4J8ZA

Crystal structure of the human spop btb domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
MVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAERSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Speckle-type POZ protein
publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00651 BTB BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.700 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4j8zA02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 4j8zA01
1LQBB 2P1QA 4EOZA 4U2NA 2JZ3C 4CP3A 4W9FB 5H7GA 1R28A 3LNMB 1HV2A 1P22B 4ZOUA 2ASTA 3OHVA 5HYWB 4W9IB 4U2MA 2P1MA 1FQVB 4W9CB 3HU6A 3MKSA 5BXDA 5A6RA 2OVRA 2Q81A 4CXTA 5EUPA 3ZTCB 5A15A 4APFA 2P1OA 4BGCA 3DCGB 3M4TA 4B95B 3DRZA 5BO4C 1VCBB 4HXIA 1A68A 1QDVA 2NN2A 2NZ0B 3BIMA 2OVQA 2IZVC 4B9KE 1FS1B 3M8VA 3ZKJB 1EOFA 4W9DB 2VKPA 3E4UA 2A79B 3OGLA 4AJYC 3L2OA 3OGMA 2FNJC 2IHCA 4AWJB 1DSXA 4JTDB 3ZRCB 3ZUNB 3M5BA 3OGKA 4BKTB 2IF5A 3FKCA 3ZRFB 3LBZA 4W9HH 3HQIA 4JTAB 4I6JC 4N9F5 1LDKD 2PPIA 5H7HA 4B9KB 3B84A 2ASSA 2OVPA 3OHUA 2E32B 2MA9C 2R9RB 5HZGC 3ZNGB 4JTCB 5DADA 5BXHA 1R2BA 3ZTDB 4U77A 2P1NA 5DAFA 4AP2A 4W9KB 3V7DA 3WSOB 4J8ZA 3HVEA 1T1DA 1EODA 1LM8C 4CXJA 1EOEA 3C6OA 3HTMA 1EXBE 1CS3A 4UYIA 3C6NA 3I3NA 5JH5B 4W9HB 1QDWA 4UIJA 5IBKA 4W9GB 5LLIB 3M52A 4CRHA 1NN7A 1S1GA 5FTAA 4BKSB 4JGHC 4W9LB 4WQOC 1BUOA 2VPKA 3GA1A 4CXIA 4W9EB 4W9JB 3LUTB 5BXBA 2P1PA 1NEXA 3C6PA 3KVTA 1FS2B 2I2RA 2C9WC 2Z8HA 2YY9A 1R29A 2E31B 3HVEB
chains in the Genus database with same CATH superfamily
2EPAA 1XMQE 2P1QA 2UU9E 2EQ3A 1YYWA 4WPYA 4BBYA 1T39A 3K6QA 1R28A 2EPKX 4LF5E 1P22B 2RSMA 4WSGA 4F6MA 1GQEA 3OHVA 3BGHA 3MSWA 1A1GA 3OMLA 4U2MA 4JI6E 1FQVB 5ADZA 2LT7A 4R2CA 2LVHA 5A6RA 1X6FA 2EQ0A 2YU8A 2Q81A 4F9BB 1N34E 2GHFA 2B7TA 2YWQA 1YYKA 1T4LB 4X9JA 4HXIA 2EMFA 4ZYDA 5A6AA 4DV5E 2NN2A 2OVQA 2IZVC 4KZSA 3RMPA 1FS1B 1BBOA 2EOSA 2N8XA 4F6NA 3DF6A 4NZVA 2EM5A 2V83A 3OGLA 4X8WA 2YRHA 2YPNA 2EMXA 2VRDA 3ZRCB 3UK3C 4Q28A 1HNWE 3OGKA 4R8OA 2JPAA 2YTGA 1L4SA 4BC9A 5BR8E 3HPZA 2LTRA 4N9F5 3VYXA 4GKJE 4M9VC 2PPIA 2MDRA 2JR1A 4LFAE 5AC4A 2JWOA 4GKKE 2K4VA 2OVPA 3OHUA 3VK6A 2EN7A 3M99B 3ZNGB 2FTXB 5BXHA 2EMKA 4LF4E 2RS7A 2DGCA 2WBTA 1WJPA 4AP2A 4W9KB 4JI0E 2EPCA 2YSPA 2EL6A 2B3TB 1T1DA 3J80C 3BIDA 1LM8C 1T38A 3C6OA 3C6MA 2ENCA 4UYIA 4TUGA 4WX9A 2LUPB 4YY8A 4CRHA 2UXDE 4X66E 1UILA 3JU0A 4F54A 5AE1A 4JGHC 4W9LB 4BKSB 1XMOE 2MC6A 2NUGA 3TQMA 2G7HA 2N3GA 4O43A 1X47A 5LL6R 3VYYA 2EMAA 2LUQA 4W9JB 5BXBA 2F8BA 1T4NA 1I94E 3C6PA 3KVTA 1A1LA 2KOUA 4JI7E 2EOEA 4NXNE 3J81C 2Z8HA 1KYQA 1N36E 2HC5A 2RPCA 4B3ME 2GLIA 5A6BA 4EOZA 2MC5A 4U2NA 2EQ1A 1YFHA 4DUYE 4DR2E 2DLKA 4BMJA 2L3CA 2PRTA 3LNMB 3ADLA 2YTQA 2FV4B 2LRSA 5DNYA 5KL3A 2H36X 2DB2A 