4J8ZA

Crystal structure of the human spop btb domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
MVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAERSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Speckle-type POZ protein
publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.700 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4j8zA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 4j8zA01
5EUPA 3WSOB 3M8VA 5HZGC 1LQBB 4W9JB 1QDWA 4EOZA 5HYWB 3C6PA 3FKCA 4UYIA 3BIMA 1FS1B 1BUOA 4BKSB 3M4TA 2PPIA 2ASSA 4W9FB 5A15A 1FS2B 4CXJA 3ZRFB 4CXIA 1T1DA 2JZ3C 1LM8C 3C6OA 4U2MA 5LLIB 1A68A 2E32B 4CXTA 3OHVA 4W9IB 1HV2A 1NEXA 2OVQA 3L2OA 4W9CB 3B84A 5BXHA 1FQVB 4B9KE 2FNJC 2Q81A 4AWJB 4W9LB 3I3NA 2OVPA 4JGHC 1EOFA 2P1MA 2P1OA 5H7GA 2OVRA 2Z8HA 2VPKA 1LDKD 3LBZA 2R9RB 4UIJA 5BO4C 4W9GB 5IBKA 4U2NA 2C9WC 4JTCB 3HU6A 4JTDB 5DAFA 1S1GA 1EXBE 2IF5A 3E4UA 5A6RA 5H7HA 3OGKA 4CRHA 4HXIA 4AJYC 1R29A 4APFA 5JH5B 3OGLA 3HVEB 4CP3A 1CS3A 3GA1A 3OGMA 2IZVC 2YY9A 1R2BA 2ASTA 2P1PA 1P22B 1R28A 2A79B 1VCBB 4BKTB 1QDVA 4BGCA 3ZKJB 3KVTA 4W9HB 3ZTCB 4N9F5 3V7DA 5DADA 3LNMB 1DSXA 1NN7A 3ZNGB 2MA9C 4B95B 4W9HH 3DCGB 4W9DB 4W9KB 3ZRCB 2E31B 3ZUNB 3DRZA 2VKPA 5BXBA 4J8ZA 3HTMA 4ZOUA 3LUTB 3C6NA 2IHCA 1EODA 3OHUA 2NZ0B 3HVEA 3MKSA 3M52A 5FTAA 4JTAB 1EOEA 4I6JC 2I2RA 5BXDA 4B9KB 4WQOC 2P1NA 4W9EB 3HQIA 2NN2A 3M5BA 4U77A 2P1QA 3ZTDB 4AP2A
chains in the Genus database with same CATH superfamily
1YZ9A 4WPYA 1KYQA 2UUCE 4WX9A 3HTXA 2FGGA 3M8VA 1XNRE 2YTOA 2Q8UA 2R1FA 1LQBB 3ADLA 4EOZA 5ADZA 3C6PA 2GPIA 1X49A 4B3RE 3BIMA 1FS1B 3THNA 4BKSB 2ASSA 2CTDA 3VHTB 2LE2A 4JI3E 1IMUA 1A1KA 3ZRFB 1T1DA 3ADJA 3K6QA 2KOUA 2HJJA 4R03A 3C6MA 1LM8C 4U2MA 4WYQB 1A68A 2EM5A 3JU0A 2OVQA 4GKJE 5BXHA 1TF6A 2MC6A 1N32E 2EM0A 3I3NA 1EOFA 1JK2A 2ELYA 2EP3A 2JPAA 1UN6B 2VPKA 2KHXA 2EQ0A 2E72A 4BHBA 5KL6A 3HPSA 3HU6A 2YRHA 2EN6A 1RMDA 2YTQA 2RTXA 3J7AG 1QNTA 1DI2A 2JOXA 2L2NA 1WRJA 2I13A 2B3TB 2IF5A 3IWCA 2ENHA 2JYAA 3E4UA 5A6RA 4RHBB 2L33A 4KHPE 3BGHA 4X64E 4N4RB 4JI6E 3L00A 2EM9A 4AJYC 2NUEA 1ZBQA 2YTGA 2LO3A 3BBGA 4OX9E 2JP9A 1EH8A 4JI8E 3HVEB 4CP3A 3IWBA 2E1MA 4ZYHA 2EPUA 2YY9A 2VQFE 4GEQB 2M1SA 1P22B 3THOB 1R28A 5IWAE 1ZAAC 4BKTB 5LL6R 5AE2A 1T4LB 3ZKJB 3AUZA 2YTJA 4X8WA 2M4IA 1G2DC 2EOOA 4N9F5 2FV4B 4O24A 1DSXA 3ZNGB 2EQ1A 4DUZE 2EMIA 1MEYC 4DR3E 2JY9A 4IJDA 2YZTA 2LBSB 2B9DA 3KWRA 4LFCE 3DRZA 5IXMB 2EMAA 2LCEA 1STUA 4MLVA 2CPNA 3LUTB 2MC5A 2CT1A 1GTKA 2NZ0B 1XMQE 3M52A 5FTAA 4I6JC 2BB8A 4O43A 1L4SA 5BXDA 2N3GA 2DRPA 4LFAE 1NCSA 2EN2A 2NA2A 4DR4E 4P7DA 2V86A 2YTPA 5HZGC 2DMIA 3HXLA 4TUIA 1ZBTA 3F6HA 4W9JB 1QDWA 1ZU1A 4LF6E 2EOQA 4JI7E 1O0WA 2LMZA 2V8QB 2ELZA 2L2MA 2YU8A 4AQYE 4W9FB 2MKNA 4YY8A 