4J8ZA

Crystal structure of the human spop btb domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
MVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAERSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Speckle-type POZ protein
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.700 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4j8zA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 4j8zA01
3KVTA 5DADA 4W9FB 3HU6A 1R29A 4ZOUA 2Q81A 1R28A 1FS2B 4W9HH 4U2NA 4UYIA 4W9LB 3M5BA 3ZRFB 4B9KB 1NEXA 2MA9C 5H7HA 3MKSA 4U77A 2Z8HA 3OHVA 2P1MA 2VPKA 5A6RA 5EUPA 3ZNGB 1DSXA 5BXHA 2ASSA 3LBZA 4APFA 5BXDA 4N9F5 3M4TA 3ZRCB 4W9JB 3C6NA 1BUOA 2PPIA 3C6PA 2YY9A 3ZKJB 1EOFA 3HVEB 4W9KB 3ZTDB 4CXJA 2IZVC 5HYWB 5LLIB 1T1DA 3I3NA 5JH5B 3C6OA 4B9KE 2P1QA 3M52A 3DCGB 4JGHC 4AP2A 4AWJB 3E4UA 5HZGC 4W9CB 2JZ3C 4AJYC 4EOZA 1NN7A 3OHUA 5BXBA 4U2MA 1A68A 5DAFA 2C9WC 2IHCA 2OVQA 2NZ0B 4CXTA 4WQOC 4J8ZA 3WSOB 1LM8C 4I6JC 4W9GB 4CXIA 2R9RB 4JTDB 1R2BA 4B95B 4BGCA 2OVRA 4CP3A 3HTMA 3OGMA 4CRHA 5BO4C 3LUTB 4UIJA 3HVEA 3GA1A 1EODA 2A79B 1CS3A 3B84A 4W9DB 3V7DA 4W9IB 2FNJC 2P1PA 1S1GA 3BIMA 1LDKD 1FQVB 4HXIA 2IF5A 1QDWA 2P1NA 1HV2A 4BKTB 3L2OA 5H7GA 3ZUNB 3ZTCB 1EXBE 3M8VA 2ASTA 1EOEA 3OGLA 5A15A 5IBKA 2E32B 2NN2A 2E31B 1VCBB 2P1OA 4BKSB 2VKPA 1QDVA 3LNMB 4JTCB 2I2RA 4W9HB 1FS1B 3DRZA 5FTAA 4W9EB 3HQIA 3OGKA 1LQBB 4JTAB 2OVPA 3FKCA 1P22B
chains in the Genus database with same CATH superfamily
4W9FB 2L8TA 2LRSA 1R29A 3QG5C 4Q28A 2L2KB 4U2NA 5KL7A 1WJPA 2YRKA 2EL4A 2B9DA 1RQ0A 3ZRFB 2JR1A 1KJKA 2L2NA 2M1SA 4U77A 3HTXA 4JI3E 2MKDA 2EN3A 5A6KA 2NUEA 3ADLA 5A6RA 1YUIA 3KZZA 4BHBA 2YPNA 1L4SA 1STUA 1YSAC 2EOIA 2E1MA 1A1JA 2JPAA 2YTNA 5A6AA 4GZNC 4TUGA 2VE7C 1N34E 3ZRCB 4W9JB 4AQYE 2LUPB 4GEQB 2PPIA 2IHR1 4LU9A 2EPCA 4KWYA 3F6GA 4W9KB 2ELYA 4N4RB 2WCC3 4CXJA 2EMAA 2HHHE 4O24A 5JH5B 4GKKE 4F54A 2EMKA 1A1KA 1DI2A 1WHNA 4KHPE 3M52A 2JY9A 3C4TA 1IBLE 4MLQA 2JOBA 5HZGC 3KZYA 1NN7A 2LJHA 2ZM6E 4JI6E 1A68A 4X66E 2C9WC 2EQ0A 4JI7E 4BMJA 1N32E 4L8NA 4J8ZA 4F9CB 4DKKA 2UU9E 4DV0E 4JI5E 1YYWA 4I6JC 4W9GB 5IV8B 4CXIA 2R76A 2V89A 4F6NA 1WRJA 2RTXA 1G2FC 4WFTA 1IQOA 2ENAA 1MEYC 2JVAA 4F9AB 2EMHA 1X49A 4K0KE 1EH6A 1YZ9A 3B84A 2KONA 2YTJA 2NA2A 1XMOE 1NEIA 2E5LE 2BBGA 2YT4A 1LDKD 1FQVB 4HXIA 2NABA 1HNZE 2IF5A 2JYAA 2PRTA 4JI4E 4WXDA 1WXRA 1HV2A 2N3GA 4LF5E 2EQ3A 5H7GA 3ZTCB 2ADRA 3M8VA 2ASTA 2YRHA 3HPZA 2YSOA 3P1XA 1X5WA 2B7VA 2NUFA 2P1OA 3HXLA 2V83A 1AAYA 2VKPA 3BF2A 5IT9C 2M4IA 1QDVA 5AE1A 3RMPA 4JTCB 3IWBA 2G7HA 1FS1B 2EE8A 2EPKX 2EPPA 1I94E 4IS1C 1EH8A 5AE2A 2EQ1A 4B3ME 2EOEA 3FKCA 4JI8E 5DADA 1T4LB 2Q81A 1R28A 4BHCA 1HNXE 4JI1E 4DV7E 3JTZA 1IBKE 4UYIA 5LMNE 2L2MA 2MA9C 4IJDA 2LV2A 1IQSA 3VYXA 