4J8ZA

Crystal structure of the human spop btb domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
MVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAERSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Speckle-type POZ protein
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.700 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4j8zA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 4j8zA01
2C9WC 5H7GA 1T1DA 4JTAB 4W9EB 4W9HH 1HV2A 3OGKA 2P1QA 4BKTB 1S1GA 5BXHA 3LUTB 3OGMA 2YY9A 2JZ3C 2E32B 5DADA 1EODA 3HTMA 3HVEB 2A79B 3BIMA 5BXDA 3M4TA 3ZKJB 4UIJA 3FKCA 2OVQA 4AP2A 3HQIA 4W9FB 4W9CB 4W9DB 2ASSA 3C6OA 3B84A 3OHUA 4CP3A 3ZUNB 2E31B 1R29A 1FS1B 2P1MA 4JGHC 4CXIA 1LQBB 4B9KB 2NN2A 2OVRA 5HZGC 3ZTDB 4W9HB 3I3NA 3WSOB 4UYIA 5A15A 4W9IB 5LLIB 5IBKA 5A6RA 4J8ZA 2IF5A 5DAFA 1EOFA 3ZTCB 2IZVC 2NZ0B 3C6PA 1CS3A 3OHVA 3ZRCB 3KVTA 1R28A 4WQOC 3LBZA 2P1PA 2MA9C 1NEXA 2Z8HA 1EOEA 5EUPA 3HVEA 3M5BA 5H7HA 1P22B 3HU6A 4W9GB 4W9KB 2Q81A 3DRZA 3GA1A 3LNMB 3ZNGB 2FNJC 2VKPA 1VCBB 2OVPA 3C6NA 1R2BA 4W9LB 3V7DA 1A68A 2IHCA 4CXTA 4AJYC 4JTCB 4HXIA 4EOZA 3E4UA 4B95B 1QDVA 4W9JB 1FS2B 5JH5B 4BGCA 2PPIA 4ZOUA 4U77A 5FTAA 4U2MA 2ASTA 2P1OA 5HYWB 5BO4C 4BKSB 4U2NA 2R9RB 2VPKA 4I6JC 4APFA 4CXJA 5BXBA 3DCGB 1FQVB 3MKSA 1EXBE 1LM8C 1LDKD 4B9KE 1QDWA 1BUOA 3M8VA 3M52A 4AWJB 2I2RA 4CRHA 4N9F5 3ZRFB 1DSXA 1NN7A 3L2OA 3OGLA 2P1NA 4JTDB
chains in the Genus database with same CATH superfamily
2RS6A 1HV2A 4DV5E 4KWYA 1TF3A 1A1FA 1A1KA 2LRSA 3OGMA 4R2QA 4LF4E 2E32B 2JZ3C 3HTMA 3FIGA 2CT1A 2EPAA 4M0VA 3BF2A 3ZOQB 1IBME 4WPYA 4IS1C 1X6FA 4IJDA 2EL4A 4F9BB 3HQIA 3DJWA 4DUZE 4WXDA 4W9DB 2MDRA 1STUA 3L00A 2B9DA 5KL5A 4R2EA 3B84A 1PDAA 2I13A 2EL5A 3JTZA 5KL6A 3MSWA 4F6NA 1A1GA 1R29A 2EMHA 2EOSA 1GZ6A 4NHRA 4P78A 1IQOA 5KL7A 2P1MA 4JGHC 4B9KB 1B69A 2DGCA 2EMGA 2VE7C 2RQLA 1NCSA 4JI3E 4YY3E 1QU6A 5AC4A 3ADJA 3EPKA 2CPNA 1WHQA 2EPZA 2YTNA 4GEQB 2EN7A 2YTJA 2MKDA 1I94E 3LLHA 1TF6A 1X48A 3HQ1A 2EOZA 5DAFA 1X3CA 1AAYA 2ENAA 4BC7A 4R2RA 5LMNE 2F4VE 3EPLA 2EP3A 2KONA 3JU0A 3AUZA 1T39A 2IZVC 2EMAA 1CS3A 3C6PA 3OHVA 4F2JC 4WQOC 2EN3A 1R28A 2J7JA 5A6BD 2P1PA 4YHHE 3J7AG 2MA9C 2V8QB 4TUGA 5F3WA 2Z8HA 2EZ6A 4BHCA 2VQEE 4DR7E 4NZVA 1T38A 4JI7E 1N32E 3C6KA 5H7HA 4R8OA 4JI4E 4R2AA 4W9KB 4JI1E 3DRZA 3GA1A 3LNMB 2EM5A 5AASA 5LLQA 2EPMX 3BGHA 2LT7A 4O4KA 1A68A 4CXTA 4AJYC 3DF6A 4X65E 2EOQA 1RC7A 4LF5E 1QDVA 1YUJA 2EPRA 4R2CA 2L2MA 4MLQA 4ZOUA 1FKAE 2NUEA 3VYYA 4BKSB 2ADRA 4U2NA 2LTSA 4I6JC 5IV8B 3QG5C 2JR1A 2EMZA 1LDKD 2R1FA 1BUOA 3M99B 2K4VA 2V85A 1N3GA 2EPXA 2H36X 2L3JA 3EQ1A 4ZYGA 2YSOA 2EM6A 4JTAB 4ZYDA 4B3RE 1SFEA 2GLIA 2HJJA 1G2FC 4DR1E 2FGGA 2A25A 2MC5A 1HNWE 1MGTA 4HTGA 2CTDA 1N36E 4LF6E 