1FS2B 2EMKA 4DV5E 4R2DA 5KL2A 4DV2E 2I9IA 3C6KA 3C6OA 1HNZE 2EOSA 5LLIB 2E32B 1EH7A 3ADIA 3OHVA 2EPLX 4KWYA 2RSIA 1HV2A 1X3CA 2MKDA 2JXPA 2B7VA 4WSPA 2LRSA 3M99B 3L2OA 4W9CB 2YTFA 4M0VA 1PKPA 2L92A 3C4TA 2FNJC 4W9LB 2K4VA 4R2SA 2P1MA 1N36E 2HC5A 2EM7A 4F54A 1SFEA 2EOEA 3FIGA 2NABA 4Q35B 4W9GB 1N34E 4HTGA 2RQLA 2V88A 2L3CA 4R2RA 5A6BA 5DAFA 2GLIA 2KONA 4B3ME 4BC7A 5BR8E 1X6HA 2VE7C 4KZSA 2EOJA 4WSGA 2EZ6A 1EXBE 2DSYA 2LVHA 2E5LE 2A25A 2RS6A 4M30A 4F6MA 1TF3A 4YY3E 4JI0E 4HXIA 4CRHA 5AC4A 2K7IA 2LUPB 4O4KA 4F9CB 2V89A 5LMUE 5LMNE 4DV7E 4R2QA 1CS3A 2EMWA 2LTSA 3GA1A 2EL6A 2LUQA 1WHQA 2GHFA 1IBME 1R2BA 3JAMC 2P1PA 1X6EA 2DLQA 4DUYE 1A1IA 2HGHA 2D9HA 2F8BA 2EQ3A 5AE3A 4HEIA 3KVTA 1DQ3A 4W9HB 3ZTCB 3BF2A 2H36X 4R2AA 4JYAE 1KJKA 2RPCA 5DADA 4ZGCA 4K0KE 3ECRA 1A1FA 2L8TA 2EM2A 2EM3A 4M9VC 4W9DB 4W9KB 4B95B 4F2JC 5A6JA 2LV2A 3RMPA 4X9JA 2VKPA 1SR9A 4J8ZA 1DGCA 4LF9E 2DGCA 1X6FA 1G2FC 1TN9A 3F6GA 1YFHA 2IHCA 1AH5A 1WHNA 4L5NC 1EODA 2EM6A 3C6NA 2V87A 1IQOA 3ADGA 3HVEA 2UXCE 3MKSA 1X48A 1X5WA 2EPAA 1EOEA 1PDAA 2L3JA 2I2RA 3VYXA 2EL5A 1YPNA 2EOMA 3DF6A 5F3WA 1YUIA 4LF5E 4W9EB 3HQIA 2YT4A 4LF7E 2UXBE 1EH6A 3J80C 2NN2A 4U77A 4OOGC 4M2ZA 3ZTDB 4AP2A 3LMLA 5EUPA 1RQ0A 1P47A 2EOYA 1A1JA 2LTRA 1PJTA 2EN8A 2LJHA 4NZVA 4LU9A 4JI4E 1A1HA 5HYWB 1FJGE 2ODRC 2L2KB 4BHCA 5TSEA 5LLQA 3KZZA 3J7Yp 2DIXA 4O5GA 4DV1E 2R76A 1RC7A 4JI2E 2PPIA 4F9BB 4CXJA 1I94E 4CXIA 3HQ1A 2VQEE 2EMZA 2M9AA 2YTDA 2JZ3C 3VYYA 2J7JA 4R8OA 2V85A 2EOIA 5KL4A 4CXTA 2UUBE 1N3GA 2PRTA 2B7TA 3B84A 1IBKE 2RSMA 2YTIA 2WBUA 1YYOA 1N33E 1A1GA 1UILA 2YTNA 1WXRA 4JGHC 2OVPA 5T6JA 4AWJB 4ZYEA 2P1OA 5H7GA 2OVRA 1HR0E 2Z8HA 4WXDA 3LBZA 2EJ4A 2R9RB 5BO4C 2JWOA 5IBKA 1WJPA 4U2NA 4JTCB 4MLQA 4ZYDA 1YUJA 4DR6E 4JTDB 2DMYA 2EOXA 4X66E 4GKKE 4WXCA 4NXME 2UUAE 4FK5C 2WZOA 1T4OA 3H09A 2N3HA 5IT9C 2EE8A 3JTZA 2MDRA 2EORA 1R29A 1T38A 4APFA 5JH5B 2YRMA 2YU5A 2IZVC 1HNWE 4NHRA 2ASTA 5KL7A 2EL4A 4WFTA 1VCBB 3TQMA 1PJSA 4BGCA 4JI1E 2LT7A 2VRDA 1AAYA 4LTYA 3C4BA 2M7QA 2EMGA 3V7DA 2YPNA 1NN7A 2CSHA 2EM8A 1F2IG 2EPMX 2EWLA 5FLXC 2WCC3 2MA9C 4X65E 4W9HH 4B3SE 2EMFA 5DNYA 1YYKA 3ZRCB 2V83A 2EMYA 3ZUNB 1LLMC 4BMJA 4ZOUA 1J5EE 2N8XA 3EPLA 4F6NA 3OHUA 1GQEA 4YHHE 1EKZA 2EM4A 2HHHE 1IBLE 2VF1A 3DRYA 5IV8B 1XNQE 2EPCA 4JV5E 1GZ6A 2EMHA 3M5BA 3OTOE 1YSAC 2EN4A 1BB8A 2EPNA 2UXDE 2ODRD 2EMXA 4R2CA 3WSOB 4BCAA 1MGTA 2JVAA 3QG5C 3ZOQB 3FKCA 2EPKX 4F9AB 5A6AA 4UYIA 4BBYA 5AE1A 2EPRA 4GZNC 4BS9A 1BUOA 3M4TA 4LF8E 4DMIA 3EPKA 1PJQA 5A15A 2DB2A 1J26A 4DR2E 4B3TE 4ZYGA 4NXNE 4DKKA 5KL3A 5KL5A 1T39A 3HPZA 4P78A 4IS1C 3KZYA 4W9IB 1NEXA 2YSOA 4Q28A 4DV0E 1FQVB 4B9KE 3EPHA 1XMOE 2EN7A 2F4VE 2Q81A 1FKAE 2JR1A 2MDGA 2YTEA 3P1XA 2EMBA 1LDKD 3T1HE 4UIJA 2C9WC 2L6MA 2RS7A 