3DRXA

X-ray crystal structure of human kctd5 protein crystallized in high-salt buffer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
161
Chain Sequence
ALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIEFLCVVSKELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pentameric assembly of potassium channel tetramerization domain-containing protein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords BTB/POZ domain-containing protein KCTD5
total genus 37
structure length 161
sequence length 177
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02214 BTB_2 BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drxA03
3.30.710.20 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3drxA01
4YY8A 3DRXA 3DRYA 4ZGCA
chains in the Genus database with same CATH superfamily
3O3LA 5IS2A 2CDRB 3WIUA 4MYUA 1T05A 1NK9A 3R5BA 4P7TA 1NU4A 2HVHA 2GGPB 1VGYA 3HVTA 2PDAA 4CDIA 1KLNA 3THTA 4YB1P 1IN0A 1YKWA 4NYZA 2VOPA 3J81Y 4JI2F 3VQSA 2Z8QA 3AB4B 3DYAA 3AD9C 1SQGA 2CQ2A 1X4GA 2YWEA 1UL3A 4NX9A 1L3UA 2HGMA 3JAMU 2W1BA 4OYIA 2KTQA 4WF9Q 4ZIWA 4DPXA 2OSRA 1JLFA 2HWHA 4O4RA 2VD3A 2IRXA 5D0GA 1XR7A 2XG8A 5D4PA 3U1NA 4DMZA 1UTAA 4OZ2A 5HN0A 5A8RB 5KG1A 2UP1A 4S0MA 4J9PA 2FLLA 1E6VA 5D6GA 4KIAA 1RYSA 2EVZA 2DY9A 1VFJA 3D1HA 4ZP6A 4ZPTR 3ZZOA 3W2VA 1H72C 2HZAA 5H9EJ 3IS9B 2DO4A 1T3NA 5KFUA 1Z4UA 4FBUA 1P22B 3A8KA 4AFFA 1RAEB 3LQVA 5CA5A 2K7KA 3V6KA 1RTHB 1YJUA 1AZSB 1UWAA 3TNVA 2HRYA 3CUNA 2IMWP 2VBYA 2J0XA 1IUJA 3ILIA 3Q8YA 2CWXA 4ICLA 2Q81A 1FE0A 1HARA 4J9RA 2B9YA 2HW3A 4USHA 4DV7F 3PJXA 3RJMB 3V4MA 1D8ZA 3NEKA 1YBTA 4I4BA 4ED3A 2XMMA 2IM2A 3H2LA 4EOZA 4L72B 2KXFA 3D6FB 1R43A 2RQCA 1F1BB 3GFHA 1AUDA 3NMAA 3ZUNB 3K5MA 2DKOB 4PXDA 4W9HB 3C19A 5C25B 3KFWX 5L46A 3QO9B 3JSMA 1R7IA 3M2RA 3MM8B 1UVMA 1AYEA 4C48A 4O4GB 5K14B 1VQPS 3K89A 1EKSA 1XNQJ 3OHAA 5ETQA 1U6ZA 2B4VA 4OHVA 3G86A 4BKSB 2AGQA 1O0PA 3CVKA 4PXCA 4M94A 3NAHA 5ETNA 4Q5VA 4NLOA 4P74A 1X5SA 3MEGB 4ZOSA 1D9FA 2R9RB 3IRXA 1K9MT 4PXBA 2OELA 1R2BA 3ZKJB 5A8RA 4ZVRB 3KHHA 3ISND 5HBMB 4YY3F 1N5YB 4W98A 2C2KB 4LF1A 2ZC3A 3B4DA 1HMVA 4WJBA 1T9XA 4DPWA 5M2PA 3PR4A 3CCSS 4WWSA 4O3SA 1FRXA 2HBYB 4M5LA 5EHHA 4DFJA 4UQTA 2IVFB 2BXJA 4RW9B 4OQJA 2I6WA 3OL7A 1MLAA 4ZHRB 2R2TA 5LMNJ 1PG5B 2HFZA 1BLUA 1FX2A 5CXTA 2PGCA 1CS3A 4RBTA 3IRWP 4DLEA 3SCLE 2HLTA 3PM9A 5HVGA 1SJFA 1OYEA 3AQPA 3QGHA 1KN6A 4OZJA 2W7OA 2YWKA 2VBXA 3RBZA 4RWWA 3BH7B 4DR3J 1ZOTA 2B0GA 2CPFA 2HBRB 2H4YB 4ID8A 4RBVA 1Q86T 2PI5A 4CRHA 3O44A 5FTAA 2BUNA 1NHKL 2XMTA 2W9BA 4NCAA 2JLFA 3MM6A 5KFFA 1BGXT 2YVSA 1XNRJ 2VONA 3SXLA 2OSQA 3GV8B 1BY9A 1V5IB 4F25A 2QA4G 3V6DB 5H9FK 1SKRA 4KKOB 3MPVA 5KFIA 1U8WA 1IKVB 5DG7A 1QAJA 2XCPA 2K06A 3CMQA 3KLFB 5I42B 4V19J 4M5GA 1UW9A 4ZLPA 3RRHA 3N9UC 4OZ3A 1YITS 2XHCA 3RBDA 2DT9A 5CH7B 1JX4A 2XULA 1CS4A 4K4UA 1TL1B 4NPOA 4CO0A 1RWPB 3B54A 1UMJA 2M7SA 2WONA 5C2CA 4CLZA 3M05A 4ZVFA 3WZ0A 4J90A 3ZNGB 1RAGB 3GTYX 3TX8A 1VCBB 4JTAB 4KE5A 3C66A 2OLWA 2UVRA 4KH0B 4C97A 3FZ2A 2OJ3A 4LQ3A 5DDPC 2ZZMA 1RAIB 1FDNA 4FVCA 1MROB 4DR2J 2OTLS 3H4BA 1IM6A 2LVWA 4ZVTB 1DQ9A 2H51B 3QFHA 4FF1A 4E98A 1HWUA 2JRSA 2X3GA 2E9ZA 2DH8A 4ED4A 1SC1B 3M6XA 2DXEA 1FJGF 4OHYA 2RHSB 2YQ1A 3BKFA 4IG3A 5AE3A 2A6OA 2HK2A 4CTAA 2QMWA 5L9NA 3BPDA 2CZVC 1HW9A 2EPIA 2KB2A 2VC1A 2Q1LA 4J9MA 4P2MA 2BW2A 5DADA 3MAQA 2HWTA 1TU0B 2CJAA 1WD6A 4O23A 1S1TA 3J80Y 4F4YA 4C4WA 4KKOA 1N5QA 2BJ8A 2MSTA 4H4MB 2UVVA 1V5VA 1NEXA 2BVZA 3RZAA 2BJEA 3AQOA 3SCKE 4B02A 2PD1A 3T5KA 4DL7A 1Q7YT 1RHQB 4LT6A 4NLSA 5K8NA 2V4QA 3LWMA 2DCUB 5H9FJ 2GO9A 1IR1A 1S0VA 5AT1B 2W01A 2HQIA 3HF5A 1RTDA 5BXBA 4KQZA 3R6GB 4DXLA 4FF3A 2D41A 4WK3A 5D77A 1J5EF 3NOCA 1NJZA 1D1UA 1K1SA 4DPUA 5M2RA 1RTIA 1RXOB 4NLRA 4R8UA 2MQMA 5FD1A 3U7JA 2XS5A 2P1MA 3JB9k 2IYIA 3EWGA 3DDNA 4YMEA 3AA8A 1TK5A 3CD6S 4WP3A 3OSNA 1TQLA 4F2SA 2V94A 2R7TA 1X4CA 1FRMA 1VRTA 1S1XB 2J7UA 3I4HX 2CQCA 2E5HA 3ZTRA 3SV3A 3EYZA 4J9QA 4ZJQA 1FNXH 3IWNC 4DBQA 4HTJA 1NJYA 4USMA 3LGNA 3H5XA 2KVQE 1OSDA 3S6EA 2DNGA 2CQPA 2IY5B 5KT2A 1CQMA 1RTJA 4ZOUA 3AJDA 3VGSA 2HHXA 3L3CA 5HMWA 3MAHA 4ZLJA 1WACA 4KV8B 2VFTA 1WKKA 5KFJA 2A3JA 5K5MA 5IV4A 3CSKA 1HNVB 1UVLA 5IBKA 4PEOA 2Z57B 2ZWOA 1S57A 3NG8A 2WVCA 2QSFA 3N6LA 2J76E 3VGUA 1VBYA 5DAFA 2B5JA 3BH6B 4C98A 3DM2B 2BQ3A 1X60A 5LMUF 3K0JA 1T9UA 4OYPA 4O3NA 2CVEA 4DL5A 4LBHA 1OIAA 1S7IA 1TP7A 2FHMA 2AGOA 4M1KA 4B08A 4O44A 4PG5A 4DS5A 3GLJA 3CJ0A 3G8QA 4USTA 3IM8A 4FS2A 3SBMA 1TKZB 3EGWB 1MNEA 4H4KC 3E8OA 1ZM4A 4IUFA 4F67A 4DR4F 1H3DA 4AWJB 2VPZB 2CNNB 1MMLA 4QR2A 4ZVPB 5HJXA 3UN5A 4FS1A 3RB4A 1KTVA 2RS8A 5LM7E 2O5DA 2NR0A 2KJWA 3N79A 4JV5J 1U1NA 2C3PA 1Q4RA 1VQSA 2CJQA 4CLLA 1Q5VA 2CQIA 1IBLF 4QWDA 3V5RA 4HH0A 1JK9B 1RWWB 1DBDA 3JS9A 3ZXWA 3DOKA 1H73A 1RU1A 2ZD1A 1S6QB 3UVJB 4C8OA 2VOOA 4IFYA 2Q79A 3F0NA 4ZN1A 5A0YB 2QEXS 3TP2A 5BO4C 1SUQB 2AQ4A 3U1MA 2ZH1A 3P5BP 3NLCA 1N6QA 4LRDA 4RNOA 4HDHA 3H2VE 1UFKA 4WIIA 1A7GE 2KDOA 3FSYA 1HKAA 2WAQD 1DSXA 4K2XA 4P2FA 4BC7A 2P1PA 4YR3A 4F4WA 1YBAA 5FIIA 2JSXA 1XMOJ 3TI0A 4IOAQ 1CC8A 1VS3A 2PFDA 3HDSA 4N77A 2L9DA 2G1HA 2NSBA 1HHTP 4ZKAA 3UD5A 1KOHA 4DX6A 3NXZA 