3DRXA

X-ray crystal structure of human kctd5 protein crystallized in high-salt buffer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
161
Chain Sequence
ALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIEFLCVVSKELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pentameric assembly of potassium channel tetramerization domain-containing protein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords BTB/POZ domain-containing protein KCTD5
total genus 37
structure length 161
sequence length 177
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02214 BTB_2 BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drxA03
3.30.710.20 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3drxA01
3DRYA 4YY8A 3DRXA 4ZGCA
chains in the Genus database with same CATH superfamily
1ZM4A 4ID5A 1R27B 2FJXA 4W9LB 4M5MA 5BYRA 2ALYB 3KLGB 5A15A 2HLTA 4IFYB 2ALZA 4J9UE 3DN9A 2AJ4A 2HFSA 2OPRA 1FWKA 1EJ7L 1YBAA 3BBBA 4I2PB 4Y34A 2OELA 1OY9A 4O4GB 4CH0S 1RT3B 1R29A 1HFEL 1I94F 2B9YA 2NUUG 1T3OA 1U7LA 3G9CA 1VFJA 2OTLS 1RT5B 3I0SB 2DR9A 2KZMA 2AZ3A 2KB2A 5J1EA 3IG1A 1HBOA 2VKZG 3C66A 2VZ9A 2AF6A 4JBCA 1X5SA 2W4PA 3R5DA 5EGYA 1IKWA 2K7JA 3SV4A 3DU5A 2V2VA 1FFSB 4XTTA 3OL9A 4CXIA 1Q53A 4LRBA 2J9EA 4ECZA 3HF5A 3MUVP 1BGXT 5DQGA 4YY8A 2ZDOA 1Q79A 1QM9A 4K59A 2DYAA 2A6OA 2WVEA 4DSJA 4JI2J 2P1MA 2J7KA 2J5AA 2RS8A 1S1TA 2ZZTA 2RT3A 1UA0A 1I94J 2YKNB 3ZNUA 3V6HA 2W01A 1RAJA 2A10A 3SI8A 2X1GA 4BCAA 3G86A 1Q78A 1JLQA 2LYVA 2WBMA 2YQ1A 1LXJA 2ZUGA 1SH2A 2MGZB 3NGSA 4PUOB 4DG1A 1S10A 3X1LB 3V4MA 1IKVB 1F9EB 2RRAA 3HHLA 2RQCA 2MLYA 3CPWR 1FHTA 2ASDA 2E9ZA 5E0OA 4USTA 2DNHA 1RAOA 4ZCKA 4ZITA 2J7UA 4QYZJ 4K0KJ 4DL0C 4DI6A 4CM0A 5LMNJ 3H20A 1DAXA 1OS5A 1UW4A 4ILRA 2RDIA 2YNHA 1TV6A 3A8KA 3W2VA 4B02A 1NHKL 2IRXA 3HT0A 3K59A 4DV4J 4EBCA 4W9IB 1T9YA 3MTJA 5HMYA 2YNIA 2VOPA 1DQAA 1GK8A 2DKOB 2O5DA 2EBGA 2RDDA 2Y1LB 5FD1A 1VC6A 