4DR1E 2UU9E 3T1YE 1ZR9A 5A6KA 4X62E 4DV6E 1BBOA 1X47A 2YRKA 1S1GA 2ADRA 4LFBE 2JOBA 1IQSA 2EN1A 2ENAA 2ENCA 2WBTA 3LLHA 5A2QC 2ZM6E 4DV3E 2NUGA 3OGKA 5H7HA 3DRXA 1A1LA 2EPPA 2WBSA 2EOHA 3MSWA 4JI5E 2EOFA 1NEIA 2EOZA 5AC5A 2G7HA 2DLKA 2BBGA 3OMLA 4RH8A 2LJUA 3OGLA 4DR7E 2EPXA 3OGMA 1B69A 2NUFA 3IWDA 2A79B 3J81C 1YYWA 4BC9A 2EMCA 3BIDA 1QDVA 5A6BD 3LNMB 1UHZA 3MHHC 2YWQA 3DCGB 2EN3A 3MHSC 1T4NA 2E31B 2EMLA 4TUGA 5BXBA 5AASA 1HNXE 3HTMA 3AV0A 2IHR1 1QU6A 4R2EA 4LF4E 1JK1A 1Z1BA 4I8OA 4L8NA 3EQ1A 1UBDC 4DV4E 3EPJA 2EPOA 5A69A 2YSPA 5CFFE 4JTAB 4DR5E 3DJWA 4R2PA 3UK3C 4B9KB 4WQOC 2P1NA 3VK6A 1BBGA 2FTXB 2P1QA 2EPZA
chains in the Genus database with same CATH topology
1YZ9A 4WPYA 2UUCE 3HTXA 3M8VA 2FGGA 1XNRE 1LQBB 3ADLA 4EOZA 5ADZA 3C6PA 1X49A 4B3RE 3BIMA 1FS1B 4BKSB 2ASSA 4JI3E 2LE2A 3ZRFB 1T1DA 3ADJA 3K6QA 2KOUA 4R03A 1LM8C 4U2MA 4WYQB 1A68A 3JU0A 2OVQA 4GKJE 5BXHA 2MC6A 1N32E 3I3NA 1EOFA 2VPKA 2KHXA 3HPSA 3HU6A 2RTXA 3J7AG 1DI2A 2JOXA 2L2NA 2B3TB 2IF5A 3IWCA 3E4UA 5A6RA 2L33A 4KHPE 4X64E 4JI6E 4AJYC 2NUEA 1ZBQA 4OX9E 4JI8E 3HVEB 4CP3A 3IWBA 2E1MA 2YY9A 2VQFE 4GEQB 2M1SA 1P22B 1R28A 5IWAE 4BKTB 5LL6R 5AE2A 1T4LB 3ZKJB 3AUZA 4X8WA 2M4IA 4N9F5 2FV4B 1DSXA 3ZNGB 4DUZE 4DR3E 2JY9A 2LBSB 2YZTA 2B9DA 3KWRA 4LFCE 3DRZA 3LUTB 1STUA 2CPNA 2MC5A 2NZ0B 1XMQE 3M52A 5FTAA 4I6JC 5BXDA 2N3GA 4LFAE 2NA2A 4DR4E 4P7DA 2V86A 5HZGC 3HXLA 4TUIA 1ZBTA 3F6HA 4W9JB 1QDWA 4LF6E 4JI7E 1O0WA 2LMZA 2V8QB 2L2MA 4AQYE 4W9FB 4YY8A 1FS2B 4DV5E 4DV2E 3C6OA 1HNZE 5LLIB 2E32B 3ADIA 3OHVA 1HV2A 2B7VA 4WSPA 2LRSA 3L2OA 4W9CB 4M0VA 1PKPA 2L92A 3C4TA 2FNJC 4W9LB 2K4VA 2P1MA 1N36E 4F54A 3FIGA 4W9GB 1N34E 2V88A 2L3CA 5DAFA 2KONA 4B3ME 4BC7A 5BR8E 4KZSA 2VE7C 2EZ6A 1EXBE 2DSYA 2E5LE 2RS6A 4M30A 4CRHA 4JI0E 4YY3E 4HXIA 2LUPB 4F9CB 2V89A 5LMUE 5LMNE 4DV7E 1CS3A 3GA1A 2LTSA 2LUQA 1WHQA 1IBME 1R2BA 3JAMC 2P1PA 4DUYE 2F8BA 5AE3A 3KVTA 1DQ3A 4W9HB 3ZTCB 2H36X 5DADA 4ZGCA 4K0KE 4B95B 2L8TA 4W9DB 4W9KB 3RMPA 2VKPA 1SR9A 4J8ZA 4LF9E 3F6GA 2IHCA 3C6NA 4L5NC 1WHNA 1EODA 2V87A 3HVEA 3ADGA 2UXCE 3MKSA 1X48A 1EOEA 2L3JA 2I2RA 3VYXA 3DF6A 5F3WA 4LF5E 4W9EB 3HQIA 2YT4A 4LF7E 2UXBE 2NN2A 3J80C 4U77A 4OOGC 4M2ZA 3ZTDB 4AP2A 3LMLA 5EUPA 1RQ0A 2LTRA 2LJHA 4LU9A 4JI4E 5HYWB 1FJGE 2ODRC 2L2KB 3J7Yp 1RC7A 2DIXA 4JI2E 4DV1E 2PPIA 4F9BB 4CXJA 1I94E 4CXIA 3HQ1A 2VQEE 2JZ3C 3VYYA 4R8OA 2V85A 4CXTA 2UUBE 2B7TA 3B84A 1IBKE 2RSMA 1YYOA 1N33E 1UILA 4AWJB 1WXRA 4JGHC 2OVPA 5T6JA 2P1OA 5H7GA 2OVRA 1HR0E 2Z8HA 3LBZA 2R9RB 5BO4C 2JWOA 5IBKA 4U2NA 4JTCB 4DR6E 4JTDB 2DMYA 4X66E 4GKKE 4NXME 2UUAE 2WZOA 1T4OA 3H09A 2N3HA 5IT9C 3JTZA 2MDRA 1R29A 4APFA 5JH5B 2IZVC 1HNWE 2ASTA 4WFTA 1VCBB 4BGCA 4JI1E 4LTYA 3C4BA 2M7QA 3V7DA 1NN7A 2EWLA 5FLXC 2MA9C 