5IT9Y 2RF2A 1ZA2B 2CUYA 3HHLB 1CJUB 4WZMA 3I9V9 4FP9A 3CNQP 3RRGA 5FDLB 2RU9A 3BSOA 1NSPA 2F65A 4XTTA 4ALZA 4C8LA 1REVB 4TY9A 4LJMA 4KFBA 1HNZF 4DV5F 4OI1A 1GMWA 3M9OB 3LP0B 4NASA 4OIXA 3W8PA 2NXEA 5B0CA 2WB1D 1OPZA 1R6YA 2M4MA 4DPYA 1VQ6S 3QAEA 4G3IA 1CJKA 2HQDA 2O66A 2YKMA 2J6UA 3QWPA 5E3RA 4PG7A 4EZ9A 3MXHP 3LAKA 2M9KA 4YUDA 3VF0B 3CIMA 2KM8C 2L41A 4EBDA 1W26A 2CQ0A 3HD1A 3W65A 2R7UA 3UCUP 3DLJA 2FC9A 3IXQA 1Y10A 4AP2A 4A47A 4LF9J 1R8AA 3BGLA 2QN6B 3IR5B 2WVFA 4JI1J 1C1BB 1R89A 1MW7A 2BE2A 2E1PA 4RX6A 3OLBA 3CCES 1C1CA 1YRUA 2YKAA 4HLBA 5HL7Q 3FBFA 3NNAA 2VHGA 1VLOA 1GTHA 1YZ6A 2ZE2A 3NS6A 2B7CB 3AJ1A 4NWBA 3CTRA 1ZS6A 4J9UE 2ZJRQ 4X64J 2E1RA 2J8AA 2WSEC 5GAEI 3VALA 2MA9C 4N7TA 1MMNA 2AYGA 1VC5A 3LTOA 4U6PA 2V8PA 4DR7F 3V2UC 1JJHA 1RACB 1VYAA 3M2VA 1S59A 4K0KF 4W90B 2QRRA 3OFEA 3S7RA 3LPEA 3CJ5A 3EGZA 4R25A 4LIRA 3RU0A 2J6TA 1BQMB 3QLHB 5KFGA 1YIJS 1HI0P 1IKYA 3PW7A 1TFWA 3TVKA 1C4CA 2NYIA 2ATCB 3SV4A 3R1HA 2MGZB 3HVTB 4EEYA 2ATLA 3E51A 4DL4A 4QIWD 1C0TA 1N5TA 2CQ4A 4ZS6A 4U2NA 1T94A 1YJRA 2J9DE 4X4SA 1IKXB 4DUZF 2G0JA 2RDIA 2QTWA 4Y34A 2FY8A 2W2MP 2GMJA 4C7QA 3LANA 3P96A 1HHQA 2Q6BA 1DLOB 4AT1B 2YKNB 3GYGA 3JXOA 3ZO7A 5IXUA 3J7YI 4TYBA 1S79A 4HHUA 1IJEB 5E0OA 4F26A 4PPDA 5F8LA 2OPRA 2N4CA 1LWFB 1HQUB 3D9BA 2BJ7A 4AL6A 3HPOA 4K59A 2IHR1 3OTOJ 4RW4A 2R2SA 2EFGA 1SCJB 2LDIA 1VIXA 4NOHA 1FKPB 2JC0A 5A8WA 5T14A 2ZVIA 3ENAA 2RDDA 1FHTA 3DN9A 2HVDA 4ED8A 2I5JB 4OI4A 1RAAB 3TA1A 2W9CB 1HD1A 1DAXA 3I9ZA 1VJQA 2RSQA 2DR7A 4ICLB 3M4TA 4F8RA 4PUOA 3EZ5A 2XMJA 3UR0A 3JYTB 5I3UB 1PJ5A 1VLYA 1SKUB 4JI6J 2GAGC 2N3LA 1X4FA 2XSJB 3KJVB 4B3MJ 5E33A 2BOAA 4WK1A 5JVHQ 2WRMA 3JAMY 4LFAF 5LL6d 1EXBE 5A6RA 1RT2B 4NLQA 2IJFA 4K50A 1KC8T 2MDAA 3UDVA 4KGZB 2AYEA 2FYXA 5L39A 2Z58B 4W9CB 2AEJA 2JDJA 4NA1A 2HYIB 2SXLA 1ACMB 2QIFA 1K0TA 8ATCB 3DLKA 3OXGA 4G6VB 4QCLA 3M7VA 2WBMA 4KH1B 4EMDA 3SYZA 4DSLA 4C6AA 2ZUGA 1GMVA 1W25A 1XK8A 2ZVSA 3ISNC 2YKOA 1P9QC 2IDEA 3MI7X 2DHHA 4MK7A 4Q7AA 4QPTA 4EGLA 1T03A 1DRZA 4O3RA 1N0UA 3IRXB 4QR0A 5B08A 1TUGB 2C9WC 2LP4A 4H54A 1NDPA 1T02A 5BR8J 1S77D 2RJZA 1VJWA 2IFXA 2B6AA 3BDPA 3UCGA 2XCAA 4B9SA 1DFDA 3W5XA 4ZLLA 4HI1A 3OTBA 1L3TA 1LEOA 3HTMA 1S6OA 4CXIA 1RUSA 1M1GA 5KG6A 4ECUA 2JEIA 1TL3A 4NLVA 2WVEA 1YI2S 2G2OA 3OTCA 5ETLA 3HT0A 3NOGA 2AV5A 2VG5A 4X66J 3RAMA 1TUWA 2P9CA 1WG4A 4PQAA 5IT9U 3WQPA 2COLA 1FD2A 4RW7B 2NLWA 3JYTA 3QSYB 2XBPA 5A6PA 2E29A 5J2MB 2IA6A 4Z2XA 4ECYA 2GVDA 3H98A 2DGQA 1RHJB 1TKZA 1Y5LB 4IFYB 5ETPA 2BQUA 2UVWA 1TTHB 3BPSP 3VWSA 3AHPA 2QLBB 3PG9A 7FDRA 2Y1LB 3D7SB 1X7VA 1UKUA 2ZJPQ 1IBKF 1IBCB 3EVWA 3J81j 2ROGA 3GJRB 4EUVA 4LF8F 5DQHA 2HS0A 1LW0B 2APOA 4B3OA 1NZAA 3UD3P 3PW4A 2VV5A 3QIPA 2UXDJ 4CO2A 3VVUA 1QAXA 2OEMA 3Q2TC 2XWYA 3H8YA 1DQ8A 2VPXB 5LXYA 2OPPB 1UP1A 2MKJA 5KOWA 1LWXA 4O3OA 1WKLA 1N36J 2MKHA 3MD3A 1XR6A 3CC4S 4LFCJ 3R5JB 1HNXJ 1CEZA 1APSA 1R8HA 1BQMA 1S6UA 3FQKA 3QLHA 5IC6B 2RF2B 4BWJA 5HP1B 1FD8A 4U77A 3BN4A 1PCAA 2XI2A 3D66A 4RKUC 2DTJA 1XN9A 2EBGA 3MECA 3KDNA 5E3AA 3EZOA 5L8RC 3CCLS 3J7ZT 2D3OR 1WI8A 2AEFA 2J9CA 4IG0A 1TUVA 3WIVA 1VQ9S 1NJIT 4JI4F 5F3TA 4X62F 3QJLA 2VBZA 3Q2SC 2FDNA 2HNDB 3HVWA 4ZP9A 2GIRA 3C2PA 3H90A 2UUTA 5CYMB 2KHCA 5E3QA 4FZVA 4XDCA 3K2YA 3FEXB 1NB7A 4Y2KA 1LFWA 1OO0B 3RGIA 2HZCA 3ZZTA 5D0RA 3BJYA 5FJ4A 1QD1A 1WEXA 2YXLA 3AD7C 1KVKA 2IAJA 3MMBB 3CCWA 4TYAA 4ANEA 2ZHAA 2W2PP 2EK1A 1TL7A 3GCXP 3I31A 1M0SA 3L95X 4OYAA 4DUTA 2AJ2A 4CP3A 2K3KA 3ETOA 1N4LA 5LSRA 5CZXA 2HHHJ 1HPZB 4HEA9 2LDYA 4BBYA 2DGTA 2MQQA 1ICEB 4DEZA 5HLFA 2VUGA 3ICLA 4DSEA 4HXIA 1WOOA 4B3OB 2FQQB 5KG4A 4A8QA 3AODA 4NI2A 1PC5A 1FI4A 1PAUB 3JSBA 3OFFA 2FHOB 4TNOA 4RU9A 1KHVA 3CJ3A 1BUXA 1S9FA 5D8HB 4K4XA 3FRYA 3M6WA 2PT0A 4HR2A 3MHYA 3HU6A 2XQCA 3NWGA 1N48A 3CPWR 3ITHA 5F3ZA 3ZFVA 5DDOC 1ZYQA 4DS4A 2GVDB 1HFEL 4X65F 2C22A 3M30A 1OSCA 3VVTA 4LRBA 2NPFA 4CLWA 4NZ6A 2D7SA 2WW8A 1FKAF 2UXCF 2PMZD 4NCGA 4JI7J 1BD6A 4KAIA 2YPZA 3S1TA 2WCXA 5DDRC 3RW6A 4B95B 2AHOB 3C8YA 2F7VA 4YQWA 1JJ2R 1X4DA 2ZM6F 5BXIA 1YRTA 4PAAA 4C0HA 1JWWA 5KFVA 1KLMB 5J1PA 1RHMB 5CYMA 2E1AA 2QA4S 4PQUA 4OL8A 4OYZA 3R2DJ 1T03B 5KFPA 3GMGA 2W2QP 3IGNA 3NP5A 1JLBB 5DS7A 1CJUA 4AUKA 4JI1F 2VG7A 3DRRA 2IBOA 1D9AA 1OY9A 2DPJA 3QZ7A 3IAS9 3CDBA 2YH0A 4KHMA 4Z7CA 2JWNA 4DV3J 4RU2A 1QE1B 1SBRA 1UFLA 3H59A 4PCQA 1HD0A 2QT7A 1JKHA 3MF5A 3KJQB 3CCMS 1N6QB 3JTOA 2GHVC 3MEKA 2UUBJ 4UZBA 2MQOA 1BQNB 1WC4A 4CT9A 3HSZA 1VQ4S 4ZLNA 5I3QA 1J2VA 1Q8KA 1NRKA 2JVRA 2RQKA 1NSKL 1UPMB 3NBPA 1LM8C 2XO7A 2YNIB 4OLOA 4DFPA 4QWBA 1NPRA 4DUYF 2HS3A 3OR1B 4RL1A 3I32A 3JTPA 4BDPA 1XJWB 2DNPA 5E3CA 2LEBA 3L4BC 4EO8A 7AT1B 1J5OB 3P49B 1WOSA 2G0IA 4LBPA 1HW8A 4DL2A 3ZTCB 3QGGA 2VQFF 1FT8A 3G6ES 4LF5J 2V8DA 1WHYA 4I56A 4DFKA 2HFUA 4K8RA 4TQSA 1CLFA 1HI1A 4UUXA 2XYHB 3C6UA 2D1CA 2V4RA 3QIDA 5ETSA 4DCPB 4XK8C 3UPFA 4JV1A 3GJQB 1PBUA 1EIYB 3GFYA 3KG1A 3MAAA 1Z1ZA 3A8JA 2BACA 4A8SA 3CC7S 2U1AA 2MJUA 1EOFA 2BEFA 2ZEJA 4HHJA 4DSFA 2QV6A 1EKRA 4P71A 3PNIA 4ES1A 2WVDA 1TELA 3TAMA 4ZPVR 4MIWA 4GVBA 5J1NA 2B9XA 3B6BA 3LGMA 5DG8A 4DR1F 3TAQA 2A18A 4OX9J 3HVEB 2ZNZA 1NJXA 1TR0A 1RWKB 4IKAA 4WZQA 4J9LA 