4J8ZA

Crystal structure of the human spop btb domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
b'MVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAERSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Speckle-type POZ protein
publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.700 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4j8zA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 4j8zA01
2FNJC 4B9KE 5IBKA 4W9GB 5BO4C 5LLIB 3OHUA 3M52A 4U77A 4W9HB 1FS1B 3HVEB 2IF5A 4W9LB 3HQIA 1EOFA 4CXJA 1BUOA 3FKCA 3OGLA 2VKPA 4JTAB 3HVEA 2P1QA 3M5BA 1CS3A 2VPKA 3L2OA 4CXIA 2IZVC 2OVRA 1LDKD 1QDVA 5HYWB 2Q81A 3HU6A 3WSOB 1EODA 4W9KB 4W9EB 3OHVA 4W9JB 1EOEA 3C6OA 2P1MA 4BKSB 2ASSA 1DSXA 3ZRCB 4W9DB 1LM8C 3DRZA 2NN2A 1NN7A 4JTCB 1A68A 4APFA 2P1PA 3ZNGB 3ZTCB 4U2NA 4CXTA 2P1NA 1T1DA 3LUTB 5H7HA 5A15A 4UYIA 3LNMB 3E4UA 5FTAA 2JZ3C 3I3NA 4U2MA 1FS2B 2E32B 4I6JC 2C9WC 3BIMA 3OGMA 1R29A 2A79B 4N9F5 3ZRFB 4AP2A 2R9RB 2IHCA 3B84A 4JTDB 4J8ZA 2NZ0B 4CP3A 4AWJB 2E31B 3C6NA 1HV2A 1QDWA 2I2RA 2OVQA 2YY9A 4BKTB 1VCBB 5H7GA 4WQOC 3HTMA 2P1OA 5DAFA 5A6RA 3M4TA 4AJYC 3MKSA 2PPIA 3KVTA 1FQVB 5BXHA 4ZOUA 4W9IB 3ZUNB 4CRHA 1S1GA 5EUPA 4EOZA 4W9FB 3OGKA 1P22B 1NEXA 1LQBB 3ZTDB 4JGHC 4W9CB 3GA1A 4B9KB 5JH5B 2Z8HA 1EXBE 4BGCA 5HZGC 3M8VA 1R2BA 3V7DA 3LBZA 1R28A 5BXDA 3C6PA 3DCGB 2MA9C 5BXBA 3ZKJB 4UIJA 5DADA 2ASTA 4W9HH 2OVPA 4HXIA 4B95B
chains in the Genus database with same CATH superfamily
3H09A 4O4KA 2L2NA 2YRHA 2ELZA 2M4IA 2YU8A 1QU6A 2CT1A 4FK5C 5AE2A 2EOQA 1TN9A 2RS7A 1PJSA 2EPAA 4WSPA 3EQ1A 2Q8UA 4R2PA 1X49A 5IV8B 4LF4E 2VKPA 3HVEA 2NA2A 1YUIA 1F2IG 2EP3A 1J26A 1ZAAC 2L33A 2EMIA 2MC5A 1WXRA 5KL5A 1QDVA 4BCAA 3HU6A 4BS9A 5KL4A 1EODA 2EOHA 2CTDA 2DSYA 2EPUA 1DSXA 3EPLA 2EOFA 3VHTB 4DR5E 4IS1C 2EPZA 2EM0A 4LFCE 1GQEA 2DIXA 4DR1E 1XMOE 1HNZE 4LTYA 1A68A 4APFA 2UXBE 1BB8A 4R2RA 1Z1BA 1T39A 5AC4A 4JI2E 4X66E 2RPCA 2YSPA 2YTFA 4F9AB 2JOXA 2MC6A 2DB2A 4DR2E 5FTAA 2EOEA 3I3NA 4U2MA 2RQLA 3K6QA 2RS6A 4BMJA 1BBOA 2E32B 5BR8E 4I6JC 2YTOA 2A25A 3LLHA 5A69A 3EPKA 1RC7A 1AH5A 2IHCA 2R9RB 3KZYA 3P1XA 1EKZA 4CP3A 3HQ1A 3J7Yp 2B7TA 2MKNA 2BBGA 5F3WA 4JI8E 4R2DA 2EOOA 1XNQE 1NCSA 2HJJA 2N3GA 3ADLA 3J80C 2LRSA 2V85A 1VCBB 2M7QA 4DUZE 1T4LB 5H7GA 1BBGA 4L8NA 2P1OA 4HEIA 5A6RA 2FV4B 3OTOE 4AJYC 2EQ1A 1X5WA 4O24A 2EL6A 3MKSA 4N4RB 4OOGC 4JV5E 1PKPA 3C4BA 4ZGCA 3C6MA 1WHQA 2EOYA 2L6MA 2N8XA 1XMQE 2YRKA 2E1MA 1J5EE 4W9IB 2ADRA 4ZOUA 1L4SA 2EM9A 4GZNC 4W9FB 1ZBTA 2LVHA 4B9KB 2GHFA 1EXBE 1ZR9A 4BGCA 2K4VA 4X8WA 3V7DA 2LO3A 3LBZA 3C6PA 2EOSA 4JI3E 4K0KE 1KYQA 2PRTA 3BF2A 4UIJA 2VQFE 2UXCE 4W9HH 2EPLX 2EPNA 2DGCA 4W9GB 4OX9E 2N3HA 2EN7A 2UUCE 3M52A 5LMUE 2ODRC 2IF5A 1FJGE 1PJQA 4CXJA 2V83A 