2V8QB 1JK2A 4R2EA 2GHFA 2UXDE 2P1MA 4O43A 5EUPA 3ZNGB 5ADZA 5BXHA 2EM9A 4X64E 2EM3A 1GQEA 4DV2E 3ECRA 4N9F5 3JAMC 4NHRA 2A25A 2EPLX 4M2ZA 4DR7E 3C6NA 2K4VA 1BUOA 2E72A 3EPLA 5F3WA 2UUCE 2YY9A 2ODRC 2HC5A 3ZKJB 2MKNA 2UUAE 2LO3A 3ZTDB 1EH7A 5HYWB 5FLXC 3AUZA 2EL6A 2LBSB 1JK1A 2EM0A 2N8XA 2YTFA 4AWJB 3IWCA 1UILA 4JYAE 2JZ3C 4W9CB 4GKJE 2CSHA 1N3GA 3MHHC 2RSMA 5AE3A 2EPRA 5DAFA 4JI0E 1FJGE 4X9JA 2EMWA 2OVQA 4WQOC 3WSOB 5A2QC 4DR3E 1LM8C 1X6HA 2EWLA 2R9RB 2EPZA 4JTDB 1R2BA 2L92A 5A69A 1RC7A 3UK3C 2WBUA 4DUZE 2OVRA 2M7QA 3OGMA 4LF7E 2EPMX 2EPAA 5BO4C 4UIJA 3DRYA 3KWRA 2A79B 3V7DA 1GTKA 4O4KA 1YPNA 2DMYA 2M9AA 3BIMA 2EMGA 2EM5A 2V87A 2I13A 2EOOA 2EN7A 4O5GA 4F2JC 1QDWA 2DLQA 2DMIA 2EM2A 4TUIA 1DQ3A 3TQMA 2DLKA 2B3TB 4JV5E 3ADIA 2MDGA 3HPSA 2ELZA 4R2RA 4MLVA 1HR0E 2V88A 4B3RE 5IBKA 3EPJA 2EM4A 2UXCE 3T1HE 4X8WA 1VCBB 1A1IA 2EL5A 3EPHA 3H09A 5CFFE 2CTDA 4DV3E 4W9HB 4DMIA 2EOXA 2YU8A 2EMFA 3DRZA 2CPNA 4R8OA 3HQIA 4W9EB 1Z1BA 2EOFA 3BBGA 2VRDA 4Q35B 3J80C 1QU6A 5KL3A 2UUBE 4DV5E 3EPKA 2MC5A 5A6BD 4LF6E 2EMIA 4ZOUA 1YYKA 3VYYA 1J26A 4WXCA 1WHQA 2R1FA 4W9HH 3ZOQB 4B9KB 2WBTA 5H7HA 3MKSA 3OHVA 1X47A 1DGCA 2EPOA 4BC7A 4P78A 2EORA 5AC4A 4DV6E 2EN8A 4ZYDA 4NXME 1DSXA 4R2QA 2YTEA 2YTOA 3LMLA 1FKAE 1AH5A 2EMCA 3DRXA 1T4OA 3LBZA 5DNYA 5BXDA 1TF6A 1X3CA 2KOUA 3M4TA 4I8OA 2B7TA 4M9VC 1UN6B 2EN6A 1T4NA 3J81C 3C6PA 1G2DC 2EMYA 2CT1A 2EZ6A 2EMBA 5LLIB 1T1DA 3I3NA 3C6OA 4B3SE 4YY8A 2VQEE 4DR1E 1KYQA 3MHSC 2RSIA 2NUGA 2P1QA 1N36E 1PJTA 1BB8A 4R2SA 5A6BA 3DCGB 2J7JA 5KL5A 3E4UA 4AJYC 2L3CA 4EOZA 4KZSA 2ENHA 3LLHA 2DB2A 4U2MA 2RPCA 2YZTA 2WBSA 3IWDA 5KL2A 3J7AG 2EPXA 3VK6A 1T38A 1ZAAC 2VQFE 4DR6E 4ZGCA 4CXTA 1QNTA 2EM6A 1XMQE 2ENCA 1X48A 3ADGA 4NZVA 2DGCA 5KL4A 4ZYHA 1A1HA 2D9HA 3DJWA 2EJ4A 3HTMA 2EM8A 3AV0A 2YTIA 4R2AA 4CRHA 3LUTB 2FGGA 5KL6A 2F8BA 2LTRA 3GA1A 1EODA 2L33A 2EMZA 3JU0A 2EMLA 2YWQA 3C6KA 4WSPA 2FNJC 2P1PA 4LTYA 1GZ6A 1SR9A 4W9IB 4HEIA 4BC9A 4WSGA 1B69A 4RH8A 5LMUE 3BIDA 1LLMC 3K6QA 2JOXA 1BBOA 1YYOA 4DR2E 4R03A 4DV4E 2LJUA 3C6MA 4ZYGA 2RQLA 2I9IA 1P47A 2HJJA 2YTDA 3THNA 1A1FA 2YRMA 3OGLA 2YU5A 3F6HA 1UBDC 2E32B 2NN2A 5A15A 1TN9A 2VF1A 4OX9E 2EM7A 2EN4A 2YSPA 4BKSB 2KHXA 1X6FA 4RHBB 2I2RA 2MDRA 3L00A 1IBME 3VHTB 1SFEA 1LQBB 2EOYA 2LMZA 1MGTA 2YTGA 1EKZA 4DUYE 3KVTA 4DR5E 1PJSA 3HU6A 2DSYA 2ODRD 2GLIA 1FS2B 4W9LB 3M5BA 2EPNA 1NEXA 2LVHA 1J5EE 3C4BA 4YHHE 4WYQB 2Z8HA 3BGHA 2UXBE 4P7DA 4LF8E 2EOMA 2VPKA 3THOB 4ZYEA 5LL6R 1ZR9A 4OOGC 2ASSA 2LCEA 3J7Yp 1XNRE 4APFA 4X65E 1PJQA 2LT7A 1ZBQA 3OMLA 4DV1E 4BS9A 1BBGA 4WPYA 2EMXA 1EOFA 3HVEB 2DRPA 2IZVC 5AC5A 2EOZA 2FV4B 2K7IA 5LLQA 4L5NC 2EN1A 4NXNE 4B9KE 2EOQA 3FIGA 4F6MA 4B3TE 1UHZA 1PDAA 2WZOA 1HNWE 4JGHC 4AP2A 5AASA 1X6EA 4HTGA 