1YJNS 2NS1B 3GYNA 2NPIA 3C3LA 2WK4A 3PJWA 4Y2MA 1Q78A 1C0TB 2JZ5A 2HNDA 3DLEB 4H4OA 4Q2MA 4GKKF 2GQCA 2G4BA 1RZMA 3D2WA 2LXIA 1RYRA 1KP6A 2L08A 2J6SA 2MKCA 3DRXA 3MUMP 1GX6A 7FD1A 2JEFA 2YNHB 4WFNQ 3ZZPA 2X51A 5SUHA 2MTLA 1QVFR 5K8OA 4PG4A 5KFEA 4NXNJ 2B9WA 1HQEA 3CJ8A 3MMJA 3VV2B 2HLUA 1UVNA 3QRPA 5ETTA 4EO6A 5KT4A 4J9SA 4ZN3A 4IR9A 3HLUA 4W4MA 1FKPA 5A8WB 3RUBL 1LOUA 4F4ZA 4ED2A 4HYKA 3VCDA 4URGA 1JXEA 3B82A 1F3VA 3RTVA 2GAHC 4EI2A 3GIIA 3TUPA 1JLGB 1RT4A 4JI3F 2HHVA 1TMMA 3DC2A 1NDKA 2KKHA 4IOCQ 1S76D 2GJFA 3UR3C 1S99A 2QA2A 2B4OA 3KHRA 1LDKD 2DRBA 3M1VB 2PIIA 3ULHA 3WC0A 3ENQA 2LXUA 3K5PA 4RWXA 2PA8D 3IGVA 5J2MA 3HFZB 4B9NA 1U47A 2PO4A 2HQCA 4DX8H 4HTIA 1TAUA 3IA0A 4KGMA 4L74A 4P6QA 4B3SF 3HFVA 1LWFA 2XY5A 1ELOA 3BO3A 3PX6A 3M8PA 4JYAJ 1FX4A 1S9EB 2UVUA 1S1UA 1WSRA 2FPHX 2F9DA 2H3EB 2L9NA 3MM5B 4NZ0A 3QGIA 2PE8A 4QPXA 5GADU 1SC6A 1RBLA 4FKYA 5KAKA 1WF0A 4ES3A 1BWEA 2OVRA 5FLXU 4ID5B 4IG0B 3TEHB 5CYJA 2HNYB 4B9VA 4JI7F 2IC3A 1NCLA 1N32F 1S4EA 3LUTB 3W8GA 3ZZ0A 2XGQA 1RWNB 2OPSB 4MKBA 4WXWA 3ZTOA 3VAMA 1K1QA 2O3DA 1LWEA 4TY8B 4OX8A 4U96A 1FS1B 4P7VA 1KWMA 2D74B 4OV6A 3GIJA 1NJWA 1XNQF 3C15A 1NPKA 3E4UA 2E9RX 4J8ZA 3P5TL 2V9KA 4OJ1A 2OI2A 3MECB 2C2OB 2JLEA 4J91A 2ADCA 4Y65A 2KFYA 4DV3F 2I8EA 2VDHA 5MAOA 3BQ2A 1EOEA 2G0CA 3OV7A 4J9OA 1RAHB 4I6JC 5K20B 3T3FA 4F2RA 2F8HA 2VIHA 2VJUA 1IKWB 1X9WA 4GKJJ 2VKZG 4I7FB 4I1TA 3KLGA 3WBZA 3VGVA 4DR5J 3PEJA 4X4OA 2YWFA 3MEEB 4WFAQ 4CLPA 1T0TV 3WX4A 3P8BB 1IQTA 3V81B 1S1VA 1SV5A 2GMHA 3M6UA 4WFXA 1K73T 1JXLA 1IWGA 3QATA 1FEEA 4JV0A 4X62J 3MTKA 4DUYJ 4X4NA 2GC8A 4WP8A 1HQUA 5KFSA 1KQFB 4P73A 3TRGA 4KHRA 2P2CB 4ELVA 4F3OA 1UFWA 1WEYA 3CEDA 1HA1A 1RT3B 3M32B 5DZ6A 2ZBPA 4MKYA 4DV6J 1QTNB 2WZ1A 1O6XA 3VR1A 4DQSA 2G9OA 2KI2A 1HWKA 2K3IA 4DPOA 3VHQA 2L9WA 2QO3A 2DO0A 5D78A 4DV4J 3NRBA 3H5YA 2VFVA 4M95A 4U9RA 2CQ3A 1NH7A 2W9AA 3LAMA 4ECZA 1T9TA 1FNOA 5IV3A 3T9ZA 3W9HA 1S49A 2CWKA 1GXTA 3QSIA 4X4QA 5DLGA 1YX2A 1JLBA 3OHVA 1EQMA 5KFZA 3T6JA 2VJVA 1U6FA 1R0BG 3HSGA 4WFZA 4DZDA 3PX4A 4MH8A 1FJCA 1EB0A 1QE1A 2PMHA 5JMNA 4KY3A 1IWAA 3H4DA 1ZA1B 1JMTA 1IKYB 1JB0C 3CF5Q 1U02A 1NEEA 2GGPA 4IH7A 1B0VA 4OZNA 2FJXA 4K4ZA 2FLNA 2LLZA 3DGPA 1U1KA 4ID5A 4B3TF 1LWCA 3D67A 4CP5A 1SH2A 1N33F 4M5MA 5JVGQ 3BSNA 3DXSX 2HVEA 3ZZZA 2LQJA 2IJNA 4NLGA 2VG6B 4AQYJ 2H5EA 2YKQA 2DISA 2DNNA 2VH7A 1B99A 4K5SA 1YBUA 4MKAA 2V2VA 4UTGA 2WB4A 3LUYA 4WPAA 4JGHC 2L3MA 3ET6A 1KEKA 3M32A 1UZHA 4O3QA 2VC0A 4TU8A 3KDOA 2QX0A 5EX3A 1GXUA 3TO8A 4O0NA 4QWCA 4DR2F 4W9JB 4TLRA 2QLJB 2CPHA 2J5AA 4FXVA 4X2BA 4LRAA 2E44A 3H7HB 2A0FB 3QT8A 4CO4A 3NMRA 4NXMF 1RE1B 1FWKA 3OXLA 2NZCA 2UV8G 3MEEA 2RKIB 2RNEA 3TA0A 3T1HF 1RBAA 4NI2B 5JUMA 1RJJA 3B8HA 4H4MA 4NE9C 3JTNA 3S01A 3OFGA 3NGRA 1NKEA 2BDPA 1FRHA 4U8YA 1CVJA 3EXYA 2QMUB 1FESA 2RS2A 1MN9A 3AOCA 4YY3J 3DM2A 2HZVA 1KNZA 2Y8YA 2UXCJ 2ZOFA 3ILLA 3WHIA 4N76A 1X5PA 3PW5A 3KK3B 2XSFA 4O44B 3PJ9A 1CJVA 1B0PA 5E7OB 3VZHA 5LXRA 3HXMA 4LSZB 5IM0A 1WHWA 1RWMB 2KT5A 2FIUA 3I5AA 2GJ2A 3HZGA 1WOPA 2AWZA 1QDUB 1U25A 1ZPVA 5CYQB 5AXLA 2MXYA 2Y9HA 5A15A 3MPUB 4I69A 4UW2A 1V9OA 3HHLC 1TKTB 2ERRA 1HIYA 2YWWA 1RQ0A 1SIZA 2CQDA 1RT6A 1FF2A 1Q79A 4DR3F 2K1RB 3KUEA 1SC3B 1XWLA 4WYLA 1DJ0A 2VBWA 4JI8J 4PWDB 1VQOS 1U26A 3QAUA 4X4UA 3TUZC 1WUUA 2JEJA 1VK8A 2CXEA 4LR7A 5C7PA 8RUCA 2ADBA 5KT5A 2PI4A 4V19X 1IVZA 4PWWA 3MMAA 1PO6A 4IDKB 4ETXA 2XEXA 3Q86A 1F0XA 1TV6B 2WONB 3SSRA 3PHEA 3V7DA 1FO1A 1A6LA 1C4AA 4XPCA 4Q0BA 5DZ7A 1FQVB 1FRLA 4MAKA 1P27B 2PMWA 1R8CA 2W7AA 5B0GA 5A8KA 1S1GA 3EX7B 3QJPA 2RT3A 4FBTA 3LPYA 1M1HA 3NGUA 2XY7A 3BSAA 5DQIA 4JOUA 3SDEA 2OD6A 4HHHA 3OLAA 1TL5A 3UI3A 2NQPA 3FKBA 2Y3YA 3DMJA 4LREA 2MZRA 3W5YA 3PCOB 4M5KA 3HT3A 1I94J 3A12A 3A3OB 3HFKA 4QBUA 3M9NB 1OYDA 5B0BA 3DLBA 2M0GB 1RBOB 1UCNA 3GJSB 3I87A 2FVQA 3PDNA 4A8FA 3MM6B 3TZZA 3UWTA 3VAGA 5BYQA 3LP0A 2CPYA 2FGCA 2HMIB 1FDBA 1RTHA 4PRFA 1F5AA 4MFBA 5C5JA 3OHUA 3W60A 4B17A 4NEYA 5J2QB 2YWHA 2HWIA 4R0JA 3UDLA 2CPIA 1E6YA 4DPTA 4JV5F 2KYXA 1NSQA 2EWHA 2DGSA 2LQBA 1XBWA 1FK9B 4ZA1A 4GVLA 2ZDOA 2P9GA 1QSYA 5KG0A 4FN5A 4Q45A 1QTMA 3OGLA 2AJ0A 2OPQA 1HQ2A 1L3VA 4H4OB 3T19A 1VC6A 1EHWA 3OR2A 3QZ8A 1T05B 2DR8A 3R5AA 5KFWA 5IM0B 3OVBA 2R7QA 1KLMA 4AL5A 4NLTA 1QDVA 1QY7A 1SPBP 4UOHA 3H42A 1NKBA 1FFGB 3DLKB 1SJ3P 2DXDA 3R5CA 5BYSA 2GV1A 2JNJA 3BO2A 1LV5A 3T6BA 4NXNF 5C42A 3TZWA 2C42A 2ACMA 2XI3A 4MMOA 3AOBA 3CJRA 1VRTB 1F9EB 3MM7B 4B3TJ 4OJHA 2MEWA 5ETVA 1DQAA 3MEDB 1GMWD 5K9FA 3FZBA 1RADB 3CD0A 4KGVB 9RUBA 2QMXA 1RT5B 3KJNB 3PV8A 2EFOA 4YEAA 1XQIA 4EWTA 3RR7A 3H5UA 5F9NA 2YQ3A 3IR6B 5HVFA 1LNQA 2GHWA 1D8YA 3PIOQ 2WOMB 2KFZA 3EJMA 2V63A 1Q8IA 4K4WA 3X1LB 3G96A 2ALYB 1XR5A 4DL3A 4FYVB 2OTJS 1S1TB 3MTJA 1I51B 1U45A 1VOMA 1H2VZ 4YP3A 3GWCA 2MY8A 3F44A 3ZNJ1 1QAYA 4GKJF 3Q8RB 1TVRA 3MR2A 4WKRA 4B9MA 2HQFA 2MLYA 3ISZA 3SZ2A 1UA0A 3BR8A 2V2ZA 3TVZA 4FYYB 3D6TB 2HQ3A 2C3UA 3MWBA 4FNHA 4OYWA 4RLEA 3OJSA 3GG1A 5CD4H 1VCTA 2OEJA 3BM7A 4M5HA 3O1LA 2ZBRA 3ZZUA 2KYZA 2I2YA 1VQNS 5M2UA 5JXSA 1UEUA 5LMUJ 4WKYA 1CPZA 4ATNA 3L9ZA 3T1YF 1JIHA 3N6NA 4USWA 4CCHA 3K58A 2YBVA 2OPSA 3PEHA 4CYUB 1RT6B 4OZ1A 