3FIGA 4RHBB 2KONA 1QNTA 1X6EA 2NUEA 2P1MA 1RMDA 3L00A 2RSIA 4P7DA 3MKSA 1IQOA 2L33A 1X6HA 4X64E 3ZTCB 2P1OA 3DCGB 3M4TA 4JI1E 2EN4A 1MEYC 3DRZA 3DRXA 5BO4C 1WHQA 2ENAA 1WRJA 4LFBE 1EH7A 4BHBA 2NZ0B 1UBDC 4B3TE 2WCC3 3M8VA 4DR7E 1PJQA 4R2EA 1EOFA 2EN2A 1N32E 3EPKA 4AJYC 4OX9E 2EM0A 1IQSA 3OGMA 4FK5C 4R2SA 5KL7A 4WSPA 2EOXA 2YTPA 2ZM6E 2I13A 1A1FA 3FKCA 2RTXA 5AE2A 4R03A 2EMBA 2EOYA 1IBKE 4JI5E 4BHCA 3F6HA 4I6JC 2DMYA 3C6KA 3IWCA 2JP9A 2L3JA 1ZBTA 2EORA 2EPRA 4BCAA 3B84A 2ASSA 1STUA 2EOJA 1YUIA 4ZYEA 1A1HA 4LF7E 2N3HA 3THOB 2EP3A 1YUJA 5LMNE 4DR5E 2UUBE 4NHRA 4O5GA 2ODRD 2DLQA 1NCSA 4MLQA 2EMGA 1PDAA 3WSOB 2EM7A 2IHR1 4CXJA 1JK2A 2ELYA 1EOEA 3BF2A 2V89A 2HHHE 3HTMA 5LMUE 1EXBE 2EN3A 2EOIA 2EN8A 2HGHA 2KHXA 4W9HB 2EM9A 1QDWA 1X3CA 4NXME 4DMIA 4KHPE 2EOOA 2L6MA 3EPLA 3HQ1A 4W9GB 3IWBA 1EH8A 1EKZA 4GZNC 2LJHA 2EPXA 1S1GA 5FTAA 2EM6A 5F3WA 4HEIA 3LMLA 2LJUA 4RH8A 4WXDA 5T6JA 1BUOA 2P1PA 5A2QC 2A25A 5A69A 2EMYA 2L2KB 4DR4E 5A6BD 1FS2B 2I2RA 2YRMA 1N3GA 4OOGC 2C9WC 2DIXA 3ZOQB 1UHZA 3LLHA 4DUZE 1B69A 2YY9A 2WZOA 4WFTA 2VF1A 4LF8E 2V88A 4B3SE 5A6KA 2JZ3C 2V8QB 3C4BA 4TUIA 4WXCA 2NUFA 2YTIA 1BB8A 1HR0E 1HV2A 2M9AA 3HPSA 3KWRA 4L8NA 3JAMC 4BC7A 4R2AA 2V87A 1X5WA 2WBUA 2BBGA 2ASTA 4LTYA 3C4TA 1UN6B 2EPUA 2L92A 2VQFE 2YZTA 2EZ6A 2LTSA 1Z1BA 2YT4A 3HU6A 4W9CB 3KZZA 2EL4A 5BXDA 2RQLA 1AH5A 2OVRA 4M30A 2YSOA 5A15A 2EOMA 1A1JA 4B95B 3AV0A 2E72A 2EOQA 3VHTB 1IBME 1RQ0A 2EOZA 2L2MA 2EM4A 1QDVA 3BIMA 4B9KE 2DMIA 4JV5E 1GZ6A 4B3RE 1FJGE 4ZYHA 2NABA 4W9DB 3P1XA 1J26A 2LMZA 5AC5A 3QG5C 2A79B 2VKPA 3E4UA 3J7Yp 2EM2A 3L2OA 2ADRA 4MLVA 2FNJC 2IHCA 4JTDB 2EE8A 3ZUNB 2EPPA 3M5BA 4JYAE 4BKTB 4DR1E 4O24A 5AE3A 1IMUA 3ZRFB 2V86A 3HQIA 4LF9E 1WXRA 4GEQB 4Q35B 1J5EE 1LDKD 1ZR9A 4DV1E 1YYOA 3IWDA 2E32B 2R9RB 1QU6A 5DADA 2CPNA 4O4KA 2YU5A 2JVAA 1RC7A 4U77A 1ZAAC 1YZ9A 1X48A 2P1NA 1G2FC 5DAFA 3V7DA 4J8ZA 5FLXC 2JYAA 1XNQE 1TF6A 5JH5B 2YTDA 2V85A 1DQ3A 5KL4A 4YY3E 4UIJA 3ADJA 5LLIB 2R76A 3M52A 1GTKA 2EN1A 1NN7A 2B9DA 3ADIA 2EL5A 3EQ1A 2D9HA 1P47A 2LO3A 3J7AG 1IBLE 4WQOC 3GA1A 2EPMX 1YPNA 2L2NA 4ZYGA 2ENHA 5IV8B 4R2PA 3LUTB 1TF3A 2DSYA 2UXBE 2L8TA 2EOHA 4JI8E 5LLQA 2EM3A 3EPJA 1WHNA 1LQBB 2EMLA 4X65E 4WYQB 4CP3A 4DV7E 4W9FB 2EPLX 1HNXE 2E5LE 2EJ4A 5H7GA 2M4IA 4F9AB 1G2DC 1ZBQA 4ZGCA 2EPNA 2M1SA 2ODRC 5IXMB 1HNZE 4ZOUA 3BBGA 2LV2A 1JK1A 5HYWB 4W9IB 2EMZA 1NEIA 2I9IA 3ADGA 2R1FA 2YTNA 4L5NC 2VQEE 4DV3E 4DR3E 4DV6E 1TN9A 4CXTA 2MKDA 5EUPA 4I8OA 2EPOA 2UUCE 2RS6A 4APFA 3MHHC 4BGCA 4M2ZA 2MKNA 1MGTA 4P78A 4LFCE 1DI2A 1VCBB 1ZU1A 2YRKA 1BBGA 2NA2A 4R2RA 1LLMC 4IJDA 1A68A 4R2QA 2EPZA 4HTGA 3THNA 4JI4E 3ZKJB 3H09A 4LU9A 3T1YE 2MDGA 2UUAE 5KL6A 2Q8UA 2ELZA 4AWJB 2B7VA 1F2IG 1DSXA 4IS1C 5IT9C 1T4OA 4K0KE 2IF5A 3DRYA 3LBZA 