZOA 5BPPA 3GA1A 1HV2A 4TRQA 3TAXA 1OCZE 3NF1A 1FQVB 3QARA 4W9GB 2C2LA 3ZNGA 4BTAA 1KT1A 4LRZA 4WNEA 2YY9A 2ZIRA 3FH5A 2A5UA 4APOA 4GZDA
chains in the Genus database with same CATH topology
1WM5A 3FTSA 4E85A 5BNWA 3PEVB 5A6RA 5ANLA 3RIBA 1N54A 4Q94A 2VPKA 1P22B 4WWOA 3FUKA 4TUUA 4XX5A 4YNDA 2GRMA 4G1TA 3OXLA 4J8EA 3QAQA 4U04A 4AIFA 3P2BA 5KJKA 4BFRA 3PEUB 5H7HA 3MKQA 4G25A 4ANVA 2P1MA 3FHEA 4N39A 4HXIA 5DIZA 5G04C 1HX8A 4ILHB 2PL2A 4UQZA 3TG4A 3LYAA 4DI4A 3B7RL 1HG2A 3MV3B 2J4BA 3D3MA 5C1DA 3L2OA 3FTWA 2XRZA 3FU6A 3PNLB 3MYVA 1EODA 1UJJA 2KZTB 4IRUA 3U64A 4B94A 2XCBA 3PRZA 3C6NA 1QNFA 1HFAA 2X6JA 4B0ZA 1SQMA 3EDTB 1BUOA 5BV1A 2V8SE 4ME2A 2M63A 4HS2A 1QDVA 3AU5A 3FP3A 3OHUA 4JPSA 1QQEA 2KCVA 3PH0C 3S7BA 4FADA 2Y3AA 4PS8A 2P1NA 3ZYMA 5CCLA 1WY6A 4I43A 4AM9A 1QDWA 1YA0A 2NSZA 3FUDA 3SFZA 3CVYA 3ML8A 3LKUA 2E31B 1A68A 4AV7A 4AVXA 3IBEA 4KZ0A 5ARGA 3RO2A 3ZRFB 5G04J 4HOTA 5E76A 2LAHA 4CDNA 2IF4A 2IF5A 4GB9A 2FI7A 3KS2A 3DBSA 3BEEA 5BXHA 4XI9A 4I9CA 5FZRA 5BT1A 4FA6A 4J8ZA 1Z3XA 3MX3A 2QFCA 3KEZA 2L9BA 4HORA 4U2MA 4PS7A 2QY7A 4LUNU 3U4TA 3T5VA 3D9NA 3RRUA 3CK9A 3SD5A 4K0RA 4CP3A 3FTXA 4W9LB 1OWLA 3B7UX 4BKTB 4XIFA 5G05J 1FS1B 1LM8C 3ZGQA 5EX3A 3Q5MA 3D9PA 2OVRA 2P1PA 4DLOA 3CVPA 1ELWA 3OTNA 4GA0A 1EPUA 4PS3A 4RG6A 2IHCA 3DRZA 3CQGB 1HE8A 4XE0A 1ZU2A 1N52A 4JTCB 4BKSB 2IOSA 4U0SA 3SI5A 3CK7A 2YHCA 5A6CA 1ELKA 2J09A 2E2EA 4BT8A 1LQBB 5FTAA 2FF4A 4Y6CA 4UQXA 1R28A 3VLFA 3CVXA 5KCMA 3C98A 1MQSA 1R29A 1ZBPA 4HOQA 4F1SA 4UYIA 4W9FB 3ZXSA 4C0EA 3ZTDB 3FUFA 1EDUA 4ACLA 4I6JC 1FVFA 1H2TC 3FTZA 5D0OD 1H6KA 5LOZA 5E75A 3QJZA 3L17A 4J8DA 4KZCA 3TJPA 4FU3A 3SNXA 5IBKA 4GZ6A 4XKBA 3ESKA 2CG3A 3ZYKA 2IOLA 3C6OA 3GYZA 3OHVA 5JHAA 3FEYA 2PM7A 4DLQA 5FJYA 2KCKA 3APDA 3ZRCB 4AOFA 1IHGA 3FU5A 4WNGA 2FEZA 3PS6A 3CKBA 3QDNA 3T8MA 3CLJA 3QB2A 3MKRA 5D0QD 2LNIA 4W9CB 3L13A 1HU3A 3OXFA 5EUPA 3FUEA 4I2ZA 1OWPA 3LNMB 5BXDA 4G11A 3G2WA 2WXLA 1EYHA 4WQOC 4NACA 2FO7A 2WXHA 2OOEA 2NXPA 3FKCA 3CVNA 4KMOA 3RU0A 4CRWA 3QWVA 1EXBE 3IKOB 4FP7A 1WAO1 4J8FA 5CMYA 3M4TA 2VSNA 2RG8A 3L54A 4Q96A 2PM6A 2CHWA 2A79B 1LF8A 5G05C 3ZN3A 1PC2A 2UY1A 3GW4A 3L16A 2YINA 2HM8A 3SBTB 3CIAA 3P1UA 1CS3A 3ASDA 3Q15A 2WXMA 2AXVA 3OGKA 2WXIA 5BXBA 4FC8A 3B7TA 3CHQA 4N3BA 5AIJA 2WB2A 5CMWA 1MHQA 3B13A 3FWVA 2Y4TA 5LP0A 3FU0A 2XPZA 4A55A 1INZA 3ZYLA 4KYOB 4LEUA 3UPVA 3L22A 4C9BB 1SZ9A 3VTYA 3CSTA 3LDZA 3E4BA 3N71A 3U66A 4CXTA 1DSXA 1NZNA 4U8HA 2WQ6A 4EZJA 4L2LA 2EQXA 4FJZA 3K9IA 4JHJA 4V3IA 3QWWA 4FLBA 2J07A 4UI9K 4U07A 2I2RA 4A1SA 4XZ4A 2GW1A 3PUKA 1E8YA 2KCLA 2X3MA 2X6IA 4L2YA 1NN7A 5FT9A 3L6AA 4AJYC 1E7UA 2WXQA 3URZA 3FULA 3PUJA 1VDYA 1DVPA 4I1AA 1W3BA 3B84A 3MA5A 3ONLA 4DK5A 2WMOA 3LVQE 4KXKB 2R17C 1H0AA 3VTXA 1HO8A 2VSXE 3CVQA 1BPOA 4MKTA 4YVOA 2Z8HA 3UT8A 5DAFA 3Q49B 2L0IA 4JVSA 3NZUA 3AS4A 2ASSA 1Y8MA 4URKA 2WM9A 4FJYA 4W9KB 3ENEA 3RRNB 4XI0A 2E32B 3SF4A 5HQ8A 5T8IA 3ONKA 4HLEA 1E8XA 2WQ7A 4CDMA 4I1OB 3LY8A 2NC9A 3HVEA 3CHMA 3CKCA 4A3VA 5KJNA 4JHKA 3I4GA 4KVOA 5JJ7A 2OVFA 2XHEA 4R7LA 2YNQA 2AW6A 4GZ5A 2WXGA 3G2TA 2WXRA 4CDRA 4EZKA 3AU4A 1QZ2A 4FHJA 4OYSA 3TXMA 2MHKA 3CHPA 1UG3A 2XPYA 3VLEA 2GRLA 2R9RB 2IJGX 2WXPA 1UW4B 2HYZA 2J9QA 2Y4UA 4WWPA 2VYIA 3SGHA 2YQ8A 4G23A 3D9LA 4BTBA 3ASFA 3FFLA 4F3VA 2VGXB 4Y6WA 5FTPA 1JWGA 3D9MA 5ENNA 1A17A 1XNFA 3Q47B 4AY6A 2WMNA 3MEKA 3T5XA 3JCKC 3IV0A 3FDHA 2C9WC 3CHSA 3LEWA 4GMJA 4RG9A 3GZSA 4BX9A 4ILGA 4G26A 5G55A 2ILRA 3DRYA 3EHNA 3DPDA 4W9DB 2IONA 1H2VC 3ASHA 3KD7A 2XPIA 2WXJA 4JZYA 1R2BA 1IQUA 2YHEA 3UQ3A 4ZOUA 4LCTA 4IN3B 4CEMA 2OVPA 4W9RA 3LPZA 3UMVA 4EOZA 3E4UA 1PY1A 5CHEE 2CFZA 5ARFA 4RSYA 3TXNA 2R5SA 3UT7A 5JJTA 3D9IA 4N2SA 4UI9J 5FZSA 3D9OA 3ZHEB 1JUQA 3AS5A 2FBNA 4J8SA 2GGFA 4ANUA 2R59A 3JQ0A 1P5QA 1VCBB 2FNJC 4N5CA 3TG5A 1T1DA 1KLXA 4BY6A 5A23A 3EIJA 2LO6A 3LY9A 3ZHEA 3PDNA 3CHRA 5AJDA 4UWLA 5AJLA 5J90A 4O6FA 3QWPA 4CRHA 4HFGA 1JWFA 3S2AA 2I2OA 3HQIA 3PREA 3ZTCB 2ASTA 4WWNA 2J08A 4Q69A 2P1QA 3ZNGB 3O4ZA 2OVQA 3NZSA 4NRHB 5A15A 3LVRE 4ATGA 3APCA 4E6HA 3SBSA 2PQRA 3IEGA 3CQCB 4DPRA 3ZFWA 4MRUA 4N2QA 2MA9C 2BUGA 1Y6IA 4B8CB 3BG1B 3FU3A 2VJ8A 3QK0A 4TV3A 4WUYA 5T4YA 4GYOA 4WNFA 3MKSA 3CVUA 3NQPA 3Q4AB 2WXKA 3AS8A 3EIQC 3I5PA 4PH4B 4P29A 5BUZA 3BIMA 