1N54B 2MY7A 3MR5A 3WSOB 3K5LA 2H5JB 2HNYA 3ZTDB 5EUPA 2VG7B 2YPYA 3CJSA 2VB6A 4DZ6A 4I0WA 4M5IA 4ECTA 2CNOB 1CS4B 3MR6A 4JV2A 1SL1A 1IBLJ 2CNLB 1FVSA 1SL2A 2HFVA 5L1JA 1M1KT 3M52A 2VL1A 4CM0A 4URSA 3OTDA 2XWXA 4CM2A 4U7CA 3ILOA 1ZTWA 3DKDA 1JNRB 1Y5IB 1SJRA 1MWZA 2R8JA 4DSJA 2Q3PA 2E5LF 1SQFA 5G0RA 2QL5B 1OJ4A 3OVAA 1DTQA 2ZZNA 3H25A 1CSJA 3HZEA 1S1WB 4C0BA 2OHDA 1TVRB 2ILZA 4KGXB 4YB6A 2I38A 3TARA 4B9KB 4N8OA 1VI7A 2V2QA 4GO7X 4USIA 5CZVA 3J7Z5 1GEHA 3V81A 1KD1T 2BOPA 1NK7A 2W24A 4UYIA 3NKYA 1X4HA 2ZITA 4BGCA 4Q8EA 3CW2C 1R0CB 3EICA 3GJTB 1BHNA 3W9JA 3B4MA 3IM9A 3TAPA 5HROB 1HNWF 1NZ8A 3VAKA 2R7SA 3G9CA 1HPZA 4IYQA 5CAAA 3ILJA 3R9LA 3Q83A 3TEGA 3W7BA 5DM7Q 1JQGA 1IBKJ 5T7LB 1FEHA 2MQNA 1RISA 3AXKA 4ED6A 1E6VB 2OEKA 4E8UA 1FKOA 1GK8A 1BE4A 3D0GE 2UUCJ 4M5DA 4OX7A 4ZVGA 1VRQC 2NXJA 1O5JA 3TX0A 3M5BA 2ALZA 1AUSL 3W9IA 4W9KB 1KDNA 3CCRS 3Q0AA 2HIYA 2RU3A 1RLDA 4I6AA 3TOQA 3UN3A 5IT4A 3TZXA 2W8KA 2DY1A 4CNYA 1HBMB 1WHVA 1N36F 1Y3JA 4KT0C 4JI6F 2V68A 4AQYF 3W61A 3LP1B 2DR6A 2Y8WA 2DNLA 3N5BA 4R5PB 1KS2A 2R42A 2LMIA 4MYTA 3RG6A 4DQRA 3CMAS 3IBCB 1LXNA 4DX5A 2MHEA 2W8LA 4IRKA 4W9LB 1SH0A 1WELA 1TK0A 1S1XA 2AJ1A 2OD4A 2F1FA 3CIZA 1G6BA 1SB6A 3QT5A 2FNJC 4YY8A 2MKIA 2J0QD 4DLGA 2ZH5A 2HFNA 3IBWA 4B9UA 5K8MA 2IBKA 1KOOA 2R7RA 4NXMJ 3LBZA 4A48A 3EUNA 3GV7B 3R3TA 1XTZA 2CQGA 2ASLA 5F8JA 2D9PA 2OUGA 2V8GA 5E5NA 2DRDA 1ZZNA 5CABA 2GHPA 3MURP 3JQMA 2X3DA 1J27A 3SFGA 3US5A 1HBNA 3FCWA 1RT4B 3ONQA 2F5GA 5IWAF 2HSEB 4X4VA 1G3OA 4I7FA 3I5CA 4A4JA 3HSDA 2FZCB 2EBEA 2NUUG 1S5ZA 3OR1A 4G1IA 2R8KA 3EMTA 5DO2A 1B3TA 2EXUA 3MPWA 2Z8HA 1RLCL 1DLOA 2CKWA 5D4LA 3IFEA 1C2PA 1UWBA 3MD1A 4OMFG 4L3NA 3I3NA 4DV2J 3D0HE 3PYDA 4AXIA 3W64A 2HFOA 1UZDA 2OFHX 1N8RT 5IOLA 2QGFB 4A46A 5KFKA 1HR0J 1T11A 1KKHA 3BEGB 1VDHA 1X4AA 2DH9A 2VDIA 3A3PB 3BR9A 1RB0A 4HACB 1H2TZ 1H74A 3PRBA 1RK8A 4KRWA 5AXKA 5HMZA 4TU7A 4CH1A 1IXKA 4DV7J 4EBEA 3W5ZA 5F8NA 4MKVA 5GVQA 4WBFA 4KPYA 2VICA 2N4DA 3HHLD 4ED5A 2B56A 1EP4B 3OL6A 4W9HH 3Q8VA 2IC3B 4O0IA 1E6YB 4UQGA 1TMJA 2HNZA 3TQEA 2XO6A 4FXWA 1TKDA 1PYOB 1LWEB 4ECXA 3OL8A 1P6TA 2FJWA 1U2CA 3PO4A 3MUVP 3ENVA 2D9OA 3H40A 1GAOA 1KTQA 3G82A 2ROEA 4QIVA 3CCJS 2D69A 2O1PA 3GQCA 3UCZP 2CQHA 3QRRA 1B4SA 4F4AA 5HMXA 2XMVA 4O4GA 5K14A 4RNFA 3C6TB 3I0RB 1FCAA 4LFCF 1Q81T 1WSVA 3BB5A 3QBCA 3KUGA 1HBNB 1XMQJ 3DCGB 3RRKA 3ELHA 4A8YA 4UUWA 1RP5A 3W63A 1X9MA 2EKYA 2FVCA 4UT4A 2IF5A 1CJTA 1HBOA 2F4FA 2XC9A 4L76A 2R7VA 3CJKA 4AJYC 3AJ2A 1C0UB 1UEKA 4EBCA 1K44A 1C0UA 5DQGA 1CBKA 4GC6A 4Q2LA 2BRKA 2UXBJ 4F0MA 3SIPB 4OX6A 4ZCKA 3Q8QB 1FFSB 3R8YA 5DDQC 2LA6A 2AEMA 3CDEA 5E2QA 2V67A 3RAXA 1HWLA 2VFRA 2YY3A 1T9YA 2J0WA 4DL0C 3HMJG 2AW0A 1N34F 3FKCA 3UD4P 1CJKB 4OJGA 5HANA 3FDSA 2BJ9A 2LEAA 3MM9B 4NLWA 3KYLA 2FGOA 2QL9B 1JLFB 1PJ7A 1Y11A 4XAKA 4F04B 4IRCA 4NL5A 2DR9A 1AA1B 2BV3A 3CT9A 4NRTA 1JLEA 3PX0A 3BIMA 3PYFA 1UVJA 2P1NA 1ZM3A 2IVMA 2DNRA 3M2UB 2VA3A 2XLJA 1HL6A 2GFFA 2UUCF 1ZBTA 2Q6CA 3CULA 5I4MA 3OGMA 2V2KA 3DDIA 4U8VA 4ZCLA 2FVSA 5EGYA 3C6NA 5H7HA 3LP1A 4ZMMA 2V6AA 5THWA 4OV1A 2D3ZA 3DLEA 4KHPF 5KG5A 1QJHA 2FLPA 4OYXA 5EUHA 1I3OB 2K1RA 2ZOGA 4OHZA 5KFOA 3QMQA 1RWOB 2DNOA 2Z56B 3M30B 4LVOP 5HMYA 3M2VB 4LQ9A 1P1LA 2C2RA 2C2ZB 2QYCA 4YOEA 4P52A 2CPEA 2KN4A 4ZPCA 2IM1A 1VQ5S 1IM4A 4NCGB 3KLEB 4ED1A 3T1YJ 1ZAVA 3I55S 4UF4A 3ZTSA 1JLCA 5KG2A 2XS2A 2BANB 2VU5A 1YGYA 1Q82T 2EC2A 3UFCX 2AGPA 3LP2A 4DCOB 1T3OA 5AJ3J 2OKQA 2Z4PA 3AT1B 2PN6A 3TJ9A 4F4XA 1WF1A 1I1GA 3GB0A 3A3NB 3C14B 1Z2LA 2DNKA 3R7BB 3MCOA 3SEOA 3FGVA 2GCFA 3OQ2A 1LXJA 5CQGA 3N5FA 5GMDA 1HNXF 2UUBF 3AFGA 1RCXB 2E5GA 3KLGB 3PZPA 2G2YA 2ROPA 1QAIA 2RKIA 3AY0A 5HK4A 3MFIA 1AXQA 2UUAJ 1UPPA 3DMJB 1RI7A 1RWUA 4M63A 4JBCA 3H2UB 2XM3A 3CJQA 5A2QY 3NY0A 5ETMA 3HK2A 3SQOP 2N7CA 4EU0A 4P72A 1R8BA 5LMNF 4L75A 5DG9A 1WC6A 3QRQA 4PPZA 3CCUS 2LEPA 3VAIA 1SIWB 5F0WA 3KG0A 2ZFHA 5KT3A 4DQQA 1U6BA 1QLNA 4LMZA 2IPOB 3R5DA 4RW6A 4C3LA 5B0FA 4Q8FA 1H98A 2PSZA 3LO3A 4FNIA 3Q23A 5MLCV 1N56A 3ZZYA 1X31C 4DQIA 3KK1A 1NUEA 1TKTA 3D3CJ 2W2NP 2ZHBA 3M8YA 4R5PA 1RDRA 3P4UB 4BKTB 2BE7D 2CPXA 3CDAA 3DHWC 2ZBQA 2ABYA 2OPQB 1S0NA 5CCMA 4I67A 4NCBA 3TUIC 4RNMA 3M2UA 2CG4A 2B51A 4IQXA 1A0OB 2P1QA 1EARA 4ER8A 4AYBD 2XHWA 1EAYC 2YX7A 2DNYA 3KHGA 1U1QA 3M8QB 3FQLA 2DEIA 3MM5A 3ZTQA 3DRPA 5F8HA 4ZCMA 1G1XA 2BE9B 2FJDB 4CLFA 3TAMB 4JTCB 2E5IA 1UW4A 6FDRA 4J5OA 4PABA 3ZC4A 1VC0A 4CXJA 4RUCA 2CZ4A 4FPIA 4ITSA 4ZDNA 3FCVA 4F0KA 4PXEA 3GP9A 9ATCB 3J7AN 1URNA 4GKKJ 1S9GA 3KTQA 3CJTA 1GMUA 4HT5A 2HRTA 1QM9A 4PG6A 5GAHI 3DRYA 2ASJA 4LSNB 1S10A 2AYBA 1HNWJ 4CLTA 2R2UA 3OTEA 3AB2B 3UDCA 4PYAA 5F9LA 4ZCIA 1FERA 4RW4B 2D3UA 3QJJA 3SI8A 5KFCA 5HQMA 4LF4F 1TZ0A 2PPIA 1FA0A 3C14A 4OYBA 1H0HB 2VPYB 2Y0BB 5D4OA 2BKNA 4ZVUB 3QPIA 5IFMA 2WOMA 2E9TA 2HURA 1S1WA 3CCTA 1LQ9A 4LIWA 1VHIA 3D1QA 3KLIB 3TYTA 1F5BA 2G2ZA 2KJVA 2RQ4A 4RW8A 3G6VA 3Q22A 4C11B 1LK5A 3P45B 1HWIA 2P5VA 2YNFA 2H48B 2HHQA 3BBCA 3BKUA 4USUA 2GQ2A 3FMWA 1PAEX 2C3YA 4J9VA 3IG1B 1SJ4P 2JH3A 1TL4A 1KQGB 4I6YA 5CHCB 3CO9A 3O2IA 4USJC 5GAEU 3M8RA 4RNHA 3C46A 4K4TA 1B7FA 4FYWB 2HFSA 3GE9A 4LBIA 4DHVA 3MCSA 4HACA 3SSQA 