1BUOA 3OGLA 3KWRA 5A6AA 4F2JC 1DI2A 2EMCA 3IWBA 3J81C 4P78A 1CS3A 4DMIA 2I9IA 3ADIA 3L2OA 4CXIA 3F6HA 2VQEE 2IZVC 1A1IA 2OVRA 5KL6A 3JTZA 2EMHA 2ELYA 2EWLA 1T4NA 2EOJA 3IWCA 3WSOB 1YYOA 4WSGA 4W9EB 3OHVA 2L8TA 2ENAA 2NN2A 1X3CA 1MGTA 2LE2A 2JPAA 3BBGA 4JI0E 4U2NA 4CXTA 1GZ6A 2LJHA 1I94E 4DV0E 3LUTB 5A15A 2KOUA 2LTRA 4ZYDA 2B9DA 4UYIA 2L92A 5KL7A 2JY9A 5AE1A 3LNMB 2VRDA 3DF6A 1TF6A 4DR7E 4DV2E 4WPYA 4WX9A 2B7VA 4DV6E 1DQ3A 2JXPA 2LUPB 2C9WC 3OGMA 1R29A 2A79B 5IWAE 5A2QC 1YYWA 3DRXA 5LL6R 5AE3A 2YU5A 2M9AA 2GLIA 1N36E 4WYQB 3C6NA 1N32E 4HTGA 1T4OA 1A1JA 2YY9A 1B69A 2EM4A 4B3SE 4GKKE 1G2DC 4WQOC 2HC5A 4Q35B 4F6MA 1SFEA 1EH7A 4DV1E 2EPRA 2B3TB 4NHRA 3VYXA 5LLQA 2EMAA 2L3CA 4R2SA 2PPIA 4LFAE 3EPHA 3BGHA 1FQVB 3KVTA 1QNTA 2LV2A 4I8OA 4DV3E 1A1LA 4CRHA 1SR9A 2CSHA 2JWOA 1LQBB 1X47A 1IQOA 1NEXA 1P22B 2M1SA 4W9CB 2UUBE 5HZGC 2LT7A 4KZSA 3DCGB 2RSIA 5BXBA 3MHSC 2I13A 5AASA 5KL2A 2LTSA 3UK3C 4F54A 4M2ZA 4MLQA 4B3TE 3TQMA 1ZU1A 2DRPA 2E72A 4JI1E 3M99B 5IBKA 3ZOQB 2EN4A 5LLIB 3OHUA 2WCC3 3ADGA 3RMPA 2EQ0A 4JI4E 4U77A 2DMYA 4W9HB 1FS1B 1WJPA 3HVEB 2EORA 2FTXB 2BB8A 3HQIA 2L3JA 4YHHE 4JTAB 1IBME 2P1QA 2F8BA 4TUGA 2E5LE 4KHPE 2EMBA 2YTJA 5A6BD 2YPNA 4DR3E 5HYWB 2Q81A 2NABA 3MHHC 4W9JB 4BHBA 4DKKA 3C6OA 4NXNE 2P1MA 4BKSB 2ASSA 3ZRCB 4KWYA 2YTEA 3DRZA 1T38A 1HR0E 5LMNE 3ZNGB 1DGCA 3ZTCB 2YZTA 3THOB 2UU9E 3JU0A 1T1DA 4AQYE 3L00A 3BIDA 2WBTA 1LLMC 4JI7E 1A1FA 2D9HA 1RMDA 4BBYA 2ZM6E 4LF9E 2JZ3C 1EH8A 4YY3E 4LF8E 1N33E 4BHCA 4F9BB 1WRJA 1YZ9A 4TUIA 4F6NA 2V88A 3ADJA 4GKJE 4N9F5 3ZRFB 4M0VA 4J8ZA 2NZ0B 4AWJB 2E31B 3DJWA 3C6KA 4ZYHA 2EMZA 1GTKA 3VYYA 2JP9A 2OVQA 3DRYA 2EL5A 4WXCA 2EE8A 1YFHA 2NUGA 4WFTA 2EMLA 2FGGA 5CFFE 1ZBQA 3KZZA 3OMLA 2EJ4A 1HNWE 4IJDA 1A1KA 1P47A 4WXDA 2K7IA 2EN8A 2YTQA 5A6KA 3ECRA 2VE7C 1G2FC 3EPJA 5KL3A 5BXHA 2JOBA 4R8OA 4LF6E 4LFBE 4R2QA 4JYAE 4DR6E 3HXLA 4LU9A 2EOIA 2V89A 5ADZA 1KJKA 1S1GA 5EUPA 2UUAE 2EPPA 3HPZA 3OGKA 1YPNA 4JGHC 1TF3A 5JH5B 4BC9A 5IT9C 2HHHE 1UBDC 3M8VA 2YRMA 3J7AG 2EN1A 4L5NC 2NUFA 4GEQB 1N3GA 4DUYE 1O0WA 2DLQA 2LMZA 2YT4A 4X62E 4NXME 2LJUA 2MA9C 3ZKJB 2EOZA 2EPOA 2YSOA 2R1FA 5A6JA 2HGHA 1RQ0A 5DADA 4YY8A 2MKDA 4M9VC 4X64E 2OVPA 5DNYA 4ZYGA 2YWQA 5IXMB 1XNRE 4RH8A 4ZYEA 2EMWA 2NUEA 2EM2A 2FNJC 4B9KE 4LF7E 4MLVA 2JYAA 4R2AA 5BO4C 1FKAE 2MDRA 5A6BA 2L2KB 4Q28A 2IHR1 1A1GA 2EN2A 2EM8A 2EOMA 1N34E 4W9LB 3T1HE 2EPMX 5AC5A 2V87A 1X6EA 1EOFA 2EM6A 3FKCA 2YTPA 4R2EA 3M5BA 2EMYA 2EMFA 3IWDA 2VPKA 1UHZA 1NEIA 1LDKD 2EQ3A 2DMIA 4B3RE 4W9KB 1EOEA 2EL4A 2V86A 2ENHA 2EN6A 3C4TA 2RTXA 2LCEA 3QG5C 2VF1A 4RHBB 2ODRD 1LM8C 4W9DB 5FLXC 1NN7A 4LF5E 4O43A 1IBLE 1A1HA 4JTCB 2P1PA 2EM5A 2EM7A 4JI6E 2EOXA 2P1NA 1JK1A 2H36X 4JI5E 5H7HA 4BC7A 2YTIA 3E4UA 4X9JA 1YYKA 