4X65E 4W9HH 4B3SE 5DNYA 1YYKA 3ZRCB 2V83A 3ZUNB 4BMJA 4ZOUA 1J5EE 3OHUA 1GQEA 4YHHE 1EKZA 2HHHE 1IBLE 2VF1A 3DRYA 1XNQE 4JV5E 1GZ6A 3M5BA 3OTOE 2UXDE 2ODRD 3WSOB 4BCAA 2JVAA 3ZOQB 3FKCA 4UYIA 4F9AB 4BBYA 5AE1A 4BS9A 1BUOA 3M4TA 4LF8E 4DMIA 5A15A 2DB2A 1J26A 4DR2E 4B3TE 4NXNE 4DKKA 3HPZA 4P78A 4W9IB 1NEXA 4Q28A 4DV0E 1FQVB 4B9KE 1XMOE 2F4VE 2Q81A 1FKAE 2JR1A 3P1XA 1LDKD 3T1HE 4UIJA 2C9WC 2L6MA 2RS7A 4DR1E 2UU9E 3T1YE 4X62E 4DV6E 1X47A 1S1GA 4LFBE 2JOBA 2NUGA 4DV3E 3LLHA 2ZM6E 5A2QC 5H7HA 3OGKA 3DRXA 4JI5E 3MSWA 2G7HA 3OMLA 3OGLA 4DR7E 3OGMA 2NUFA 3IWDA 2A79B 3J81C 1YYWA 4BC9A 1QDVA 3LNMB 1UHZA 3DCGB 1T4NA 2E31B 4TUGA 5BXBA 5AASA 1HNXE 3HTMA 3AV0A 2IHR1 1QU6A 4LF4E 4I8OA 4L8NA 4DV4E 5CFFE 4JTAB 4DR5E 3DJWA 4B9KB 4WQOC 2P1NA 3VK6A 2FTXB 2P1QA 4JYAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EUP A;  3WSO B;  3M8V A;  5HZG C;  1LQB B;  4W9J B;  1QDW A;  4EOZ A;  5HYW B;  3C6P A;  3FKC A;  4UYI A;  3BIM A;  1FS1 B;  1BUO A;  4BKS B;  3M4T A;  2PPI A;  2ASS A;  4W9F B;  5A15 A;  1FS2 B;  4CXJ A;  3ZRF B;  4CXI A;  1T1D A;  2JZ3 C;  1LM8 C;  3C6O A;  4U2M A;  5LLI B;  1A68 A;  2E32 B;  4CXT A;  3OHV A;  4W9I B;  1HV2 A;  1NEX A;  2OVQ A;  3L2O A;  4W9C B;  3B84 A;  5BXH A;  1FQV B;  4B9K E;  2FNJ C;  2Q81 A;  4AWJ B;  4W9L B;  3I3N A;  2OVP A;  4JGH C;  1EOF A;  2P1M A;  2P1O A;  5H7G A;  2OVR A;  2Z8H A;  2VPK A;  1LDK D;  3LBZ A;  2R9R B;  4UIJ A;  5BO4 C;  4W9G B;  5IBK A;  4U2N A;  2C9W C;  4JTC B;  3HU6 A;  4JTD B;  5DAF A;  1S1G A;  1EXB E;  2IF5 A;  3E4U A;  5A6R A;  5H7H A;  3OGK A;  4CRH A;  4HXI A;  4AJY C;  1R29 A;  4APF A;  5JH5 B;  3OGL A;  3HVE B;  4CP3 A;  1CS3 A;  3GA1 A;  3OGM A;  2IZV C;  2YY9 A;  1R2B A;  2AST A;  2P1P A;  1P22 B;  1R28 A;  2A79 B;  1VCB B;  4BKT B;  1QDV A;  4BGC A;  3ZKJ B;  3KVT A;  4W9H B;  3ZTC B;  4N9F 5;  3V7D A;  5DAD A;  3LNM B;  1DSX A;  1NN7 A;  3ZNG B;  2MA9 C;  4B95 B;  4W9H H;  3DCG B;  4W9D B;  4W9K B;  3ZRC B;  2E31 B;  3ZUN B;  3DRZ A;  2VKP A;  5BXB A;  4J8Z A;  3HTM A;  4ZOU A;  3LUT B;  3C6N A;  2IHC A;  1EOD A;  3OHU A;  2NZ0 B;  3HVE A;  3MKS A;  3M52 A;  5FTA A;  4JTA B;  1EOE A;  4I6J C;  2I2R A;  5BXD A;  4B9K B;  4WQO C;  2P1N A;  4W9E B;  3HQI A;  2NN2 A;  3M5B A;  4U77 A;  2P1Q A;  3ZTD B;  4AP2 A; 
#chains in the Genus database with same CATH topology