1KRPA 2RUGA 3OR2B 3FCHA 2DIUA 2FY1A 2DGWA 4EFAC 4MFBB 4QU7A 3H5SA 1X4EA 3QIPB 5H1SV 2AU0A 4LR8A 2K8GA 2MZTA 2MLXA 2NXCA 2BJDA 1VRUA 2DGUA 2QSWA 2XMUA 4J7CA 4C9DA 3Q8SB 2AJFE 1Y00A 3MOZA 1FK9A 4CH0S 3PW0A 1TL1A 4OYOA 1F9HA 3Q8UA 3R7SB 3KK2B 2AT1B 2DR5A 3A4TA 2HIQA 2HG4A 3HM9A 2RRBA 1FJ7A 2EG2A 2YKPA 1XEZA 2HKEA 3BGUA 4BC9A 2B43A 1NK8A 3DLGB 3NWRA 3E01B 2CRLA 2E7VA 3AAWB 3FEYB 4C3KA 3EPGA 2Q66A 3THPA 3OBIA 1P1TA 1YJVA 1S6PA 2GA7A 2E66A 3PFEA 2POKA 2UU9J 4H4KA 4YN3B 4C8YA 2OGUA 3F56A 2DITA 3KJFB 4RO0A 2XMKA 3TW0A 2HHWA 1HV2A 2Z2ZA 1WDTA 3PYEA 2R4FA 3O6QA 2M8HA 2J9EA 4K2JA 4RW7A 1FWPA 4L6V3 4Y00A 5A76A 1U1PA 1L3SA 1A68A 4USVA 1DHMA 3BF4A 2AZ1A 2YKMB 4DV5J 4DV2F 2IRYA 2RVJA 2BJ1A 4FVMA 5KFLA 5IT0A 1BUOA 1DTQB 2Z2YB 2BABA 1XMQF 1YVFA 3HHEA 4DN9A 1Q5YA 4EYIB 1T9WA 2DHXA 4LUBA 3PW2A 2OVPA 2UUAF 4ECWA 3UNGC 4ZITA 3O5TB 1M5VC 3GZ7A 2CG8A 4RBUA 4NEZA 1SI9A 3TVYA 2F4VF 2CQBA 3FNNA 2PA3A 3FJ2A 2X7IA 1IQZA 1VR6A 1Y7PA 4ZP8A 1HMVB 3KK1B 5T41A 1YG0A 2ZJQQ 1NBEB 4LRCA 1QUPA 1U48A 4DV6F 1VRUB 1FVQA 3NCQA 2M8DB 3HHNB 2KXHA 3PO5A 4TU9A 1RHUB 2B9EA 3HD2A 3LNMB 1JLEB 1HBMA 3CGIA 3H0PA 3OVSA 5B0EA 3KLHA 2HNZB 4WYWA 3RB3A 5C24B 3EVMA 4FF4A 3E2EA 2C3OA 1F9FA 2OFGX 2GIQA 2ZH3A 4LF6F 4YR0A 3PVXA 1BC6A 1U24A 2LCWA 3TZYA 3PY8A 3BQ0A 4DR7J 1PIEA 1NO8A 1L3KA 2JVOA 4HI2A 5KFAA 1AT1B 3FFIB 1EX8A 3M2RB 3MM8A 2JJ4D 5SZTA 2FJVA 1Q0NA 2AD9A 2R8HA 4ECRA 3OUYA 1CG2A 5ITHA 3GR1A 4NZ7A 1RAOA 3RB6A 4NMXA 1FTRA 1S0MA 3D5MA 1YZ7A 1HBUA 3D54A 4LSLB 4Z7YA 1YRXA 4WFYA 4ZP7A 4F50A 4A8WA 1WTFA 2CAJA 1KHWA 2BBEA 1R31A 2XYPB 1J5EJ 2KXNB 4JUZA 3HCXA 3I5BA 4KGKA 3DGVA 4C8MA 3RW7A 3T9NA 1N34J 4OHXA 3AA9A 3FBBA 4ELUA 1N32J 4CXTA 2OPRB 3P3DA 3GIKA 3CE8A 2QZ8A 4FYXB 4DV0F 1F2HA 5B7WA 2BX6A 1H38A 4QYZK 2DXFA 3A1YG 3FK4A 3IS9A 2V34A 4MTPA 4RW9A 1VBZA 4B9KE 4MT1A 3IP0A 2V0NA 2GX8A 3OTOF 4LFBJ 1HNIA 2MYFA 4OI3A 2CA9A 3A13A 4ANDA 4C3MA 4OI0A 1ZH5A 1TFYA 4V1Ak 1HNZJ 4TLQA 2RAQA 4DG1B 2VPWB 1M5PC 3KVTA 5GADI 5HSPA 1BWVA 3DXBA 3I4PA 4BS2A 3NGSA 1Q7LB 3T1HJ 3GG0A 3UQSA 2P1OA 3R1LA 2E31B 2GS8A 3U02A 5LLIB 1D9DA 3TUJC 2QL7B 2P6SA 2MQ8A 2MMYA 2VZ9A 4KO0A 4CZCA 3GU0A 5D0HA 3FEZA 4ZJLA 5LJ3Y 1T7PA 5KFTA 3HQIA 3OGKA 4HVZA 3P6YC 2KU7A 1QDWA 1RWXB 3GSIA 4LFAJ 1UJ6A 5G4DA 1X0FA 2Y1IA 1NSAA 1SUQA 4ZJOA 1WNEA 4K4SA 3BS9A 4PQUB 2EKNA 2HVZA 4ZVEA 1AW0A 2R8IA 1S6QA 3HVEA 1G2EA 2VFSA 1U1MA 1JJCB 2FHJD 4MK9A 3MFHA 2FJEB 4JI0F 3CJ2A 3QNWB 2KO1A 1GQEA 4X64F 3V6HA 4BCAA 3M8ZA 5GAGU 5ETKA 3S8SA 2N3OA 4JI8F 3GONA 3PTWA 1T8EA 1QUVA 2LQ9A 2IJRA 3IBFB 1H2UX 2FHJA 2DRAA 4QYRA 4ZPWR 3WX8A 5GAHU 5BYRA 1J5OA 4IRDA 2AX1A 2G13A 4HDGA 1YQHA 1V6HA 2OAUA 2FTRA 3I6PA 4LF2A 2DK2A 4OZLA 4QJVA 1Q95G 2NN2A 4URQU 4ILRA 1JLCB 3JQJA 5CD4A 4WFBQ 4U7UD 2MZJA 4X66F 3TA2A 2B4UA 1RKJA 3MEDA 3G8SA 1JLQB 2WSCC 2VKRA 1N33J 1XMOF 2ZOMA 4OFZA 4HH1A 2CNKB 2YWGA 1CULB 2IRUA 2CPZA 5KG7A 4N56A 1ZPWX 4Z37A 2R2RA 1U2RA 2F8MA 1RAFB 2EFVA 1VBXA 2NREA 1XERA 5HZGC 1MN7A 1XIQA 2BR0A 4CRJA 1HNVA 2V69A 1S0OA 1R27B 4MIBA 4DV1F 3LGHA 2HS4A 2CPJA 3DOLA 3D28A 2YNFB 2RD5C 1V3ZA 4PKDB 3KLHB 4CIOA 1X9SA 2MPUA 3KUHA 1KQKA 2YX1A 1NDLA 3M6VA 3OFHA 2H54B 3KOAA 1G4CA 4N9F5 2ZDPA 1PKUA 1SVDA 1NDCA 2RH3A 5HP1A 3EPIA 3DU6A 2VQEJ 3N0VA 2P8IA 1FXRA 3PKMA 2PEBA 2LA4A 2ZD1B 3UVJA 4B9TA 1HWJA 1PBAA 5KT7A 4J37A 5DM6Q 5DLFA 1OY6A 4CT8A 3N28A 1B64A 1WKJA 1DY3A 1H6KX 1R6VA 2MQLA 5DGBA 4LF9F 1UETA 1BQXA 3IO1A 5F8MA 5FLXY 2RQMA 1RT7A 2V5HG 2CJ9A 5ADZA 1T1DA 2E32B 4CLKA 2CJKA 3AD8C 4Y6IA 3CJKB 5JJBA 3OXFA 1YLXA 1K0VA 3CO0P 2XZWA 3CJ4A 3N4WA 3E01A 3BQ1A 1UA1A 5KFHA 3DRPB 3FMBA 4FXDA 2LU1A 2B8PA 4IH6A 1PYSB 2XS7A 3OL9A 1T9VA 1JLGA 3MMAB 3LWLA 3CCQS 2OVQA 4ES2A 1WC5A 3HJVA 2HGNA 1BQNA 2M5YA 5HLFB 5E3PA 4ECQA 5A6WA 4XPEA 5I3PA 1S1VB 1SV5B 3PXGa 4ECSA 2X1GA 3G6XA 2DHAA 2F9JA 3ZTPA 2KFNA 3W2VB 1MROA 1TL7B 4WXOA 1U1RA 3JQKA 3MUTP 3HHLA 4KR0B 3C6OA 3KMQA 3PACA 4QOTA 3KNGA 4AL7A 4ED7A 4U67Q 2XLKA 2ZH2A 3EDQB 2CQ1A 2IM3A 2RILA 2HBZB 1GNKA 2CYYA 2DCLA 4P9SA 4OX9F 5C24A 5KG3A 1CULA 1FDAA 4OJ3A 2QFIA 4C2MA 4DUZJ 3DU5A 3M8SA 4WE1A 1VQLS 3D6MB 1WWHA 4L3KA 4UOFA 2DH7A 4AD6A 6AT1B 3J7YU 2J7KA 3DCAA 2EI5A 2AX0A 3FBCA 3UN2A 3NNCA 2EG1A 2XSJA 4OLPA 2U2FA 2I9SA 2M70A 2KRRA 4CLUA 4QQBA 1DARA 5BJRA 4NRUA 2X1AA 2ZKTA 5IZHA 4W9IB 5J2PB 2AF6A 3AH6A 4RUHA 2WHOA 4C0OC 1YSJA 2C3MA 1U8SA 4Y3CA 2UU9F 5F0UA 4K4VA 4ILMA 2XZDB 1C1CB 2FLOA 2IZVC 2JX2A 1DTTA 3C16B 3FBEA 2I0XA 3BGRA 3BGOP 3D4JA 3DOMA 4UOCA 2A10A 4WP9A 1RTZA 3DOMB 3W66A 3OHBA 4MJKA 5J1EA 4GC7A 4ECVA 2JL9A 1ULRA 3L7PA 2BKOA 4NLDA 4RZRA 2ASYA 3PKYA 1WEZA 3BYRA 1GT8A 5ETOA 1FJGJ 3CD5A 5BXHA 1GFWB 1JXVA 1RHKB 2K2PA 3DRSB 4QIFA 3SQGB 4WU3A 2KM8B 3KLEA 3F73A 3TJ8A 2ZH8A 4DL6A 1S12A 1KSPA 3B84A 3KHLA 2ZZTA 2JZ3C 2EW9A 5AXMA 4O3PA 4EYHB 3LP2B 4M8LA 3GPAA 4QU6A 3VTIA 3RB0A 5I42A 1H7XA 1KFDA 3GR0A 3KNAA 5FDLA 2M3DA 4IG3B 3NGTA 2BMBA 1FDDA 2WBRA 1QSSA 1EODA 1SXLA 2VG5B 1AB8A 1W2BR 1D09B 2QLWA 2VQFJ 1Y3KA 1P9YA 4LF5F 3HX9A 1TV6A 5J2NB 4I2QB 4JYAF 2LYVA 2V8HA 2VASA 3HI9A 4ETZA 3ZRCB 2A1BA 2GJIA 2MZSA 3MGJA 4KPCA 3O8WA 3NNHA 3DOLB 2LQ8A 2R7XA 3DYAB 2RDJA 4C8ZA 4F3MA 2WTFA 4B3RF 4DI6A 4P10A 