2HJJA 4W9HH 4JTAB 4F9CB 4BS9A 5H7HA 1DGCA 2EMWA 2EM8A 1YSAC 4DV4E 2BB8A 4N4RB 4B9KB 2YTFA 2EMHA 1O0WA 2MA9C 2M7QA 4R2DA 3T1HE 5HZGC 4X62E 3EPHA 4JTCB 1R2BA 3ZTDB 2WBSA 2EMIA 2JOXA 2YTOA 3HTXA 1A1KA 2J7JA 2EOFA 2K7IA 2F4VE 1FKAE 4DV2E 4AQYE 5TSEA 2VE7C 3HVEA 4DV0E 1EODA 2CT1A 2EWLA 2LE2A 2EMCA 1N33E 3HXLA 5KL5A 2YTJA 2LCEA 1CS3A 3C6NA 3I3NA 4DR6E 2CSHA 2JOBA 3DJWA 5IBKA 2FGGA 4M0VA 5AASA 1EH6A 3KZYA 2LBSB 5IWAE 4YHHE 3F6GA 3JTZA 3OTOE 3ECRA 1A1IA 2E1MA 3AUZA 4DKKA 1SFEA 1SR9A 4JI2E 2VPKA 4CXIA 2GPIA 4JI3E 4W9EB 3MHSC 2EN6A 2CTDA 2YTEA 1KJKA 1NEXA 2JY9A 2JXPA 5A6JA 5KL2A 1PJSA 1AAYA 1XNRE 1PJTA 2UXCE 1PKPA 4F2JC 1X49A 1R29A 2E31B 3HVEB 4LF6E 2DRPA 5CFFE 4KWYA
chains in the Genus database with same CATH topology
1XMQE 2P1QA 2UU9E 1YYWA 4WPYA 4BBYA 3K6QA 1R28A 4LF5E 1P22B 2RSMA 1GQEA 3OHVA 3MSWA 4U2MA 3OMLA 4JI6E 1FQVB 5ADZA 5A6RA 2Q81A 4F9BB 1N34E 2B7TA 1YYKA 1T4LB 4HXIA 4DV5E 2NN2A 2OVQA 2IZVC 4KZSA 3RMPA 1FS1B 3DF6A 3OGLA 2V83A 4X8WA 3ZRCB 4Q28A 1HNWE 3OGKA 4R8OA 4BC9A 5BR8E 3HPZA 2LTRA 4N9F5 3VYXA 4GKJE 2PPIA 2MDRA 2JR1A 4LFAE 2JWOA 4GKKE 2K4VA 2OVPA 3OHUA 3VK6A 3ZNGB 2FTXB 5BXHA 4LF4E 2RS7A 4AP2A 4W9KB 4JI0E 2B3TB 1T1DA 3J80C 1LM8C 3C6OA 4UYIA 4TUGA 2LUPB 4YY8A 4CRHA 2UXDE 4X66E 1UILA 3JU0A 4F54A 5AE1A 4JGHC 4W9LB 4BKSB 2NUGA 2MC6A 1XMOE 2G7HA 2N3GA 1X47A 5LL6R 3VYYA 2LUQA 4W9JB 5BXBA 2F8BA 1T4NA 1I94E 3C6PA 3KVTA 2KOUA 4JI7E 4NXNE 3J81C 2Z8HA 1N36E 4B3ME 4EOZA 2MC5A 4U2NA 4DUYE 4DR2E 4BMJA 2L3CA 3LNMB 3ADLA 2FV4B 2LRSA 5DNYA 2H36X 2DB2A 3FIGA 2KONA 2P1MA 2NUEA 4P7DA 3MKSA 2L33A 4X64E 3ZTCB 2P1OA 3DCGB 3M4TA 4JI1E 3DRZA 3DRXA 5BO4C 1WHQA 4LFBE 2NZ0B 4B3TE 3M8VA 4DR7E 1EOFA 1N32E 4AJYC 4OX9E 3OGMA 4WSPA 2ZM6E 3FKCA 2RTXA 5AE2A 4R03A 1IBKE 4JI5E 3F6HA 4I6JC 2DMYA 3IWCA 2L3JA 1ZBTA 4BCAA 3B84A 2ASSA 1STUA 4LF7E 2N3HA 5LMNE 4DR5E 2UUBE 2ODRD 3WSOB 2IHR1 4CXJA 1EOEA 2HHHE 2V89A 3HTMA 5LMUE 1EXBE 2KHXA 4W9HB 1QDWA 4NXME 4DMIA 4KHPE 2L6MA 3HQ1A 4W9GB 3IWBA 1EKZA 2LJHA 1S1GA 5FTAA 5F3WA 3LMLA 5T6JA 1BUOA 2P1PA 5A2QC 2L2KB 4DR4E 1FS2B 2I2RA 4OOGC 2C9WC 2DIXA 3ZOQB 1UHZA 3LLHA 4DUZE 2YY9A 2WZOA 4WFTA 2VF1A 4LF8E 4B3SE 2V88A 2JZ3C 2V8QB 3C4BA 4TUIA 2NUFA 1HR0E 1HV2A 3HPSA 3KWRA 4L8NA 3JAMC 4BC7A 2V87A 2ASTA 4LTYA 3C4TA 2L92A 2VQFE 2YZTA 2EZ6A 2LTSA 2YT4A 3HU6A 4W9CB 5BXDA 2OVRA 4M30A 5A15A 4B95B 3AV0A 1IBME 1RQ0A 2L2MA 1QDVA 3BIMA 4B9KE 4JV5E 1GZ6A 4B3RE 1FJGE 4W9DB 3P1XA 1J26A 2LMZA 2A79B 2VKPA 3E4UA 3J7Yp 3L2OA 2FNJC 2IHCA 4JTDB 3ZUNB 3M5BA 4JYAE 4BKTB 4DR1E 5AE3A 3ZRFB 2V86A 3HQIA 4LF9E 1WXRA 4GEQB 1J5EE 1LDKD 4DV1E 1YYOA 3IWDA 2E32B 2R9RB 1QU6A 5DADA 2CPNA 2JVAA 1RC7A 4U77A 1YZ9A 1X48A 2P1NA 5DAFA 3V7DA 4J8ZA 5FLXC 1XNQE 5JH5B 2V85A 1DQ3A 4YY3E 4UIJA 3ADJA 5LLIB 3M52A 1NN7A 