4JI0E 5DADA 2NABA 4GKKE 1EODA 1T4LB 1ZBTA 2EMLA 2LJUA 3EPJA 4DR4E 2EM9A 1XMQE 4JYAE 5A6BA 4Q28A 3M4TA 4UIJA 4L5NC 4L8NA 4KHPE 3FKCA 2OVQA 1DI2A 1XNRE 3F6GA 4JV5E 4W9CB 5LMUE 2YRMA 3VHTB 4WXCA 2ASSA 4O24A 1EH7A 1X49A 2HHHE 4OX9E 1YZ9A 1BB8A 4R2PA 2EMFA 2RPCA 4DR2E 4CP3A 3ZUNB 3VYXA 4HEIA 2E31B 4M30A 2UXBE 2YTEA 2WBSA 2GPIA 2LTRA 1LQBB 4LU9A 2EQ1A 4X9JA 3ADIA 4DV4E 2EM2A 2YWQA 5AE2A 2RTXA 2JWOA 5KL2A 2YU8A 1HR0E 1UN6B 3ZTDB 4W9HB 3I3NA 1G2DC 5A15A 2EOIA 2EPCA 3T1YE 3K6QA 4W9IB 2EOHA 5LLIB 2E1MA 2EOXA 5A6RA 4J8ZA 1PKPA 2EQ3A 2LUPB 3C6MA 1EOFA 1A1LA 1T4OA 2EM0A 2ENCA 2NZ0B 2EN2A 2KOUA 3ZRCB 3KVTA 2ODRD 5LL6R 4O43A 2LMZA 1YUIA 1NEXA 5AE1A 5AE3A 2LBSB 4N4RB 4JI6E 4X66E 1TN9A 4LFAE 5EUPA 1YSAC 3HVEA 3M5BA 2YT4A 3C4TA 4W9GB 2JY9A 4DR6E 4JI5E 2VRDA 4LF8E 1BBGA 2NA2A 2FNJC 4R2DA 5A6JA 1VCBB 4LFBE 4BMJA 4DV1E 4ZYEA 2GHFA 1KJKA 2FTXB 2EM7A 1P47A 2JP9A 4EOZA 3HPZA 1DGCA 4B95B 2LJHA 1AH5A 2RSMA 1SR9A 2LE2A 4W9JB 4BGCA 4R2SA 2EL6A 2EWLA 4U2MA 2P1OA 2HGHA 5HYWB 2YPNA 2R9RB 2EQ0A 1UHZA 1XMOE 1MEYC 4APFA 4CXJA 1ZU1A 2EOEA 2EPPA 2L92A 2UXCE 3MKSA 2L2KB 2EM3A 2MKNA 3ECRA 2WBTA 3RMPA 1YYWA 2EMYA 3M8VA 2YTDA 1GQEA 2L8TA 2LV2A 2YTGA 2YRHA 3HTXA 1DSXA 1NN7A 2B7TA 3OGLA 2C9WC 4X64E 2V86A 1F2IG 2EMWA 2FV4B 4B3SE 4DV7E 2YY9A 3BBGA 1DQ3A 2YRKA 2B3TB 2ODRC 1J5EE 3EPHA 2ELYA 4RH8A 3BIMA 1YPNA 3KZZA 5BXDA 5FLXC 2DSYA 3ZKJB 5IT9C 2ZM6E 4LFCE 2BB8A 2YTFA 4DUYE 2MDGA 2PRTA 4DV2E 2NUGA 2D9HA 4DV6E 2JYAA 3C6OA 3MHHC 3OHUA 3ADGA 2DIXA 2N3GA 2EMBA 1FS1B 2EJ4A 2ELZA 3KZYA 2NN2A 2LUQA 2B7VA 2JOXA 5DNYA 2HC5A 4MLVA 1WRJA 4I8OA 2EORA 2YTOA 1O0WA 5HZGC 5A2QC 3MHSC 2EOMA 2N3HA 4ZYHA 1RQ0A 2EOOA 4BC9A 4BBYA 2UUAE 4FK5C 4WSPA 2IF5A 3UK3C 2EN8A 1IMUA 1PJTA 2YTPA 4F54A 2E5LE 4M2ZA 1EH8A 2EPLX 3THOB 2EMCA 1WHNA 2DLKA 2EE8A 2VF1A 1EOEA 2V83A 3HPSA 1A1JA 2L3CA 1P22B 4WYQB 1A1HA 4WFTA 2WBUA 1UBDC 5T6JA 1FJGE 3J80C 4ZGCA 4YY8A 2EOJA 3DRYA 3H09A 4WX9A 1R2BA 3C6NA 4W9LB 3V7DA 2DMYA 1X6EA 1N33E 4JTCB 3LMLA 1N34E 2V87A 2IHR1 1FS2B 2UUCE 2EMIA 1WJPA 2PPIA 3OMLA 5A6KA 1XNQE 5FTAA 5BR8E 2ASTA 1BBOA 4B3TE 2EN4A 2WZOA 2VPKA 2YZTA 1FQVB 3DCGB 2CSHA 1EXBE 3IWBA 4F9CB 5KL3A 1ZBQA 1IQSA 2BBGA 2ENHA 3AV0A 1LM8C 2EM4A 1QDWA 2M4IA 1GTKA 2DB2A 3IWCA 4AWJB 2YU5A 1IBLE 1IBKE 1Z1BA 3L2OA 2V89A 4DR5E 4JTDB 3OTOE 1ZAAC 5H7GA 1T1DA 4W9EB 4W9HH 3OGKA 2EOYA 1J26A 2P1QA 4BKTB 1S1GA 5ADZA 4LF7E 5BXHA 3LUTB 5TSEA 1ZR9A 4KZSA 2YSPA 2F8BA 3HVEB 2YTQA 2A79B 2RSIA 4R03A 3J81C 4TUIA 1PJQA 2EOFA 2VQFE 4Q35B 4JI8E 4K0KE 1HNZE 4AP2A 4W9FB 2MC6A 1NEIA 2LCEA 2R76A 2EPOA 4DR3E 3F6HA 3THNA 4P7DA 2EM8A 2EN1A 2M7QA 5A6AA 4B3ME 2N8XA 4BCAA 1X6HA 4X62E 2EMXA 1YFHA 4CXIA 3ADLA 4GKJE 2E72A 4LTYA 2Q8UA 4DV3E 3P1XA 2OVRA 4DMIA 3WSOB 4F9AB 1T4NA 3HXLA 4UYIA 4LF9E 