 1YZ9 A;  4WPY A;  1KYQ A;  2UUC E;  4WX9 A;  3HTX A;  2FGG A;  3M8V A;  1XNR E;  2YTO A;  2Q8U A;  2R1F A;  1LQB B;  3ADL A;  4EOZ A;  5ADZ A;  3C6P A;  2GPI A;  1X49 A;  4B3R E;  3BIM A;  1FS1 B;  3THN A;  4BKS B;  2ASS A;  2CTD A;  3VHT B;  2LE2 A;  4JI3 E;  1IMU A;  1A1K A;  3ZRF B;  1T1D A;  3ADJ A;  3K6Q A;  2KOU A;  2HJJ A;  4R03 A;  3C6M A;  1LM8 C;  4U2M A;  4WYQ B;  1A68 A;  2EM5 A;  3JU0 A;  2OVQ A;  4GKJ E;  5BXH A;  1TF6 A;  2MC6 A;  1N32 E;  2EM0 A;  3I3N A;  1EOF A;  1JK2 A;  2ELY A;  2EP3 A;  2JPA A;  1UN6 B;  2VPK A;  2KHX A;  2EQ0 A;  2E72 A;  4BHB A;  5KL6 A;  3HPS A;  3HU6 A;  2YRH A;  2EN6 A;  1RMD A;  2YTQ A;  2RTX A;  3J7A G;  1QNT A;  1DI2 A;  2JOX A;  2L2N A;  1WRJ A;  2I13 A;  2B3T B;  2IF5 A;  3IWC A;  2ENH A;  2JYA A;  3E4U A;  5A6R A;  4RHB B;  2L33 A;  4KHP E;  3BGH A;  4X64 E;  4N4R B;  4JI6 E;  3L00 A;  2EM9 A;  4AJY C;  2NUE A;  1ZBQ A;  2YTG A;  2LO3 A;  3BBG A;  4OX9 E;  2JP9 A;  1EH8 A;  4JI8 E;  3HVE B;  4CP3 A;  3IWB A;  2E1M A;  4ZYH A;  2EPU A;  2YY9 A;  2VQF E;  4GEQ B;  2M1S A;  1P22 B;  3THO B;  1R28 A;  5IWA E;  1ZAA C;  4BKT B;  5LL6 R;  5AE2 A;  1T4L B;  3ZKJ B;  3AUZ A;  2YTJ A;  4X8W A;  2M4I A;  1G2D C;  2EOO A;  4N9F 5;  2FV4 B;  4O24 A;  1DSX A;  3ZNG B;  2EQ1 A;  4DUZ E;  2EMI A;  1MEY C;  4DR3 E;  2JY9 A;  4IJD A;  2YZT A;  2LBS B;  2B9D A;  3KWR A;  4LFC E;  3DRZ A;  5IXM B;  2EMA A;  2LCE A;  1STU A;  4MLV A;  2CPN A;  3LUT B;  2MC5 A;  2CT1 A;  1GTK A;  2NZ0 B;  1XMQ E;  3M52 A;  5FTA A;  4I6J C;  2BB8 A;  4O43 A;  1L4S A;  5BXD A;  2N3G A;  2DRP A;  4LFA E;  1NCS A;  2EN2 A;  2NA2 A;  4DR4 E;  4P7D A;  2V86 A;  2YTP A;  5HZG C;  2DMI A;  3HXL A;  4TUI A;  1ZBT A;  3F6H A;  4W9J B;  1QDW A;  1ZU1 A;  4LF6 E;  2EOQ A;  4JI7 E;  1O0W A;  2LMZ A;  2V8Q B;  2ELZ A;  2L2M A;  2YU8 A;  4AQY E;  4W9F B;  2MKN A;  4YY8 A;  1FS2 B;  2EMK A;  4DV5 E;  4R2D A;  5KL2 A;  4DV2 E;  2I9I A;  3C6K A;  3C6O A;  1HNZ E;  2EOS A;  5LLI B;  2E32 B;  1EH7 A;  3ADI A;  3OHV A;  2EPL X;  4KWY A;  2RSI A;  1HV2 A;  1X3C A;  2MKD A;  2JXP A;  2B7V A;  4WSP A;  2LRS A;  3M99 B;  3L2O A;  4W9C B;  2YTF A;  4M0V A;  1PKP A;  2L92 A;  3C4T A;  2FNJ C;  4W9L B;  2K4V A;  4R2S A;  2P1M A;  1N36 E;  2HC5 A;  2EM7 A;  4F54 A;  1SFE A;  2EOE A;  3FIG A;  2NAB A;  4Q35 B;  4W9G B;  1N34 E;  4HTG A;  2RQL A;  2V88 A;  2L3C A;  4R2R A;  5A6B A;  5DAF A;  2GLI A;  2KON A;  4B3M E;  4BC7 A;  5BR8 E;  1X6H A;  2VE7 C;  4KZS A;  2EOJ A;  4WSG A;  2EZ6 A;  1EXB E;  2DSY A;  2LVH A;  2E5L E;  2A25 A;  2RS6 A;  4M30 A;  4F6M A;  1TF3 A;  4YY3 E;  4JI0 E;  4HXI A;  4CRH A;  5AC4 A;  2K7I A;  2LUP B;  4O4K A;  4F9C B;  2V89 A;  5LMU E;  5LMN E;  4DV7 E;  4R2Q A;  1CS3 A;  2EMW A;  2LTS A;  3GA1 A;  2EL6 A;  2LUQ A;  1WHQ A;  2GHF A;  1IBM E;  1R2B A;  3JAM C;  2P1P A;  1X6E A;  2DLQ A;  4DUY E;  1A1I A;  2HGH A;  2D9H A;  2F8B A;  2EQ3 A;  5AE3 A;  4HEI A;  3KVT A;  1DQ3 A;  4W9H B;  3ZTC B;  3BF2 A;  2H36 X;  4R2A A;  4JYA E;  1KJK A;  2RPC A;  5DAD A;  4ZGC A;  4K0K E;  3ECR A;  1A1F A;  2L8T A;  