1PDAA 1X6FA 4P7DA 2EPCA 2MDGA 1FS2B 1X48A 4NZVA 5T6JA 1IQSA 3HPSA 3BIMA 4X65E 1YUJA 2EPXA 2L2MA 2G7HA 4AP2A 1MEYC 3B84A 4JTDB 2JR1A 2YTGA 1EH6A 3MSWA 4F9CB 1AAYA 2EM3A 2J7JA 2LUQA 4R03A 1HV2A 2KHXA 1QDWA 2I2RA 2F4VE 2EPKX 4BKTB 2WBUA 3HTMA 4M30A 3LMLA 5DAFA 3M4TA 2LBSB 3AUZA 1PJTA 2YTNA 1UN6B 2CPNA 3ZUNB 3F6GA 2EZ6A 4DV4E 3T1YE 2ENCA 3THNA 2YTDA 1X6HA 2RSMA 4EOZA 3FIGA 1YSAC 3ZTDB 2GPIA 4DV5E 3GA1A 2V8QB 5TSEA 1STUA 4DV7E 1JK2A 1IBKE 4DR4E 2EMKA 2KONA 2Z8HA 2WZOA 1R2BA 3AV0A 2EMXA 2DLKA 1R28A 5BXDA 4R2CA 2R76A 2JVAA 2WBSA 1HNXE 1IMUA 1UILA 1WHNA 3HTXA 2ASTA 2UXDE 3VK6A 4O5GA 4HXIA 4B3ME 4B95B 3JAMC 2EN3A 2EMGA
chains in the Genus database with same CATH topology
3H09A 2L2NA 2M4IA 1QU6A 5AE2A 2RS7A 4WSPA 1X49A 4LF4E 2VKPA 3HVEA 2NA2A 1J26A 2L33A 2MC5A 1WXRA 1QDVA 4BCAA 3HU6A 4BS9A 1EODA 2DSYA 1DSXA 4DR5E 1A68A 4LFCE 1GQEA 2DIXA 4DR1E 1XMOE 1HNZE 4LTYA 4APFA 2UXBE 4JI2E 4X66E 4F9AB 2JOXA 2MC6A 2DB2A 4DR2E 5FTAA 3I3NA 4U2MA 3K6QA 2RS6A 4BMJA 2E32B 5BR8E 4I6JC 3LLHA 1RC7A 2R9RB 2IHCA 3P1XA 1EKZA 4CP3A 3HQ1A 3J7Yp 2B7TA 5F3WA 4JI8E 1XNQE 2N3GA 3ADLA 3J80C 2LRSA 2V85A 1VCBB 2M7QA 4DUZE 1T4LB 5H7GA 4L8NA 2P1OA 5A6RA 2FV4B 3OTOE 4AJYC 3MKSA 4OOGC 4JV5E 1PKPA 3C4BA 4ZGCA 1WHQA 2L6MA 1XMQE 4ZOUA 4W9IB 1J5EE 2E1MA 4W9FB 1ZBTA 4B9KB 1EXBE 4BGCA 2K4VA 4X8WA 3V7DA 3LBZA 3C6PA 4JI3E 4K0KE 4UIJA 2VQFE 2UXCE 4W9HH 4W9GB 4OX9E 2N3HA 2UUCE 3M52A 5LMUE 2ODRC 2IF5A 1FJGE 4CXJA 2V83A 1BUOA 3OGLA 3KWRA 1DI2A 3IWBA 3J81C 4P78A 1CS3A 4DMIA 3ADIA 3L2OA 4CXIA 3F6HA 2VQEE 2IZVC 2OVRA 3JTZA 2EWLA 1T4NA 3IWCA 3WSOB 1YYOA 4W9EB 3OHVA 2L8TA 2NN2A 2LE2A 4JI0E 4U2NA 4CXTA 1GZ6A 2LJHA 1I94E 4DV0E 3LUTB 5A15A 2KOUA 2LTRA 2B9DA 4UYIA 2L92A 2JY9A 5AE1A 3LNMB 3DF6A 4DR7E 4DV2E 4WPYA 2B7VA 4DV6E 1DQ3A 2LUPB 2C9WC 3OGMA 1R29A 2A79B 5IWAE 5A2QC 1YYWA 3DRXA 5LL6R 5AE3A 1N36E 4WYQB 3C6NA 1N32E 1T4OA 2YY9A 4B3SE 4GKKE 4WQOC 4DV1E 2B3TB 3VYXA 2L3CA 2PPIA 4LFAE 3KVTA 1FQVB 4I8OA 4DV3E 4CRHA 1SR9A 2JWOA 1LQBB 1X47A 1NEXA 1P22B 2M1SA 4W9CB 2UUBE 5HZGC 4KZSA 3DCGB 5BXBA 5AASA 2LTSA 4F54A 4M2ZA 4B3TE 4JI1E 5IBKA 3ZOQB 5LLIB 3OHUA 3ADGA 3RMPA 4JI4E 4U77A 2DMYA 4W9HB 1FS1B 3HVEB 2FTXB 3HQIA 2L3JA 4YHHE 4JTAB 1IBME 2P1QA 2F8BA 4TUGA 2E5LE 3JAMC 4KHPE 4DR3E 5HYWB 2Q81A 4W9JB 4DKKA 3C6OA 4NXNE 2P1MA 4BKSB 2ASSA 3ZRCB 3DRZA 1HR0E 5LMNE 3ZNGB 3ZTCB 2YZTA 2UU9E 3JU0A 1T1DA 4AQYE 4JI7E 4BBYA 2ZM6E 4LF9E 2JZ3C 4YY3E 4LF8E 1N33E 4F9BB 1YZ9A 4TUIA 2V88A 3ADJA 4GKJE 4N9F5 3ZRFB 4M0VA 4J8ZA 2NZ0B 4AWJB 2E31B 3DJWA 3VYYA 2OVQA 3DRYA 2NUGA 4WFTA 5CFFE 2FGGA 1HNWE 1ZBQA 3OMLA 2VE7C 5BXHA 2JOBA 4R8OA 4LF6E 4LFBE 4JYAE 4DR6E 3HXLA 4LU9A 5ADZA 2V89A 1S1GA 5EUPA 2UUAE 3HPZA 3OGKA 4JGHC 5JH5B 4BC9A 5IT9C 2HHHE 3M8VA 3J7AG 4L5NC 2NUFA 