2DRPA 2UXDE 5IBKA 4M9VC 1A1IA 2G7HA 3VK6A 1EH6A 2JVAA 3KWRA 2RS7A 3ZTCB 1JK2A 1L4SA 1KYQA 4GZNC 5IWAE 4BHBA 1RMDA 2UU9E 2L33A 3LBZA 3TQMA 4DV0E 4F6MA 4NXME 2EPKX 1YYKA 2V88A 4JI2E 5KL4A 4X8WA 2YTIA 2UUBE 3HU6A 1EKZA 2NUFA 4NXNE 1JK1A 4RHBB 1X47A 2Q81A 2EPUA 1LLMC 2LVHA 3ZNGB 2I9IA 3J7Yp 2K7IA 4O5GA 2VKPA 5CFFE 4OOGC 4DKKA 2OVPA 4BS9A 2IHCA 1PJSA 2WCC3 3JAMC 4HXIA 3E4UA 2KHXA 1WXRA 5JH5B 2EMKA 4U77A 1HNXE 3T1HE 5BO4C 1YYOA 2EN6A 2L2NA 3DRXA 5BXBA 2M1SA 2EPNA 3C4BA 2JXPA 1UILA 4AQYE 4B9KE 1QNTA 2M9AA 2DMIA 5AC5A 2LO3A 3BIDA 5A69A 3M52A 4WSGA 2I2RA 4CRHA 3IWDA 2L6MA 2JPAA 4N9F5 1X5WA 3ZRFB 2DLQA 5IXMB 2P1NA 2JOBA
chains in the Genus database with same CATH topology
2RS6A 1HV2A 4DV5E 2LRSA 3OGMA 4LF4E 2E32B 2JZ3C 3HTMA 3FIGA 4M0VA 1IBME 3ZOQB 4WPYA 4F9BB 3HQIA 3DJWA 4DUZE 4W9DB 2MDRA 1STUA 2B9DA 3B84A 3JTZA 3MSWA 1R29A 1GZ6A 4P78A 2P1MA 4JGHC 4B9KB 2VE7C 4JI3E 4YY3E 1QU6A 3ADJA 2CPNA 1WHQA 4GEQB 1I94E 3LLHA 1X48A 3HQ1A 5DAFA 4BC7A 5LMNE 2F4VE 2IZVC 2KONA 3JU0A 3C6PA 3AUZA 1CS3A 3OHVA 4WQOC 1R28A 2P1PA 4YHHE 3J7AG 2MA9C 2V8QB 4TUGA 5F3WA 2Z8HA 2EZ6A 2VQEE 4DR7E 4JI7E 1N32E 5H7HA 4R8OA 4JI4E 4W9KB 4JI1E 3DRZA 3GA1A 3LNMB 5AASA 1A68A 4CXTA 4AJYC 3DF6A 4X65E 1RC7A 1QDVA 4LF5E 2L2MA 4ZOUA 1FKAE 2NUEA 3VYYA 4BKSB 4U2NA 2LTSA 4I6JC 2JR1A 1LDKD 1BUOA 2K4VA 2V85A 2H36X 2L3JA 4JTAB 4B3RE 4DR1E 2FGGA 2MC5A 1HNWE 1N36E 4LF6E 4JI0E 5DADA 4GKKE 1EODA 1T4LB 1ZBTA 4DR4E 1XMQE 4JYAE 4Q28A 3M4TA 4UIJA 4L5NC 4L8NA 4KHPE 3FKCA 2OVQA 1DI2A 1XNRE 3F6GA 4JV5E 4W9CB 5LMUE 2ASSA 4OX9E 1X49A 2HHHE 1YZ9A 4DR2E 4CP3A 3ZUNB 3VYXA 2E31B 4M30A 2UXBE 2LTRA 1LQBB 4LU9A 3ADIA 4DV4E 5AE2A 2RTXA 2JWOA 1HR0E 3ZTDB 4W9HB 3I3NA 5A15A 3T1YE 3K6QA 4W9IB 5LLIB 2E1MA 5A6RA 4J8ZA 1PKPA 2LUPB 1EOFA 1T4OA 2NZ0B 2KOUA 3ZRCB 3KVTA 2ODRD 5LL6R 2LMZA 1NEXA 5AE1A 5AE3A 2LBSB 4JI6E 4X66E 4LFAE 5EUPA 3HVEA 3M5BA 2YT4A 3C4TA 4W9GB 2JY9A 4DR6E 4JI5E 4LF8E 2NA2A 2FNJC 1VCBB 4LFBE 4BMJA 4DV1E 2FTXB 4EOZA 3HPZA 4B95B 2LJHA 2RSMA 4W9JB 1SR9A 2LE2A 4BGCA 2EWLA 4U2MA 2P1OA 5HYWB 2R9RB 1UHZA 1XMOE 4APFA 4CXJA 2L92A 2UXCE 3MKSA 2L2KB 3RMPA 1YYWA 3M8VA 1GQEA 2L8TA 3HTXA 1DSXA 1NN7A 2B7TA 3OGLA 2C9WC 4X64E 2V86A 2FV4B 4B3SE 4DV7E 2YY9A 1DQ3A 2B3TB 2ODRC 1J5EE 3BIMA 5BXDA 5FLXC 2DSYA 3ZKJB 5IT9C 2ZM6E 4LFCE 4DUYE 4DV2E 2NUGA 4DV6E 3C6OA 3OHUA 3ADGA 2DIXA 2N3GA 1FS1B 2NN2A 2LUQA 2B7VA 2JOXA 5DNYA 4I8OA 1O0WA 5HZGC 5A2QC 2N3HA 1RQ0A 4BC9A 2UUAE 4BBYA 4WSPA 2IF5A 4F54A 2E5LE 4M2ZA 1WHNA 1EOEA 2VF1A 2V83A 3HPSA 2L3CA 1P22B 4WYQB 4WFTA 5T6JA 1FJGE 3J80C 4ZGCA 4YY8A 3DRYA 3H09A 3C6NA 1R2BA 4W9LB 3V7DA 2DMYA 1N33E 4JTCB 3LMLA 1N34E 2V87A 2IHR1 1FS2B 2UUCE 2PPIA 3OMLA 5FTAA 1XNQE 5BR8E 2ASTA 4B3TE 2WZOA 2VPKA 2YZTA 1FQVB 3DCGB 1EXBE 3IWBA 