2EM2 A;  2EM3 A;  4M9V C;  4W9D B;  4W9K B;  4B95 B;  4F2J C;  5A6J A;  2LV2 A;  3RMP A;  4X9J A;  2VKP A;  1SR9 A;  4J8Z A;  1DGC A;  4LF9 E;  2DGC A;  1X6F A;  1G2F C;  1TN9 A;  3F6G A;  1YFH A;  2IHC A;  1AH5 A;  1WHN A;  4L5N C;  1EOD A;  2EM6 A;  3C6N A;  2V87 A;  1IQO A;  3ADG A;  3HVE A;  2UXC E;  3MKS A;  1X48 A;  1X5W A;  2EPA A;  1EOE A;  1PDA A;  2L3J A;  2I2R A;  3VYX A;  2EL5 A;  1YPN A;  2EOM A;  3DF6 A;  5F3W A;  1YUI A;  4LF5 E;  4W9E B;  3HQI A;  2YT4 A;  4LF7 E;  2UXB E;  1EH6 A;  3J80 C;  2NN2 A;  4U77 A;  4OOG C;  4M2Z A;  3ZTD B;  4AP2 A;  3LML A;  5EUP A;  1RQ0 A;  1P47 A;  2EOY A;  1A1J A;  2LTR A;  1PJT A;  2EN8 A;  2LJH A;  4NZV A;  4LU9 A;  4JI4 E;  1A1H A;  5HYW B;  1FJG E;  2ODR C;  2L2K B;  4BHC A;  5TSE A;  5LLQ A;  3KZZ A;  3J7Y p;  2DIX A;  4O5G A;  4DV1 E;  2R76 A;  1RC7 A;  4JI2 E;  2PPI A;  4F9B B;  4CXJ A;  1I94 E;  4CXI A;  3HQ1 A;  2VQE E;  2EMZ A;  2M9A A;  2YTD A;  2JZ3 C;  3VYY A;  2J7J A;  4R8O A;  2V85 A;  2EOI A;  5KL4 A;  4CXT A;  2UUB E;  1N3G A;  2PRT A;  2B7T A;  3B84 A;  1IBK E;  2RSM A;  2YTI A;  2WBU A;  1YYO A;  1N33 E;  1A1G A;  1UIL A;  2YTN A;  1WXR A;  4JGH C;  2OVP A;  5T6J A;  4AWJ B;  4ZYE A;  2P1O A;  5H7G A;  2OVR A;  1HR0 E;  2Z8H A;  4WXD A;  3LBZ A;  2EJ4 A;  2R9R B;  5BO4 C;  2JWO A;  5IBK A;  1WJP A;  4U2N A;  4JTC B;  4MLQ A;  4ZYD A;  1YUJ A;  4DR6 E;  4JTD B;  2DMY A;  2EOX A;  4X66 E;  4GKK E;  4WXC A;  4NXM E;  2UUA E;  4FK5 C;  2WZO A;  1T4O A;  3H09 A;  2N3H A;  5IT9 C;  2EE8 A;  3JTZ A;  2MDR A;  2EOR A;  1R29 A;  1T38 A;  4APF A;  5JH5 B;  2YRM A;  2YU5 A;  2IZV C;  1HNW E;  4NHR A;  2AST A;  5KL7 A;  2EL4 A;  4WFT A;  1VCB B;  3TQM A;  1PJS A;  4BGC A;  4JI1 E;  2LT7 A;  2VRD A;  1AAY A;  4LTY A;  3C4B A;  2M7Q A;  2EMG A;  3V7D A;  2YPN A;  1NN7 A;  2CSH A;  2EM8 A;  1F2I G;  2EPM X;  2EWL A;  5FLX C;  2WCC 3;  2MA9 C;  4X65 E;  4W9H H;  4B3S E;  2EMF A;  5DNY A;  1YYK A;  3ZRC B;  2V83 A;  2EMY A;  3ZUN B;  1LLM C;  4BMJ A;  4ZOU A;  1J5E E;  2N8X A;  3EPL A;  4F6N A;  3OHU A;  1GQE A;  4YHH E;  1EKZ A;  2EM4 A;  2HHH E;  1IBL E;  2VF1 A;  3DRY A;  5IV8 B;  1XNQ E;  2EPC A;  4JV5 E;  1GZ6 A;  2EMH A;  3M5B A;  3OTO E;  1YSA C;  2EN4 A;  1BB8 A;  2EPN A;  2UXD E;  2ODR D;  2EMX A;  4R2C A;  3WSO B;  4BCA A;  1MGT A;  2JVA A;  3QG5 C;  3ZOQ B;  3FKC A;  2EPK X;  4F9A B;  5A6A A;  4UYI A;  4BBY A;  5AE1 A;  2EPR A;  4GZN C;  4BS9 A;  1BUO A;  3M4T A;  4LF8 E;  4DMI A;  3EPK A;  1PJQ A;  5A15 A;  2DB2 A;  1J26 A;  4DR2 E;  4B3T E;  4ZYG A;  4NXN E;  4DKK A;  5KL3 A;  5KL5 A;  1T39 A;  3HPZ A;  4P78 A;  4IS1 C;  3KZY A;  4W9I B;  1NEX A;  2YSO A;  4Q28 A;  4DV0 E;  1FQV B;  4B9K E;  3EPH A;  