5KTQA 2YNGA 1R3NA 2Z0GA 5KFMA 1JLAB 3IG1A 1RT1B 1IBMF 5HJYA 3R27A 2BRLA 2W2OP 1RT1A 5L9XA 3OW2R 1VISA 2KG1A 2C2DA 2NZ0B 2AYMA 1BMQB 1RCOB 3LW5C 4CO3A 2AJQA 3EXCX 5B0AA 1RT2A 4QZVB 3JSMB 2BM0A 2FHKA 5T7LA 2XGPA 3CDUA 3NGDA 2YTCA 3DLHA 2GNKA 4ELTA 2DNQA 4DWIA 1WDDA 2KT2A 5CYQA 1F60B 4R8UB 5AE2A 3OJUA 3ZNUA 1Y0HA 3AOAA 3GYXB 3K17A 4ZVOB 3SMZA 3BREA 2R8GA 4NLYA 2VQEF 2HPUA 1RSCA 2ZE2B 1RT7B 4R0EA 1UVIA 4BWMA 3HO1A 3MMCB 1CJTB 2HHPA 2V4JA 3V4IA 4OI2A 2W7PA 1M90T 3DLGA 2ZM6J 2W4CA 1YTYA 4WQOC 2JFKA 1VQKS 4LF8J 1RT5A 3MZIA 3LALA 4RUBA 2BANA 4UY8T 2CJBA 5KFYA 3W2WA 4DV0J 3W2WB 1WJ9A 1S6PB 3ZZRA 2JLGA 2QYGA 4F4KA 4KFBB 1FXLA 4Y2IA 1D0EA 3OSPA 3IWXA 4ZVQB 3NBPB 2DJWA 4ZHRA 3ZRFB 1F6TA 4FKXA 2BJ3A 4CTAB 4Y0FA 1QVGR 3GFXA 1S48A 1IKWA 1OY8A 3PRDA 2C2NA 1IKXA 4G1PA 4PWUA 5HO4A 3IN5A 2V50A 3D0IE 3QGPA 2HVIA 1FWLA 2DEJA 4TVAB 2VFUA 2UUWA 3L7UA 4NA2A 1VMBA 2YKNA 4CI0B 4K5RA 4RUAA 4W92B 3I0SB 1Q16B 1U7LA 2KRBA 2CPDA 2N7YA 3HHDA 4NYOA 1S7HA 3MCNA 3POTA 2MKKA 3T5HA 2MKSA 4NLXA 4B9LA 2J0SD 1IJFB 1NNDA 2BKPA 2DHGA 3DI6B 5EWFA 1SJ1A 3BGFA 1YDLA 4I2QA 4LVNP 1SL0A 1VBKA 3LA0A 4USKA 4QW8A 4RW6B 3NS7B 1SKWA 2HMIA 2EK6A 3PYGA 4CQ1A 2J7WA 5L1LA 2DBBA 5D4NA 3G4SS 1ZZFA 4E0DA 1HR0F 2F8EX 4N5SA 4P2XA 4ZGCA 3FVYA 1GH8A 4JP8A 2OPPA 1VQ7S 1KVIA 2M52A 5HATA 4U7UK 2FJAB 3WC2A 3X3UA 2KHDA 2O67A 4Q44A 2YH1A 3IWLA 1ZM2A 2O01C 3ITHB 4PR6A 3FC9A 4KC5A 4QWEA 3CCVS 2NSCA 3KJVA 2IMOA 4F02A 2B7BB 4HT7A 4U95A 1LW0A 2VKPA 2JHEA 4CLSA 2DHSA 4GO5X 1R28A 4W9EB 5AE1A 5L38A 3BZQA 4G1QA 3KKFA 2LFVA 2GW8A 3NAIA 2ZKUA 2ZH9A 1R0AB 1QSLA 4IFVB 1MWYA 3RYLA 3M9MB 1WC1A 3VZIA 3GA1A 1Q1KA 1FTCA 1UVKA 3MPYA 4W9DB 4Q43A 2RHQB 3FSIA 3GILA 1FRJA 4YDXA 4X4PA 3KK2A 4YB7A 2ILYA 2AZ3A 2E7XA 2G1DA 3JSRA 1YK9A 3MMCA 4KSEB 4XDDA 2GO8A 4WTOB 3HKZD 2PEHA 3OUYB 2HHTA 1F3FA 5KOXA 1LQBB 3TWZA 1PC4A 3D6HB 1X0PA 3EGVA 3MMBA 4YB5A 4F36A 5KFDA 4U2MA 2A2DA 1NMEB 3PFOA 3T1AA 4IH5A 3ADAC 1RHRB 2VG6A 4UOGA 4XIUA 5HQ8A 1REVA 4CO5A 1X5TA 2ACYA 5AXNA 4F0HA 2HEKA 3DI6A 4KV8A 4OZ5A 3ETMA 4DJBA 2V8VA 4NLUA 2BM1A 1TL3B 3BYPA 3FUYA 4M5JA 1TKXB 4CWBA 3R6LB 2B5JB 4Y28C 1YHQS 2B3TB 2EFNA 3DRZA 1U1OA 1JLAA 5H9EK 1U1LA 5LJ5Y 4I2PB 1YJ9S 3RBXA 4RW8B 4YDDB 4DV4F 1ZAXA 2BW7A 2WW4A 3D68A 1NK4A 4N8NA 1JLQA 2MB0B 1GX5A 1FRKA 3QFWA 2AKWB 1IBMJ 2H5IB 2FZGB 2YX4A 3DDKA 3IC1A 4Y2AA 2QE5A 2RIJA 8AT1B 4N41A 1S4FA 4W9FB 3BV8A 2XTJP 4JI5J 2CIMA 3CWJA 2OMOA 5C25A 1NH8A 4ZPDA 5GAGI 3KK3A 1LKZA 3DOKB 3EE3A 3M8VA 1SJQA 4QW9A 2XLIA 4FDFA 2F3JA 5GMKa 2HAIA 5EWEA 1VQ8S 2Q43A 3SQGA 4A8KA 2ZC4A 3CCZA 3TJAA 4I64A 3LF0A 1RWVB 2ZHOA 3BBBA 4K4YA 1ITPA 1NXIA 4NYPA 3EGNA 3FFIA 3DFEA 4ZPBA 1KFSA 1M5HA 1WG5A 4L73A 2OMLA 2CADA 4Q0BB 1I94F 1MSWD 5D15A 3GCWP 2OH2A 5JH5B 5G0RB 3IMQJ 5L1IA 1HHSA 2CDQA 2YNHA 1IR2A 2ASSA 4LRFA 5H7GA 4LF4J 3NGKA 3T41A 5KFXA 5C42B 4IO1A 4DF8A 3TQ1A 1N88A 3KG4A 3DRRB 4WU2A 2BQRA 4RR5A 1U4BA 4J9NA 1KVJA 5HQLA 3CMES 5A2QU 4ZVSB 1JKHB 4LR9A 3VQTA 1RTJB 4CNZA 5BXDA 5K8PA 4WE1B 2NXNA 1Q53A 3PRVA 4ZPAA 4QYZJ 4F3QA 1P8GA 3GSDA 4QIEA 4IO9Q 4BLGA 3EM1A 2HQGA 4X4TA 1F5CA 2RRNA 4YHHF 2IDLA 5CCLA 1VHFA 4CYUA 4CLYA 5HI7A 2VPKA 4P75A 2GIFA 1H7WA 2FC8A 1IR0A 1KONA 1EP4A 1ROFA 5LOQA 3HP6A 1EJ7L 2QG9B 4DG1A 1Y5NB 2E7WA 3RBEA 2KT3A 4APFA 1XC9A 2RE1A 5F8GA 1UJ5A 1N5VA 2UV8A 3DNCA 4GVBB 4AXJA 3CB4A 1I6JA 4C8KA 2ZH6A 2FD2A 3PHTA 2KH9A 1Y4ZB 1SQEA 4B3RJ 4P2SA 2DNMA 3ENWA 2OIHA 2E5JA 1Y9OA 1C1BA 1WTBA 1B0TA 1NPPA 3R2CJ 1RAJA 3HJFA 3DRSA 3MAAB 3JSYA 2RUSA 2LKZA 2BZ2A 2H1YA 2GQQA 2MKYA 2W4PA 4B3SJ 2DPIA 1U0SA 2E1CA 3THVA 4TQRA 1MU2B 3CC2S 1HBUB 4LSLA 4PZVA 5KFBA 4UY85 1ZM9A 5DETA 2JC1A 2D3O1 4FYDA 2F40A 1AROP 1OPIA 4YS2A 1L5UA 4G65A 4IR1A 1HQEB 2W25A 3NL0A 3EZUA 2JEGA 3UO0A 3G2XA 1UAWA 1VIOA 2ZNYA 3K7RA 2HHUA 4QR1A 3WDOA 3GIRA 2MLZA 2WSFC 3A8IA 1FXDA 2V9WA 1TKXA 2M2BA 4NA3A 1OWXA 2HAFA 1ZTTA 2F4VJ 5B0DA 1U0HB 3HULA 4WCEQ 1S97A 4YR2A 1U0HA 5AJ3F 2F63A 3OD2A 4C11A 4B3MF 2DGOA 2HK3A 1GTEA 2NYHA 1MG7A 1PILA 3UNYA 5J2QA 4DR6J 1PJ6A 2QJ3A 3FSXA 1K47A 2YNGB 1LW2B 2GVZB 1FKOB 3NCPA 5IC4B 2R3VA 1EQ0A 2KVIA 1WI6A 3OPKA 1KR4A 4DR5F 1O8BA 2A2CA 1OQ3A 2J9DA 1Q8BA 5F8IA 3MR3A 3IAM9 4PYDA 4FPRA 1N52B 2GZOA 3BN7A 3M1VA 2KG0A 4LF6J 3F41A 4OYMA 1RA7A 3QT6A 2C2MB 2XNQA 1K8AT 3KXDA 4LF7J 4WIQA 5EDWA 2L48A 1R0AA 2HRUA 3V6DA 3I96A 5A0YA 5B09A 2ZH7A 5U47A 3M8WA 4DX7A 2KZMA 3BKTA 2E5LJ 2DYAA 1YWXA 4DSKA 1CC7A 1NN7A 3Q89A 1NKCA 5DJBA 1RTDB 4F7VA 1YJWS 1IKVA 1SH3A 1V3RA 3BSCA 1DTTB 2B8QA 3C16A 1HI8A 2AJ4A 2YQ0A 1FRIA 3MKSA 5KFQA 4G1QB 3R97A 2FZKB 4QIGA 5EX0A 5E41A 5L1KA 3T5LA 3M8QA 2DNZA 2GMLA 1FFWB 3W62A 2YNIA 3W3SA 4J9KA 1PSDA 1O51A 2LECA 5BR8F 2K7JA 2NUHA 4BHQA 2FVPA 4K0KJ 2HHHF 2CZ9A 2W4DA 1FNMA 1RGVA 4JB8B 3SCIE 2ZUAA 4N47A 3KWMA 1N0VC 1U49A 2XB2D 4PWDA 3L09A 5HYWB 2FB0A 2Y0SD 1V3SA 2FUG9 2MZQA 3EVOA 1B70B 2WVBA 1PYTA 3H20A 4ZIVA 2DB1A 2ZBCA 4ZVHA 3GV5B 3K5NA 4HKQA 1NHVA 1PGZA 5LSOA 3VAJA 2Z2LA 4TY8A 4LFBF 1WC3A 4TN2A 4KJIA 4I2PA 5HBMA 1CQNA 2PC6A 3I0SA 4D3GA 3DLLQ 4EZ6A 3U1LA 2DGXA 1OMSA 1WC0A 4KO0B 2QA1A 4EK2A 3UDEA 3MR7A 3NCRA 1NLKL 2XNRA 2DNHA 4RJVA 2R9LA 2NZ4A 2ZBIA 3MM9A 1UEVA 2KZZA 2NXUA 3LH2S 