5T3RA 4G2VA 4CT0A 2C0LA 4D10C 4JTDB 4B89A 3CHOA 2I6HA 2J49A 2ONDA 3QOUA 1EOFA 1ELRA 4GA2A 4KVMA 5CCMA 4U0ZA 4UWKA 3FTYA 5A7DB 2NN2A 3M8VA 3QKYA 3M5BA 2IFUA 4JEUA 1B89A 3HVEB 4YY8A 4F7AA 4DJAA 5H7GA 1NA3A 3VLDA 4ZGCA 1DNPA 1E96B 3LCAA 1UN9A 2IU1A 4HOSA 2CFUA 2V4LA 2X6HA 3M52A 3RO3A 3TGOA 1HH8A 3ZW3A 4U77A 2OVBA 4GCOA 2IZVC 2RD0A 3HU6A 3L08A 3PVLA 4J6IA 2BTDA 2V5FA 2X38A 2XQ0A 3CV0A 4JA7A 3ZYQA 5FQ8A 4U2NA 3LY7A 2P1OA 5FQ4A 4AEZC 4UI9C 3JUIA 3O48A 2UWJG 3ESLA 3LXUX 4M3OA 4ANWA 2XRYA 1LDKD 3LS8A 2XCCA 4JXTA 4OVVA 5JHBA 2E0IA 2VTBA 1S0PA 1TJCA 2KM4A 5FQ6A 3U3WA 4I9EA 4I1MA 4U63A 5C2YA 1UJKA 2V0PA 4PUCA 4WNDA 2VTBB 4I6JA 2LAIA 4OVUA 4B9KE 4AWJB 4B8AA 2VKPA 2PPIA 3UUXA 1FS2B 1E90A 2VSYA 2JZ3C 4GMLA 1U3CA 3PE3A 4UWFA 2ZU6B 1HG5A 3EJNA 4F53A 2I1JA 3FUJA 3MKQB 3MV2B 1KT0A 4A3TA 4U0UA 2KC7A 2DCPA 5FQ7A 1GW6A 1H2UA 4L1BA 5AENA 4I6EA 2A4ZA 2I9CA 2AXUA 3B7SA 4JW1A 5AYWD 5LX8A 2MRIA 3HTMA 4FLHA 4APFA 4N3AA 2AWIA 3R7QA 4IYPA 4CGWA 3MJWA 5FWQA 1E8WA 2L0TB 4CXJA 4ILIA 3OXGA 3DRXA 4FULA 1OUVA 1EF1C 3BG0B 4KBQA 5HI7A 4GZCA 4EECA 2PQNA 2XEVA 3G2VA 3PZDA 5J08A 4W9HH 4NURA 4I6GA 3OGLA 1U3DA 2VQ2A 4L7TA 4XKCA 3LJ3A 4ABNA 4BX8A 1HF8A 3CVWA 3CVVA 5BO4C 4C0MA 5DADA 3OAWA 3SHFA 3FY4A 2L6JA 4H7YA 2KZTA 4FHKA 4UQYA 3ULQA 1IQRA 3MCXA 5BW8C 3ZEFA 1NEXA 3TL5A 3V7DA 3WSOB 2MOWA 3IHVA 2CG2A 4I17A 5DBKA 2LSUA 2VGXA 4N9F5 4W9IB 3ZIMA 4YVQC 3U9WA 4HOUA 3R9AB 2CHZA 3RKVA 4MLPA 3LUTB 2VGYA 3FUIA 2WPVA 1IYGA 3G2UA 2Q81A 2WQHA 4CXIA 5EKQD 5EDSA 2XGMA 3FH7A 3UT4A 4GPKA 4GCNA 2J4DA 1HXIA 4LERA 4A1GA 4W9JB 4EBAG 4EZLA 3FH8A 3HHMA 4H7XA 3D9KA 4JEHA 2WXNA 1TJFA 5KJLA 3FTVA 1FVHA 4NQ0A 5LCWC 5JJ6A 3SZ7A 4CGVA 1L5JA 3QNKA 3RJVA 4JA9A 2I1KA 3WXXA 4EBAA 4PDXA 4JC8A 3PNTB 5HYWB 2NZ0B 5ANRA 1EOEA 2BF0X 4AXHA 4EQFA 1OWNA 3CGHA 3CEQA 1JPLA 4EPZA 1HS6A 2DIWA 4CCAA 1TEZA 3FUHA 4AJWA 3ASGA 5JH5B 4GU5A 2WXOA 3PE4A 4QFVA 2VSOE 3LBZA 3I4RB 2HR2A 3QC1A 3ZRHA 3UX4A 5HZGC 5G2NA 3S7FA 2PZIA 2LSVA 2KATA 3RK6A 2AXZA 3ZVVA 4DI3A 3OGMA 3FEXA 4G24A 2JLBA 3R7RA 1UN8A 3KAEA 3S7DA 4AY5A 1SZAA 3MGBA 5LLIB 2JEKA 4JL0A 1HZ4A 1NA0A 5KJMA 4JTAB 4J0UA 2IQCA 3CR3A 2C0MA 3G2SA 3JYSA 2X6KA 3I3NA 3HIZA 1Z6TA 3MZLB 4GA1A 2AVPA 4GYYA 4N3CA 2P58C 2XGSA 5LCWJ 2DBAA 4MS6A 4UWGA 4B9KB 2UY1B 4B95B 5BV0A 5M72A 4JGHC 3KVTA 4W9HB 1NP7A 4HVBA 4L23A 4CT4A 2HO1A 3CSFA 3GZ1A 3ZPJA 2Q7FA 3D9JA 3ZKJB 3RRMB 4KT6B 5EX0A 3IHYA 1E8ZA 2CHXA 2OV8A 2FULA 5LFAA 1OWMA 3FTUA 4GYWA 3DCGB 4BT9A 4ACKA 4JHRA 4ANXA 3ML9A 3JQ1A 4I2WA 4IULA 1FCHA 3ZUNB 3HDXA 3GZ2A 5BPPA 3GA1A 4GAAA 1HV2A 3CK8A 4TRQA 3TAXA 2WVIA 2X6FA 3NF1A 4BWRA 3QARA 1FQVB 4W9GB 3C6PA 2C2LA 1S1GA 3HYMB 4UWHA 1E7VA 1KT1A 3FUMA 4WAFA 4AP2A 4BTAA 1Z3YA 4LRZA 4BSXA 1PAQA 4K03A 1OWOA 2XGOA 4GZ3A 1X5BA 4RVBA 1H19A 2WXFA 4W9EB 1XGWA 4WNEA 5FZQA 2YY9A 3EHMA 3CVLA 3S7JA 3FH5A 4BGCA 2A5UA 3FUNA 4APOA 4UIJA 3APFA 4GZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9H H;  5A6R A;  3OGL A;  2VPK A;  1P22 B;  4W9C B;  4EOZ A;  3E4U A;  5BO4 C;  5EUP A;  5DAD A;  3LNM B;  5BXD A;  4WQO C;  1NEX A;  3FKC A;  3V7D A;  3WSO B;  5H7H A;  1VCB B;  4N9F 5;  4W9I B;  2FNJ C;  2P1M A;  1EXB E;  1T1D A;  4HXI A;  3M4T A;  3LUT B;  2Q81 A;  4CRH A;  2A79 B;  3HQI A;  4CXI A;  3ZTC B;  2AST A;  1CS3 A;  3L2O A;  2P1Q A;  3ZNG B;  2OVQ A;  1EOD A;  3OGK A;  4W9J B;  5A15 A;  3C6N A;  1BUO A;  1QDV A;  4HS2 A;  2MA9 C;  3OHU A;  4CXT A;  1DSX A;  3MKS A;  2NZ0 B;  5HYW B;  1EOE A;  2EQX A;  2P1N A;  2I2R A;  3BIM A;  1QDW A;  4JTD B;  1NN7 A;  2E31 B;  4AJY C;  1A68 A;  5JH5 B;  3LBZ A;  1EOF A;  3ZRF B;  2NN2 A;  3M8V A;  3B84 A;  5HZG C;  3M5B A;  3HVE B;  3OGM A;  2IF5 A;  5H7G A;  5BXH A;  4J8Z A;  3M52 A;  2Z8H A;  5LLI B;  5DAF A;  4U77 A;  4U2M A;  2ASS A;  4JTA B;  2IZV C;  4W9K B;  3HU6 A;  2E32 B;  4U2N A;  3I3N A;  4CP3 A;  4W9L B;  4BKT B;  2P1O A;  1FS1 B;  1LM8 C;  3HVE A;  4B95 B;  2OVR A;  4B9K B;  2P1P A;  4JGH C;  2IHC A;  4W9H B;  1LDK D;  3KVT A;  5BXB A;  3DRZ A;  4JTC B;  4BKS B;  5FTA A;  1LQB B;  3ZKJ B;  1R28 A;  4B9K E;  4AWJ B;  2VKP A;  3DCG B;  1R29 A;  2PPI A;  1FS2 B;  2JZ3 C;  4UYI A;  4W9F B;  2R9R B;  3ZTD B;  3OHV A;  4I6J C;  3ZUN B;  3GA1 A;  1HV2 A;  1FQV B;  4W9G B;  3C6P A;  1S1G A;  2C9W C;  5IBK A;  3HTM A;  4AP2 A;  4APF A;  3C6O A;  4W9D B;  4CXJ A;  4W9E B;  2YY9 A;  3ZRC B;  4BGC A;  1R2B A;  4UIJ A;  4ZOU A;  2OVP A; 