1XMO E;  2EN7 A;  2F4V E;  2Q81 A;  1FKA E;  2JR1 A;  2MDG A;  2YTE A;  3P1X A;  2EMB A;  1LDK D;  3T1H E;  4UIJ A;  2C9W C;  2L6M A;  2RS7 A;  4DR1 E;  2UU9 E;  3T1Y E;  1ZR9 A;  5A6K A;  4X62 E;  4DV6 E;  1BBO A;  1X47 A;  2YRK A;  1S1G A;  2ADR A;  4LFB E;  2JOB A;  1IQS A;  2EN1 A;  2ENA A;  2ENC A;  2WBT A;  3LLH A;  5A2Q C;  2ZM6 E;  4DV3 E;  2NUG A;  3OGK A;  5H7H A;  3DRX A;  1A1L A;  2EPP A;  2WBS A;  2EOH A;  3MSW A;  4JI5 E;  2EOF A;  1NEI A;  2EOZ A;  5AC5 A;  2G7H A;  2DLK A;  2BBG A;  3OML A;  4RH8 A;  2LJU A;  3OGL A;  4DR7 E;  2EPX A;  3OGM A;  1B69 A;  2NUF A;  3IWD A;  2A79 B;  3J81 C;  1YYW A;  4BC9 A;  2EMC A;  3BID A;  1QDV A;  5A6B D;  3LNM B;  1UHZ A;  3MHH C;  2YWQ A;  3DCG B;  2EN3 A;  3MHS C;  1T4N A;  2E31 B;  2EML A;  4TUG A;  5BXB A;  5AAS A;  1HNX E;  3HTM A;  3AV0 A;  2IHR 1;  1QU6 A;  4R2E A;  4LF4 E;  1JK1 A;  1Z1B A;  4I8O A;  4L8N A;  3EQ1 A;  1UBD C;  4DV4 E;  3EPJ A;  2EPO A;  5A69 A;  2YSP A;  5CFF E;  4JTA B;  4DR5 E;  3DJW A;  4R2P A;  3UK3 C;  4B9K B;  4WQO C;  2P1N A;  3VK6 A;  1BBG A;  2FTX B;  2P1Q A;  2EPZ A; 
#chains in the Genus database with same CATH homology
 1YZ9 A;  4WPY A;  2UUC E;  3HTX A;  3M8V A;  2FGG A;  1XNR E;  1LQB B;  3ADL A;  4EOZ A;  5ADZ A;  3C6P A;  1X49 A;  4B3R E;  3BIM A;  1FS1 B;  4BKS B;  2ASS A;  4JI3 E;  2LE2 A;  3ZRF B;  1T1D A;  3ADJ A;  3K6Q A;  2KOU A;  4R03 A;  1LM8 C;  4U2M A;  4WYQ B;  1A68 A;  3JU0 A;  2OVQ A;  4GKJ E;  5BXH A;  2MC6 A;  1N32 E;  3I3N A;  1EOF A;  2VPK A;  2KHX A;  3HPS A;  3HU6 A;  2RTX A;  3J7A G;  1DI2 A;  2JOX A;  2L2N A;  2B3T B;  2IF5 A;  3IWC A;  3E4U A;  5A6R A;  2L33 A;  4KHP E;  4X64 E;  4JI6 E;  4AJY C;  2NUE A;  1ZBQ A;  4OX9 E;  4JI8 E;  3HVE B;  4CP3 A;  3IWB A;  2E1M A;  2YY9 A;  2VQF E;  4GEQ B;  2M1S A;  1P22 B;  1R28 A;  5IWA E;  4BKT B;  5LL6 R;  5AE2 A;  1T4L B;  3ZKJ B;  3AUZ A;  4X8W A;  2M4I A;  4N9F 5;  2FV4 B;  1DSX A;  3ZNG B;  4DUZ E;  4DR3 E;  2JY9 A;  2LBS B;  2YZT A;  2B9D A;  3KWR A;  4LFC E;  3DRZ A;  3LUT B;  1STU A;  2CPN A;  2MC5 A;  2NZ0 B;  1XMQ E;  3M52 A;  5FTA A;  4I6J C;  5BXD A;  2N3G A;  4LFA E;  2NA2 A;  4DR4 E;  4P7D A;  2V86 A;  5HZG C;  3HXL A;  4TUI A;  1ZBT A;  3F6H A;  4W9J B;  1QDW A;  4LF6 E;  4JI7 E;  1O0W A;  2LMZ A;  2V8Q B;  2L2M A;  4AQY E;  4W9F B;  4YY8 A;  1FS2 B;  4DV5 E;  4DV2 E;  3C6O A;  1HNZ E;  5LLI B;  2E32 B;  3ADI A;  3OHV A;  1HV2 A;  2B7V A;  4WSP A;  2LRS A;  3L2O A;  4W9C B;  4M0V A;  1PKP A;  2L92 A;  3C4T A;  2FNJ C;  4W9L B;  2K4V A;  2P1M A;  1N36 E;  4F54 A;  3FIG A;  4W9G B;  1N34 E;  2V88 A;  2L3C A;  5DAF A;  2KON A;  4B3M E;  4BC7 A;  5BR8 E;  4KZS A;  2VE7 C;  2EZ6 A;  1EXB E;  2DSY