4GEQB 4DUYE 1O0WA 2LMZA 2YT4A 4X62E 4NXME 2MA9C 3ZKJB 5DADA 1RQ0A 4YY8A 4X64E 2OVPA 5DNYA 1XNRE 2FNJC 2NUEA 4B9KE 4LF7E 5BO4C 1FKAE 2MDRA 2L2KB 4Q28A 2IHR1 1N34E 4W9LB 3T1HE 1EOFA 2V87A 3FKCA 3M5BA 3IWDA 2VPKA 1UHZA 1LDKD 4B3RE 4W9KB 1EOEA 2V86A 3C4TA 2RTXA 2VF1A 2ODRD 1LM8C 4W9DB 1NN7A 4LF5E 4JTCB 1IBLE 2P1PA 4JI6E 2P1NA 2H36X 4JI5E 5H7HA 4BC7A 3E4UA 1YYKA 4P7DA 1FS2B 1X48A 5T6JA 3HPSA 3BIMA 4X65E 2L2MA 2G7HA 4AP2A 3B84A 4JTDB 2JR1A 4F9CB 3MSWA 2LUQA 4R03A 1HV2A 2KHXA 1QDWA 2I2RA 2F4VE 4BKTB 3HTMA 4M30A 3LMLA 5DAFA 3M4TA 2LBSB 3AUZA 2CPNA 3ZUNB 3F6GA 2EZ6A 4DV4E 3T1YE 2RSMA 4EOZA 3FIGA 3ZTDB 4DV5E 3GA1A 2V8QB 1STUA 4DV7E 1IBKE 4DR4E 2KONA 2Z8HA 2WZOA 1R2BA 3AV0A 1R28A 5BXDA 2JVAA 1HNXE 1UILA 1WHNA 3HTXA 2ASTA 2UXDE 3VK6A 4HXIA 4B3ME 4B95B 5FLXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNJ C;  4B9K E;  5IBK A;  4W9G B;  5BO4 C;  5LLI B;  3OHU A;  3M52 A;  4U77 A;  4W9H B;  1FS1 B;  3HVE B;  2IF5 A;  4W9L B;  3HQI A;  1EOF A;  4CXJ A;  1BUO A;  3FKC A;  3OGL A;  2VKP A;  4JTA B;  3HVE A;  2P1Q A;  3M5B A;  1CS3 A;  2VPK A;  3L2O A;  4CXI A;  2IZV C;  2OVR A;  1LDK D;  1QDV A;  5HYW B;  2Q81 A;  3HU6 A;  3WSO B;  1EOD A;  4W9K B;  4W9E B;  3OHV A;  4W9J B;  1EOE A;  3C6O A;  2P1M A;  4BKS B;  2ASS A;  1DSX A;  3ZRC B;  4W9D B;  1LM8 C;  3DRZ A;  2NN2 A;  1NN7 A;  4JTC B;  1A68 A;  4APF A;  2P1P A;  3ZNG B;  3ZTC B;  4U2N A;  4CXT A;  2P1N A;  1T1D A;  3LUT B;  5H7H A;  5A15 A;  4UYI A;  3LNM B;  3E4U A;  5FTA A;  2JZ3 C;  3I3N A;  4U2M A;  1FS2 B;  2E32 B;  4I6J C;  2C9W C;  3BIM A;  3OGM A;  1R29 A;  2A79 B;  4N9F 5;  3ZRF B;  4AP2 A;  2R9R B;  2IHC A;  3B84 A;  4JTD B;  4J8Z A;  2NZ0 B;  4CP3 A;  4AWJ B;  2E31 B;  3C6N A;  1HV2 A;  1QDW A;  2I2R A;  2OVQ A;  2YY9 A;  4BKT B;  1VCB B;  5H7G A;  4WQO C;  3HTM A;  2P1O A;  5DAF A;  5A6R A;  3M4T A;  4AJY C;  3MKS A;  2PPI A;  3KVT A;  1FQV B;  5BXH A;  4ZOU A;  4W9I B;  3ZUN B;  4CRH A;  1S1G A;  5EUP A;  4EOZ A;  4W9F B;  3OGK A;  1P22 B;  1NEX A;  1LQB B;  3ZTD B;  4JGH C;  4W9C B;  3GA1 A;  4B9K B;  5JH5 B;  2Z8H A;  1EXB E;  4BGC A;  5HZG C;  3M8V A;  1R2B A;  3V7D A;  3LBZ A;  1R28 A;  5BXD A;  3C6P A;  3DCG B;  2MA9 C;  5BXB A;  3ZKJ B;  4UIJ A;  5DAD A;  2AST A;  4W9H H;  2OVP A;  4HXI A;  4B95 B; 
#chains in the Genus database with same CATH topology