2B9DA 3ADIA 3J7AG 4WQOC 1IBLE 3GA1A 2L2NA 3LUTB 2DSYA 2UXBE 2L8TA 4JI8E 1WHNA 1LQBB 4X65E 4WYQB 4CP3A 4DV7E 4W9FB 1HNXE 2E5LE 5H7GA 2M4IA 4F9AB 4ZGCA 1ZBQA 2M1SA 2ODRC 1HNZE 4ZOUA 5HYWB 4W9IB 3ADGA 4L5NC 2VQEE 4DV3E 4DR3E 4DV6E 4CXTA 5EUPA 4I8OA 2UUCE 2RS6A 4APFA 4BGCA 4M2ZA 4P78A 4LFCE 1DI2A 1VCBB 2NA2A 1A68A 4JI4E 3ZKJB 3H09A 4LU9A 3T1YE 2UUAE 4AWJB 2B7VA 1DSXA 5IT9C 1T4OA 4K0KE 2IF5A 3DRYA 3LBZA 4W9HH 4JTAB 4F9CB 4BS9A 5H7HA 4B9KB 4DV4E 1O0WA 2MA9C 2M7QA 3T1HE 5HZGC 4X62E 4JTCB 1R2BA 3ZTDB 2JOXA 3HTXA 2F4VE 1FKAE 4DV2E 4AQYE 2VE7C 3HVEA 4DV0E 1EODA 2EWLA 2LE2A 1N33E 3HXLA 1CS3A 3C6NA 3I3NA 4DR6E 2JOBA 3DJWA 5IBKA 2FGGA 4M0VA 5AASA 2LBSB 5IWAE 4YHHE 3F6GA 3JTZA 3OTOE 2E1MA 3AUZA 4DKKA 1SR9A 4JI2E 2VPKA 4CXIA 4JI3E 4W9EB 1NEXA 2JY9A 1XNRE 2UXCE 1PKPA 1X49A 1R29A 2E31B 3HVEB 4LF6E 5CFFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQB B;  2P1Q A;  4EOZ A;  4U2N A;  2JZ3 C;  4CP3 A;  4W9F B;  5H7G A;  1R28 A;  3LNM B;  1HV2 A;  1P22 B;  4ZOU A;  2AST A;  3OHV A;  5HYW B;  4W9I B;  4U2M A;  2P1M A;  1FQV B;  4W9C B;  3HU6 A;  3MKS A;  5BXD A;  5A6R A;  2OVR A;  2Q81 A;  4CXT A;  5EUP A;  3ZTC B;  5A15 A;  4APF A;  2P1O A;  4BGC A;  3DCG B;  3M4T A;  4B95 B;  3DRZ A;  5BO4 C;  1VCB B;  4HXI A;  1A68 A;  1QDV A;  2NN2 A;  2NZ0 B;  3BIM A;  2OVQ A;  2IZV C;  4B9K E;  1FS1 B;  3M8V A;  3ZKJ B;  1EOF A;  4W9D B;  2VKP A;  3E4U A;  2A79 B;  3OGL A;  4AJY C;  3L2O A;  3OGM A;  2FNJ C;  2IHC A;  4AWJ B;  1DSX A;  4JTD B;  3ZRC B;  3ZUN B;  3M5B A;  3OGK A;  4BKT B;  2IF5 A;  3FKC A;  3ZRF B;  3LBZ A;  4W9H H;  3HQI A;  4JTA B;  4I6J C;  4N9F 5;  1LDK D;  2PPI A;  5H7H A;  4B9K B;  3B84 A;  2ASS A;  2OVP A;  3OHU A;  2E32 B;  2MA9 C;  2R9R B;  5HZG C;  3ZNG B;  4JTC B;  5DAD A;  5BXH A;  1R2B A;  3ZTD B;  4U77 A;  2P1N A;  5DAF A;  4AP2 A;  4W9K B;  3V7D A;  3WSO B;  4J8Z A;  3HVE A;  1T1D A;  1EOD A;  1LM8 C;  4CXJ A;  1EOE A;  3C6O A;  3HTM A;  1EXB E;  1CS3 A;  4UYI A;  3C6N A;  3I3N A;  5JH5 B;  4W9H B;  1QDW A;  4UIJ A;  5IBK A;  4W9G B;  5LLI B;  3M52 A;  4CRH A;  1NN7 A;  1S1G A;  5FTA A;  4BKS B;  4JGH C;  4W9L B;  4WQO C;  1BUO A;  2VPK A;  3GA1 A;  4CXI A;  4W9E B;  4W9J B;  3LUT B;  5BXB A;  2P1P A;  1NEX A;  3C6P A;  3KVT A;  1FS2 B;  2I2R A;  2C9W C;  2Z8H A;  2YY9 A;  1R29 A;  2E31 B;  3HVE B; 
#chains in the Genus database with same CATH topology