2QMWA 2LXIA 4PXBA 1O6XA 3TJAA 1J2VA 2JLFA 3TNVA 1FXRA 1R3NA 1UEKA 2RVJA 3GYGA 3HHDA 1SH0A 3FCWA 3TX8A 4GMKA 4GVBB 4WFBQ 1L3VA 1EB0A 1HPZB 1XBWA 2HLUA 2FGCA 3N6LA 1NKBA 1WOPA 3WZ0A 1YJUA 5GAHU 1BQXA 2XYGB 1XR7A 5KFBA 3MM7A 1ZBTA 4RBUA 3HPOA 3C6TB 2XSJB 3TOQA 1D9AA 4JTDB 4USUA 5AT1B 2Y1JA 2KM8C 4PWUA 3MR2A 5KFSA 5HANA 1YIJS 4B3MF 2XS7A 1XWLA 1HWLA 4R0JA 2HFNA 4U7UK 2RDJA 1TL1A 4JOUA 3PW0A 1RAEB 2B56A 3UVJB 3EGWB 4HVZA 4Y2CA 3RZAA 4OJGA 3TJ8A 5CYJA 5HL7Q 3AJDA 3MM6B 2VBWA 1KONA 2UV8A 1S1WA 2FQQB 3MMAA 5LT5A 3KK2A 2AKWB 1S0VA 3NY0A 2DH8A 2R42A 4G1IA 2B4OA 3BS9A 3H5UA 4ZK7M 1FCAA 4CZCA 5K8NA 4FXDA 5KFQA 3IWNC 3N5BA 2KH9A 1KEKA 1ZAXA 3FVYA 1MLAA 3M8QB 2AW0A 2QE5A 3C14B 2VD3A 2XGPA 1WC3A 3DRPB 4PYAA 4ZLNA 3PG9A 2BKPA 2DNMA 4WYLA 3MEGA 4C98A 5I3QA 1ZM3A 2O67A 1FKAF 4YS2A 1R31A 2OO4A 3LUYA 1DTTB 3O6QA 2XM3A 4L76A 1JNZB 4B9SA 3GPAA 1BD6A 1NB2A 5KFAA 5IQ6A 5HP1B 4KGKA 1FJGF 2UUAF 3MM9A 3V4IA 5J2PB 4N8NA 1NJWA 4L6V3 4I0WA 4LR9A 5CYQB 3VVTA 2C2KB 2G4BA 5DZ7A 4ECRA 1U49A 5LJ3Y 6AT1B 3LP2B 1NDCA 1RCOB 2RIJA 2EW9A 2XI3A 2V50A 2YX7A 1A6LA 1N48A 4WP9A 3UWTA 4B17A 5E5NA 1YI2S 5KAKA 5F9LA 1C0TA 3QO9A 4EYHB 1BMQB 4Y2IA 1HMVB 3MFIA 3HFKA 3GV5B 1WC5A 5D3GB 4FKXA 1FFWB 1TL7B 2VG5B 1H73A 2H3EB 3A8EA 3E51A 2OVQA 2B4UA 1RT2B 2V69A 1EAYC 2DNOA 4DR7J 5A8WB 2CQPA 2CQHA 1C0UB 1RLCL 4CO2A 2CJYB 3NWRA 2LQ5A 4K4ZA 4KTQA 4Q45A 1OPIA 2KU7A 4CO1A 2E5IA 2QJ3A 4TLRA 1S9FA 1U6BA 5JJBA 2R7XA 2BMBA 1QAYA 1BQNA 5A2QY 3NKYA 3IA0A 4W9CB 4PG4A 4DFPA 4PG6A 1S79A 4QPXA 3FEZA 2BEFA 2HPUA 3M8PB 3S8SA 2Y9HA 4WFYA 1U1NA 2RH3A 1S99A 1JLQB 2MGZA 2I2RA 1XEZA 3D68A 4HHHA 5AXLA 5IC6B 1OQ3A 1OYEA 4B9LA 2YBVA 1VDHA 3PVXA 3KMQA 5U47A 2HHHF 2UXDF 1S6QB 3PYDA 3BR8A 3JXOA 3P49B 2R9RB 3QPIA 3U1NA 3DRPA 3VGUA 2WVCA 3T1HF 1APSA 4CTAA 5CAAA 3KHGA 3KHHA 5EX3A 4ENOA 2DGTA 3HXMA 1IBMF 1TKTA 1EP4B 1WJ9A 4CLFA 2ZE2A 1DHMA 4QU7A 2FNJC 1U1RA 1Y0HA 2AGOA 2BQUA 1FEEA 4A8MP 1N0UA 