4F9CB 1ZBQA 3AV0A 1LM8C 1QDWA 2M4IA 2DB2A 3IWCA 4AWJB 1IBLE 1IBKE 3L2OA 2V89A 4DR5E 4JTDB 3OTOE 5H7GA 1T1DA 4W9EB 4W9HH 3OGKA 1J26A 2P1QA 4BKTB 1S1GA 5ADZA 4LF7E 5BXHA 3LUTB 4KZSA 2F8BA 3HVEB 2A79B 4R03A 3J81C 4TUIA 2VQFE 4JI8E 4K0KE 1HNZE 4AP2A 4W9FB 2MC6A 4DR3E 3F6HA 4P7DA 2M7QA 4B3ME 4BCAA 4X62E 4CXIA 3ADLA 4GKJE 4LTYA 4DV3E 3P1XA 2OVRA 4DMIA 3WSOB 4F9AB 1T4NA 3HXLA 4UYIA 4LF9E 2UXDE 5IBKA 2G7HA 3VK6A 3KWRA 2JVAA 2RS7A 3ZTCB 5IWAE 2UU9E 2L33A 3LBZA 4DV0E 4NXME 1YYKA 2V88A 4JI2E 4X8WA 2UUBE 3HU6A 1EKZA 2NUFA 4NXNE 1X47A 2Q81A 3ZNGB 3J7Yp 2VKPA 5CFFE 4OOGC 4DKKA 2OVPA 4BS9A 2IHCA 3JAMC 4HXIA 3E4UA 2KHXA 1WXRA 5JH5B 4U77A 1HNXE 3T1HE 5BO4C 1YYOA 2L2NA 3DRXA 5BXBA 2M1SA 3C4BA 1UILA 4AQYE 4B9KE 3M52A 2I2RA 4CRHA 3IWDA 2L6MA 4N9F5 3ZRFB 2P1NA 2JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9W C;  5H7G A;  1T1D A;  4JTA B;  4W9E B;  4W9H H;  1HV2 A;  3OGK A;  2P1Q A;  4BKT B;  1S1G A;  5BXH A;  3LUT B;  3OGM A;  2YY9 A;  2JZ3 C;  2E32 B;  5DAD A;  1EOD A;  3HTM A;  3HVE B;  2A79 B;  3BIM A;  5BXD A;  3M4T A;  3ZKJ B;  4UIJ A;  3FKC A;  2OVQ A;  4AP2 A;  3HQI A;  4W9F B;  4W9C B;  4W9D B;  2ASS A;  3C6O A;  3B84 A;  3OHU A;  4CP3 A;  3ZUN B;  2E31 B;  1R29 A;  1FS1 B;  2P1M A;  4JGH C;  4CXI A;  1LQB B;  4B9K B;  2NN2 A;  2OVR A;  5HZG C;  3ZTD B;  4W9H B;  3I3N A;  3WSO B;  4UYI A;  5A15 A;  4W9I B;  5LLI B;  5IBK A;  5A6R A;  4J8Z A;  2IF5 A;  5DAF A;  1EOF A;  3ZTC B;  2IZV C;  2NZ0 B;  3C6P A;  1CS3 A;  3OHV A;  3ZRC B;  3KVT A;  1R28 A;  4WQO C;  3LBZ A;  2P1P A;  2MA9 C;  1NEX A;  2Z8H A;  1EOE A;  5EUP A;  3HVE A;  3M5B A;  5H7H A;  1P22 B;  3HU6 A;  4W9G B;  4W9K B;  2Q81 A;  3DRZ A;  3GA1 A;  3LNM B;  3ZNG B;  2FNJ C;  2VKP A;  1VCB B;  2OVP A;  3C6N A;  1R2B A;  4W9L B;  3V7D A;  1A68 A;  2IHC A;  4CXT A;  4AJY C;  4JTC B;  4HXI A;  4EOZ A;  3E4U A;  4B95 B;  1QDV A;  4W9J B;  1FS2 B;  5JH5 B;  4BGC A;  2PPI A;  4ZOU A;  4U77 A;  5FTA A;  4U2M A;  2AST A;  2P1O A;  5HYW B;  5BO4 C;  4BKS B;  4U2N A;  2R9R B;  2VPK A;  4I6J C;  4APF A;  4CXJ A;  5BXB A;  3DCG B;  1FQV B;  3MKS A;  1EXB E;  1LM8 C;  1LDK D;  4B9K E;  1QDW A;  1BUO A;  3M8V A;  3M52 A;  4AWJ B;  2I2R A;  4CRH A;  4N9F 5;  3ZRF B;  1DSX A;  1NN7 A;  3L2O A;  3OGL A;  2P1N A;  4JTD B; 
#chains in the Genus database with same CATH topology