 3H09 A;  4O4K A;  2L2N A;  2YRH A;  2ELZ A;  2M4I A;  2YU8 A;  1QU6 A;  2CT1 A;  4FK5 C;  5AE2 A;  2EOQ A;  1TN9 A;  2RS7 A;  1PJS A;  2EPA A;  4WSP A;  3EQ1 A;  2Q8U A;  4R2P A;  1X49 A;  5IV8 B;  4LF4 E;  2VKP A;  3HVE A;  2NA2 A;  1YUI A;  1F2I G;  2EP3 A;  1J26 A;  1ZAA C;  2L33 A;  2EMI A;  2MC5 A;  1WXR A;  5KL5 A;  1QDV A;  4BCA A;  3HU6 A;  4BS9 A;  5KL4 A;  1EOD A;  2EOH A;  2CTD A;  2DSY A;  2EPU A;  1DSX A;  3EPL A;  2EOF A;  3VHT B;  4DR5 E;  4IS1 C;  2EPZ A;  2EM0 A;  4LFC E;  1GQE A;  2DIX A;  4DR1 E;  1XMO E;  1HNZ E;  4LTY A;  1A68 A;  4APF A;  2UXB E;  1BB8 A;  4R2R A;  1Z1B A;  1T39 A;  5AC4 A;  4JI2 E;  4X66 E;  2RPC A;  2YSP A;  2YTF A;  4F9A B;  2JOX A;  2MC6 A;  2DB2 A;  4DR2 E;  5FTA A;  2EOE A;  3I3N A;  4U2M A;  2RQL A;  3K6Q A;  2RS6 A;  4BMJ A;  1BBO A;  2E32 B;  5BR8 E;  4I6J C;  2YTO A;  2A25 A;  3LLH A;  5A69 A;  3EPK A;  1RC7 A;  1AH5 A;  2IHC A;  2R9R B;  3KZY A;  3P1X A;  1EKZ A;  4CP3 A;  3HQ1 A;  3J7Y p;  2B7T A;  2MKN A;  2BBG A;  5F3W A;  4JI8 E;  4R2D A;  2EOO A;  1XNQ E;  1NCS A;  2HJJ A;  2N3G A;  3ADL A;  3J80 C;  2LRS A;  2V85 A;  1VCB B;  2M7Q A;  4DUZ E;  1T4L B;  5H7G A;  1BBG A;  4L8N A;  2P1O A;  4HEI A;  5A6R A;  2FV4 B;  3OTO E;  4AJY C;  2EQ1 A;  1X5W A;  4O24 A;  2EL6 A;  3MKS A;  4N4R B;  4OOG C;  4JV5 E;  1PKP A;  3C4B A;  4ZGC A;  3C6M A;  1WHQ A;  2EOY A;  2L6M A;  2N8X A;  1XMQ E;  2YRK A;  2E1M A;  1J5E E;  4W9I B;  2ADR A;  4ZOU A;  1L4S A;  2EM9 A;  4GZN C;  4W9F B;  1ZBT A;  2LVH A;  4B9K B;  2GHF A;  1EXB E;  1ZR9 A;  4BGC A;  2K4V A;  4X8W A;  3V7D A;  2LO3 A;  3LBZ A;  3C6P A;  2EOS A;  4JI3 E;  4K0K E;  1KYQ A;  2PRT A;  3BF2 A;  4UIJ A;  2VQF E;  2UXC E;  4W9H H;  2EPL X;  2EPN A;  2DGC A;  4W9G B;  4OX9 E;  2N3H A;  2EN7 A;  2UUC E;  3M52 A;  5LMU E;  2ODR C;  2IF5 A;  1FJG E;  1PJQ A;  4CXJ A;  2V83 A;  1BUO A;  3OGL A;  3KWR A;  5A6A A;  4F2J C;  1DI2 A;  2EMC A;  3IWB A;  3J81 C;  4P78 A;  1CS3 A;  4DMI A;  2I9I A;  3ADI A;  3L2O A;  4CXI A;  3F6H A;  2VQE E;  2IZV C;  1A1I A;  2OVR A;  5KL6 A;  3JTZ A;  2EMH A;  2ELY A;  2EWL A;  1T4N A;  2EOJ A;  3IWC A;  3WSO B;  1YYO A;  4WSG A;  4W9E B;  3OHV A;  2L8T A;  2ENA A;  2NN2 A;  1X3C A;  1MGT A;  2LE2 A;  2JPA A;  3BBG A;  4JI0 E;  4U2N A;  4CXT A;  1GZ6 A;  2LJH A;  1I94 E;  4DV0 E;  3LUT B;  5A15 A;  2KOU A;  2LTR A;  4ZYD A;  2B9D A;  4UYI A;  2L92 A;  5KL7 A;  2JY9 A;  5AE1 A;  3LNM B;  2VRD A;  3DF6 A;  1TF6 A;  4DR7 E;  4DV2 E;  4WPY A;  4WX9 A;  2B7V A;  4DV6 E;  1DQ3 A;  2JXP A;  2LUP B;  2C9W C;  3OGM A;  1R29 A;  2A79 B;  5IWA E;  5A2Q C;  1YYW A;  3DRX A;  5LL6 R;  5AE3 A;  2YU5 A;  2M9A A;  2GLI A;  1N36 E;  4WYQ B;  3C6N A;  1N32 E;  4HTG A;  1T4O A;  1A1J A;  2YY9 A;  1B69 A;  2EM4 A;  4B3S E;  4GKK E;  1G2D C;  4WQO C;  2HC5 A;  4Q35 B;  4F6M A;  1SFE A;  1EH7 A;  4DV1 E;  2EPR A;  2B3T B;  4NHR A;  3VYX A;  5LLQ A;  2EMA A;  2L3C A;  4R2S A;  2PPI A;  4LFA E;  3EPH A;  3BGH A;  1FQV B;  3KVT A;  1QNT A;  2LV2 A;  4I8O A;  4DV3 E;  1A1L A;  4CRH A;  1SR9 A;  2CSH A;  2JWO A;  