4DR3F 2DNLA 4HT7A 4KE5A 3B4DA 3GIMA 2XMKA 5T14A 1FX4A 4ED2A 4G3IA 4LSNA 2Y1RI 4J9KA 1ZM2A 3SSQA 4ZPWR 4RO0A 1HNVA 4RL1A 2FPHX 4O4GA 4X4PA 4ANEA 3A12A 3O8WA 1HNWF 2ROPA 4K5RA 3MMBA 1GXTA 3SBMA 4TY8A 2IC3B 4M5HA 3EYZA 1NK4A 4QU6A 4EYIB 2CZ4A 4NA3A 4AQYJ 2BE2B 4XIUA 3QZ7A 2UUCF 4DR4F 3AOAA 3PACA 1C2PA 3ULHA 3L7PA 4BS2A 2XNRA 5AE3A 2LQBA 2OEKA 1U2CA 2P8IA 4RR5A 3T5LA 2KT5A 5HJXA 3LAKA 4C8LA 2DH7A 4NWBA 3UVJA 4DL5A 2M8HA 1MROB 3KLIA 3DLGB 2DNZA 4BKSB 4B08A 1KQSR 2ZVIA 2MZJA 4NOHA 2DNGA 2I8EA 2OH2A 1D09B 1PJ7A 2YQ3A 4MH8A 3UN3A 3CO9A 5HN0A 1FD2A 1WI8A 3FNNA 4FP9A 4OMFG 1L3SA 1UJ5A 1RBLA 2YWWA 1CQMA 1SPBP 3MFHA 4F4YA 1FTCA 2CJKA 3HHLB 2CQIA 3LGMA 4TU8A 5BR8J 2WW8A 3JAMU 2Q43A 1WNEA 3NCPA 1FWLA 1N88A 2GMJA 2A2DA 3MPYA 4HDHA 5HO4A 4JV5J 4NLQA 5D4OA 3UNGC 4WTOB 2HIYA 1XR6A 3A8JA 5DDRC 1DTTA 1I1GA 4KO0A 4DQIA 4D3HA 5FLXY 5BO4C 2CWXA 3QWPA 1YRTA 1MMLA 1YSJA 2GNKA 3QMQA 5D0RA 2KXNB 4B3RJ 4PWDB 1N54B 2UXCJ 1AW0A 2XMWA 1FF2A 4DR5J 1XNQJ 1RK8A 1JK9B 1URNA 4KSEB 4EI2A 2MMYA 1LFPA 1UFLA 2CYYA 5LL6d 4UQGA 1FKPB 1JXEA 1NDKA 2P9GA 5FDLB 4LSNB 1X9WA 5H9EJ 2AV5A 2C2MB 4DSLA 3I31A 3OVAA 4Z37A 4DV1F 3DLEB 3A3NB 1YRXA 2RNEA 3CTRA 3DGPA 3D28A 4WFXA 2W2QP 4TY8B 3MEEA 2YNFA 5C25A 4C4WA 4QPTA 2HHUA 1XC9A 5E3AA 1PYOB 2BM0A 1RACB 1FS1B 2FZGB 3KNGA 2FVQA 3K17A 2OMOA 4P52A 1J5OB 2XB2D 1FK9A 3BKFA 2AYEA 3MPVA 1FVSA 2R8GA 1TZ0A 4LF9F 2ZC3A 3CJ3A 5E7OB 5F0UA 4QR2A 4ZVEA 4UT4A 4YHHF 4QWCA 3US5A 4LIWA 1U2RA 2XNQA 5ETTA 4BWJA 4U67Q 1F3VA 4YB1P 2ZJRQ 1FNXH 5CXTA 3L9ZA 4NYPA 4LF6F 3MI7X 3KNAA 4Q8EA 3FBBA 2XLIA 1H2VZ 3CVKA 1FRMA 3CJSA 2MZ1A 3HFZB 4IH5A 2VPYB 3E3XA 3G6VA 5LMUJ 1JXVA 2W7OA 4E2FB 2VONA 5EUPA 3QAUA 4K2XA 3OR1A 1PKUA 2O66A 2F8MA 3R7SB 2WTFA 1H7WA 2D9PA 2LA4A 4RUBA 1OMSA 2BUNA 4CNZA 2B43A 1D0EA 4J91A 4CP5A 2EFGA 4C11B 1X5TA 3G4SS 3V81A 1X0FA 1DTQA 2RD5C 3OBIA 3HU6A 3MAAB 3LWLA 1P8GA 2DXEA 2WVBA 3RB0A 4OX9F 1N33F 3ILIA 3D5MA 2CWKA 2AYGA 