 2RS6 A;  1HV2 A;  4DV5 E;  4KWY A;  1TF3 A;  1A1F A;  1A1K A;  2LRS A;  3OGM A;  4R2Q A;  4LF4 E;  2E32 B;  2JZ3 C;  3HTM A;  3FIG A;  2CT1 A;  2EPA A;  4M0V A;  3BF2 A;  3ZOQ B;  1IBM E;  4WPY A;  4IS1 C;  1X6F A;  4IJD A;  2EL4 A;  4F9B B;  3HQI A;  3DJW A;  4DUZ E;  4WXD A;  4W9D B;  2MDR A;  1STU A;  3L00 A;  2B9D A;  5KL5 A;  4R2E A;  3B84 A;  1PDA A;  2I13 A;  2EL5 A;  3JTZ A;  5KL6 A;  3MSW A;  4F6N A;  1A1G A;  1R29 A;  2EMH A;  2EOS A;  1GZ6 A;  4NHR A;  4P78 A;  1IQO A;  5KL7 A;  2P1M A;  4JGH C;  4B9K B;  1B69 A;  2DGC A;  2EMG A;  2VE7 C;  2RQL A;  1NCS A;  4JI3 E;  4YY3 E;  1QU6 A;  5AC4 A;  3ADJ A;  3EPK A;  2CPN A;  1WHQ A;  2EPZ A;  2YTN A;  4GEQ B;  2EN7 A;  2YTJ A;  2MKD A;  1I94 E;  3LLH A;  1TF6 A;  1X48 A;  3HQ1 A;  2EOZ A;  5DAF A;  1X3C A;  1AAY A;  2ENA A;  4BC7 A;  4R2R A;  5LMN E;  2F4V E;  3EPL A;  2EP3 A;  2KON A;  3JU0 A;  3AUZ A;  1T39 A;  2IZV C;  2EMA A;  1CS3 A;  3C6P A;  3OHV A;  4F2J C;  4WQO C;  2EN3 A;  1R28 A;  2J7J A;  5A6B D;  2P1P A;  4YHH E;  3J7A G;  2MA9 C;  2V8Q B;  4TUG A;  5F3W A;  2Z8H A;  2EZ6 A;  4BHC A;  2VQE E;  4DR7 E;  4NZV A;  1T38 A;  4JI7 E;  1N32 E;  3C6K A;  5H7H A;  4R8O A;  4JI4 E;  4R2A A;  4W9K B;  4JI1 E;  3DRZ A;  3GA1 A;  3LNM B;  2EM5 A;  5AAS A;  5LLQ A;  2EPM X;  3BGH A;  2LT7 A;  4O4K A;  1A68 A;  4CXT A;  4AJY C;  3DF6 A;  4X65 E;  2EOQ A;  1RC7 A;  4LF5 E;  1QDV A;  1YUJ A;  2EPR A;  4R2C A;  2L2M A;  4MLQ A;  4ZOU A;  1FKA E;  2NUE A;  3VYY A;  4BKS B;  2ADR A;  4U2N A;  2LTS A;  4I6J C;  5IV8 B;  3QG5 C;  2JR1 A;  2EMZ A;  1LDK D;  2R1F A;  1BUO A;  3M99 B;  2K4V A;  2V85 A;  1N3G A;  2EPX A;  2H36 X;  2L3J A;  3EQ1 A;  4ZYG A;  2YSO A;  2EM6 A;  4JTA B;  4ZYD A;  4B3R E;  1SFE A;  2GLI A;  2HJJ A;  1G2F C;  4DR1 E;  2FGG A;  2A25 A;  2MC5 A;  1HNW E;  1MGT A;  4HTG A;  2CTD A;  1N36 E;  4LF6 E;  4JI0 E;  5DAD A;  2NAB A;  4GKK E;  1EOD A;  1T4L B;  1ZBT A;  2EML A;  2LJU A;  3EPJ A;  4DR4 E;  2EM9 A;  1XMQ E;  4JYA E;  5A6B A;  4Q28 A;  3M4T A;  4UIJ A;  4L5N C;  4L8N A;  4KHP E;  3FKC A;  2OVQ A;  1DI2 A;  1XNR E;  3F6G A;  4JV5 E;  4W9C B;  5LMU E;  2YRM A;  3VHT B;  4WXC A;  2ASS A;  4O24 A;  1EH7 A;  1X49 A;  2HHH E;  4OX9 E;  1YZ9 A;  1BB8 A;  4R2P A;  2EMF A;  2RPC A;  4DR2 E;  4CP3 A;  3ZUN B;  3VYX A;  4HEI A;  2E31 B;  4M30 A;  2UXB E;  2YTE A;  2WBS A;  2GPI A;  2LTR A;  1LQB B;  4LU9 A;  2EQ1 A;  4X9J A;  3ADI A;  4DV4 E;  2EM2 A;  2YWQ A;  5AE2 A;  2RTX A;  2JWO A;  5KL2 A;  2YU8 A;  1HR0 E;  1UN6 B;  3ZTD B;  4W9H B;  3I3N A;  1G2D C;  5A15 A;  2EOI A;  2EPC A;  3T1Y E;  3K6Q A;  4W9I B;  2EOH A;  5LLI B;  2E1M A;  2EOX A;  5A6R A;  4J8Z A;  1PKP A;  2EQ3 A;  2LUP B;  3C6M A;  1EOF A;  1A1L A;  1T4O A;  2EM0 A;  2ENC A;  2NZ0 B;  2EN2 A;  2KOU A;  3ZRC B;  3KVT A;  2ODR D;  5LL6 R;  4O43 A;  2LMZ A;  1YUI A;  1NEX A;  5AE1 A;  5AE3 A;  2LBS B;  4N4R B;  4JI6 E;  4X66 E;  1TN9 A;  4LFA E;  5EUP A;  1YSA C;  3HVE A;  3M5B A;  2YT4 A;  3C4T A;  4W9G B;  2JY9 A;  4DR6 E;  4JI5 E;  2VRD A;  4LF8 E;  1BBG A;  2NA2 A;  2FNJ C;  