4I68A 4K7QA 2B4PA 5GMEA 3W1YC 4Y2CA 4YHHJ 4A8XA 3SFUA 3J81U 1VQYA 5I3UA 4D3HA 3HVRA 1LK7A 4GRSA 2HGLA 3MCMA 4PG8A 3QYYA 4W9GB 4UIJA 2RMLA 4IOBA 3L7OA 5F41A 1RTIB 3VAHA 4A8MP 4DU8A 3TANA 2HBQB 1S9EA 1RT3A 2DD8S 2BE2B 2IIHA 5D3GB 2Y1RI 1N5SA 4NLPA 2LU2A 2UZAA 5IQQA 4YFUA 2LXFA 3QO9A 3J80U 4JI0J 2MHNA 2FVRA 2I5JA 4KYZA 2MJNA 2Z2MA 1AFIA 3C6PA 1ZETA 3CXCR 1UJ4A 5RUBA 2ASDA 1NM2A 1S9GB 4TKTA 3N01A 4TXSA 1W2IA 3BDEA 4ZK7M 4DDFA 2C1EB 2XMAA 5LT5A 4LSNA 3RR8A 1XNRF 4JI4J 2ASTA 2MZ1A 5IWAJ 4E2FB 3G6YA 1FS2B 3MM7A 2H65B 1HBOB 1WORA 2CFXA 3ET6B 3LOUA 4NMLA 3SCJE 2IAJB 2ZWPA 3R7NB 4IDKA 2EC0A 2MGZA 2IA0A 3GFZA 2PFFB 1N5YA 1BXNA 3CD7A 4JI2J 2A79B 2EEYA 3G87A 3QQCD 4ENOA 4X4RA 3G8TA 1RABB 1VK3A 3BO4A 2RRAA 1FJEB 4C8NA 1X8DA 2QC3A 2N82B 1YJ7A 3DGPB 1ZAWA 2C28A 1D3WA 4OI6A 3MEGA 1RU2A 1R8PA 1RKIA 2M88A 2OO4A 2R7OA 3PIPQ 3GIMA 1G7CB 5IQ6A 1R29A 2DVIA 3J7A1 1U09A 3D1OA 4DQPA 3EDRB 2AMCB 1X4BA 2LQ5A 3K8WA 2CJXB 3K57A 4DV1J 4HL9A 2X1BA 5DRKA 2IHCA 4JI5F 2P6TA 3POTB 3FRZA 4ERDA 1FE4A 2E1MC 1S1UB 1KBRA 1REGX 1I5OB 1YJTA 1NK6A 4MIAA 1UWBB 4XO0A 1W7WA 2JFDA 5HVHA 1HNIB 4DR1J 1JJ4A 5EN1A 3HVAA 4ED0A 4RNNA 4X65J 3SSSA 1SKSA 1NB2A 1OQ6A 1WHXA 2AIRB 2QLXA 2QFJA 5DGAA 4PUOB 1MWQA 3KLIA 2JOQA 3KMSA 2HHSA 4ANCA 4CO1A 1A9NB 4DU7A 1AZSA 5LSLA 2KL8A 3KLFA 3E3XA 3KLVA 4JTDB 2V4JB 3V4IB 2RB7A 3HKWA 3Q8PB 4DSIA 2OP5A 1WG1A 4KTQA 4MK8A 3L2OA 5J2PA 3C6TA 3I0RA 1S72S 2DGVA 1DZ5A 2UXDF 4I6WA 3MPDA 4OZ0A 3BGRB 5D3GA 3UW1A 2H4WB 2UXBF 3G82B 5ETRA 1LWCB 2XYGB 3I82A 5KT6A 2A6MA 3I56S 5A8KB 1T95A 1GXLA 1M5SA 2BYCA 1U2FA 1M5OC 1TK8A 1WF2A 3PR5B 2EFQA 4UZCA 4JI3J 1NK0A 2C2EA 1TAQA 2B6AB 3OT9A 3Q24A 3C15B 1DURA 4DF4A 2FJBB 4KBIA 3K59A 3HSJA 2MQPA 2XMWA 3K8VA 4QWAA 3G71S 1Q8LA 1URRA 2GVZA 2IVYA 1LW2A 1MMDA 1B7YB 2BA9A 1XMBA 2Y1JA 2NCKL 1EETB 3K5OA 1KQSR 1HYSA 2I1RA 1EETA 5J2NA 1HYSB 1LFPA 3QT7A 4X84A 3IR7B 4AE5A 3VGTA 4WTYA 4CH7A 5KFRA 5C2GA 2H9ZA 3VAFA 1AFJA 4DCJB 4KHPJ 4KB7A 2I2RA 2J8SA 3MOJB 1HLWA 2YY9A 3NS5A 2CVIA 4M5DB 2IYGA 3M8PB 1NK5A 4RPFA 5HROA 3R5GA 3CDWA 1CJVB 4A8OA 3C6UB 5HAOA 3TR5A 4DN0A 3QWUA 5EWGA 1F2GA 1VQMS 2ZH4A 1Z2ZA 2QLFB 2VF3A 4M5NA 2AP6A 1NAQA 2EFPA 2XZTB 4DOZA 4DR6F 3MDFA 3N6MA 3AXMA 3U27A 3DHXA 3HHKA 5J1EB 4DFMA 2W9CA 3SDEB 2W9BB 2VODA 4DR4J 3M4XA 1MU2A 4IQMA 5KFNA 4IFVA 2R7WA 1OS5A 1RA6A 2DIVA 5D0EA 4OHWA 4ILLA 2P9EA 6FD1A 1EZZB 2X1FA 4GMKA 2MSSA 1M5KC 3UE2A 2IM0A 1X5OA 3V6JA 3T5JA 4LF7F 3BBFA 1NHUA 2Z30B 3B78A 2XY6A 3RAQA 2VA2A 2CJYB 4FF2A 1SC4B 1JNZB 3A8EA 3D3BJ
chains in the Genus database with same CATH topology
3O3LA 5IS2A 4MYUA 1T05A 1NK9A 3R5BA 4P7TA 1NU4A 2HVHA 2GGPB 1VGYA 3HVTA 2PDAA 1KLNA 3THTA 4YB1P 1IN0A 4NYZA 2VOPA 3J81Y 4JI2F 3VQSA 2Z8QA 3AB4B 3DYAA 2CQ2A 1X4GA 2YWEA 1UL3A 4NX9A 1L3UA 2HGMA 1DFDA 2KTQA 4WF9Q 4CXIA 2OSRA 1JLFA 2HWHA 4O4RA 2VD3A 2IRXA 5D4PA 1XR7A 2XG8A 3U1NA 4DMZA 3KK3A 5HN0A 5A8RB 5KG1A 2UP1A 4J9PA 2FLLA 1E6VA 5D6GA 4KIAA 1RYSA 2EVZA 3D1HA 1VFJA 4ZP6A 4ZPTR 3ZZOA 5H9EJ 3W2VA 1T3NA 4FBUA 1P22B 3IS9B 2DO4A 4N9F5 5KFUA 1Z4UA 4AFFA 3LQVA 5CA5A 2K7KA 3V6KA 1RTHB 1YJUA 3TNVA 3CUNA 2HRYA 2IMWP 2VBYA 2J0XA 1IUJA 4ICLA 2Q81A 1FE0A 1HARA 4J9RA 2B9YA 2HW3A 4USHA 4DV7F 3PJXA 3V4MA 4ED3A 1D8ZA 4I4BA 2XMMA 2IM2A 3H2LA 4EOZA 4L72B 2KXFA 1R43A 2RQCA 3GFHA 1AUDA 3NMAA 3ZUNB 3K5MA 4PXDA 4W9HB 5C25B 3KFWX 3JSMA 3QO9B 1R7IA 3M2RA 3MM8B 1UVMA 4O4GB 5K14B 1VQPS 3OHAA 1U6ZA 2B4VA 4OHVA 3G86A 4BKSB 2AGQA 1O0PA 3CVKA 4PXCA 4M94A 3NAHA 4Q5VA 4NLOA 1D9FA 1X5SA 3MEGB 4ZOSA 2R9RB 3IRXA 1K9MT 4PXBA 1R2BA 3ZKJB 5A8RA 3KHHA 3ISND 5HBMB 4YY3F 1N5YB 3CCSS 2ZC3A 3B4DA 1HMVA 4WJBA 5M2PA 3PR4A 4O3SA 1FRXA 5EHHA 4DFJA 4UQTA 2IVFB 2BXJA 4RW9B 4OQJA 3OL7A 2R2TA 4ZHRB 2HFZA 1BLUA 5CXTA 2PGCA 1CS3A 4RBTA 3IRWP 4DLEA 3SCLE 2HLTA 3PM9A 1SJFA 3AQPA 3QGHA 1KN6A 4OZJA 2YWKA 2VBXA 4RWWA 1ZOTA 2B0GA 2CPFA 4ID8A 2PI5A 4RBVA 1Q86T 4CRHA 3O44A 2BUNA 2XMTA 2W9BA 4NCAA 2JLFA 3MM6A 5KFFA 1BGXT 2YVSA 2VONA 3SXLA 2OSQA 3GV8B 1BY9A 3V6DB 4F25A 2QA4G 1SKRA 4KKOB 3MPVA 5KFIA 1IKVB 5DG7A 1QAJA 2XCPA 3KLFB 4V19J 4ZLPA 3RRHA 3N9UC 1YITS 3RBDA 2DT9A 5CH7B 1JX4A 2XULA 4K4UA 1TL1B 4NPOA 4CO0A 1UMJA 2M7SA 2WONA 3M05A 4ZVFA 3WZ0A 3ZNGB 3TX8A 1VCBB 4JTAB 4KE5A 3C66A 2OLWA 4C97A 3FZ2A 2OJ3A 4LQ3A 5DDPC 2ZZMA 1FDNA 4FVCA 1MROB 2OTLS 3H4BA 2LVWA 1DQ9A 4FF1A 4E98A 1HWUA 2JRSA 2X3GA 2E9ZA 2DH8A 3M6XA 1FJGF 4OHYA 4IG3A 5AE3A 4OI0A 4CTAA 5L9NA 2QMWA 4J9MA 2ALZA 2CZVC 1HW9A 2EPIA 2KB2A 2VC1A 2Q1LA 2BW2A 5DADA 3MAQA 2HWTA 2CJAA 1WD6A 4O23A 1S1TA 3J80Y 4F4YA 4C4WA 4KKOA 1N5QA 2MSTA 4H4MB 2UVVA 1NEXA 2BVZA 3RZAA 2BJEA 3AQOA 3SCKE 4B02A 2PD1A 3T5KA 4DL7A 1Q7YT 4LT6A 4NLSA 5K8NA 2V4QA 3LWMA 2DCUB 5H9FJ 2GO9A 1S0VA 2HQIA 3HF5A 1RTDA 5BXBA 4KQZA 4FF3A 2D41A 4WK3A 5D77A 1J5EF 1NJZA 1D1UA 1K1SA 5M2RA 1RTIA 4NLRA 4R8UA 2MQMA 5FD1A 3U7JA 2XS5A 3JB9k 2IYIA 4YMEA 3DDNA 1TK5A 3AA8A 3CD6S 3OSNA 1TQLA 4F2SA 2V94A 2R7TA 1X4CA 1FRMA 1VRTA 1S1XB 2J7UA 3I4HX 2CQCA 2E5HA 3SV3A 3IWNC 3EYZA 4J9QA 1FNXH 4DBQA 4HTJA 1NJYA 3LGNA 3H5XA 1OSDA 3S6EA 2DNGA 2CQPA 5KT2A 1CQMA 1RTJA 4ZOUA 2HHXA 4B9KE 3L3CA 5HMWA 3MAHA 1WACA 4KV8B 2VFTA 5KFJA 2A3JA 5K5MA 3CSKA 