4I6AA 2N7CA 1R0AB 4PG5A 2HQGA 3HSDA 4TYBA 3IRXB 3FGVA 3LP2A 2CPEA 3T1AA 3J7YI 3KYLA 4DF4A 3HDSA 2DNYA 2LXUA 1HNIA 1SC6A 2WONB 5IT0A 1Q7LB 4J5OA 4P2XA 1VC0A 5D3GA 2BR0A 5ETMA 4F04B 4ATNA 8RUCA 2D1CA 2LLZA 2WONA 4USIA 4EGLA 2AJFE 1S1VB 2G0IA 3TUZC 4UY85 4B95B 2NSCA 3FRYA 2IC3A 3VALA 3GG1A 1JLBA 4OV6A 1NN7A 2HQDA 2KJWA 5EHHA 1LWCA 1JLGA 3VGVA 3T1YF 1TL3B 2GW8A 2QX0A 2QLBB 2WVDA 2YWEA 1SC3B 3MM8B 1N52B 3UDLA 1QUPA 3O5TB 4JV0A 1RT6A 2JZ5A 3SEOA 3SXLA 4YFUA 3LGHA 2DD8S 4CI0B 3U7JA 2H5IB 2R7RA 1GMWA 3I4HX 3P5BP 3TEGA 2V68A 4CDIA 1NSAA 4Q7AA 4F0MA 1C1BB 4CH7A 1T7PA 2HNZA 4H4MB 2DHAA 2YKAA 1U24A 2MXYA 4ILMA 1AZSA 5GAGI 3P3DA 3M6WA 3MDFA 1HQUB 1S59A 2J0QD 4DSKA 1S4FA 4I6JC 1BUOA 2A79B 4NLGA 3OFFA 1DQ9A 3QIDA 3BSOA 4ED7A 1ZM9A 4OIXA 4RBTA 3CGIA 3OR1B 2APOA 3QRPA 2G9OA 1XK8A 3G6YA 4OYOA 2V34A 3MM5A 3HVEA 3HHKA 2IAJA 3C14A 4BWMA 1KC8T 1CJVB 5G0RB 4NRUA 5KT2A 1SJ4P 4H4OB 2J6UA 4OZNA 3QFHA 1RU1A 1T9WA 2E31B 1MN7A 4R8UB 1M5SA 1RISA 3DHXA 3W2VB 5J1EB 3LANA 3PO4A 3FSYA 5DO2A 1T03A 2MKIA 2H54B 3KKFA 5BXDA 4CLSA 4Q44A 4HR2A 4MTPA 1RHMB 3IRWP 2HMIA 2MZQA 3ITHA 4MYUA 3J81U 1WF2A 2GGPB 4WU3A 3J80Y 1UJ6A 1R7IA 3F73A 1K73T 2IBKA 3POTA 4IOCQ 3PJXA 4CH1A 4A8KA 2B4VA 1HIYA 5D4NA 1JKHA 5H7GA 4ZCLA 5KFVA 4DLGA 2KZZA 3BPSP 1RA6A 2KVIA 3AH6A 3J7Z5 4DQPA 3P45B 3ETOA 2X7IA 5LLIB 3GZ7A 1LKZA 4CT9A 1D3WA 2W2NP 3DGPB 1E6YB 5F9NA 1Q95G 5ETQA 3TVYA 4WU2A 4DV7J 2ROEA 3BN7A 2WSEC 2M52A 5J2QA 1JLBB 3MOJB 4IFVB 4FXVA 4L3KA 1UZDA 3Q8QB 2N3OA 4RNNA 2B8QA 2QG9B 4C7QA 5F8HA 2JRSA 1J5OA 2NN2A 2DY9A 3I9ZA 3R8YA 4YR3A 1M5KC 3FBCA 4LSLA 4BC7A 1S9EB 4MMOA 4Z2XA 4YQWA 3CO0P 1R89A 3PJWA 1UVKA 3J81j 3NMAA 2IHCA 1S9EA 3T41A 2DT9A 2DHGA 3M6UA 4DF8A 1B4SA 1DARA 1R6YA 3NS6A 4NLUA 4PG7A 4WWSA 4ES1A 3UPFA 4DR7F 3DRSA 3OR2A 3TYTA 1DBDA 2IPOB 3LP1A 1AT1B 3X3UA 3ZTPA 1JLCA 4EEYA 1YHQS 1UVNA 1VIOA 4CLZA 4PXEA 3HFVA 5KFNA 4DOZA 3MWBA 4QBUA 3I0RB 3O44A 1CULB 4DL4A 