4R2D A;  5A6J A;  1VCB B;  4LFB E;  4BMJ A;  4DV1 E;  4ZYE A;  2GHF A;  1KJK A;  2FTX B;  2EM7 A;  1P47 A;  2JP9 A;  4EOZ A;  3HPZ A;  1DGC A;  4B95 B;  2LJH A;  1AH5 A;  2RSM A;  1SR9 A;  2LE2 A;  4W9J B;  4BGC A;  4R2S A;  2EL6 A;  2EWL A;  4U2M A;  2P1O A;  2HGH A;  5HYW B;  2YPN A;  2R9R B;  2EQ0 A;  1UHZ A;  1XMO E;  1MEY C;  4APF A;  4CXJ A;  1ZU1 A;  2EOE A;  2EPP A;  2L92 A;  2UXC E;  3MKS A;  2L2K B;  2EM3 A;  2MKN A;  3ECR A;  2WBT A;  3RMP A;  1YYW A;  2EMY A;  3M8V A;  2YTD A;  1GQE A;  2L8T A;  2LV2 A;  2YTG A;  2YRH A;  3HTX A;  1DSX A;  1NN7 A;  2B7T A;  3OGL A;  2C9W C;  4X64 E;  2V86 A;  1F2I G;  2EMW A;  2FV4 B;  4B3S E;  4DV7 E;  2YY9 A;  3BBG A;  1DQ3 A;  2YRK A;  2B3T B;  2ODR C;  1J5E E;  3EPH A;  2ELY A;  4RH8 A;  3BIM A;  1YPN A;  3KZZ A;  5BXD A;  5FLX C;  2DSY A;  3ZKJ B;  5IT9 C;  2ZM6 E;  4LFC E;  2BB8 A;  2YTF A;  4DUY E;  2MDG A;  2PRT A;  4DV2 E;  2NUG A;  2D9H A;  4DV6 E;  2JYA A;  3C6O A;  3MHH C;  3OHU A;  3ADG A;  2DIX A;  2N3G A;  2EMB A;  1FS1 B;  2EJ4 A;  2ELZ A;  3KZY A;  2NN2 A;  2LUQ A;  2B7V A;  2JOX A;  5DNY A;  2HC5 A;  4MLV A;  1WRJ A;  4I8O A;  2EOR A;  2YTO A;  1O0W A;  5HZG C;  5A2Q C;  3MHS C;  2EOM A;  2N3H A;  4ZYH A;  1RQ0 A;  2EOO A;  4BC9 A;  4BBY A;  2UUA E;  4FK5 C;  4WSP A;  2IF5 A;  3UK3 C;  2EN8 A;  1IMU A;  1PJT A;  2YTP A;  4F54 A;  2E5L E;  4M2Z A;  1EH8 A;  2EPL X;  3THO B;  2EMC A;  1WHN A;  2DLK A;  2EE8 A;  2VF1 A;  1EOE A;  2V83 A;  3HPS A;  1A1J A;  2L3C A;  1P22 B;  4WYQ B;  1A1H A;  4WFT A;  2WBU A;  1UBD C;  5T6J A;  1FJG E;  3J80 C;  4ZGC A;  4YY8 A;  2EOJ A;  3DRY A;  3H09 A;  4WX9 A;  1R2B A;  3C6N A;  4W9L B;  3V7D A;  2DMY A;  1X6E A;  1N33 E;  4JTC B;  3LML A;  1N34 E;  2V87 A;  2IHR 1;  1FS2 B;  2UUC E;  2EMI A;  1WJP A;  2PPI A;  3OML A;  5A6K A;  1XNQ E;  5FTA A;  5BR8 E;  2AST A;  1BBO A;  4B3T E;  2EN4 A;  2WZO A;  2VPK A;  2YZT A;  1FQV B;  3DCG B;  2CSH A;  1EXB E;  3IWB A;  4F9C B;  5KL3 A;  1ZBQ A;  1IQS A;  2BBG A;  2ENH A;  3AV0 A;  1LM8 C;  2EM4 A;  1QDW A;  2M4I A;  1GTK A;  2DB2 A;  3IWC A;  4AWJ B;  2YU5 A;  1IBL E;  1IBK E;  1Z1B A;  3L2O A;  2V89 A;  4DR5 E;  4JTD B;  3OTO E;  1ZAA C;  5H7G A;  1T1D A;  4W9E B;  4W9H H;  3OGK A;  2EOY A;  1J26 A;  2P1Q A;  4BKT B;  1S1G A;  5ADZ A;  4LF7 E;  5BXH A;  3LUT B;  5TSE A;  1ZR9 A;  4KZS A;  2YSP A;  2F8B A;  3HVE B;  2YTQ A;  2A79 B;  2RSI A;  4R03 A;  3J81 C;  4TUI A;  1PJQ A;  2EOF A;  2VQF E;  4Q35 B;  4JI8 E;  4K0K E;  1HNZ E;  4AP2 A;  4W9F B;  2MC6 A;  1NEI A;  2LCE A;  2R76 A;  2EPO A;  4DR3 E;  3F6H A;  3THN A;  4P7D A;  2EM8 A;  2EN1 A;  2M7Q A;  5A6A A;  4B3M E;  2N8X A;  4BCA A;  1X6H A;  4X62 E;  2EMX A;  1YFH A;  