 2EPA A;  1XMQ E;  2P1Q A;  2UU9 E;  2EQ3 A;  1YYW A;  4WPY A;  4BBY A;  1T39 A;  3K6Q A;  1R28 A;  2EPK X;  4LF5 E;  1P22 B;  2RSM A;  4WSG A;  4F6M A;  1GQE A;  3OHV A;  3BGH A;  3MSW A;  1A1G A;  3OML A;  4U2M A;  4JI6 E;  1FQV B;  5ADZ A;  2LT7 A;  4R2C A;  2LVH A;  5A6R A;  1X6F A;  2EQ0 A;  2YU8 A;  2Q81 A;  4F9B B;  1N34 E;  2GHF A;  2B7T A;  2YWQ A;  1YYK A;  1T4L B;  4X9J A;  4HXI A;  2EMF A;  4ZYD A;  5A6A A;  4DV5 E;  2NN2 A;  2OVQ A;  2IZV C;  4KZS A;  3RMP A;  1FS1 B;  1BBO A;  2EOS A;  2N8X A;  4F6N A;  3DF6 A;  4NZV A;  2EM5 A;  2V83 A;  3OGL A;  4X8W A;  2YRH A;  2YPN A;  2EMX A;  2VRD A;  3ZRC B;  3UK3 C;  4Q28 A;  1HNW E;  3OGK A;  4R8O A;  2JPA A;  2YTG A;  1L4S A;  4BC9 A;  5BR8 E;  3HPZ A;  2LTR A;  4N9F 5;  3VYX A;  4GKJ E;  4M9V C;  2PPI A;  2MDR A;  2JR1 A;  4LFA E;  5AC4 A;  2JWO A;  4GKK E;  2K4V A;  2OVP A;  3OHU A;  3VK6 A;  2EN7 A;  3M99 B;  3ZNG B;  2FTX B;  5BXH A;  2EMK A;  4LF4 E;  2RS7 A;  2DGC A;  2WBT A;  1WJP A;  4AP2 A;  4W9K B;  4JI0 E;  2EPC A;  2YSP A;  2EL6 A;  2B3T B;  1T1D A;  3J80 C;  3BID A;  1LM8 C;  1T38 A;  3C6O A;  3C6M A;  2ENC A;  4UYI A;  4TUG A;  4WX9 A;  2LUP B;  4YY8 A;  4CRH A;  2UXD E;  4X66 E;  1UIL A;  3JU0 A;  4F54 A;  5AE1 A;  4JGH C;  4W9L B;  4BKS B;  1XMO E;  2MC6 A;  2NUG A;  3TQM A;  2G7H A;  2N3G A;  4O43 A;  1X47 A;  5LL6 R;  3VYY A;  2EMA A;  2LUQ A;  4W9J B;  5BXB A;  2F8B A;  1T4N A;  1I94 E;  3C6P A;  3KVT A;  1A1L A;  2KOU A;  4JI7 E;  2EOE A;  4NXN E;  3J81 C;  2Z8H A;  1KYQ A;  1N36 E;  2HC5 A;  2RPC A;  4B3M E;  2GLI A;  5A6B A;  4EOZ A;  2MC5 A;  4U2N A;  2EQ1 A;  1YFH A;  4DUY E;  4DR2 E;  2DLK A;  4BMJ A;  2L3C A;  2PRT A;  3LNM B;  3ADL A;  2YTQ A;  2FV4 B;  2LRS A;  5DNY A;  5KL3 A;  2H36 X;  2DB2 A;  3FIG A;  4RHB B;  2KON A;  1QNT A;  1X6E A;  2NUE A;  2P1M A;  1RMD A;  3L00 A;  2RSI A;  4P7D A;  3MKS A;  1IQO A;  2L33 A;  1X6H A;  4X64 E;  3ZTC B;  2P1O A;  3DCG B;  3M4T A;  4JI1 E;  2EN4 A;  1MEY C;  3DRZ A;  3DRX A;  5BO4 C;  1WHQ A;  2ENA A;  1WRJ A;  4LFB E;  1EH7 A;  4BHB A;  2NZ0 B;  1UBD C;  4B3T E;  2WCC 3;  3M8V A;  4DR7 E;  1PJQ A;  4R2E A;  1EOF A;  2EN2 A;  1N32 E;  3EPK A;  4AJY C;  4OX9 E;  2EM0 A;  1IQS A;  3OGM A;  4FK5 C;  4R2S A;  5KL7 A;  4WSP A;  2EOX A;  2YTP A;  2ZM6 E;  2I13 A;  1A1F A;  3FKC A;  2RTX A;  5AE2 A;  4R03 A;  2EMB A;  2EOY A;  1IBK E;  4JI5 E;  4BHC A;  3F6H A;  4I6J C;  2DMY A;  3C6K A;  3IWC A;  2JP9 A;  2L3J A;  1ZBT A;  2EOR A;  2EPR A;  4BCA A;  3B84 A;  2ASS A;  1STU A;  2EOJ A;  1YUI A;  4ZYE A;  1A1H A;  4LF7 E;  2N3H A;  3THO B;  2EP3 A;  1YUJ A;  5LMN E;  4DR5 E;  2UUB E;  4NHR A;  4O5G A;  2ODR D;  2DLQ A;  1NCS A;  4MLQ A;  2EMG A;  1PDA A;  3WSO B;  2EM7 A;  2IHR 1;  4CXJ A;  1JK2 A;  2ELY A;  1EOE A;  3BF2 A;  2V89 A;  2HHH E;  3HTM A;  5LMU E;  1EXB E;  2EN3 A;  2EOI A;  2EN8 A;  2HGH A;  2KHX A;  4W9H B;  2EM9 A;  1QDW A;  1X3C A;  4NXM E;  4DMI A;  4KHP E;  2EOO A;  2L6M A;  3EPL A;  3HQ1 A;  4W9G B;  3IWB A;  1EH8 A;  1EKZ A;  4GZN C;  2LJH A;  2EPX