4LFCE 3OHUA 2H36X 4M0VA 5BXBA 4DR4E 2V86A 5A6JA 1O0WA 2IHCA 4LFAE 2NZ0B 2RS7A 5TSEA 1IMUA 1F2IG 2YTPA 3EQ1A 2N3HA 2JP9A 1YUJA 5T6JA 2JWOA 2V85A 4LF9E 4B95B 3MSWA 4BCAA 4BGCA 5BR8E 5IXMB 4CP3A 1A1GA 3ADJA 1ZU1A 4F9BB 2LE2A 4R2DA 4R2PA 3HVEA 1TF3A 4LFBE 1ZBTA 1CS3A 4W9DB 2EP3A 1NCSA 2EPUA 2DIXA 1S1GA 2BB8A 4LF4E 4R2CA 4M30A 3T1YE 1PKPA 2L6MA 2GPIA 1A1LA 2YTQA 2EN2A 2HGHA 2P1NA 4X62E 2Q8UA 4BKTB 3L2OA 3ZUNB 2LTSA 4WX9A 1EXBE 2LUQA 2JXPA 4FK5C 1N33E 5IWAE 1EOEA 2RS6A 4BBYA 1T39A 2EOHA 2E31B 1RMDA 2EOSA 2MC6A 1XNQE 3HQ1A 4YY3E 3LNMB 1YFHA 2EOJA 2F4VE 3DF6A 4JI2E 3M99B 5FTAA 3OGKA 2L3JA 4JTAB 3OTOE 2OVPA 2FTXB 1P22B
chains in the Genus database with same CATH topology
4W9FB 2L8TA 2LRSA 1R29A 4Q28A 2L2KB 4U2NA 2B9DA 1RQ0A 3ZRFB 2JR1A 2L2NA 2M1SA 4U77A 3HTXA 4JI3E 2NUEA 3ADLA 5A6RA 1STUA 2E1MA 4TUGA 2VE7C 1N34E 3ZRCB 4W9JB 4AQYE 2LUPB 4GEQB 2PPIA 2IHR1 4LU9A 3F6GA 4W9KB 4CXJA 2HHHE 5JH5B 4GKKE 4F54A 1DI2A 1WHNA 4KHPE 3M52A 2JY9A 3C4TA 1IBLE 2JOBA 5HZGC 1NN7A 2LJHA 2ZM6E 4JI6E 1A68A 4X66E 2C9WC 4JI7E 4BMJA 1N32E 4L8NA 4J8ZA 4F9CB 4DKKA 2UU9E 4DV0E 4JI5E 1YYWA 4I6JC 4W9GB 4CXIA 2V89A 2RTXA 4WFTA 2JVAA 4F9AB 1X49A 4K0KE 1YZ9A 3B84A 2KONA 2NA2A 1XMOE 2E5LE 1LDKD 2YT4A 1FQVB 4HXIA 1HNZE 2IF5A 4JI4E 1WXRA 1HV2A 2N3GA 4LF5E 5H7GA 3ZTCB 3M8VA 2ASTA 3HPZA 3P1XA 2B7VA 2P1OA 2NUFA 3HXLA 2V83A 2VKPA 5IT9C 2M4IA 1QDVA 5AE1A 3RMPA 4JTCB 3IWBA 2G7HA 1FS1B 1I94E 5AE2A 4B3ME 3FKCA 4JI8E 5DADA 1T4LB 2Q81A 1R28A 1HNXE 4JI1E 4DV7E 3JTZA 1IBKE 4UYIA 5LMNE 2L2MA 2MA9C 3VYXA 2V8QB 2P1MA 2UXDE 3ZNGB 5EUPA 5ADZA 5BXHA 4X64E 1GQEA 4DV2E 4N9F5 3JAMC 4M2ZA 4DR7E 3C6NA 2K4VA 1BUOA 5F3WA 2UUCE 2YY9A 2ODRC 3ZKJB 2UUAE 3ZTDB 5HYWB 5FLXC 3AUZA 2LBSB 4AWJB 3IWCA 1UILA 4JYAE 2JZ3C 4W9CB 4GKJE 2RSMA 5AE3A 5DAFA 4JI0E 1FJGE 2OVQA 4WQOC 3WSOB 5A2QC 4DR3E 1LM8C 2EWLA 2R9RB 4JTDB 1R2BA 2L92A 1RC7A 4DUZE 2OVRA 2M7QA 3OGMA 4LF7E 5BO4C 4UIJA 3DRYA 3KWRA 2A79B 3V7DA 2DMYA 3BIMA 2V87A 1QDWA 4TUIA 1DQ3A 4JV5E 2B3TB 3ADIA 3HPSA 1HR0E 2V88A 4B3RE 5IBKA 2UXCE 3T1HE 4X8WA 1VCBB 3H09A 5CFFE 4DV3E 4W9HB 4DMIA 3DRZA 2CPNA 4R8OA 3HQIA 4W9EB 3J80C 1QU6A 2UUBE 4DV5E 2MC5A 4LF6E 4ZOUA 1YYKA 3VYYA 1J26A 1WHQA 4W9HH 3ZOQB 4B9KB 5H7HA 3MKSA 3OHVA 1X47A 4BC7A 4P78A 4DV6E 4NXME 1DSXA 1FKAE 3LMLA 3DRXA 1T4OA 3LBZA 5DNYA 5BXDA 2KOUA 3M4TA 4I8OA 2B7TA 1T4NA 3J81C 3C6PA 2EZ6A 5LLIB 1T1DA 3I3NA 3C6OA 4B3SE 4YY8A 2VQEE 4DR1E 2NUGA 2P1QA 1N36E 3DCGB 3E4UA 4AJYC 2L3CA 4EOZA 4KZSA 3LLHA 2DB2A 4U2MA 2YZTA 3IWDA 3J7AG 3VK6A 4ZGCA 2VQFE 4DR6E 4CXTA 1XMQE 1X48A 3ADGA 3DJWA 3HTMA 3AV0A 4CRHA 3LUTB 2FGGA 2F8BA 2LTRA 3GA1A 1EODA 2L33A 3JU0A 4W9IB 4WSPA 2FNJC 2P1PA 4LTYA 1SR9A 1GZ6A 4BC9A 5LMUE 3K6QA 2JOXA 1YYOA 4DR2E 4R03A 4DV4E 3OGLA 3F6HA 5A15A 