A;  2E5L E;  2RS6 A;  4M30 A;  4CRH A;  4JI0 E;  4YY3 E;  4HXI A;  2LUP B;  4F9C B;  2V89 A;  5LMU E;  5LMN E;  4DV7 E;  1CS3 A;  3GA1 A;  2LTS A;  2LUQ A;  1WHQ A;  1IBM E;  1R2B A;  3JAM C;  2P1P A;  4DUY E;  2F8B A;  5AE3 A;  3KVT A;  1DQ3 A;  4W9H B;  3ZTC B;  2H36 X;  5DAD A;  4ZGC A;  4K0K E;  4B95 B;  2L8T A;  4W9D B;  4W9K B;  3RMP A;  2VKP A;  1SR9 A;  4J8Z A;  4LF9 E;  3F6G A;  2IHC A;  3C6N A;  4L5N C;  1WHN A;  1EOD A;  2V87 A;  3HVE A;  3ADG A;  2UXC E;  3MKS A;  1X48 A;  1EOE A;  2L3J A;  2I2R A;  3VYX A;  3DF6 A;  5F3W A;  4LF5 E;  4W9E B;  3HQI A;  2YT4 A;  4LF7 E;  2UXB E;  2NN2 A;  3J80 C;  4U77 A;  4OOG C;  4M2Z A;  3ZTD B;  4AP2 A;  3LML A;  5EUP A;  1RQ0 A;  2LTR A;  2LJH A;  4LU9 A;  4JI4 E;  5HYW B;  1FJG E;  2ODR C;  2L2K B;  3J7Y p;  1RC7 A;  2DIX A;  4JI2 E;  4DV1 E;  2PPI A;  4F9B B;  4CXJ A;  1I94 E;  4CXI A;  3HQ1 A;  2VQE E;  2JZ3 C;  3VYY A;  4R8O A;  2V85 A;  4CXT A;  2UUB E;  2B7T A;  3B84 A;  1IBK E;  2RSM A;  1YYO A;  1N33 E;  1UIL A;  4AWJ B;  1WXR A;  4JGH C;  2OVP A;  5T6J A;  2P1O A;  5H7G A;  2OVR A;  1HR0 E;  2Z8H A;  3LBZ A;  2R9R B;  5BO4 C;  2JWO A;  5IBK A;  4U2N A;  4JTC B;  4DR6 E;  4JTD B;  2DMY A;  4X66 E;  4GKK E;  4NXM E;  2UUA E;  2WZO A;  1T4O A;  3H09 A;  2N3H A;  5IT9 C;  3JTZ A;  2MDR A;  1R29 A;  4APF A;  5JH5 B;  2IZV C;  1HNW E;  2AST A;  4WFT A;  1VCB B;  4BGC A;  4JI1 E;  4LTY A;  3C4B A;  2M7Q A;  3V7D A;  1NN7 A;  2EWL A;  5FLX C;  2MA9 C;  4X65 E;  4W9H H;  4B3S E;  5DNY A;  1YYK A;  3ZRC B;  2V83 A;  3ZUN B;  4BMJ A;  4ZOU A;  1J5E E;  3OHU A;  1GQE A;  4YHH E;  1EKZ A;  2HHH E;  1IBL E;  2VF1 A;  3DRY A;  1XNQ E;  4JV5 E;  1GZ6 A;  3M5B A;  3OTO E;  2UXD E;  2ODR D;  3WSO B;  4BCA A;  2JVA A;  3ZOQ B;  3FKC A;  4UYI A;  4F9A B;  4BBY A;  5AE1 A;  4BS9 A;  1BUO A;  3M4T A;  4LF8 E;  4DMI A;  5A15 A;  2DB2 A;  1J26 A;  4DR2 E;  4B3T E;  4NXN E;  4DKK A;  3HPZ A;  4P78 A;  4W9I B;  1NEX A;  4Q28 A;  4DV0 E;  1FQV B;  4B9K E;  1XMO E;  2F4V E;  2Q81 A;  1FKA E;  2JR1 A;  3P1X A;  1LDK D;  3T1H E;  4UIJ A;  2C9W C;  2L6M A;  2RS7 A;  4DR1 E;  2UU9 E;  3T1Y E;  4X62 E;  4DV6 E;  1X47 A;  1S1G A;  4LFB E;  2JOB A;  2NUG A;  4DV3 E;  3LLH A;  2ZM6 E;  5A2Q C;  5H7H A;  3OGK A;  3DRX A;  4JI5 E;  3MSW A;  2G7H A;  3OML A;  3OGL A;  4DR7 E;  3OGM A;  2NUF A;  3IWD A;  2A79 B;  3J81 C;  1YYW A;  4BC9 A;  1QDV A;  3LNM B;  1UHZ A;  3DCG B;  1T4N A;  2E31 B;  4TUG A;  5BXB A;  5AAS A;  1HNX E;  3HTM A;  3AV0 A;  2IHR 1;  1QU6 A;  4LF4 E;  4I8O A;  4L8N A;  4DV4 E;  5CFF E;  4JTA B;  4DR5 E;  3DJW A;  4B9K B;  4WQO C;  2P1N A;  3VK6 A;  2FTX B;  2P1Q A;  4JYA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...