A;  1S1G A;  5FTA A;  2EM6 A;  5F3W A;  4HEI A;  3LML A;  2LJU A;  4RH8 A;  4WXD A;  5T6J A;  1BUO A;  2P1P A;  5A2Q C;  2A25 A;  5A69 A;  2EMY A;  2L2K B;  4DR4 E;  5A6B D;  1FS2 B;  2I2R A;  2YRM A;  1N3G A;  4OOG C;  2C9W C;  2DIX A;  3ZOQ B;  1UHZ A;  3LLH A;  4DUZ E;  1B69 A;  2YY9 A;  2WZO A;  4WFT A;  2VF1 A;  4LF8 E;  2V88 A;  4B3S E;  5A6K A;  2JZ3 C;  2V8Q B;  3C4B A;  4TUI A;  4WXC A;  2NUF A;  2YTI A;  1BB8 A;  1HR0 E;  1HV2 A;  2M9A A;  3HPS A;  3KWR A;  4L8N A;  3JAM C;  4BC7 A;  4R2A A;  2V87 A;  1X5W A;  2WBU A;  2BBG A;  2AST A;  4LTY A;  3C4T A;  1UN6 B;  2EPU A;  2L92 A;  2VQF E;  2YZT A;  2EZ6 A;  2LTS A;  1Z1B A;  2YT4 A;  3HU6 A;  4W9C B;  3KZZ A;  2EL4 A;  5BXD A;  2RQL A;  1AH5 A;  2OVR A;  4M30 A;  2YSO A;  5A15 A;  2EOM A;  1A1J A;  4B95 B;  3AV0 A;  2E72 A;  2EOQ A;  3VHT B;  1IBM E;  1RQ0 A;  2EOZ A;  2L2M A;  2EM4 A;  1QDV A;  3BIM A;  4B9K E;  2DMI A;  4JV5 E;  1GZ6 A;  4B3R E;  1FJG E;  4ZYH A;  2NAB A;  4W9D B;  3P1X A;  1J26 A;  2LMZ A;  5AC5 A;  3QG5 C;  2A79 B;  2VKP A;  3E4U A;  3J7Y p;  2EM2 A;  3L2O A;  2ADR A;  4MLV A;  2FNJ C;  2IHC A;  4JTD B;  2EE8 A;  3ZUN B;  2EPP A;  3M5B A;  4JYA E;  4BKT B;  4DR1 E;  4O24 A;  5AE3 A;  1IMU A;  3ZRF B;  2V86 A;  3HQI A;  4LF9 E;  1WXR A;  4GEQ B;  4Q35 B;  1J5E E;  1LDK D;  1ZR9 A;  4DV1 E;  1YYO A;  3IWD A;  2E32 B;  2R9R B;  1QU6 A;  5DAD A;  2CPN A;  4O4K A;  2YU5 A;  2JVA A;  1RC7 A;  4U77 A;  1ZAA C;  1YZ9 A;  1X48 A;  2P1N A;  1G2F C;  5DAF A;  3V7D A;  4J8Z A;  5FLX C;  2JYA A;  1XNQ E;  1TF6 A;  5JH5 B;  2YTD A;  2V85 A;  1DQ3 A;  5KL4 A;  4YY3 E;  4UIJ A;  3ADJ A;  5LLI B;  2R76 A;  3M52 A;  1GTK A;  2EN1 A;  1NN7 A;  2B9D A;  3ADI A;  2EL5 A;  3EQ1 A;  2D9H A;  1P47 A;  2LO3 A;  3J7A G;  1IBL E;  4WQO C;  3GA1 A;  2EPM X;  1YPN A;  2L2N A;  4ZYG A;  2ENH A;  5IV8 B;  4R2P A;  3LUT B;  1TF3 A;  2DSY A;  2UXB E;  2L8T A;  2EOH A;  4JI8 E;  5LLQ A;  2EM3 A;  3EPJ A;  1WHN A;  1LQB B;  2EML A;  4X65 E;  4WYQ B;  4CP3 A;  4DV7 E;  4W9F B;  2EPL X;  1HNX E;  2E5L E;  2EJ4 A;  5H7G A;  2M4I A;  4F9A B;  1G2D C;  1ZBQ A;  4ZGC A;  2EPN A;  2M1S A;  2ODR C;  5IXM B;  1HNZ E;  4ZOU A;  3BBG A;  2LV2 A;  1JK1 A;  5HYW B;  4W9I B;  2EMZ A;  1NEI A;  2I9I A;  3ADG A;  2R1F A;  2YTN A;  4L5N C;  2VQE E;  4DV3 E;  4DR3 E;  4DV6 E;  1TN9 A;  4CXT A;  2MKD A;  5EUP A;  4I8O A;  2EPO A;  2UUC E;  2RS6 A;  4APF A;  3MHH C;  4BGC A;  4M2Z A;  2MKN A;  1MGT A;  4P78 A;  4LFC E;  1DI2 A;  1VCB B;  1ZU1 A;  2YRK A;  1BBG A;  2NA2 A;  4R2R A;  1LLM C;  4IJD A;  1A68 A;  4R2Q A;  2EPZ A;  4HTG A;  3THN A;  4JI4 E;  3ZKJ B;  3H09 A;  4LU9 A;  3T1Y E;  2MDG A;  2UUA E;  5KL6 A;  2Q8U A;  2ELZ A;  4AWJ B;  