2E32B 2NN2A 2VF1A 4OX9E 4BKSB 2KHXA 2I2RA 2MDRA 1IBME 1LQBB 2LMZA 1EKZA 4DUYE 3KVTA 4DR5E 3HU6A 2DSYA 2ODRD 1FS2B 4W9LB 3M5BA 1NEXA 1J5EE 3C4BA 4YHHE 4WYQB 2Z8HA 2UXBE 4P7DA 4LF8E 2VPKA 5LL6R 4OOGC 2ASSA 3J7Yp 1XNRE 4APFA 4X65E 1ZBQA 3OMLA 4DV1E 4BS9A 4WPYA 1EOFA 3HVEB 2IZVC 2FV4B 4L5NC 4NXNE 4B9KE 3FIGA 4B3TE 1UHZA 2WZOA 1HNWE 4JGHC 4AP2A 5AASA 4LFCE 3OHUA 5BXBA 2H36X 4M0VA 4DR4E 2V86A 1O0WA 2IHCA 4LFAE 2NZ0B 2RS7A 2N3HA 5T6JA 2JWOA 2V85A 4LF9E 4B95B 3MSWA 4BCAA 4BGCA 5BR8E 4CP3A 3ADJA 4F9BB 2LE2A 3HVEA 4LFBE 1ZBTA 1CS3A 4W9DB 2DIXA 1S1GA 4LF4E 4M30A 3T1YE 1PKPA 2L6MA 2P1NA 4X62E 4BKTB 3L2OA 3ZUNB 2LTSA 1EXBE 2LUQA 1N33E 1EOEA 5IWAE 2RS6A 4BBYA 2E31B 2MC6A 1XNQE 3HQ1A 4YY3E 3LNMB 2F4VE 3DF6A 4JI2E 5FTAA 3OGKA 2L3JA 4JTAB 3OTOE 2OVPA 2FTXB 1P22B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVT A;  5DAD A;  4W9F B;  3HU6 A;  1R29 A;  4ZOU A;  2Q81 A;  1R28 A;  1FS2 B;  4W9H H;  4U2N A;  4UYI A;  4W9L B;  3M5B A;  3ZRF B;  4B9K B;  1NEX A;  2MA9 C;  5H7H A;  3MKS A;  4U77 A;  2Z8H A;  3OHV A;  2P1M A;  2VPK A;  5A6R A;  5EUP A;  3ZNG B;  1DSX A;  5BXH A;  2ASS A;  3LBZ A;  4APF A;  5BXD A;  4N9F 5;  3M4T A;  3ZRC B;  4W9J B;  3C6N A;  1BUO A;  2PPI A;  3C6P A;  2YY9 A;  3ZKJ B;  1EOF A;  3HVE B;  4W9K B;  3ZTD B;  4CXJ A;  2IZV C;  5HYW B;  5LLI B;  1T1D A;  3I3N A;  5JH5 B;  3C6O A;  4B9K E;  2P1Q A;  3M52 A;  3DCG B;  4JGH C;  4AP2 A;  4AWJ B;  3E4U A;  5HZG C;  4W9C B;  2JZ3 C;  4AJY C;  4EOZ A;  1NN7 A;  3OHU A;  5BXB A;  4U2M A;  1A68 A;  5DAF A;  2C9W C;  2IHC A;  2OVQ A;  2NZ0 B;  4CXT A;  4WQO C;  4J8Z A;  3WSO B;  1LM8 C;  4I6J C;  4W9G B;  4CXI A;  2R9R B;  4JTD B;  1R2B A;  4B95 B;  4BGC A;  2OVR A;  4CP3 A;  3HTM A;  3OGM A;  4CRH A;  5BO4 C;  3LUT B;  4UIJ A;  3HVE A;  3GA1 A;  1EOD A;  2A79 B;  1CS3 A;  3B84 A;  4W9D B;  3V7D A;  4W9I B;  2FNJ C;  2P1P A;  1S1G A;  3BIM A;  1LDK D;  1FQV B;  4HXI A;  2IF5 A;  1QDW A;  2P1N A;  1HV2 A;  4BKT B;  3L2O A;  5H7G A;  3ZUN B;  3ZTC B;  1EXB E;  3M8V A;  2AST A;  1EOE A;  3OGL A;  5A15 A;  5IBK A;  2E32 B;  2NN2 A;  2E31 B;  1VCB B;  2P1O A;  4BKS B;  2VKP A;  1QDV A;  3LNM B;  4JTC B;  2I2R A;  4W9H B;  1FS1 B;  3DRZ A;  5FTA A;  4W9E B;  3HQI A;  3OGK A;  1LQB B;  4JTA B;  2OVP A;  3FKC A;  1P22 B; 
#chains in the Genus database with same CATH topology