4CXI A;  3ADL A;  4GKJ E;  2E72 A;  4LTY A;  2Q8U A;  4DV3 E;  3P1X A;  2OVR A;  4DMI A;  3WSO B;  4F9A B;  1T4N A;  3HXL A;  4UYI A;  4LF9 E;  2DRP A;  2UXD E;  5IBK A;  4M9V C;  1A1I A;  2G7H A;  3VK6 A;  1EH6 A;  2JVA A;  3KWR A;  2RS7 A;  3ZTC B;  1JK2 A;  1L4S A;  1KYQ A;  4GZN C;  5IWA E;  4BHB A;  1RMD A;  2UU9 E;  2L33 A;  3LBZ A;  3TQM A;  4DV0 E;  4F6M A;  4NXM E;  2EPK X;  1YYK A;  2V88 A;  4JI2 E;  5KL4 A;  4X8W A;  2YTI A;  2UUB E;  3HU6 A;  1EKZ A;  2NUF A;  4NXN E;  1JK1 A;  4RHB B;  1X47 A;  2Q81 A;  2EPU A;  1LLM C;  2LVH A;  3ZNG B;  2I9I A;  3J7Y p;  2K7I A;  4O5G A;  2VKP A;  5CFF E;  4OOG C;  4DKK A;  2OVP A;  4BS9 A;  2IHC A;  1PJS A;  2WCC 3;  3JAM C;  4HXI A;  3E4U A;  2KHX A;  1WXR A;  5JH5 B;  2EMK A;  4U77 A;  1HNX E;  3T1H E;  5BO4 C;  1YYO A;  2EN6 A;  2L2N A;  3DRX A;  5BXB A;  2M1S A;  2EPN A;  3C4B A;  2JXP A;  1UIL A;  4AQY E;  4B9K E;  1QNT A;  2M9A A;  2DMI A;  5AC5 A;  2LO3 A;  3BID A;  5A69 A;  3M52 A;  4WSG A;  2I2R A;  4CRH A;  3IWD A;  2L6M A;  2JPA A;  4N9F 5;  1X5W A;  3ZRF B;  2DLQ A;  5IXM B;  2P1N A;  2JOB A; 
#chains in the Genus database with same CATH homology
 2RS6 A;  1HV2 A;  4DV5 E;  2LRS A;  3OGM A;  4LF4 E;  2E32 B;  2JZ3 C;  3HTM A;  3FIG A;  4M0V A;  1IBM E;  3ZOQ B;  4WPY A;  4F9B B;  3HQI A;  3DJW A;  4DUZ E;  4W9D B;  2MDR A;  1STU A;  2B9D A;  3B84 A;  3JTZ A;  3MSW A;  1R29 A;  1GZ6 A;  4P78 A;  2P1M A;  4JGH C;  4B9K B;  2VE7 C;  4JI3 E;  4YY3 E;  1QU6 A;  3ADJ A;  2CPN A;  1WHQ A;  4GEQ B;  1I94 E;  3LLH A;  1X48 A;  3HQ1 A;  5DAF A;  4BC7 A;  5LMN E;  2F4V E;  2IZV C;  2KON A;  3JU0 A;  3C6P A;  3AUZ A;  1CS3 A;  3OHV A;  4WQO C;  1R28 A;  2P1P A;  4YHH E;  3J7A G;  2MA9 C;  2V8Q B;  4TUG A;  5F3W A;  2Z8H A;  2EZ6 A;  2VQE E;  4DR7 E;  4JI7 E;  1N32 E;  5H7H A;  4R8O A;  4JI4 E;  4W9K B;  4JI1 E;  3DRZ A;  3GA1 A;  3LNM B;  5AAS A;  1A68 A;  4CXT A;  4AJY C;  3DF6 A;  4X65 E;  1RC7 A;  1QDV A;  4LF5 E;  2L2M A;  4ZOU A;  1FKA E;  2NUE A;  3VYY A;  4BKS B;  4U2N A;  2LTS A;  4I6J C;  2JR1 A;  1LDK D;  1BUO A;  2K4V A;  2V85 A;  2H36 X;  2L3J A;  4JTA B;  4B3R E;  4DR1 E;  2FGG A;  2MC5 A;  1HNW E;  1N36 E;  4LF6 E;  4JI0 E;  5DAD A;  4GKK E;  1EOD A;  1T4L B;  1ZBT A;  4DR4 E;  1XMQ E;  4JYA E;  4Q28 A;  3M4T A;  4UIJ A;  4L5N C;  4L8N A;  4KHP E;  3FKC A;  2OVQ A;  1DI2 A;  1XNR E;  3F6G A;  4JV5 E;  4W9C B;  5LMU E;  2ASS A;  4OX9 E;  1X49 A;  2HHH E;  1YZ9 A;  4DR2 E;  4CP3 A;  3ZUN B;  3VYX A;  2E31 B;  4M30 A;  2UXB E;  2LTR A;  1LQB B;  4LU9 A;  3ADI A;  4DV4 E;  5AE2 A;  2RTX A;  2JWO A;  1HR0 E;  3ZTD B;  4W9H B;  3I3N A;  5A15 A;  3T1Y E;  3K6Q A;  4W9I B;  5LLI B;  2E1M A;  5A6R A;  4J8Z