5J1NA 2RU3A 4RW7A 2V8PA 3V81B 4NXNF 4GKJF 4W9FB 3H8YA 2AZ1A 3SFUA 3EVOA 1S6QA 1D8YA 3TZYA 4NI2B 2D3ZA 2NPFA 4KHPF 1RWOB 4FNIA 1RWXB 2F4VF 1RWPB 4X4TA 5CCLA 3IWXA 4W9HH 5GMEA 4DXLA 2I0XA 3DLHA 2QYCA 3BKTA 3ADAC 1U6FA 3CJKB 1J27A 4HHJA 3LPEA 4AL5A 2GS8A 3HHEA 2E1PA 2WB4A 3IMQJ 5J2PA 4P73A 4RJVA 4LMZA 2D74B 2P1PA 2B9WA 3BJYA 3NWGA 2GO9A 5AE2A 1JKHB 3I9V9 3CXCR 3K5OA 3D0HE 2AYBA 3BN4A 2NXUA 1FFGB 2HNDA 3DM2B 1F5CA 2HBQB 3HKWA 4ZVTB 1T11A 2MQNA 4I64A 1F3FA 3W61A 2FJDB 5D6GA 1PO6A 2C2OB 1EIYB 3NNAA 2VIHA 3PYFA 2AJ1A 3N9UC 5HROA 2FJVA 1TVRA 1WKJA 3ZC4A 4X65F 4B3OA 4C8MA 4CYUB 4G1PA 2P5VA 2UVUA 2XZTB 3QNWB 2VJUA 2IMOA 4GC6A 3H7HB 4RKUC 3ZRFB 1WTBA 1B0TA 2IYGA 1LEOA 1K47A 4ZPCA 2V4RA 4B9NA 2C9WC 4USJC 3C6NA 3PIPQ 1KR4A 1KVKA 1UFWA 2RQMA 3M30A 1QDVA 4KYZA 2GCFA 2CNKB 4X4RA 2EFQA 3BF4A 4L72B 2CXEA 1LW0B 3AXMA 1GMUA 1PILA 3R5BA 2E9TA 1HQUA 4DU7A 2GIFA 3VCDA 1WTFA 3C19A 4KY3A 4ED5A 3N6NA 1MW7A 2G1HA 1UCNA 4I1TA 4A8SA 5J2MA 3LF0A 3PRBA 3VAJA 2V8HA 1FVQA 4F4ZA 1TMJA 1ZYQA 1X5OA 4MKAA 4TXSA 2CRLA 5KFRA 2J0WA 2MPUA 2LQ9A 5A6RA 1FXLA 2QL7B 5DQIA 1ULRA 5IM0A 5F8GA 1P22B 3EGNA 2NYIA 3OTOJ 2VQEF 4KGVB 2ZJPQ 5KT3A 3GR1A 2NSBA 1RHRB 3NAIA 2ZD1B 4K0KF 1U8WA 3IC1A 3MOZA 4URQU 1YZ6A 2MQLA 2RILA 1Q1KA 3LNMB 1RBOB 4N8OA 1FJGJ 3K7RA 4F3OA 3ICLA 4ZP8A 1RTZA 1S1VA 3CSKA 1T94A 2IJFA 3HHLD 2VG5A 4O0IA 2NCKL 4ETXA 5C24B 4DV7F 5AXMA 4ZA1A 1JX4A 2EBEA 1Q5VA 2A18A 2RQ4A 2PSZA 4NLYA 1NSQA 2PT0A 3C6PA 3R5AA 3EXCX 1TUVA 1Y5LB 3MEEB 3QJJA 2VG6B 1KOOA 2GAHC 4I4BA 2OSRA 3I6PA 3N28A 3OTCA 1EOEA 2X3GA 3T19A 3OT9A 5KT4A 1VQOS 1NRKA 1C4CA 3H5XA 5JXSA 2E5GA 3NG8A 2BJ1A 2KRBA 5KOXA 5L46A 3GJQB 2EFOA 3KDNA 2RUSA 4LQ9A 1S0NA 2FTRA 4OZJA 3HX9A 1T9UA 3FMBA 1EZZB 2OSQA 3DOMA 2VG7B 3M8PA 3QGPA 4NCGA 4OZ3A 4QWBA 4R0EA 5KFLA 3WDOA 1R8HA 1I6JA 4A47A 1CLFA 3RYLA 3DOMB 3IGVA 4CYUA 4J9SA 3OGKA 3DYAB 1C1CB 5KG5A 2E5LJ 2DRDA 2PD1A 3R1LA 3ISNC 3CCSS 2VKPA 1L3UA 4GKKJ 