 4W9F B;  2L8T A;  2LRS A;  1R29 A;  3QG5 C;  4Q28 A;  2L2K B;  4U2N A;  5KL7 A;  1WJP A;  2YRK A;  2EL4 A;  2B9D A;  1RQ0 A;  3ZRF B;  2JR1 A;  1KJK A;  2L2N A;  2M1S A;  4U77 A;  3HTX A;  4JI3 E;  2MKD A;  2EN3 A;  5A6K A;  2NUE A;  3ADL A;  5A6R A;  1YUI A;  3KZZ A;  4BHB A;  2YPN A;  1L4S A;  1STU A;  1YSA C;  2EOI A;  2E1M A;  1A1J A;  2JPA A;  2YTN A;  5A6A A;  4GZN C;  4TUG A;  2VE7 C;  1N34 E;  3ZRC B;  4W9J B;  4AQY E;  2LUP B;  4GEQ B;  2PPI A;  2IHR 1;  4LU9 A;  2EPC A;  4KWY A;  3F6G A;  4W9K B;  2ELY A;  4N4R B;  2WCC 3;  4CXJ A;  2EMA A;  2HHH E;  4O24 A;  5JH5 B;  4GKK E;  4F54 A;  2EMK A;  1A1K A;  1DI2 A;  1WHN A;  4KHP E;  3M52 A;  2JY9 A;  3C4T A;  1IBL E;  4MLQ A;  2JOB A;  5HZG C;  3KZY A;  1NN7 A;  2LJH A;  2ZM6 E;  4JI6 E;  1A68 A;  4X66 E;  2C9W C;  2EQ0 A;  4JI7 E;  4BMJ A;  1N32 E;  4L8N A;  4J8Z A;  4F9C B;  4DKK A;  2UU9 E;  4DV0 E;  4JI5 E;  1YYW A;  4I6J C;  4W9G B;  5IV8 B;  4CXI A;  2R76 A;  2V89 A;  4F6N A;  1WRJ A;  2RTX A;  1G2F C;  4WFT A;  1IQO A;  2ENA A;  1MEY C;  2JVA A;  4F9A B;  2EMH A;  1X49 A;  4K0K E;  1EH6 A;  1YZ9 A;  3B84 A;  2KON A;  2YTJ A;  2NA2 A;  1XMO E;  1NEI A;  2E5L E;  2BBG A;  2YT4 A;  1LDK D;  1FQV B;  4HXI A;  2NAB A;  1HNZ E;  2IF5 A;  2JYA A;  2PRT A;  4JI4 E;  4WXD A;  1WXR A;  1HV2 A;  2N3G A;  4LF5 E;  2EQ3 A;  5H7G A;  3ZTC B;  2ADR A;  3M8V A;  2AST A;  2YRH A;  3HPZ A;  2YSO A;  3P1X A;  1X5W A;  2B7V A;  2NUF A;  2P1O A;  3HXL A;  2V83 A;  1AAY A;  2VKP A;  3BF2 A;  5IT9 C;  2M4I A;  1QDV A;  5AE1 A;  3RMP A;  4JTC B;  3IWB A;  2G7H A;  1FS1 B;  2EE8 A;  2EPK X;  2EPP A;  1I94 E;  4IS1 C;  1EH8 A;  5AE2 A;  2EQ1 A;  4B3M E;  2EOE A;  3FKC A;  4JI8 E;  5DAD A;  1T4L B;  2Q81 A;  1R28 A;  4BHC A;  1HNX E;  4JI1 E;  4DV7 E;  3JTZ A;  1IBK E;  4UYI A;  5LMN E;  2L2M A;  2MA9 C;  4IJD A;  2LV2 A;  1IQS A;  3VYX A;  2V8Q B;  1JK2 A;  4R2E A;  2GHF A;  2UXD E;  2P1M A;  4O43 A;  5EUP A;  3ZNG B;  5ADZ A;  5BXH A;  2EM9 A;  4X64 E;  2EM3 A;  1GQE A;  4DV2 E;  3ECR A;  4N9F 5;  3JAM C;  4NHR A;  2A25 A;  2EPL X;  4M2Z A;  4DR7 E;  3C6N A;  2K4V A;  1BUO A;  2E72 A;  3EPL A;  5F3W A;  2UUC E;  2YY9 A;  2ODR C;  2HC5 A;  3ZKJ B;  2MKN A;  2UUA E;  2LO3 A;  3ZTD B;  1EH7 A;  5HYW B;  5FLX C;  3AUZ A;  2EL6 A;  2LBS B;  1JK1 A;  2EM0 A;  2N8X A;  2YTF A;  4AWJ B;  3IWC A;  1UIL A;  4JYA E;  2JZ3 C;  4W9C B;  4GKJ E;  2CSH A;  1N3G A;  3MHH C;  2RSM A;  5AE3 A;  2EPR A;  5DAF A;  4JI0 E;  1FJG E;  4X9J A;  2EMW A;  2OVQ A;  4WQO C;  3WSO B;  5A2Q C;  4DR3 E;  1LM8 C;  1X6H A;  2EWL A;  2R9R B;  2EPZ A;  4JTD B;  1R2B A;  2L92 A;  5A69 A;  1RC7 A;  3UK3 C;  2WBU A;  4DUZ E;  2OVR A;  2M7Q A;  3OGM A;  4LF7 E;  2EPM X;  2EPA A;  5BO4 C;  4UIJ A;  3DRY A;  3KWR A;  2A79 B;  3V7D A;  1GTK A;  4O4K A;  1YPN A;  2DMY A;  2M9A A;  3BIM A;  2EMG A;  2EM5 A;  2V87 A;  2I13 A;  2EOO A;  2EN7 A;  4O5G A;  4F2J C;  1QDW A;  2DLQ A;  2DMI A;  2EM2 A;  4TUI A;  1DQ3 A;  3TQM A;  2DLK A;  2B3T B;  4JV5 E;  3ADI A;  2MDG A;  3HPS A;  2ELZ A;  4R2R A;  4MLV A;  1HR0 E;  2V88 