#chains in the Genus database with same CATH topology
 1WM5 A;  5BNW A;  5A6R A;  5ANL A;  3RIB A;  1N54 A;  2VPK A;  3PZ4 A;  4U04 A;  3P2B A;  2P9U G;  2EIL E;  5H7H A;  4G25 A;  1N11 A;  5DIZ A;  1OCO E;  4UUC A;  3LYA A;  1HG2 A;  3HXE A;  4LG6 A;  2J4B A;  3D3M A;  1QYM A;  3L2O A;  2XRZ A;  1UJJ A;  2XCB A;  4ATZ D;  2H6H A;  3EDT B;  1BUO A;  2M63 A;  4HS2 A;  3FP3 A;  1QQE A;  5AAR A;  3S7B A;  5CCL A;  2R02 A;  3FUD A;  3SFZ A;  1A68 A;  3X2Q E;  4AV7 A;  1MX4 A;  1SW6 A;  3J5P A;  5ARG A;  2JAB A;  4HOT A;  2QFC A;  3KEZ A;  3U4T A;  3D9N A;  1FS1 B;  3D9P A;  2P1P A;  3OTN A;  1EPU A;  4RG6 A;  4JTC B;  2IOS A;  3SI5 A;  2YHC A;  3ABK E;  5FTA A;  1OXJ A;  4UQX A;  4F6R D;  1OCC E;  3CVX A;  5KCM A;  1ZBP A;  3ZXS A;  4C0E A;  3ZTD B;  3FUF A;  1EDU A;  3FTZ A;  4HRN A;  5D0O D;  5E75 A;  3TJP A;  3NBN B;  5IBK A;  4XKB A;  2CG3 A;  1AP7 A;  3C6O A;  1S63 A;  5CBO A;  5JHA A;  3F6Q A;  3Q7A A;  1JCR A;  5FJY A;  3ZRC B;  4TUM A;  4WNG A;  3PS6 A;  3ASN E;  3KSL A;  5AQB A;  3QB2 A;  3MKR A;  5D0Q D;  4W9C B;  1HU3 A;  3LNM B;  1OY3 D;  2FO7 A;  2WXH A;  3DRA A;  4KMO A;  1EXB E;  2VSN A;  2CHW A;  1LF8 A;  5G05 C;  2MYO A;  3GW4 A;  3ASD A;  3B7T A;  3CHQ A;  3W9F A;  2XPZ A;  4C9B B;  1SZ9 A;  3U66 A;  3CST A;  5KNH D;  1NZN A;  3DSU A;  4EZJ A;  2J07 A;  2GW1 A;  2HE0 A;  1E8Y A;  3PUJ A;  2BKG A;  1W3B A;  3ONL A;  4DK5 A;  4KXK B;  2L6B A;  4MKT A;  4YVO A;  2Z8H A;  3UT8 A;  4TXQ A;  3AS4 A;  5EYP F;  5CEA A;  2WM9 A;  3RRN B;  4HLE A;  1E8X A;  2WQ7 A;  4CDM A;  3LY8 A;  1MJ0 A;  3CKC A;  3DSW A;  4HB5 A;  2WXG A;  1QZ2 A;  4OYS A;  2MHK A;  3CHP A;  4J8Y A;  3ZU7 B;  5CBN A;  3VLE A;  2WXP A;  1UW4 B;  2HYZ A;  5HQ8 A;  4BTB A;  4U8V D;  5FTP A;  1JWG A;  5ENN A;  1A17 A;  4AY6 A;  2WMN A;  4BX9 A;  4RG9 A;  5G55 A;  3EHN A;  3ASH A;  4GTP A;  2XS8 A;  2YHE A;  2F8X K;  4ZOU A;  1YYH A;  5ENR D;  2IO3 C;  2RFA A;  3E4U A;  5CHE E;  1LTX A;  3V31 A;  4N2S A;  4J8S A;  4ANU A;  2R59 A;  3TG5 A;  1KLX A;  1N4R A;  2LO6 A;  4YDW A;  2GRQ B;  5AJL A;  4CRH A;  3HQI A;  1JWF A;  3S2A A;  2I2O A;  3ZTC B;  2P1Q A;  4NRH B;  3LVR E;  3Q9N C;  2DVW A;  2PQR A;  4G8K A;  2MA9 C;  4N2Q A;  5HS0 A;  4CT0 A;  3CHO A;  4K5A B;  4QQI A;  2J49 A;  2OND A;  3DXM G;  4GA2 A;  4UWK A;  4HRM B;  2NN2 A;  5A7D B;  4JEU A;  3VLD A;  4ZGC A;  2IU1 A;  3M52 A;  1MYO A;  3UM2 A;  2F37 A;  2V4H C;  3JUE A;  3HU6 A;  2XQ0 A;  3CV0 A;  2P1O A;  5FQ4 A;  1TN6 A;  5FIO A;  3HRA A;  3ESL A;  1JCS A;  2KM4 A;  4I9E A;  4PUC A;  5CER B;  1DCQ A;  2VKP A;  2VSY A;  4GML A;  4UWF A;  4A3T A;  5KBA A;  1LD8 A;  1Z5S C;  1TNU A;  5AEN A;  1S70 B;  2A4Z A;  5AYW D;  5AN8 A;  4FLH A;  3PZ1 A;  4N3A A;  4IYP A;  2L0T B;  4CXJ A;  4ILI A;  2P2C P;  4G8L A;  5HI7 A;  4ZHB A;  4NUR A;  3OGL A;  4ABN A;  5BO4 C;  3CVV A;  3CVW A;  2DWZ A;  4I17 A;  2CG2 A;  4N9F 5;  3U9W A;  4HOU A;  3SY2 A;  4MLP A;  2VGY A;  1IYG A;  2Q81 A;  5ENP D;  3DXK G;  5EDS A;  3FH7 A;  5ENQ D;  3C72 A;  4GCN A;  3EHR A;  4EBA G;  4CGV A;  1L5J A;  4PDX A;  5HYW B;  5JA4 D;  4EQF A;  1OWN A;  1HS6 A;  2DIW A;  2XEH A;  4OAV B;  5JH5 B;  5G2N A;  4DI3 A;  1FPP A;  3UI2 A;  1SZA A;  3E32 A;  4JL0 A;  1HZ4 A;  2IQC A;  3JYS A;  3HIZ A;  1Z6T A;  1X81 A;  3E30 A;  5M72 A;  3KVT A;  2HO1 A;  3E37 A;  3ZKJ B;  5EX0 A;  3EUV A;  2XZT G;  3DCG B;  3ML9 A;  4I2W A;  4OAU C;  3ZUN B;  3HDX A;  3CK8 A;  2X6F A;  3TWR A;  1E7V A;  4WAF A;  3BU8 A;  1N0Q A;  1OWO A;  1X5B A;  4RVB A;  4W9E B;  1XGW A;  5FZQ A;  3EHM A;  3CVL A;  4BGC A;  3FUN A;  3L82 A;  4E85 A;  3PEV B;  4WWO A;  4XX5 A;  4EHM A;  4AIF A;  5EIB E;  4ANV A;  2P1M A;  3FHE A;  3E34 A;  4ILH B;  3B7R L;  3MV3 B;  2BED A;  2KZT B;  4B94 A;  3PRZ A;  2X6J A;  1SQM A;  2V8S E;  3AG4 E;  3V2O A;  5HKP A;  1NFI E;  3PH0 C;  5JMN D;  1BI8 B;  1YA0 A;  2B6C A;  3CVY A;  3LKU A;  3IBE A;  2B0O E;  5G04 J;  5E76 A;  2IF5 A;  4GB9 A;  2FI7 A;  3KS2 A;  3DBS A;  