4HI1A 4WK3A 2HZCA 2GVDA 4X2BA 1UZHA 1JXLA 2W4DA 4I69A 2UVRA 4OQJA 4C11A 5LM7E 2GVDB 2MSTA 2LQ8A 5HLFA 5ETLA 2F9DA 2QC3A 5GAEI 2YPZA 1T03B 2V6AA 3BGOP 3T6JA 1FE4A 1J5EJ 4ZMMA 4R25A 2R7TA 1YK9A 3IBFB 3GYXB 5ETOA 4U2NA 2MZTA 1TMMA 4RLEA 3TAMA 4DU8A 5DG8A 2UUBF 1GAOA 2PI4A 4LF7F 3JTNA 2E7WA 4C8OA 3TUPA 4WKRA 1XN9A 2F4FA 5C42A 5LXRA 3MD1A 3OSNA 1R8CA 2MKCA 2DGVA 2IF5A 1M90T 4ECSA 1LK7A 3CW2C 4RWXA 1JLEB 2HFOA 2DR7A 4W9DB 6FDRA 2BV3A 2CPXA 4KJIA 1WHXA 1Q82T 1XMQF 4P71A 3K5PA 2QFJA 3I3NA 1ZPVA 3D3CJ 5L1KA 5HVGA 1PCAA 1RT5A 2F40A 2MKJA 1WDDA 5HBMA 2YNFB 4HL9A 1FDAA 4JP8A 3BO4A 3CIZA 4PQUB 4LRCA 2N82B 3PYGA 4UYIA 4QYRA 4O44B 1T95A 3AD7C 1A68A 1H74A 4IR9A 3OHAA 3I5BA 2YH0A 4A8OA 2RF2A 2CJQA 2CPDA 4ICLA 1ITPA 2CG8A 2NXJA 3Q86A 3BBFA 2C2EA 5H9FK 2XMAA 3U27A 3L09A 3FFIB 2JEJA 3GE9A 3DLBA 3DRSB 3UCZP 2GJ2A 2POKA 2EPIA 2FDNA 1AA1B 4ZIWA 4ED3A 3D6MB 1TK0A 1HWUA 1D9DA 4YUDA 1REVA 1TKXB 2OPSB 3D66A 3AB4B 3GG0A 2W9AA 2CJBA 4OX8A 2V9KA 2QO3A 4O0NA 4DG1B 3K0JA 3ZNGB 4ETZA 3EGVA 3LPYA 4YB7A 5SUHA 5DAFA 1Q8BA 1N36F 4Q2MA 3M7VA 5AJ3F 1G6BA 2FHJA 3EVWA 3QYYA 5D0EA 1TV6B 3HI9A 4PXDA 4R8UA 2XWXA 2G1DA 3FSXA 2K1RB 2IZVC 4YHHJ 3D0GE 3Q89A 1W2BR 3D6TB 4P10A 5B0DA 4DPUA 1NBEB 1RTHB 2ZH7A 1U4BA 2HURA 3GMGA 4ZJLA 1K8AT 5KFZA 1ZS6A 1MU2A 2MDAA 4JI3F 2DXDA 5C5JA 4PRFA 4FF2A 1UTAA 7AT1B 3RAXA 1O0PA 2HKEA 5GMKa 2WRMA 5CYMB 1NZ8A 2PC6A 2P9CA 4Q5VA 3CB4A 3R2CJ 1G2EA 4NA2A 3L3CA 1S1WB 1LNQA 4ED4A 4DSEA 3SMZA 3E4UA 2RSQA 3GR0A 1U45A 2W2OP 2W9CB 4JI8F 1TVRB 1LWEA 2BRKA 2P1OA 3QZ8A 3ZTSA 4J8ZA 1Y3JA 4DSFA 2AHOB 1T0TV 2PMHA 2QRRA 4IFVA 2V4JA 3GJSB 2AX0A 4EO6A 1RE1B 3K5MA 3SYZA 4ZLPA 3TI0A 4NEYA 1RT6B 4USHA 4WXOA 4WYWA 4R5PB 4ED8A 3VQSA 1GTHA 2L48A 1H2UX 2GVZA 3FRZA 4H4KC 4HLBA 1VMBA 2YNHB 3QT5A 1HI1A 4NYOA 3RUBL 1S0OA 2VASA 4KKOA 4DR6F 2HBZB 1KDNA 2F7VA 3LP0B 2ZFHA 4DN9A 1H38A 1IBKJ 4LF2A 3KK2B 4JI1F 1Z2LA 3JQJA 2OI2A 1S1XA 4NLVA 3ZFVA 1NK5A 