1LQB B;  1X47 A;  1IQO A;  1NEX A;  1P22 B;  2M1S A;  4W9C B;  2UUB E;  5HZG C;  2LT7 A;  4KZS A;  3DCG B;  2RSI A;  5BXB A;  3MHS C;  2I13 A;  5AAS A;  5KL2 A;  2LTS A;  3UK3 C;  4F54 A;  4M2Z A;  4MLQ A;  4B3T E;  3TQM A;  1ZU1 A;  2DRP A;  2E72 A;  4JI1 E;  3M99 B;  5IBK A;  3ZOQ B;  2EN4 A;  5LLI B;  3OHU A;  2WCC 3;  3ADG A;  3RMP A;  2EQ0 A;  4JI4 E;  4U77 A;  2DMY A;  4W9H B;  1FS1 B;  1WJP A;  3HVE B;  2EOR A;  2FTX B;  2BB8 A;  3HQI A;  2L3J A;  4YHH E;  4JTA B;  1IBM E;  2P1Q A;  2F8B A;  4TUG A;  2E5L E;  4KHP E;  2EMB A;  2YTJ A;  5A6B D;  2YPN A;  4DR3 E;  5HYW B;  2Q81 A;  2NAB A;  3MHH C;  4W9J B;  4BHB A;  4DKK A;  3C6O A;  4NXN E;  2P1M A;  4BKS B;  2ASS A;  3ZRC B;  4KWY A;  2YTE A;  3DRZ A;  1T38 A;  1HR0 E;  5LMN E;  3ZNG B;  1DGC A;  3ZTC B;  2YZT A;  3THO B;  2UU9 E;  3JU0 A;  1T1D A;  4AQY E;  3L00 A;  3BID A;  2WBT A;  1LLM C;  4JI7 E;  1A1F A;  2D9H A;  1RMD A;  4BBY A;  2ZM6 E;  4LF9 E;  2JZ3 C;  1EH8 A;  4YY3 E;  4LF8 E;  1N33 E;  4BHC A;  4F9B B;  1WRJ A;  1YZ9 A;  4TUI A;  4F6N A;  2V88 A;  3ADJ A;  4GKJ E;  4N9F 5;  3ZRF B;  4M0V A;  4J8Z A;  2NZ0 B;  4AWJ B;  2E31 B;  3DJW A;  3C6K A;  4ZYH A;  2EMZ A;  1GTK A;  3VYY A;  2JP9 A;  2OVQ A;  3DRY A;  2EL5 A;  4WXC A;  2EE8 A;  1YFH A;  2NUG A;  4WFT A;  2EML A;  2FGG A;  5CFF E;  1ZBQ A;  3KZZ A;  3OML A;  2EJ4 A;  1HNW E;  4IJD A;  1A1K A;  1P47 A;  4WXD A;  2K7I A;  2EN8 A;  2YTQ A;  5A6K A;  3ECR A;  2VE7 C;  1G2F C;  3EPJ A;  5KL3 A;  5BXH A;  2JOB A;  4R8O A;  4LF6 E;  4LFB E;  4R2Q A;  4JYA E;  4DR6 E;  3HXL A;  4LU9 A;  2EOI A;  2V89 A;  5ADZ A;  1KJK A;  1S1G A;  5EUP A;  2UUA E;  2EPP A;  3HPZ A;  3OGK A;  1YPN A;  4JGH C;  1TF3 A;  5JH5 B;  4BC9 A;  5IT9 C;  2HHH E;  1UBD C;  3M8V A;  2YRM A;  3J7A G;  2EN1 A;  4L5N C;  2NUF A;  4GEQ B;  1N3G A;  4DUY E;  1O0W A;  2DLQ A;  2LMZ A;  2YT4 A;  4X62 E;  4NXM E;  2LJU A;  2MA9 C;  3ZKJ B;  2EOZ A;  2EPO A;  2YSO A;  2R1F A;  5A6J A;  2HGH A;  1RQ0 A;  5DAD A;  4YY8 A;  2MKD A;  4M9V C;  4X64 E;  2OVP A;  5DNY A;  4ZYG A;  2YWQ A;  5IXM B;  1XNR E;  4RH8 A;  4ZYE A;  2EMW A;  2NUE A;  2EM2 A;  2FNJ C;  4B9K E;  4LF7 E;  4MLV A;  2JYA A;  4R2A A;  5BO4 C;  1FKA E;  2MDR A;  5A6B A;  2L2K B;  4Q28 A;  2IHR 1;  1A1G A;  2EN2 A;  2EM8 A;  2EOM A;  1N34 E;  4W9L B;  3T1H E;  2EPM X;  5AC5 A;  2V87 A;  1X6E A;  1EOF A;  2EM6 A;  3FKC A;  2YTP A;  4R2E A;  3M5B A;  2EMY A;  2EMF A;  3IWD A;  2VPK A;  1UHZ A;  1NEI A;  1LDK D;  2EQ3 A;  2DMI A;  4B3R E;  4W9K B;  1EOE A;  2EL4 A;  2V86 A;  2ENH A;  2EN6 A;  3C4T A;  2RTX A;  2LCE A;  3QG5 C;  2VF1 A;  4RHB B;  2ODR D;  1LM8 C;  4W9D B;  5FLX C;  1NN7 A;  4LF5 E;  4O43 A;  1IBL E;  1A1H A;  