4J8Z A;  5FZR A;  3MX3 A;  2L9B A;  4U2M A;  4LUN U;  3T5V A;  3CK9 A;  3Q9U C;  1OWL A;  4BKT B;  4X8Q A;  5G05 J;  1LM8 C;  3B95 A;  3CVP A;  1ELW A;  5AQ9 A;  3DRZ A;  4K5C A;  2GRN B;  4LNG A;  1N52 A;  1ELK A;  2J09 A;  4DX1 A;  2FF4 A;  3C98 A;  2OEV A;  1YCS B;  4F1S A;  4I6J C;  5BXO A;  5LOZ A;  4KZC A;  1K1A A;  4FU3 A;  3ZYK A;  3FEY A;  3WG7 E;  2KCK A;  4AOF A;  3FU5 A;  2FEZ A;  3CKB A;  1LD7 A;  3QDN A;  3T8M A;  2LNI A;  3EU9 A;  3L13 A;  4I2Z A;  1OWP A;  3BUA A;  3G2W A;  2KBX A;  5FIN A;  3FKC A;  2A5E A;  3IKO B;  1WAO 1;  4O60 A;  2HM8 A;  1CS3 A;  3Q15 A;  3OGK A;  4FC8 A;  4N3B A;  4XEI G;  4CZ2 D;  3B13 A;  3FWV A;  5CMW A;  5LP0 A;  1KZO A;  3ZYL A;  4LEU A;  4U8H A;  2P9S G;  4NIK A;  4L2L A;  1N4P A;  4U95 D;  4UI9 K;  4U07 A;  4A1S A;  4XZ4 A;  3PUK A;  1E7U A;  3T9K A;  1VDY A;  1DVP A;  1IXV A;  3B84 A;  2WMO A;  3LVQ E;  2QZA A;  2VGE A;  3ABL E;  3CVQ A;  1BPO A;  5DAF A;  2L0I A;  3NZU A;  2ASS A;  3HVE A;  4A3V A;  5KJN A;  5JJ7 A;  2P9K G;  2XHE A;  2YNQ A;  2AW6 A;  3TWQ A;  1H6P A;  4GZ5 A;  4CDR A;  2J8S D;  3TXM A;  2XPY A;  2R9R B;  3IXE A;  5AQA A;  2GRO B;  2IJG X;  2XS1 A;  4JD2 G;  4WWP A;  3D9L A;  4F3V A;  2VGX B;  4Y6W A;  3Q47 B;  3FDH A;  3GZS A;  4ILG A;  3LJN A;  4G26 A;  3DRY A;  3DSS A;  1IQU A;  4IN3 B;  2OVP A;  3DEO A;  3LPZ A;  2P9L G;  5CRV A;  4EOZ A;  1PY1 A;  3UT7 A;  4UI9 J;  3D9O A;  2GGF A;  3JQ0 A;  1T1D A;  4BY6 A;  3EIJ A;  1SVX A;  3CHR A;  4UWL A;  1RZ4 A;  3QWP A;  1D8D A;  2AST A;  2F0Y A;  4WWN A;  3ZNG B;  3O4Z A;  5KWD A;  4ATG A;  3IEG A;  3ZFW A;  4MRU A;  4B8C B;  3FU3 A;  4WUY A;  4GYO A;  4WNF A;  3Q78 A;  2WXK A;  3AS8 A;  1O5M A;  4P29 A;  5BUZ A;  3BIM A;  1EOF A;  3M8V A;  5EN5 D;  3M5B A;  5CED B;  1NA3 A;  1DNP A;  1E96 B;  2CFU A;  3RO3 A;  4U77 A;  4GCO A;  2RD0 A;  3PVL A;  4U2N A;  2X38 A;  1FT1 A;  4JA7 A;  3ZYQ A;  3LY7 A;  4JXT A;  4OVV A;  3TWT A;  1S0P A;  1TJC A;  3U3W A;  2ETA A;  3EU5 A;  2V0P A;  4I6J A;  4AWJ B;  1SA5 A;  1E90 A;  2QC9 A;  3BQO A;  2ZIS A;  3FUJ A;  3MV2 B;  4BEP A;  4U0U A;  2KC7 A;  5B3S E;  1GW6 A;  4L1B A;  1TN8 A;  1V54 E;  4I6E A;  3HTM A;  2PNN A;  2AWI A;  5FWQ A;  1E8W A;  3OXG A;  3NB2 A;  3DRX A;  1EF1 C;  4YDY A;  2PQN A;  4W9H H;  4I6G A;  1HF8 A;  4C0M A;  4FHK A;  3ZEF A;  2MOW A;  3IHV A;  4W9I B;  3AAA C;  2GRR B;  3R9A B;  1WDY A;  2CHZ A;  1MX6 A;  2WPV A;  3G2U A;  4GPK A;  1HXI A;  4A1G A;  4W9J B;  4EZL A;  3FH8 A;  1N4S A;  4NQ0 A;  1BU9 A;  3ZKJ A;  5JJ6 A;  4JA9 A;  2I1K A;  3WXX A;  4JC8 A;  5CEC B;  1KPS B;  1N4Q A;  1EOE A;  3C3Q A;  1JPL A;  1V55 E;  3ASG A;  4GMR A;  2WXO A;  3PE4 A;  3ULE G;  2VSO E;  2XEN A;  2HR2 A;  1TN7 A;  3RK6 A;  3ZVV A;  3FEX A;  5EIL A;  2JLB A;  3R7R A;  1UN8 A;  3MGB A;  1NA0 A;  5KJM A;  3CR3 A;  2C0M A;  3UKR G;  3DSX A;  5LCW J;  2DBA A;  4MS6 A;  2H6G A;  2UY1 B;  4O1P A;  3D9J A;  3RRM B;  2OV8 A;  1OWM A;  2ETC A;  4IUL A;  3JXI A;  4GAA A;  3C6P A;  3HYM B;  4UWH A;  4BSX A;  4K03 A;  2XGO A;  2ZGD A;  3S7J A;  1G3N B;  2Y69 E;  5ENO D;  4UIJ A;  3APF A;  3ABM E;  4YDO A;  3SQV A;  3FUK A;  4TUU A;  3NAW A;  4YND A;  4J8E A;  3QAQ A;  5KJK A;  4BFR A;  3PEU B;  3MKQ A;  1N9A A;  4N39 A;  4YDE A;  4DX2 A;  3TG4 A;  3FU6 A;  3PNL B;  3MYV A;  4L9P A;  1EOD A;  4IRU A;  3U64 A;  3C6N A;  5B1B E;  1QNF A;  1HFA A;  4B0Z A;  4ME2 A;  1QDV A;  2ZXW E;  4JPS A;  4FAD A;  3UIN C;  2Y3A A;  4PS8 A;  3ZYM A;  1QDW A;  3UM3 A;  3KSQ A;  3RO2 A;  3ZRF B;  3NOC D;  1Q2Z A;  4CDN A;  2IF4 A;  3DWL G;  4XI9 A;  4I9C A;  4HOR A;  5EYL A;  1K3Z D;  1ZB1 A;  2QY7 A;  3RRU A;  4CP3 A;  4W9L B;  4HBD A;  3TWU A;  3ZGQ A;  3Q5M A;  1TNB A;  4GA0 A;  4RQI A;  2R2L A;  3CQG B;  1HE8 A;  4XE0 A;  4GTQ A;  4BKS B;  4U96 D;  1LQB B;  4Y6C A;  3DSV A;  3VLF A;  2DYS E;  4HOQ A;  4A63 B;  4UYI A;  3R9M A;  4ACL A;  1FVF A;  3ULY A;  1H6K A;  3QJZ A;  4TXP A;  1JCQ A;  3ESK A;  3GYZ A;  4DLQ A;  2PM7 A;  2H6I A;  3OXF A;  3FUE A;  1K8K G;  1EYH A;  4NAC A;  2OOE A;  2NXP A;  3CVN A;  4CRW A;  3QWV A;  5CMY A;  3M4T A;  3L54 A;  3NOG D;  4Q96 A;  2PM6 A;  2LXM A;  1IHB A;  2YIN A;  