1HNVB 1UVLA 5IBKA 3NG8A 3N6LA 2QSFA 5DAFA 2J76E 1VBYA 2B5JA 4C98A 3DM2B 2BQ3A 5LMUF 3K0JA 4O3NA 2CVEA 4DL5A 1OIAA 1TP7A 2FHMA 2AGOA 4M1KA 4B08A 4O44A 4PG5A 4DS5A 3CJ0A 3G8QA 4FS2A 1TKZB 3EGWB 1MNEA 4H4KC 3E8OA 1ZM4A 4DR4F 4F67A 1H3DA 4AWJB 2VPZB 1MMLA 4QR2A 3RB4A 4FS1A 1KTVA 2RS8A 2NR0A 2O5DA 2KJWA 3N79A 1U1NA 2C3PA 1Q4RA 1VQSA 2CJQA 1IBLF 2CQIA 4QWDA 3V5RA 4HH0A 1JK9B 1DBDA 2VOOA 3DOKA 2ZD1A 4C8OA 1S6QB 4IFYA 2Q79A 5A0YB 2QEXS 3TP2A 5BO4C 1SUQB 2AQ4A 3U1MA 2ZH1A 3NLCA 1N6QA 4RNOA 4HDHA 3H2VE 4WIIA 1A7GE 2KDOA 3FSYA 2WAQD 1DSXA 4K2XA 4BC7A 2P1PA 4YR3A 4F4WA 1YBAA 5FIIA 2JSXA 3TI0A 4IOAQ 1CC8A 1VS3A 3HDSA 4N77A 2L9DA 2NSBA 1HHTP 4ZKAA 1KOHA 5IT9Y 2RF2A 3HHLB 4WZMA 3I9V9 4FP9A 3RRGA 5FDLB 2RU9A 3BSOA 4ALZA 4C8LA 1REVB 4TY9A 4LJMA 4KFBA 1HNZF 4DV5F 4OI1A 3M9OB 3LP0B 4OIXA 5B0CA 2WB1D 1OPZA 1R6YA 2M4MA 1VQ6S 3QAEA 4G3IA 2O66A 2YKMA 2J6UA 3QWPA 5E3RA 4PG7A 4EZ9A 3MXHP 3LAKA 2M9KA 4YUDA 3VF0B 3CIMA 2KM8C 2L41A 4EBDA 2CQ0A 2R7UA 3UCUP 3DLJA 2FC9A 3IXQA 4A47A 1R8AA 3BGLA 3IR5B 1C1BB 1R89A 1MW7A 2BE2A 4RX6A 3OLBA 3CCES 1C1CA 1YRUA 2YKAA 4HLBA 5HL7Q 3NNAA 1GTHA 4NWBA 2ZE2A 3NS6A 2B7CB 3AJ1A 3CTRA 2MA9C 2ZJRQ 2E1RA 2J8AA 2WSEC 5GAEI 3VALA 1MMNA 2AYGA 1VC5A 4DR7F 4U6PA 3V2UC 1JJHA 3M2VA 4W90B 4K0KF 2QRRA 3OFEA 3S7RA 3EGZA 3CJ5A 4R25A 4LIRA 3RU0A 2J6TA 1BQMB 3QLHB 5KFGA 1YIJS 1HI0P 1IKYA 3PW7A 1TFWA 3TVKA 1C4CA 2NYIA 3SV4A 3R1HA 2MGZB 3HVTB 4EEYA 2ATLA 3E51A 4DL4A 4QIWD 1C0TA 1N5TA 2CQ4A 4ZS6A 4U2NA 1T94A 1YJRA 2J9DE 4X4SA 1IKXB 4DUZF 4Y34A 2RDIA 2GMJA 4C7QA 3LANA 3P96A 2Q6BA 1DLOB 5IXUA 2YKNB 3J7YI 4TYBA 1S79A 1IJEB 5E0OA 4F26A 4PPDA 5F8LA 2OPRA 2N4CA 1LWFB 1HQUB 4AL6A 3HPOA 2IHR1 4RW4A 2R2SA 2EFGA 2LDIA 1VIXA 4NOHA 1FKPB 2JC0A 5A8WA 5T14A 1FHTA 3DN9A 4ED8A 2I5JB 4OI4A 3TA1A 2W9CB 1HD1A 1DAXA 3I9ZA 2RSQA 2DR7A 4ICLB 3M4TA 4F8RA 4PUOA 3EZ5A 2XMJA 3UR0A 3JYTB 5I3UB 1VLYA 2N3LA 1X4FA 2XSJB 3KJVB 5E33A 4WK1A 5JVHQ 2WRMA 3JAMY 4LFAF 5LL6d 1EXBE 5A6RA 1RT2B 4NLQA 2IJFA 4K50A 1KC8T 2MDAA 2AYEA 5L39A 4W9CB 2JDJA 4NA1A 2HYIB 2SXLA 2QIFA 1K0TA 3DLKA 3OXGA 4G6VB 4QCLA 3SYZA 2WBMA 4DSLA 2ZUGA 1W25A 1XK8A 2ZVSA 3ISNC 2YKOA 1P9QC 3MI7X 4MK7A 4Q7AA 4QPTA 4EGLA 1T03A 1DRZA 4O3RA 1N0UA 3IRXB 4QR0A 5B08A 2C9WC 4H54A 1T02A 1S77D 2RJZA 1VJWA 2IFXA 2B6AA 3UCGA 2XCAA 4B9SA 1L3TA 4HI1A 3OTBA 3HTMA 1S6OA 5KG6A 4ECUA 2JEIA 1TL3A 4NLVA 1YI2S 3OTCA 2AV5A 2VG5A 3RAMA 2P9CA 1WG4A 4PQAA 2COLA 1FD2A 4RW7B 2NLWA 3JYTA 2XBPA 5A6PA 2E29A 5J2MB 2IA6A 4Z2XA 4ECYA 3H98A 2DGQA 1TKZA 1Y5LB 4IFYB 2BQUA 2UVWA 3VWSA 3AHPA 7FDRA 2ZJPQ 1X7VA 1UKUA 1IBKF 2ROGA 4LF8F 4EUVA 5DQHA 2HS0A 1LW0B 2APOA 4B3OA 1NZAA 3UD3P 3PW4A 2VV5A 3QIPA 4CO2A 1QAXA 3Q2TC 2XWYA 3H8YA 1DQ8A 2VPXB 5LXYA 2OPPB 1UP1A 2MKJA 5KOWA 4O3OA 2MKHA 3MD3A 1XR6A 3CC4S 1APSA 1CEZA 1R8HA 1BQMA 1S6UA 3FQKA 3QLHA 2RF2B 4BWJA 5HP1B 1FD8A 4U77A 3BN4A 2XI2A 4RKUC 3VAIA 5E3AA 2DTJA 1XN9A 2EBGA 3MECA 5L8RC 3CCLS 2D3OR 1U48A 1NK0A 3J7ZT 1VQ9S 1WI8A 4IG0A 2J9CA 2UVRA 1TUVA 4JI4F 1NJIT 5F3TA 4X62F 3QJLA 2VBZA 3Q2SC 2FDNA 2HNDB 3HVWA 4ZP9A 2GIRA 3C2PA 2UUTA 5CYMB 2KHCA 5E3QA 4FZVA 4XDCA 3K2YA 3FEXB 1NB7A 4Y2KA 1LFWA 1OO0B 3BJYA 2HZCA 3ZZTA 5FJ4A 1WEXA 2ZHAA 2IAJA 3MMBB 3CCWA 4TYAA 2EK1A 3I31A 1M0SA 3L95X 4CP3A 2K3KA 3ETOA 1N4LA 5LSRA 5CZXA 1HPZB 4HEA9 2LDYA 4BBYA 2DGTA 2MQQA 4DEZA 5HLFA 2VUGA 3ICLA 4DSEA 4HXIA 4B3OB 5KG4A 4A8QA 1PC5A 3JSBA 3OFFA 4TNOA 4RU9A 2FHOB 1KHVA 3CJ3A 5D8HB 1S9FA 4K4XA 3FRYA 3M6WA 2PT0A 3MHYA 3HU6A 3NWGA 1N48A 3CPWR 3ITHA 5F3ZA 3ZFVA 5DDOC 1ZYQA 4DS4A 1HFEL 4X65F 2C22A 3M30A 1OSCA 2NPFA 4NZ6A 2D7SA 2WW8A 1FKAF 2UXCF 2PMZD 4NCGA 1BD6A 4KAIA 3S1TA 5DDRC 2WCXA 3RW6A 4B95B 3C8YA 2F7VA 4YQWA 1JJ2R 1X4DA 2ZM6F 1YRTA 4C0HA 1JWWA 5KFVA 1KLMB 5J1PA 4OL8A 5CYMA 2E1AA 2QA4S 4PQUA 1T03B 5KFPA 3GMGA 3IGNA 3NP5A 5DS7A 1JLBB 4AUKA 4JI1F 2VG7A 3DRRA 2IBOA 1D9AA 2DPJA 3QZ7A 3IAS9 3CDBA 2YH0A 4KHMA 2JWNA 4RU2A 1QE1B 1SBRA 1UFLA 3H59A 4PCQA 1HD0A 2QT7A 1JKHA 3MF5A 3CCMS 1N6QB 3JTOA 2GHVC 3MEKA 2MQOA 1BQNB 4CT9A 1VQ4S 5I3QA 1J2VA 1NRKA 2JVRA 2RQKA 3NBPA 1LM8C 2XO7A 2YNIB 4OLOA 4DFPA 4QWBA 4DUYF 2HS3A 3OR1B 3I32A 3JTPA 4BDPA 2DNPA 5E3CA 2LEBA 4EO8A 1J5OB 3P49B 1HW8A 4DL2A 3ZTCB 3QGGA 2VQFF 1FT8A 3G6ES 2V8DA 1WHYA 4I56A 4DFKA 4TQSA 1CLFA 1HI1A 4UUXA 3C6UA 2D1CA 2V4RA 3QIDA 4XK8C 3UPFA 4JV1A 3GFYA 3KG1A 1Z1ZA 1EOFA 2BACA 4A8SA 3CC7S 2U1AA 2MJUA 4HHJA 4DSFA 2QV6A 4ES1A 3PNIA 3TAMA 4ZPVR 4MIWA 5J1NA 2B9XA 3LGMA 5DG8A 4DR1F 3TAQA 3HVEB 2A18A 2ZNZA 1NJXA 1TR0A 4IKAA 4WZQA 4J9LA 1YJNS 2NS1B 3GYNA 2NPIA 3C3LA 2WK4A 3PJWA 4Y2MA 1Q78A 1C0TB 2JZ5A 2HNDA 3DLEB 4H4OA 4Q2MA 4GKKF 2GQCA 2G4BA 3D2WA 2LXIA 1RYRA 2L08A 2J6SA 2MKCA 3DRXA 3MUMP 1GX6A 7FD1A 2JEFA 2YNHB 4WFNQ 3ZZPA 2X51A 5SUHA 1QVFR 5K8OA 4PG4A 5KFEA 2B9WA 1HQEA 3MMJA 1UVNA 2HLUA 4EO6A 5KT4A 4J9SA 4IR9A 3HLUA 1FKPA 5A8WB 4F4ZA 1LOUA 4ED2A 4HYKA 3VCDA 4URGA 1JXEA 3B82A 3RTVA 2HHVA 3M8VA 3GIIA 1JLGB 1RT4A 4JI3F 3DC2A 2KKHA 4IOCQ 1S76D 3UR3C 1S99A 2QA2A 2B4OA 3KHRA 1LDKD 2DRBA 3M1VB 2PIIA 3ULHA 3WC0A 3ENQA 2LXUA 3K5PA 4RWXA 2PA8D 3IGVA 5J2MA 4B9NA 1U47A 2PO4A 4DX8H 1TAUA 4HTIA 3IA0A 4KGMA 4P6QA 4B3SF 1LWFA 2XY5A