A;  4B3R E;  5IBK A;  3EPJ A;  2EM4 A;  2UXC E;  3T1H E;  4X8W A;  1VCB B;  1A1I A;  2EL5 A;  3EPH A;  3H09 A;  5CFF E;  2CTD A;  4DV3 E;  4W9H B;  4DMI A;  2EOX A;  2YU8 A;  2EMF A;  3DRZ A;  2CPN A;  4R8O A;  3HQI A;  4W9E B;  1Z1B A;  2EOF A;  3BBG A;  2VRD A;  4Q35 B;  3J80 C;  1QU6 A;  5KL3 A;  2UUB E;  4DV5 E;  3EPK A;  2MC5 A;  5A6B D;  4LF6 E;  2EMI A;  4ZOU A;  1YYK A;  3VYY A;  1J26 A;  4WXC A;  1WHQ A;  2R1F A;  4W9H H;  3ZOQ B;  4B9K B;  2WBT A;  5H7H A;  3MKS A;  3OHV A;  1X47 A;  1DGC A;  2EPO A;  4BC7 A;  4P78 A;  2EOR A;  5AC4 A;  4DV6 E;  2EN8 A;  4ZYD A;  4NXM E;  1DSX A;  4R2Q A;  2YTE A;  2YTO A;  3LML A;  1FKA E;  1AH5 A;  2EMC A;  3DRX A;  1T4O A;  3LBZ A;  5DNY A;  5BXD A;  1TF6 A;  1X3C A;  2KOU A;  3M4T A;  4I8O A;  2B7T A;  4M9V C;  1UN6 B;  2EN6 A;  1T4N A;  3J81 C;  3C6P A;  1G2D C;  2EMY A;  2CT1 A;  2EZ6 A;  2EMB A;  5LLI B;  1T1D A;  3I3N A;  3C6O A;  4B3S E;  4YY8 A;  2VQE E;  4DR1 E;  1KYQ A;  3MHS C;  2RSI A;  2NUG A;  2P1Q A;  1N36 E;  1PJT A;  1BB8 A;  4R2S A;  5A6B A;  3DCG B;  2J7J A;  5KL5 A;  3E4U A;  4AJY C;  2L3C A;  4EOZ A;  4KZS A;  2ENH A;  3LLH A;  2DB2 A;  4U2M A;  2RPC A;  2YZT A;  2WBS A;  3IWD A;  5KL2 A;  3J7A G;  2EPX A;  3VK6 A;  1T38 A;  1ZAA C;  2VQF E;  4DR6 E;  4ZGC A;  4CXT A;  1QNT A;  2EM6 A;  1XMQ E;  2ENC A;  1X48 A;  3ADG A;  4NZV A;  2DGC A;  5KL4 A;  4ZYH A;  1A1H A;  2D9H A;  3DJW A;  2EJ4 A;  3HTM A;  2EM8 A;  3AV0 A;  2YTI A;  4R2A A;  4CRH A;  3LUT B;  2FGG A;  5KL6 A;  2F8B A;  2LTR A;  3GA1 A;  1EOD A;  2L33 A;  2EMZ A;  3JU0 A;  2EML A;  2YWQ A;  3C6K A;  4WSP A;  2FNJ C;  2P1P A;  4LTY A;  1GZ6 A;  1SR9 A;  4W9I B;  4HEI A;  4BC9 A;  4WSG A;  1B69 A;  4RH8 A;  5LMU E;  3BID A;  1LLM C;  3K6Q A;  2JOX A;  1BBO A;  1YYO A;  4DR2 E;  4R03 A;  4DV4 E;  2LJU A;  3C6M A;  4ZYG A;  2RQL A;  2I9I A;  1P47 A;  2HJJ A;  2YTD A;  3THN A;  1A1F A;  2YRM A;  3OGL A;  2YU5 A;  3F6H A;  1UBD C;  2E32 B;  2NN2 A;  5A15 A;  1TN9 A;  2VF1 A;  4OX9 E;  2EM7 A;  2EN4 A;  2YSP A;  4BKS B;  2KHX A;  1X6F A;  4RHB B;  2I2R A;  2MDR A;  3L00 A;  1IBM E;  3VHT B;  1SFE A;  1LQB B;  2EOY A;  2LMZ A;  1MGT A;  2YTG A;  1EKZ A;  4DUY E;  3KVT A;  4DR5 E;  1PJS A;  3HU6 A;  2DSY A;  2ODR D;  2GLI A;  1FS2 B;  4W9L B;  3M5B A;  2EPN A;  1NEX A;  2LVH A;  1J5E E;  3C4B A;  4YHH E;  4WYQ B;  2Z8H A;  3BGH A;  2UXB E;  4P7D A;  4LF8 E;  2EOM A;  2VPK A;  3THO B;  4ZYE A;  5LL6 R;  1ZR9 A;  4OOG C;  2ASS A;  2LCE A;  3J7Y p;  1XNR E;  4APF A;  4X65 E;  1PJQ A;  2LT7 A;  1ZBQ A;  3OML A;  4DV1 E;  4BS9 A;  1BBG A;  4WPY A;  2EMX A;  1EOF A;  3HVE B;  2DRP A;  2IZV C;  5AC5 A;  2EOZ A;  2FV4 B;  2K7I A;  5LLQ A;  4L5N C;  