3L16 A;  3CIA A;  2WXM A;  2QYU A;  2WXI A;  4RLY A;  1INZ A;  3AJI A;  3L22 A;  3E4B A;  4GPM A;  1DSX A;  2WQ6 A;  3K9I A;  4JHJ A;  2I2R A;  3QWW A;  3DEP A;  3TWV A;  3L9T A;  5FT9 A;  3L6A A;  4AJY C;  3URZ A;  3FUL A;  4I1A A;  2P9P G;  5H7P A;  3VTX A;  4GTM A;  3Q49 B;  4URK A;  1N94 A;  3ENE A;  2E32 B;  4XI0 A;  3SF4 A;  3DST A;  1AWC B;  2OEW A;  5T8I A;  3ONK A;  2NC9 A;  1MZC A;  3C5R A;  4JHK A;  1O1S A;  3I4G A;  4KVO A;  1QBQ A;  2OVF A;  2V5Q C;  4HQD A;  3G2T A;  3UKU G;  2EIK E;  3T8K A;  4EZK A;  3AU4 A;  1UG3 A;  3ZUV B;  2Y4U A;  3UPV A;  2YQ8 A;  4G23 A;  4BSZ B;  2F8Y A;  3D9M A;  1XNF A;  3MEK A;  3T5X A;  3IV0 A;  2C9W C;  1UOH A;  1TYQ G;  3CHS A;  4GMJ A;  3HXD A;  3DPD A;  2ION A;  1H2V C;  3KD7 A;  3UQ3 A;  4LCT A;  4W9R A;  4M7C A;  3UMV A;  1A5E A;  5ARF A;  2CFZ A;  4RSY A;  2R5S A;  4HI9 A;  5EID A;  3ZHE B;  1VCB B;  1P5Q A;  3ZXP A;  5ITZ F;  5AJD A;  5J90 A;  4GTO A;  4HFG A;  4DRX E;  4Q69 A;  3NZS A;  1MX2 A;  4DPR A;  1Y6I A;  3BG1 B;  5T4Y A;  2VJ8 A;  3MKS A;  3CVU A;  4HLL A;  3I5P A;  5T3R A;  4G2V A;  4D10 C;  4JB8 P;  4B89 A;  2IO2 C;  1ELR A;  4KVM A;  5BXU A;  4U0Z A;  1B89 A;  3HVE B;  4DJA A;  3EHQ A;  5H7G A;  3Q75 A;  4HOS A;  3DPY A;  4MBG A;  2KXP C;  1YMP A;  1HH8 A;  2OVB A;  3HG0 D;  4J6I A;  2BTD A;  2V5F A;  1BLX B;  1LDK D;  4M3O A;  2XCC A;  5ENT D;  5FQ6 A;  4U63 A;  5C2Y A;  1DCE A;  1K1B A;  4WND A;  2LAI A;  4B9K E;  4B8A A;  2PPI A;  1FS2 B;  2JZ3 C;  3EJN A;  5D2M C;  2DCP A;  5FQ7 A;  1H2U A;  4LNB A;  2AXU A;  5LX8 A;  4LNU D;  2GRP B;  3R7Q A;  2IEJ A;  4FUL A;  4EEC A;  1OUV A;  3BG0 B;  2XEV A;  3PZD A;  5J08 A;  3UM1 A;  2VQ2 A;  4L7T A;  3LJ3 A;  4BX8 A;  5DAD A;  3OAW A;  2R03 A;  3FY4 A;  3ZN3 A;  2P9N G;  4H7Y A;  4BES A;  3RAU A;  3WSO B;  5DBK A;  2LSU A;  3ZIM A;  4YVQ C;  3SFX A;  3LUT B;  3FUI A;  2WQH A;  5EKQ D;  2XGM A;  3UT4 A;  1BI7 B;  2J4D A;  4LER A;  1OT8 A;  5D66 A;  3D9K A;  4JEH A;  5KJL A;  5LCW C;  3B7B A;  3D9H A;  3SZ7 A;  3QNK A;  4EBA A;  3PNT B;  2BF0 X;  4AXH A;  4F1P A;  4EPZ A;  3CEQ A;  4CCA A;  1TEZ A;  2LUH A;  4AJW A;  4QFV A;  3C3O A;  5HZG C;  3S7F A;  2PZI A;  3OGM A;  4G24 A;  3TWX A;  3KAE A;  4JTA B;  2EIM E;  3G2S A;  2X6K A;  3I3N A;  3MZL B;  2AVP A;  3J5Q B;  4N3C A;  2XGS A;  4B95 B;  5BV0 A;  4W9H B;  1NP7 A;  4HVB A;  3UIP C;  4CT4 A;  3CSF A;  3PZ3 A;  3ZPJ A;  4BET A;  4KT6 B;  3IHY A;  5LFA A;  2FUL A;  4BT9 A;  4ACK A;  4JHR A;  1FCH A;  3GZ2 A;  3ASO E;  2WVI A;  4BWR A;  1S1G A;  3KEA A;  3UTM A;  3FUM A;  4AP2 A;  1Z3Y A;  1PAQ A;  4GZ3 A;  1H19 A;  2WXF A;  3FTS A;  4Q94 A;  4DX6 D;  1P22 B;  2GRM A;  4G1T A;  4J7W A;  3OXL A;  3TWW A;  4HXI A;  5G04 C;  1HX8 A;  2PL2 A;  4UQZ A;  4N5Q A;  3V2X A;  4DI4 A;  1IKN D;  3Q7F A;  4CYM D;  5C1D A;  3FTW A;  2P9I G;  5B1A E;  3RSE G;  5BV1 A;  3AU5 A;  3OHU A;  3V30 A;  2KCV A;  2P1N A;  4O1O A;  1WY6 A;  2R05 A;  4I43 A;  4AM9 A;  2NSZ A;  3Q79 A;  3ML8 A;  2E31 B;  4AVX A;  4KZ0 A;  1FT2 A;  2LAH A;  5BXH A;  3BEE A;  1U2V G;  5BT1 A;  4FA6 A;  1Z3X A;  2XEE A;  4PS7 A;  4DUI A;  3SD5 A;  4K0R A;  3FTX A;  3B7U X;  4XIF A;  4U7E B;  5EX3 A;  2OVR A;  1NI1 A;  4DLO A;  2IHC A;  4JGH C;  4PS3 A;  1ZU2 A;  4U0S A;  3CK7 A;  3ISM C;  5A6C A;  2E2E A;  4BT8 A;  1SA4 A;  1R28 A;  3Q73 A;  1MQS A;  1R29 A;  4W9F B;  1H2T C;  1WG0 A;  3L17 A;  4J8D A;  3SNX A;  4GZ6 A;  2IOL A;  1O1R A;  3E33 A;  3APD A;  1IHG A;  4LSZ E;  3CLJ A;  1O1T A;  2FO1 E;  5EUP A;  5BXD A;  4G11 A;  4WQO C;  2WXL A;  4DX5 D;  5IY5 E;  3RU0 A;  4FP7 A;  4J8F A;  2RG8 A;  4DX7 D;  2NYJ A;  2A79 B;  2XZD G;  1PC2 A;  2UY1 A;  3SBT B;  3P1U A;  1S64 A;  2AXV A;  1OCR E;  5AIJ A;  2WB2 A;  1MHQ A;  1TNO A;  2Y4T A;  3PZ2 A;  3FU0 A;  4A55 A;  3HXC A;  4KYO B;  3VTY A;  3LDZ A;  3N71 A;  4CXT A;  2RKK A;  2EQX A;  4FJZ A;  4V3I A;  4FLB A;  5CRU A;  2KCL A;  2X3M A;  2X6I A;  4L2Y A;  1NN7 A;  1TR4 A;  2WXQ A;  2IY0 C;  3MA5 A;  1D9S A;  2R17 C;  1H0A A;  1HO8 A;  2VSX E;  3AG1 E;  2LXL A;  4JVS A;  1Y8M A;  4W9K B;  4FJY A;  5KNG A;  4I1O B;  4GTS A;  4K5B A;  3CHM A;  4R7L A;  4HRL A;  2WXR