4JTC B;  2P1P A;  2EM5 A;  2EM7 A;  4JI6 E;  2EOX A;  2P1N A;  1JK1 A;  2H36 X;  4JI5 E;  5H7H A;  4BC7 A;  2YTI A;  3E4U A;  4X9J A;  1YYK A;  1PDA A;  1X6F A;  4P7D A;  2EPC A;  2MDG A;  1FS2 B;  1X48 A;  4NZV A;  5T6J A;  1IQS A;  3HPS A;  3BIM A;  4X65 E;  1YUJ A;  2EPX A;  2L2M A;  2G7H A;  4AP2 A;  1MEY C;  3B84 A;  4JTD B;  2JR1 A;  2YTG A;  1EH6 A;  3MSW A;  4F9C B;  1AAY A;  2EM3 A;  2J7J A;  2LUQ A;  4R03 A;  1HV2 A;  2KHX A;  1QDW A;  2I2R A;  2F4V E;  2EPK X;  4BKT B;  2WBU A;  3HTM A;  4M30 A;  3LML A;  5DAF A;  3M4T A;  2LBS B;  3AUZ A;  1PJT A;  2YTN A;  1UN6 B;  2CPN A;  3ZUN B;  3F6G A;  2EZ6 A;  4DV4 E;  3T1Y E;  2ENC A;  3THN A;  2YTD A;  1X6H A;  2RSM A;  4EOZ A;  3FIG A;  1YSA C;  3ZTD B;  2GPI A;  4DV5 E;  3GA1 A;  2V8Q B;  5TSE A;  1STU A;  4DV7 E;  1JK2 A;  1IBK E;  4DR4 E;  2EMK A;  2KON A;  2Z8H A;  2WZO A;  1R2B A;  3AV0 A;  2EMX A;  2DLK A;  1R28 A;  5BXD A;  4R2C A;  2R76 A;  2JVA A;  2WBS A;  1HNX E;  1IMU A;  1UIL A;  1WHN A;  3HTX A;  2AST A;  2UXD E;  3VK6 A;  4O5G A;  4HXI A;  4B3M E;  4B95 B;  3JAM C;  2EN3 A;  2EMG A; 
#chains in the Genus database with same CATH homology
 3H09 A;  2L2N A;  2M4I A;  1QU6 A;  5AE2 A;  2RS7 A;  4WSP A;  1X49 A;  4LF4 E;  2VKP A;  3HVE A;  2NA2 A;  1J26 A;  2L33 A;  2MC5 A;  1WXR A;  1QDV A;  4BCA A;  3HU6 A;  4BS9 A;  1EOD A;  2DSY A;  1DSX A;  4DR5 E;  1A68 A;  4LFC E;  1GQE A;  2DIX A;  4DR1 E;  1XMO E;  1HNZ E;  4LTY A;  4APF A;  2UXB E;  4JI2 E;  4X66 E;  4F9A B;  2JOX A;  2MC6 A;  2DB2 A;  4DR2 E;  5FTA A;  3I3N A;  4U2M A;  3K6Q A;  2RS6 A;  4BMJ A;  2E32 B;  5BR8 E;  4I6J C;  3LLH A;  1RC7 A;  2R9R B;  2IHC A;  3P1X A;  1EKZ A;  4CP3 A;  3HQ1 A;  3J7Y p;  2B7T A;  5F3W A;  4JI8 E;  1XNQ E;  2N3G A;  3ADL A;  3J80 C;  2LRS A;  2V85 A;  1VCB B;  2M7Q A;  4DUZ E;  1T4L B;  5H7G A;  4L8N A;  2P1O A;  5A6R A;  2FV4 B;  3OTO E;  4AJY C;  3MKS A;  4OOG C;  4JV5 E;  1PKP A;  3C4B A;  4ZGC A;  1WHQ A;  2L6M A;  1XMQ E;  4ZOU A;  4W9I B;  1J5E E;  2E1M A;  4W9F B;  1ZBT A;  4B9K B;  1EXB E;  4BGC A;  2K4V A;  4X8W A;  3V7D A;  3LBZ A;  3C6P A;  4JI3 E;  4K0K E;  4UIJ A;  2VQF E;  2UXC E;  4W9H H;  4W9G B;  4OX9 E;  2N3H A;  2UUC E;  3M52 A;  5LMU E;  2ODR C;  2IF5 A;  1FJG E;  4CXJ A;  2V83 A;  1BUO A;  3OGL A;  3KWR A;  1DI2 A;  3IWB A;  3J81 C;  4P78 A;  1CS3 A;  4DMI A;  3ADI A;  3L2O A;  4CXI A;  3F6H A;  2VQE E;  2IZV C;  2OVR A;  3JTZ A;  2EWL A;  1T4N A;  3IWC A;  3WSO B;  1YYO A;  4W9E B;  3OHV A;  2L8T A;  2NN2 A;  2LE2 A;  4JI0 E;  4U2N A;  4CXT A;  1GZ6 A;  2LJH A;  1I94 E;  4DV0 E;  3LUT B;  5A15 A;  2KOU A;  2LTR A;  2B9D A;  4UYI A;  2L92 A;  2JY9 A;  5AE1 A;  3LNM B;  3DF6 A;  4DR7 