A;  1PKP A;  2LUP B;  1EOF A;  1T4O A;  2NZ0 B;  2KOU A;  3ZRC B;  3KVT A;  2ODR D;  5LL6 R;  2LMZ A;  1NEX A;  5AE1 A;  5AE3 A;  2LBS B;  4JI6 E;  4X66 E;  4LFA E;  5EUP A;  3HVE A;  3M5B A;  2YT4 A;  3C4T A;  4W9G B;  2JY9 A;  4DR6 E;  4JI5 E;  4LF8 E;  2NA2 A;  2FNJ C;  1VCB B;  4LFB E;  4BMJ A;  4DV1 E;  2FTX B;  4EOZ A;  3HPZ A;  4B95 B;  2LJH A;  2RSM A;  4W9J B;  1SR9 A;  2LE2 A;  4BGC A;  2EWL A;  4U2M A;  2P1O A;  5HYW B;  2R9R B;  1UHZ A;  1XMO E;  4APF A;  4CXJ A;  2L92 A;  2UXC E;  3MKS A;  2L2K B;  3RMP A;  1YYW A;  3M8V A;  1GQE A;  2L8T A;  3HTX A;  1DSX A;  1NN7 A;  2B7T A;  3OGL A;  2C9W C;  4X64 E;  2V86 A;  2FV4 B;  4B3S E;  4DV7 E;  2YY9 A;  1DQ3 A;  2B3T B;  2ODR C;  1J5E E;  3BIM A;  5BXD A;  5FLX C;  2DSY A;  3ZKJ B;  5IT9 C;  2ZM6 E;  4LFC E;  4DUY E;  4DV2 E;  2NUG A;  4DV6 E;  3C6O A;  3OHU A;  3ADG A;  2DIX A;  2N3G A;  1FS1 B;  2NN2 A;  2LUQ A;  2B7V A;  2JOX A;  5DNY A;  4I8O A;  1O0W A;  5HZG C;  5A2Q C;  2N3H A;  1RQ0 A;  4BC9 A;  2UUA E;  4BBY A;  4WSP A;  2IF5 A;  4F54 A;  2E5L E;  4M2Z A;  1WHN A;  1EOE A;  2VF1 A;  2V83 A;  3HPS A;  2L3C A;  1P22 B;  4WYQ B;  4WFT A;  5T6J A;  1FJG E;  3J80 C;  4ZGC A;  4YY8 A;  3DRY A;  3H09 A;  3C6N A;  1R2B A;  4W9L B;  3V7D A;  2DMY A;  1N33 E;  4JTC B;  3LML A;  1N34 E;  2V87 A;  2IHR 1;  1FS2 B;  2UUC E;  2PPI A;  3OML A;  5FTA A;  1XNQ E;  5BR8 E;  2AST A;  4B3T E;  2WZO A;  2VPK A;  2YZT A;  1FQV B;  3DCG B;  1EXB E;  3IWB A;  4F9C B;  1ZBQ A;  3AV0 A;  1LM8 C;  1QDW A;  2M4I A;  2DB2 A;  3IWC A;  4AWJ B;  1IBL E;  1IBK E;  3L2O A;  2V89 A;  4DR5 E;  4JTD B;  3OTO E;  5H7G A;  1T1D A;  4W9E B;  4W9H H;  3OGK A;  1J26 A;  2P1Q A;  4BKT B;  1S1G A;  5ADZ A;  4LF7 E;  5BXH A;  3LUT B;  4KZS A;  2F8B A;  3HVE B;  2A79 B;  4R03 A;  3J81 C;  4TUI A;  2VQF E;  4JI8 E;  4K0K E;  1HNZ E;  4AP2 A;  4W9F B;  2MC6 A;  4DR3 E;  3F6H A;  4P7D A;  2M7Q A;  4B3M E;  4BCA A;  4X62 E;  4CXI A;  3ADL A;  4GKJ E;  4LTY A;  4DV3 E;  3P1X A;  2OVR A;  4DMI A;  3WSO B;  4F9A B;  1T4N A;  3HXL A;  4UYI A;  4LF9 E;  2UXD E;  5IBK A;  2G7H A;  3VK6 A;  3KWR A;  2JVA A;  2RS7 A;  3ZTC B;  5IWA E;  2UU9 E;  2L33 A;  3LBZ A;  4DV0 E;  4NXM E;  1YYK A;  2V88 A;  4JI2 E;  4X8W A;  2UUB E;  3HU6 A;  1EKZ A;  2NUF A;  4NXN E;  1X47 A;  2Q81 A;  3ZNG B;  3J7Y p;  2VKP A;  5CFF E;  4OOG C;  4DKK A;  2OVP A;  4BS9 A;  2IHC A;  3JAM C;  4HXI A;  3E4U A;  2KHX A;  1WXR A;  5JH5 B;  4U77 A;  1HNX E;  3T1H E;  5BO4 C;  1YYO A;  2L2N A;  3DRX A;  5BXB A;  2M1S A;  3C4B A;  1UIL A;  4AQY E;  4B9K E;  3M52 A;  2I2R A;  4CRH A;  3IWD A;  2L6M A;  4N9F 5;  3ZRF B;  2P1N A;  2JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...