2EN1 A;  4NXN E;  4B9K E;  2EOQ A;  3FIG A;  4F6M A;  4B3T E;  1UHZ A;  1PDA A;  2WZO A;  1HNW E;  4JGH C;  4AP2 A;  5AAS A;  1X6E A;  4HTG A;  4LFC E;  3OHU A;  2H36 X;  4M0V A;  5BXB A;  4DR4 E;  2V86 A;  5A6J A;  1O0W A;  2IHC A;  4LFA E;  2NZ0 B;  2RS7 A;  5TSE A;  1IMU A;  1F2I G;  2YTP A;  3EQ1 A;  2N3H A;  2JP9 A;  1YUJ A;  5T6J A;  2JWO A;  2V85 A;  4LF9 E;  4B95 B;  3MSW A;  4BCA A;  4BGC A;  5BR8 E;  5IXM B;  4CP3 A;  1A1G A;  3ADJ A;  1ZU1 A;  4F9B B;  2LE2 A;  4R2D A;  4R2P A;  3HVE A;  1TF3 A;  4LFB E;  1ZBT A;  1CS3 A;  4W9D B;  2EP3 A;  1NCS A;  2EPU A;  2DIX A;  1S1G A;  2BB8 A;  4LF4 E;  4R2C A;  4M30 A;  3T1Y E;  1PKP A;  2L6M A;  2GPI A;  1A1L A;  2YTQ A;  2EN2 A;  2HGH A;  2P1N A;  4X62 E;  2Q8U A;  4BKT B;  3L2O A;  3ZUN B;  2LTS A;  4WX9 A;  1EXB E;  2LUQ A;  2JXP A;  4FK5 C;  1N33 E;  5IWA E;  1EOE A;  2RS6 A;  4BBY A;  1T39 A;  2EOH A;  2E31 B;  1RMD A;  2EOS A;  2MC6 A;  1XNQ E;  3HQ1 A;  4YY3 E;  3LNM B;  1YFH A;  2EOJ A;  2F4V E;  3DF6 A;  4JI2 E;  3M99 B;  5FTA A;  3OGK A;  2L3J A;  4JTA B;  3OTO E;  2OVP A;  2FTX B;  1P22 B; 
#chains in the Genus database with same CATH homology
 4W9F B;  2L8T A;  2LRS A;  1R29 A;  4Q28 A;  2L2K B;  4U2N A;  2B9D A;  1RQ0 A;  3ZRF B;  2JR1 A;  2L2N A;  2M1S A;  4U77 A;  3HTX A;  4JI3 E;  2NUE A;  3ADL A;  5A6R A;  1STU A;  2E1M A;  4TUG A;  2VE7 C;  1N34 E;  3ZRC B;  4W9J B;  4AQY E;  2LUP B;  4GEQ B;  2PPI A;  2IHR 1;  4LU9 A;  3F6G A;  4W9K B;  4CXJ A;  2HHH E;  5JH5 B;  4GKK E;  4F54 A;  1DI2 A;  1WHN A;  4KHP E;  3M52 A;  2JY9 A;  3C4T A;  1IBL E;  2JOB A;  5HZG C;  1NN7 A;  2LJH A;  2ZM6 E;  4JI6 E;  1A68 A;  4X66 E;  2C9W C;  4JI7 E;  4BMJ A;  1N32 E;  4L8N A;  4J8Z A;  4F9C B;  4DKK A;  2UU9 E;  4DV0 E;  4JI5 E;  1YYW A;  4I6J C;  4W9G B;  4CXI A;  2V89 A;  2RTX A;  4WFT A;  2JVA A;  4F9A B;  1X49 A;  4K0K E;  1YZ9 A;  3B84 A;  2KON A;  2NA2 A;  1XMO E;  2E5L E;  1LDK D;  2YT4 A;  1FQV B;  4HXI A;  1HNZ E;  2IF5 A;  4JI4 E;  1WXR A;  1HV2 A;  2N3G A;  4LF5 E;  5H7G A;  3ZTC B;  3M8V A;  2AST A;  3HPZ A;  3P1X A;  2B7V A;  2P1O A;  2NUF A;  3HXL A;  2V83 A;  2VKP A;  5IT9 C;  2M4I A;  1QDV A;  5AE1 A;  3RMP A;  4JTC B;  3IWB A;  2G7H A;  1FS1 B;  1I94 E;  5AE2 A;  4B3M E;  3FKC A;  4JI8 E;  5DAD A;  1T4L B;  2Q81 A;  1R28 A;  1HNX E;  4JI1 E;  4DV7 E;  3JTZ A;  1IBK E;  4UYI A;  5LMN E;  2L2M A;  2MA9 C;  3VYX A;  2V8Q B;  2P1M A;  2UXD E;  3ZNG B;  5EUP A;  5ADZ A;  5BXH A;  4X64 E;  1GQE A;  4DV2 E;  4N9F 5;  3JAM C;  4M2Z A;  4DR7 E;  3C6N A;  2K4V A;  1BUO A;  5F3W A;  2UUC E;  2YY9 A;  2ODR C;  3ZKJ B;  2UUA E;  3ZTD B;  5HYW B;  5FLX C;  3AUZ A;  2LBS B;  4AWJ B;  3IWC A;  1UIL A;  4JYA E;  