A;  4FHJ A;  3SO8 A;  2Y1L E;  2GRL A;  3UIO C;  3OHV A;  2J9Q A;  3SGH A;  2VYI A;  3ASF A;  3FFL A;  3HXB A;  3JCK C;  3LEW A;  4U8Y D;  2ILR A;  4W9D B;  1H6O A;  5AQ7 A;  2ETB A;  2XPI A;  2WXJ A;  4JZY A;  1R2B A;  4CEM A;  4HNA D;  3UXG A;  3TXN A;  5JJT A;  1N95 A;  3D9I A;  5FZS A;  1JUQ A;  3AS5 A;  2FBN A;  2FNJ C;  4N5C A;  5A23 A;  3ZHE A;  3LY9 A;  3PDN A;  4O6F A;  2ZGG A;  3PRE A;  4GTR A;  3AG3 E;  2J08 A;  4BER A;  4GTV A;  2OVQ A;  5A15 A;  3APC A;  4E6H A;  3SBS A;  3C3R A;  3CQC B;  2BUG A;  4C48 B;  3QK0 A;  4TV3 A;  3NQP A;  3Q4A B;  3EIQ C;  4PH4 B;  3W9G A;  2C0L A;  4JTD B;  3SFY A;  5AAO A;  2I6H A;  3QOU A;  5CCM A;  3FTY A;  2EIJ E;  3QKY A;  2IFU A;  2Y0B G;  4YY8 A;  4F7A A;  3LCA A;  1UN9 A;  2V4L A;  2X6H A;  3TGO A;  3ZW3 A;  2IZV C;  3L08 A;  5FQ8 A;  4AEZ C;  4UI9 C;  4ANW A;  3JUI A;  3O48 A;  2UWJ G;  3LXU X;  5BXB A;  2XRY A;  3LS8 A;  5JHB A;  2E0I A;  2VTB A;  4I1M A;  1UJK A;  2VTB B;  3JXJ A;  4OVU A;  2EIN E;  2OCC E;  3UUX A;  4B93 B;  1U3C A;  2BKK B;  3PE3 A;  4F53 A;  2ZU6 B;  1HG5 A;  2I1J A;  3MKQ B;  1KT0 A;  3B7S A;  2I9C A;  4JW1 A;  1D8E A;  2MRI A;  5HRY A;  4APF A;  4CGW A;  3MJW A;  4GTT A;  4KBQ A;  4GZC A;  3G2V A;  1U3D A;  4XKC A;  2AJA A;  3SHF A;  4UQY A;  2L6J A;  2KZT A;  3ULQ A;  1NEX A;  4Z68 A;  1IQR A;  3MCX A;  5BW8 C;  3V7D A;  3TL5 A;  4HI8 A;  2VGX A;  2RFM A;  3RKV A;  1N0R A;  1TNY A;  4CXI A;  1RW2 A;  1TNZ A;  5ENS D;  4H7X A;  3HHM A;  2WXN A;  1TJF A;  3FTV A;  1FVH A;  3RJV A;  4TXR A;  2NZ0 B;  2DZN A;  5ANR A;  1KZP A;  3CGH A;  4ZFH A;  3FUH A;  3UM0 A;  4GU5 A;  3LBZ A;  3I4R B;  3QC1 A;  3ZRH A;  3UX4 A;  2LSV A;  2KAT A;  2AXZ A;  3AG2 E;  1NL4 A;  3S7D A;  4AY5 A;  1BD8 A;  5LLI B;  2JEK A;  3V79 K;  4J0U A;  2DYR E;  1DC2 A;  4GA1 A;  2QYJ A;  4GYY A;  2P58 C;  4UWG A;  4B9K B;  4L23 A;  3GZ1 A;  2Q7F A;  3HXF A;  3TWS A;  1E8Z A;  2CHX A;  3FTU A;  4GYW A;  2H6F A;  4ANX A;  3JQ1 A;  2DZO A;  5BPP A;  3GA1 A;  1HV2 A;  4TRQ A;  3TAX A;  1OCZ E;  3NF1 A;  1FQV B;  3QAR A;  4W9G B;  2C2L A;  3ZNG A;  4BTA A;  1KT1 A;  4LRZ A;  4WNE A;  2YY9 A;  2ZIR A;  3FH5 A;  2A5U A;  4APO A;  4GZD A; 
#chains in the Genus database with same CATH homology
 1WM5 A;  3FTS A;  4E85 A;  5BNW A;  3PEV B;  5A6R A;  5ANL A;  3RIB A;  1N54 A;  4Q94 A;  2VPK A;  1P22 B;  4WWO A;  3FUK A;  4TUU A;  4XX5 A;  4YND A;  2GRM A;  4G1T A;  3OXL A;  4J8E A;  3QAQ A;  4U04 A;  4AIF A;  3P2B A;  5KJK A;  4BFR A;  3PEU B;  5H7H A;  3MKQ A;  4G25 A;  4ANV A;  2P1M A;  3FHE A;  4N39 A;  4HXI A;  5DIZ A;  5G04 C;  1HX8 A;  4ILH B;  2PL2 A;  4UQZ A;  3TG4 A;  3LYA A;  4DI4 A;  3B7R L;  1HG2 A;  3MV3 B;  2J4B A;  3D3M A;  5C1D A;  3L2O A;  3FTW A;  2XRZ A;  3FU6 A;  3PNL B;  3MYV A;  1EOD A;  1UJJ A;  2KZT B;  4IRU A;  3U64 A;  4B94 A;  2XCB A;  3PRZ A;  3C6N A;  1QNF A;  1HFA A;  2X6J A;  4B0Z A;  1SQM A;  3EDT B;  1BUO A;  5BV1 A;  2V8S E;  4ME2 A;  2M63 A;  4HS2 A;  1QDV A;  3AU5 A;  3FP3 A;  3OHU A;  4JPS A;  1QQE A;  2KCV A;  3PH0 C;  3S7B A;  4FAD A;  2Y3A A;  4PS8 A;  2P1N A;  3ZYM A;  5CCL A;  1WY6 A;  4I43 A;  4AM9 A;  1QDW A;  1YA0 A;  2NSZ A;  3FUD A;  3SFZ A;  3CVY A;  3ML8 A;  3LKU A;  2E31 B;  1A68 A;  4AV7 A;  4AVX A;  3IBE A;  4KZ0 A;  5ARG A;  3RO2 A;  3ZRF B;  5G04 J;  4HOT A;  5E76 A;  2LAH A;  4CDN A;  2IF4 A;  2IF5 A;  4GB9 A;  2FI7 A;  3KS2 A;  3DBS A;  3BEE A;  5BXH A;  4XI9 A;  4I9C A;  5FZR A;  5BT1 A;  4FA6 A;  4J8Z A;  1Z3X A;  3MX3 A;  2QFC A;  3KEZ A;  2L9B A;  4HOR A;  4U2M A;  4PS7 A;  2QY7 A;  4LUN U;  3U4T A;  3T5V A;  3D9N A;  3RRU A;  3CK9 A;  3SD5 A;  4K0R A;  4CP3 A;  3FTX A;  4W9L B;  1OWL A;  3B7U X;  4BKT B;  4XIF A;  5G05 J;  1FS1 B;  1LM8 C;  3ZGQ A;  5EX3 A;  3Q5M A;  3D9P A;  2OVR A;  2P1P A;  4DLO A;  3CVP A;  1ELW A;  3OTN A;  4GA0 A;  1EPU A;  4PS3 A;  4RG6 A;  2IHC A;  3DRZ A;  3CQG B;  1HE8 A;  4XE0 A;  1ZU2 A;  1N52 A;  4JTC B;  4BKS B;  2IOS A;  4U0S A;  3SI5 A;  3CK7 A;  2YHC A;  5A6C A;  1ELK A;  2J09 A;  2E2E A;  4BT8 A;  1LQB B;  5FTA A;  2FF4 A;  4Y6C A;  4UQX A;  1R28 A;  3VLF A;  3CVX A;  5KCM A;  3C98 A;  1MQS A;  1R29 A;  