2B7V A;  1F2I G;  1DSX A;  4IS1 C;  5IT9 C;  1T4O A;  4K0K E;  2IF5 A;  3DRY A;  3LBZ A;  2HJJ A;  4W9H H;  4JTA B;  4F9C B;  4BS9 A;  5H7H A;  1DGC A;  2EMW A;  2EM8 A;  1YSA C;  4DV4 E;  2BB8 A;  4N4R B;  4B9K B;  2YTF A;  2EMH A;  1O0W A;  2MA9 C;  2M7Q A;  4R2D A;  3T1H E;  5HZG C;  4X62 E;  3EPH A;  4JTC B;  1R2B A;  3ZTD B;  2WBS A;  2EMI A;  2JOX A;  2YTO A;  3HTX A;  1A1K A;  2J7J A;  2EOF A;  2K7I A;  2F4V E;  1FKA E;  4DV2 E;  4AQY E;  5TSE A;  2VE7 C;  3HVE A;  4DV0 E;  1EOD A;  2CT1 A;  2EWL A;  2LE2 A;  2EMC A;  1N33 E;  3HXL A;  5KL5 A;  2YTJ A;  2LCE A;  1CS3 A;  3C6N A;  3I3N A;  4DR6 E;  2CSH A;  2JOB A;  3DJW A;  5IBK A;  2FGG A;  4M0V A;  5AAS A;  1EH6 A;  3KZY A;  2LBS B;  5IWA E;  4YHH E;  3F6G A;  3JTZ A;  3OTO E;  3ECR A;  1A1I A;  2E1M A;  3AUZ A;  4DKK A;  1SFE A;  1SR9 A;  4JI2 E;  2VPK A;  4CXI A;  2GPI A;  4JI3 E;  4W9E B;  3MHS C;  2EN6 A;  2CTD A;  2YTE A;  1KJK A;  1NEX A;  2JY9 A;  2JXP A;  5A6J A;  5KL2 A;  1PJS A;  1AAY A;  1XNR E;  1PJT A;  2UXC E;  1PKP A;  4F2J C;  1X49 A;  1R29 A;  2E31 B;  3HVE B;  4LF6 E;  2DRP A;  5CFF E;  4KWY A; 
#chains in the Genus database with same CATH homology
 1XMQ E;  2P1Q A;  2UU9 E;  1YYW A;  4WPY A;  4BBY A;  3K6Q A;  1R28 A;  4LF5 E;  1P22 B;  2RSM A;  1GQE A;  3OHV A;  3MSW A;  4U2M A;  3OML A;  4JI6 E;  1FQV B;  5ADZ A;  5A6R A;  2Q81 A;  4F9B B;  1N34 E;  2B7T A;  1YYK A;  1T4L B;  4HXI A;  4DV5 E;  2NN2 A;  2OVQ A;  2IZV C;  4KZS A;  3RMP A;  1FS1 B;  3DF6 A;  3OGL A;  2V83 A;  4X8W A;  3ZRC B;  4Q28 A;  1HNW E;  3OGK A;  4R8O A;  4BC9 A;  5BR8 E;  3HPZ A;  2LTR A;  4N9F 5;  3VYX A;  4GKJ E;  2PPI A;  2MDR A;  2JR1 A;  4LFA E;  2JWO A;  4GKK E;  2K4V A;  2OVP A;  3OHU A;  3VK6 A;  3ZNG B;  2FTX B;  5BXH A;  4LF4 E;  2RS7 A;  4AP2 A;  4W9K B;  4JI0 E;  2B3T B;  1T1D A;  3J80 C;  1LM8 C;  3C6O A;  4UYI A;  4TUG A;  2LUP B;  4YY8 A;  4CRH A;  2UXD E;  4X66 E;  1UIL A;  3JU0 A;  4F54 A;  5AE1 A;  4JGH C;  4W9L B;  4BKS B;  2NUG A;  2MC6 A;  1XMO E;  2G7H A;  2N3G A;  1X47 A;  5LL6 R;  3VYY A;  2LUQ A;  4W9J B;  5BXB A;  2F8B A;  1T4N A;  1I94 E;  3C6P A;  3KVT A;  2KOU A;  4JI7 E;  4NXN E;  3J81 C;  2Z8H A;  1N36 E;  4B3M E;  4EOZ A;  2MC5 A;  4U2N A;  4DUY E;  4DR2 E;  4BMJ A;  2L3C A;  3LNM B;  3ADL A;  2FV4 B;  2LRS A;  5DNY A;  2H36 X;  2DB2 A;  3FIG A;  2KON A;  2P1M A;  2NUE A;  4P7D A;  3MKS A;  2L33 A;  4X64 E;  3ZTC B;  2P1O A;  3DCG B;  3M4T A;  4JI1 E;  3DRZ A;  3DRX A;  5BO4 C;  1WHQ A;  4LFB E;  2NZ0 B;  4B3T E;  3M8V A;  4DR7 E;  1EOF A;  1N32 E;  4AJY C;  4OX9 E;  3OGM A;  4WSP A;  2ZM6 E;  3FKC A;  2RTX A;  5AE2 A;  4R03 A;  1IBK E;  4JI5 E;  3F6H A;  4I6J C;  2DMY A;  3IWC A;  2L3J A;  