2JZ3 C;  4W9C B;  4GKJ E;  2RSM A;  5AE3 A;  5DAF A;  4JI0 E;  1FJG E;  2OVQ A;  4WQO C;  3WSO B;  5A2Q C;  4DR3 E;  1LM8 C;  2EWL A;  2R9R B;  4JTD B;  1R2B A;  2L92 A;  1RC7 A;  4DUZ E;  2OVR A;  2M7Q A;  3OGM A;  4LF7 E;  5BO4 C;  4UIJ A;  3DRY A;  3KWR A;  2A79 B;  3V7D A;  2DMY A;  3BIM A;  2V87 A;  1QDW A;  4TUI A;  1DQ3 A;  4JV5 E;  2B3T B;  3ADI A;  3HPS A;  1HR0 E;  2V88 A;  4B3R E;  5IBK A;  2UXC E;  3T1H E;  4X8W A;  1VCB B;  3H09 A;  5CFF E;  4DV3 E;  4W9H B;  4DMI A;  3DRZ A;  2CPN A;  4R8O A;  3HQI A;  4W9E B;  3J80 C;  1QU6 A;  2UUB E;  4DV5 E;  2MC5 A;  4LF6 E;  4ZOU A;  1YYK A;  3VYY A;  1J26 A;  1WHQ A;  4W9H H;  3ZOQ B;  4B9K B;  5H7H A;  3MKS A;  3OHV A;  1X47 A;  4BC7 A;  4P78 A;  4DV6 E;  4NXM E;  1DSX A;  1FKA E;  3LML A;  3DRX A;  1T4O A;  3LBZ A;  5DNY A;  5BXD A;  2KOU A;  3M4T A;  4I8O A;  2B7T A;  1T4N A;  3J81 C;  3C6P A;  2EZ6 A;  5LLI B;  1T1D A;  3I3N A;  3C6O A;  4B3S E;  4YY8 A;  2VQE E;  4DR1 E;  2NUG A;  2P1Q A;  1N36 E;  3DCG B;  3E4U A;  4AJY C;  2L3C A;  4EOZ A;  4KZS A;  3LLH A;  2DB2 A;  4U2M A;  2YZT A;  3IWD A;  3J7A G;  3VK6 A;  4ZGC A;  2VQF E;  4DR6 E;  4CXT A;  1XMQ E;  1X48 A;  3ADG A;  3DJW A;  3HTM A;  3AV0 A;  4CRH A;  3LUT B;  2FGG A;  2F8B A;  2LTR A;  3GA1 A;  1EOD A;  2L33 A;  3JU0 A;  4W9I B;  4WSP A;  2FNJ C;  2P1P A;  4LTY A;  1SR9 A;  1GZ6 A;  4BC9 A;  5LMU E;  3K6Q A;  2JOX A;  1YYO A;  4DR2 E;  4R03 A;  4DV4 E;  3OGL A;  3F6H A;  5A15 A;  2E32 B;  2NN2 A;  2VF1 A;  4OX9 E;  4BKS B;  2KHX A;  2I2R A;  2MDR A;  1IBM E;  1LQB B;  2LMZ A;  1EKZ A;  4DUY E;  3KVT A;  4DR5 E;  3HU6 A;  2DSY A;  2ODR D;  1FS2 B;  4W9L B;  3M5B A;  1NEX A;  1J5E E;  3C4B A;  4YHH E;  4WYQ B;  2Z8H A;  2UXB E;  4P7D A;  4LF8 E;  2VPK A;  5LL6 R;  4OOG C;  2ASS A;  3J7Y p;  1XNR E;  4APF A;  4X65 E;  1ZBQ A;  3OML A;  4DV1 E;  4BS9 A;  4WPY A;  1EOF A;  3HVE B;  2IZV C;  2FV4 B;  4L5N C;  4NXN E;  4B9K E;  3FIG A;  4B3T E;  1UHZ A;  2WZO A;  1HNW E;  4JGH C;  4AP2 A;  5AAS A;  4LFC E;  3OHU A;  5BXB A;  2H36 X;  4M0V A;  4DR4 E;  2V86 A;  1O0W A;  2IHC A;  4LFA E;  2NZ0 B;  2RS7 A;  2N3H A;  5T6J A;  2JWO A;  2V85 A;  4LF9 E;  4B95 B;  3MSW A;  4BCA A;  4BGC A;  5BR8 E;  4CP3 A;  3ADJ A;  4F9B B;  2LE2 A;  3HVE A;  4LFB E;  1ZBT A;  1CS3 A;  4W9D B;  2DIX A;  1S1G A;  4LF4 E;  4M30 A;  3T1Y E;  1PKP A;  2L6M A;  2P1N A;  4X62 E;  4BKT B;  3L2O A;  3ZUN B;  2LTS A;  1EXB E;  2LUQ A;  1N33 E;  1EOE A;  5IWA E;  2RS6 A;  4BBY A;  2E31 B;  2MC6 A;  1XNQ E;  3HQ1 A;  4YY3 E;  3LNM B;  2F4V E;  3DF6 A;  4JI2 E;  5FTA A;  3OGK A;  2L3J A;  4JTA B;  3OTO E;  2OVP A;  2FTX B;  1P22 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...