1ZBP A;  4HOQ A;  4F1S A;  4UYI A;  4W9F B;  3ZXS A;  4C0E A;  3ZTD B;  3FUF A;  1EDU A;  4ACL A;  4I6J C;  1FVF A;  1H2T C;  3FTZ A;  5D0O D;  1H6K A;  5LOZ A;  5E75 A;  3QJZ A;  3L17 A;  4J8D A;  4KZC A;  3TJP A;  4FU3 A;  3SNX A;  5IBK A;  4GZ6 A;  4XKB A;  3ESK A;  2CG3 A;  3ZYK A;  2IOL A;  3C6O A;  3GYZ A;  3OHV A;  5JHA A;  3FEY A;  2PM7 A;  4DLQ A;  5FJY A;  2KCK A;  3APD A;  3ZRC B;  4AOF A;  1IHG A;  3FU5 A;  4WNG A;  2FEZ A;  3PS6 A;  3CKB A;  3QDN A;  3T8M A;  3CLJ A;  3QB2 A;  3MKR A;  5D0Q D;  2LNI A;  4W9C B;  3L13 A;  1HU3 A;  3OXF A;  5EUP A;  3FUE A;  4I2Z A;  1OWP A;  3LNM B;  5BXD A;  4G11 A;  3G2W A;  2WXL A;  1EYH A;  4WQO C;  4NAC A;  2FO7 A;  2WXH A;  2OOE A;  2NXP A;  3FKC A;  3CVN A;  4KMO A;  3RU0 A;  4CRW A;  3QWV A;  1EXB E;  3IKO B;  4FP7 A;  1WAO 1;  4J8F A;  5CMY A;  3M4T A;  2VSN A;  2RG8 A;  3L54 A;  4Q96 A;  2PM6 A;  2CHW A;  2A79 B;  1LF8 A;  5G05 C;  3ZN3 A;  1PC2 A;  2UY1 A;  3GW4 A;  3L16 A;  2YIN A;  2HM8 A;  3SBT B;  3CIA A;  3P1U A;  1CS3 A;  3ASD A;  3Q15 A;  2WXM A;  2AXV A;  3OGK A;  2WXI A;  5BXB A;  4FC8 A;  3B7T A;  3CHQ A;  4N3B A;  5AIJ A;  2WB2 A;  5CMW A;  1MHQ A;  3B13 A;  3FWV A;  2Y4T A;  5LP0 A;  3FU0 A;  2XPZ A;  4A55 A;  1INZ A;  3ZYL A;  4KYO B;  4LEU A;  3UPV A;  3L22 A;  4C9B B;  1SZ9 A;  3VTY A;  3CST A;  3LDZ A;  3E4B A;  3N71 A;  3U66 A;  4CXT A;  1DSX A;  1NZN A;  4U8H A;  2WQ6 A;  4EZJ A;  4L2L A;  2EQX A;  4FJZ A;  3K9I A;  4JHJ A;  4V3I A;  3QWW A;  4FLB A;  2J07 A;  4UI9 K;  4U07 A;  2I2R A;  4A1S A;  4XZ4 A;  2GW1 A;  3PUK A;  1E8Y A;  2KCL A;  2X3M A;  2X6I A;  4L2Y A;  1NN7 A;  5FT9 A;  3L6A A;  4AJY C;  1E7U A;  2WXQ A;  3URZ A;  3FUL A;  3PUJ A;  1VDY A;  1DVP A;  4I1A A;  1W3B A;  3B84 A;  3MA5 A;  3ONL A;  4DK5 A;  2WMO A;  3LVQ E;  4KXK B;  2R17 C;  1H0A A;  3VTX A;  1HO8 A;  2VSX E;  3CVQ A;  1BPO A;  4MKT A;  4YVO A;  2Z8H A;  3UT8 A;  5DAF A;  3Q49 B;  2L0I A;  4JVS A;  3NZU A;  3AS4 A;  2ASS A;  1Y8M A;  4URK A;  2WM9 A;  4FJY A;  4W9K B;  3ENE A;  3RRN B;  4XI0 A;  2E32 B;  3SF4 A;  5HQ8 A;  5T8I A;  3ONK A;  4HLE A;  1E8X A;  2WQ7 A;  4CDM A;  4I1O B;  3LY8 A;  2NC9 A;  3HVE A;  3CHM A;  3CKC A;  4A3V A;  5KJN A;  4JHK A;  3I4G A;  4KVO A;  5JJ7 A;  2OVF A;  2XHE A;  4R7L A;  2YNQ A;  2AW6 A;  4GZ5 A;  2WXG A;  3G2T A;  2WXR A;  4CDR A;  4EZK A;  3AU4 A;  1QZ2 A;  4FHJ A;  4OYS A;  3TXM A;  2MHK A;  3CHP A;  1UG3 A;  2XPY A;  3VLE A;  2GRL A;  2R9R B;  2IJG X;  2WXP A;  1UW4 B;  2HYZ A;  2J9Q A;  2Y4U A;  4WWP A;  2VYI A;  3SGH A;  2YQ8 A;  4G23 A;  3D9L A;  4BTB A;  3ASF A;  3FFL A;  4F3V A;  2VGX B;  4Y6W A;  5FTP A;  1JWG A;  3D9M A;  5ENN A;  1A17 A;  1XNF A;  3Q47 B;  4AY6 A;  2WMN A;  3MEK A;  3T5X A;  3JCK C;  3IV0 A;  3FDH A;  2C9W C;  3CHS A;  3LEW A;  4GMJ A;  4RG9 A;  3GZS A;  4BX9 A;  4ILG A;  4G26 A;  5G55 A;  2ILR A;  3DRY A;  3EHN A;  3DPD A;  4W9D B;  2ION A;  1H2V C;  3ASH A;  3KD7 A;  2XPI A;  2WXJ A;  4JZY A;  1R2B A;  1IQU A;  2YHE A;  3UQ3 A;  4ZOU A;  4LCT A;  4IN3 B;  4CEM A;  2OVP A;  4W9R A;  3LPZ A;  3UMV A;  4EOZ A;  3E4U A;  1PY1 A;  5CHE E;  2CFZ A;  5ARF A;  4RSY A;  3TXN A;  2R5S A;  3UT7 A;  5JJT A;  3D9I A;  4N2S A;  4UI9 J;  5FZS A;  3D9O A;  3ZHE B;  1JUQ A;  3AS5 A;  2FBN A;  4J8S A;  2GGF A;  4ANU A;  2R59 A;  3JQ0 A;  1P5Q A;  1VCB B;  2FNJ C;  4N5C A;  3TG5 A;  1T1D A;  1KLX A;  4BY6 A;  5A23 A;  3EIJ A;  2LO6 A;  3LY9 A;  3ZHE A;  3PDN A;  3CHR A;  5AJD A;  4UWL A;  5AJL A;  5J90 A;  4O6F A;  3QWP A;  4CRH A;  4HFG A;  1JWF A;  3S2A A;  2I2O A;  3HQI A;  3PRE A;  3ZTC B;  2AST A;  4WWN A;  2J08 A;  4Q69 A;  2P1Q A;  3ZNG B;  3O4Z A;  2OVQ A;  3NZS A;  4NRH B;  5A15 A;  3LVR E;  4ATG A;  3APC A;  4E6H A;  3SBS A;  2PQR A;  3IEG A;  3CQC B;  4DPR A;  3ZFW A;  4MRU A;  4N2Q A;  2MA9 C;  2BUG A;  1Y6I A;  4B8C B;  3BG1 B;  3FU3 A;  2VJ8 A;  3QK0 A;  4TV3 A;  4WUY A;  5T4Y A;  4GYO A;  4WNF A;  3MKS A;  3CVU A;  3NQP A;  3Q4A B;  2WXK A;  3AS8 A;  3EIQ C;  3I5P A;  4PH4 B;  4P29 A;  5BUZ A;  3BIM A;  5T3R A;  4G2V A;  4CT0 A;  2C0L A;  4D10 C;  4JTD B;  4B89 A;  3CHO A;  2I6H A;  2J49 A;  2OND A;  3QOU A;  1EOF A;  