1ZBT A;  4BCA A;  3B84 A;  2ASS A;  1STU A;  4LF7 E;  2N3H A;  5LMN E;  4DR5 E;  2UUB E;  2ODR D;  3WSO B;  2IHR 1;  4CXJ A;  1EOE A;  2HHH E;  2V89 A;  3HTM A;  5LMU E;  1EXB E;  2KHX A;  4W9H B;  1QDW A;  4NXM E;  4DMI A;  4KHP E;  2L6M A;  3HQ1 A;  4W9G B;  3IWB A;  1EKZ A;  2LJH A;  1S1G A;  5FTA A;  5F3W A;  3LML A;  5T6J A;  1BUO A;  2P1P A;  5A2Q C;  2L2K B;  4DR4 E;  1FS2 B;  2I2R A;  4OOG C;  2C9W C;  2DIX A;  3ZOQ B;  1UHZ A;  3LLH A;  4DUZ E;  2YY9 A;  2WZO A;  4WFT A;  2VF1 A;  4LF8 E;  4B3S E;  2V88 A;  2JZ3 C;  2V8Q B;  3C4B A;  4TUI A;  2NUF A;  1HR0 E;  1HV2 A;  3HPS A;  3KWR A;  4L8N A;  3JAM C;  4BC7 A;  2V87 A;  2AST A;  4LTY A;  3C4T A;  2L92 A;  2VQF E;  2YZT A;  2EZ6 A;  2LTS A;  2YT4 A;  3HU6 A;  4W9C B;  5BXD A;  2OVR A;  4M30 A;  5A15 A;  4B95 B;  3AV0 A;  1IBM E;  1RQ0 A;  2L2M A;  1QDV A;  3BIM A;  4B9K E;  4JV5 E;  1GZ6 A;  4B3R E;  1FJG E;  4W9D B;  3P1X A;  1J26 A;  2LMZ A;  2A79 B;  2VKP A;  3E4U A;  3J7Y p;  3L2O A;  2FNJ C;  2IHC A;  4JTD B;  3ZUN B;  3M5B A;  4JYA E;  4BKT B;  4DR1 E;  5AE3 A;  3ZRF B;  2V86 A;  3HQI A;  4LF9 E;  1WXR A;  4GEQ B;  1J5E E;  1LDK D;  4DV1 E;  1YYO A;  3IWD A;  2E32 B;  2R9R B;  1QU6 A;  5DAD A;  2CPN A;  2JVA A;  1RC7 A;  4U77 A;  1YZ9 A;  1X48 A;  2P1N A;  5DAF A;  3V7D A;  4J8Z A;  5FLX C;  1XNQ E;  5JH5 B;  2V85 A;  1DQ3 A;  4YY3 E;  4UIJ A;  3ADJ A;  5LLI B;  3M52 A;  1NN7 A;  2B9D A;  3ADI A;  3J7A G;  4WQO C;  1IBL E;  3GA1 A;  2L2N A;  3LUT B;  2DSY A;  2UXB E;  2L8T A;  4JI8 E;  1WHN A;  1LQB B;  4X65 E;  4WYQ B;  4CP3 A;  4DV7 E;  4W9F B;  1HNX E;  2E5L E;  5H7G A;  2M4I A;  4F9A B;  4ZGC A;  1ZBQ A;  2M1S A;  2ODR C;  1HNZ E;  4ZOU A;  5HYW B;  4W9I B;  3ADG A;  4L5N C;  2VQE E;  4DV3 E;  4DR3 E;  4DV6 E;  4CXT A;  5EUP A;  4I8O A;  2UUC E;  2RS6 A;  4APF A;  4BGC A;  4M2Z A;  4P78 A;  4LFC E;  1DI2 A;  1VCB B;  2NA2 A;  1A68 A;  4JI4 E;  3ZKJ B;  3H09 A;  4LU9 A;  3T1Y E;  2UUA E;  4AWJ B;  2B7V A;  1DSX A;  5IT9 C;  1T4O A;  4K0K E;  2IF5 A;  3DRY A;  3LBZ A;  4W9H H;  4JTA B;  4F9C B;  4BS9 A;  5H7H A;  4B9K B;  4DV4 E;  1O0W A;  2MA9 C;  2M7Q A;  3T1H E;  5HZG C;  4X62 E;  4JTC B;  1R2B A;  3ZTD B;  2JOX A;  3HTX A;  2F4V E;  1FKA E;  4DV2 E;  4AQY E;  2VE7 C;  3HVE A;  4DV0 E;  1EOD A;  2EWL A;  2LE2 A;  1N33 E;  3HXL A;  1CS3 A;  3C6N A;  3I3N A;  4DR6 E;  2JOB A;  3DJW A;  5IBK A;  2FGG A;  4M0V A;  5AAS A;  2LBS B;  5IWA E;  4YHH E;  3F6G A;  3JTZ A;  3OTO E;  2E1M A;  3AUZ A;  4DKK A;  1SR9 A;  4JI2 E;  2VPK A;  4CXI A;  4JI3 E;  4W9E B;  1NEX A;  2JY9 A;  1XNR E;  2UXC E;  1PKP A;  1X49 A;  1R29 A;  2E31 B;  3HVE B;  4LF6 E;  5CFF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...