E;  4DV2 E;  4WPY A;  2B7V A;  4DV6 E;  1DQ3 A;  2LUP B;  2C9W C;  3OGM A;  1R29 A;  2A79 B;  5IWA E;  5A2Q C;  1YYW A;  3DRX A;  5LL6 R;  5AE3 A;  1N36 E;  4WYQ B;  3C6N A;  1N32 E;  1T4O A;  2YY9 A;  4B3S E;  4GKK E;  4WQO C;  4DV1 E;  2B3T B;  3VYX A;  2L3C A;  2PPI A;  4LFA E;  3KVT A;  1FQV B;  4I8O A;  4DV3 E;  4CRH A;  1SR9 A;  2JWO A;  1LQB B;  1X47 A;  1NEX A;  1P22 B;  2M1S A;  4W9C B;  2UUB E;  5HZG C;  4KZS A;  3DCG B;  5BXB A;  5AAS A;  2LTS A;  4F54 A;  4M2Z A;  4B3T E;  4JI1 E;  5IBK A;  3ZOQ B;  5LLI B;  3OHU A;  3ADG A;  3RMP A;  4JI4 E;  4U77 A;  2DMY A;  4W9H B;  1FS1 B;  3HVE B;  2FTX B;  3HQI A;  2L3J A;  4YHH E;  4JTA B;  1IBM E;  2P1Q A;  2F8B A;  4TUG A;  2E5L E;  3JAM C;  4KHP E;  4DR3 E;  5HYW B;  2Q81 A;  4W9J B;  4DKK A;  3C6O A;  4NXN E;  2P1M A;  4BKS B;  2ASS A;  3ZRC B;  3DRZ A;  1HR0 E;  5LMN E;  3ZNG B;  3ZTC B;  2YZT A;  2UU9 E;  3JU0 A;  1T1D A;  4AQY E;  4JI7 E;  4BBY A;  2ZM6 E;  4LF9 E;  2JZ3 C;  4YY3 E;  4LF8 E;  1N33 E;  4F9B B;  1YZ9 A;  4TUI A;  2V88 A;  3ADJ A;  4GKJ E;  4N9F 5;  3ZRF B;  4M0V A;  4J8Z A;  2NZ0 B;  4AWJ B;  2E31 B;  3DJW A;  3VYY A;  2OVQ A;  3DRY A;  2NUG A;  4WFT A;  5CFF E;  2FGG A;  1HNW E;  1ZBQ A;  3OML A;  2VE7 C;  5BXH A;  2JOB A;  4R8O A;  4LF6 E;  4LFB E;  4JYA E;  4DR6 E;  3HXL A;  4LU9 A;  5ADZ A;  2V89 A;  1S1G A;  5EUP A;  2UUA E;  3HPZ A;  3OGK A;  4JGH C;  5JH5 B;  4BC9 A;  5IT9 C;  2HHH E;  3M8V A;  3J7A G;  4L5N C;  2NUF A;  4GEQ B;  4DUY E;  1O0W A;  2LMZ A;  2YT4 A;  4X62 E;  4NXM E;  2MA9 C;  3ZKJ B;  5DAD A;  1RQ0 A;  4YY8 A;  4X64 E;  2OVP A;  5DNY A;  1XNR E;  2FNJ C;  2NUE A;  4B9K E;  4LF7 E;  5BO4 C;  1FKA E;  2MDR A;  2L2K B;  4Q28 A;  2IHR 1;  1N34 E;  4W9L B;  3T1H E;  1EOF A;  2V87 A;  3FKC A;  3M5B A;  3IWD A;  2VPK A;  1UHZ A;  1LDK D;  4B3R E;  4W9K B;  1EOE A;  2V86 A;  3C4T A;  2RTX A;  2VF1 A;  2ODR D;  1LM8 C;  4W9D B;  1NN7 A;  4LF5 E;  4JTC B;  1IBL E;  2P1P A;  4JI6 E;  2P1N A;  2H36 X;  4JI5 E;  5H7H A;  4BC7 A;  3E4U A;  1YYK A;  4P7D A;  1FS2 B;  1X48 A;  5T6J A;  3HPS A;  3BIM A;  4X65 E;  2L2M A;  2G7H A;  4AP2 A;  3B84 A;  4JTD B;  2JR1 A;  4F9C B;  3MSW A;  2LUQ A;  4R03 A;  1HV2 A;  2KHX A;  1QDW A;  2I2R A;  2F4V E;  4BKT B;  3HTM A;  4M30 A;  3LML A;  5DAF A;  3M4T A;  2LBS B;  3AUZ A;  2CPN A;  3ZUN B;  3F6G A;  2EZ6 A;  4DV4 E;  3T1Y E;  2RSM A;  4EOZ A;  3FIG A;  3ZTD B;  4DV5 E;  3GA1 A;  2V8Q B;  1STU A;  4DV7 E;  1IBK E;  4DR4 E;  2KON A;  2Z8H A;  2WZO A;  1R2B A;  3AV0 A;  1R28 A;  5BXD A;  2JVA A;  1HNX E;  1UIL A;  1WHN A;  3HTX A;  2AST A;  2UXD E;  3VK6 A;  4HXI A;  4B3M E;  4B95 B;  5FLX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...