1ELR A;  4GA2 A;  4KVM A;  5CCM A;  4U0Z A;  4UWK A;  3FTY A;  5A7D B;  2NN2 A;  3M8V A;  3QKY A;  3M5B A;  2IFU A;  4JEU A;  1B89 A;  3HVE B;  4YY8 A;  4F7A A;  4DJA A;  5H7G A;  1NA3 A;  3VLD A;  4ZGC A;  1DNP A;  1E96 B;  3LCA A;  1UN9 A;  2IU1 A;  4HOS A;  2CFU A;  2V4L A;  2X6H A;  3M52 A;  3RO3 A;  3TGO A;  1HH8 A;  3ZW3 A;  4U77 A;  2OVB A;  4GCO A;  2IZV C;  2RD0 A;  3HU6 A;  3L08 A;  3PVL A;  4J6I A;  2BTD A;  2V5F A;  2X38 A;  2XQ0 A;  3CV0 A;  4JA7 A;  3ZYQ A;  5FQ8 A;  4U2N A;  3LY7 A;  2P1O A;  5FQ4 A;  4AEZ C;  4UI9 C;  3JUI A;  3O48 A;  2UWJ G;  3ESL A;  3LXU X;  4M3O A;  4ANW A;  2XRY A;  1LDK D;  3LS8 A;  2XCC A;  4JXT A;  4OVV A;  5JHB A;  2E0I A;  2VTB A;  1S0P A;  1TJC A;  2KM4 A;  5FQ6 A;  3U3W A;  4I9E A;  4I1M A;  4U63 A;  5C2Y A;  1UJK A;  2V0P A;  4PUC A;  4WND A;  2VTB B;  4I6J A;  2LAI A;  4OVU A;  4B9K E;  4AWJ B;  4B8A A;  2VKP A;  2PPI A;  3UUX A;  1FS2 B;  1E90 A;  2VSY A;  2JZ3 C;  4GML A;  1U3C A;  3PE3 A;  4UWF A;  2ZU6 B;  1HG5 A;  3EJN A;  4F53 A;  2I1J A;  3FUJ A;  3MKQ B;  3MV2 B;  1KT0 A;  4A3T A;  4U0U A;  2KC7 A;  2DCP A;  5FQ7 A;  1GW6 A;  1H2U A;  4L1B A;  5AEN A;  4I6E A;  2A4Z A;  2I9C A;  2AXU A;  3B7S A;  4JW1 A;  5AYW D;  5LX8 A;  2MRI A;  3HTM A;  4FLH A;  4APF A;  4N3A A;  2AWI A;  3R7Q A;  4IYP A;  4CGW A;  3MJW A;  5FWQ A;  1E8W A;  2L0T B;  4CXJ A;  4ILI A;  3OXG A;  3DRX A;  4FUL A;  1OUV A;  1EF1 C;  3BG0 B;  4KBQ A;  5HI7 A;  4GZC A;  4EEC A;  2PQN A;  2XEV A;  3G2V A;  3PZD A;  5J08 A;  4W9H H;  4NUR A;  4I6G A;  3OGL A;  1U3D A;  2VQ2 A;  4L7T A;  4XKC A;  3LJ3 A;  4ABN A;  4BX8 A;  1HF8 A;  3CVW A;  3CVV A;  5BO4 C;  4C0M A;  5DAD A;  3OAW A;  3SHF A;  3FY4 A;  2L6J A;  4H7Y A;  2KZT A;  4FHK A;  4UQY A;  3ULQ A;  1IQR A;  3MCX A;  5BW8 C;  3ZEF A;  1NEX A;  3TL5 A;  3V7D A;  3WSO B;  2MOW A;  3IHV A;  2CG2 A;  4I17 A;  5DBK A;  2LSU A;  2VGX A;  4N9F 5;  4W9I B;  3ZIM A;  4YVQ C;  3U9W A;  4HOU A;  3R9A B;  2CHZ A;  3RKV A;  4MLP A;  3LUT B;  2VGY A;  3FUI A;  2WPV A;  1IYG A;  3G2U A;  2Q81 A;  2WQH A;  4CXI A;  5EKQ D;  5EDS A;  2XGM A;  3FH7 A;  3UT4 A;  4GPK A;  4GCN A;  2J4D A;  1HXI A;  4LER A;  4A1G A;  4W9J B;  4EBA G;  4EZL A;  3FH8 A;  3HHM A;  4H7X A;  3D9K A;  4JEH A;  2WXN A;  1TJF A;  5KJL A;  3FTV A;  1FVH A;  4NQ0 A;  5LCW C;  5JJ6 A;  3SZ7 A;  4CGV A;  1L5J A;  3QNK A;  3RJV A;  4JA9 A;  2I1K A;  3WXX A;  4EBA A;  4PDX A;  4JC8 A;  3PNT B;  5HYW B;  2NZ0 B;  5ANR A;  1EOE A;  2BF0 X;  4AXH A;  4EQF A;  1OWN A;  3CGH A;  3CEQ A;  1JPL A;  4EPZ A;  1HS6 A;  2DIW A;  4CCA A;  1TEZ A;  3FUH A;  4AJW A;  3ASG A;  5JH5 B;  4GU5 A;  2WXO A;  3PE4 A;  4QFV A;  2VSO E;  3LBZ A;  3I4R B;  2HR2 A;  3QC1 A;  3ZRH A;  3UX4 A;  5HZG C;  5G2N A;  3S7F A;  2PZI A;  2LSV A;  2KAT A;  3RK6 A;  2AXZ A;  3ZVV A;  4DI3 A;  3OGM A;  3FEX A;  4G24 A;  2JLB A;  3R7R A;  1UN8 A;  3KAE A;  3S7D A;  4AY5 A;  1SZA A;  3MGB A;  5LLI B;  2JEK A;  4JL0 A;  1HZ4 A;  1NA0 A;  5KJM A;  4JTA B;  4J0U A;  2IQC A;  3CR3 A;  2C0M A;  3G2S A;  3JYS A;  2X6K A;  3I3N A;  3HIZ A;  1Z6T A;  3MZL B;  4GA1 A;  2AVP A;  4GYY A;  4N3C A;  2P58 C;  2XGS A;  5LCW J;  2DBA A;  4MS6 A;  4UWG A;  4B9K B;  2UY1 B;  4B95 B;  5BV0 A;  5M72 A;  4JGH C;  3KVT A;  4W9H B;  1NP7 A;  4HVB A;  4L23 A;  4CT4 A;  2HO1 A;  3CSF A;  3GZ1 A;  3ZPJ A;  2Q7F A;  3D9J A;  3ZKJ B;  3RRM B;  4KT6 B;  5EX0 A;  3IHY A;  1E8Z A;  2CHX A;  2OV8 A;  2FUL A;  5LFA A;  1OWM A;  3FTU A;  4GYW A;  3DCG B;  4BT9 A;  4ACK A;  4JHR A;  4ANX A;  3ML9 A;  3JQ1 A;  4I2W A;  4IUL A;  1FCH A;  3ZUN B;  3HDX A;  3GZ2 A;  5BPP A;  3GA1 A;  4GAA A;  1HV2 A;  3CK8 A;  4TRQ A;  3TAX A;  2WVI A;  2X6F A;  3NF1 A;  4BWR A;  3QAR A;  1FQV B;  4W9G B;  3C6P A;  2C2L A;  1S1G A;  3HYM B;  4UWH A;  1E7V A;  1KT1 A;  3FUM A;  4WAF A;  4AP2 A;  4BTA A;  1Z3Y A;  4LRZ A;  4BSX A;  1PAQ A;  4K03 A;  1OWO A;  2XGO A;  4GZ3 A;  1X5B A;  4RVB A;  1H19 A;  2WXF A;  4W9E B;  1XGW A;  4WNE A;  5FZQ A;  2YY9 A;  3EHM A;  3CVL A;  3S7J A;  3FH5 A;  4BGC A;  2A5U A;  3FUN A;  4APO A;  4UIJ A;  3APF A;  4GZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...