3BDEA 3I4PA 4DV6J 2HQIA 5T7LB 2V5HG 4HHUA 4ES3A 2PA8D 2DIVA 5B0EA 4C8KA 1VR6A 4RW9B 2V9WA 3ILOA 3M9NB 3RBEA 3CMES 5CD4H 5AJ3J 1SH3A 1GH8A 4FS2A 4YOEA 3MM5B 3HVEB 1IJEB 5GVQA 1LQBB 1RU2A 2M2BA 4MK9A 1IBLJ 3LW5C 3OUYA 3OFGA 4DV0F 2JJ4D 3VQTA 2MKSA 4AT1B 5A76A 2IA6A 3AJ2A 3PRVA 3RW6A 4M5DA 2NQPA 1VYAA 4OYBA 5DLGA 5KFJA 1W25A 1C4AA 5KFKA 3MR5A 3TO8A 1PGZA 2CNLB 1WF0A 1YJ9S 1AB8A 2IIHA 1YRUA 4ZP9A 4Y28C 1CVJA 5A8KA 4W9EB 1LQ9A 2RRBA 4UW2A 2R8HA 2R9LA 5EWGA 3HSJA 4QCLA 5EWEA 1TAQA 1W7WA 2UUCJ 4DR4J 3T9ZA 3ISZA 1VBKA 1CG2A 1NNDA 1UEUA 2AJQA 5GADU 4CO4A 3OJUA 3OTDA 3DM2A 3KUHA 3CF5Q 1XTZA 3MGJA 5HBMB 3HVRA 2FVSA 2I1RA 3J7AN 1HBUA 3KK3B 3VHQA 3EZ5A 3V6JA 3NMRA 2KTQA 4N47A 3OL6A 2JDJA 4WKYA 3DHWC 3BREA 2VFUA 2WZ1A 3HD2A 3QLHB 3H98A 4DZDA 1VQ5S 3BB5A 1IQTA 2WAQD 1CS4B 2BZ2A 3NRBA 3CC2S 4NLXA 4G65A 2BJ3A 4PKDB 4DR3J 1UKUA 2DO0A 2CAJA 2VPXB 2QV6A 3MHYA 4KGMA 3Q8PB 3HT3A 2VFVA 4WXWA 3VAHA 1JLFB 1EP4A 4RW4B 3QJPA 4U7UD 4FYDA 2I6WA 5J1PA 1NDLA 2Z2MA 3G82B 5IT4A 3Q8VA 2ASSA 1BHNA 2AEFA 4KPYA 5A0YA 3FKBA 3IS9B 3M32B 5KG2A 2ZH1A 3V5RA 5F3ZA 4DFMA 1J5EF 1TQLA 1QSLA 2R8KA 3ETMA 5L39A 1B3TA 2QFIA 4NLRA 2HFUA 2PEBA 2ZH5A 2VOOA 4GO5X 1RLDA 4JI0F 4LFCF 1HMVA 2UV8G 4ZJQA 2F5GA 3HVWA 5HLFB 2KO1A 1SQFA 4BHQA 1OSDA 2PMWA 4K4XA 2V94A 2JL9A 1QE1A 1OWXA 3MKSA 5A6WA 4IRKA 1SB6A 4BC9A 3OQ2A 3WC2A 1IXKA 1PAUB 3W1YC 1U8SA 3J7YU 2VH7A 1SL0A 1HR0J 2MSSA 2M88A 1RDRA 1T05A 1RTHA 2ROGA 3Q8YA 4MK8A 2V2ZA 2QSFA 2R7OA 4ZVGA 1ROFA 3H42A 1ZTTA 3BGUA 2OEMA 1EODA 1RT1A 5K8MA 4O3RA 4IDKA 4M1KA 1AUSL 4DDFA 1U09A 2QLWA 1HBNB 2DJWA 2XYPB 2Z2ZA 3Q8SB 3LUTB 4CRJA 3M4XA 5D4LA 2HNDB 1BQMB 1DSXA 3QRQA 2JC1A 3UR3C 3GJRB 2AJ0A 4TY9A 5BYQA 1RKIA 2DGWA 2HHPA 3DU6A 2KM8B 1U1KA 4PUOA 4MFBA 3JSYA 1EX8A 4X84A 3OGLA 1RTIB 4YB5A 2BRLA 3CT9A 2ZBPA 4IG3B 4F36A 4DS4A 4A8FA 5KFDA 2CVEA 3FUYA 3OVBA 3ZTOA 3E01B 4HH0A 5LJ5Y 4U77A 3EXYA 1PSDA 5KT7A 1P1TA 1RAFB 4J7CA 2QZ8A 2OFGX 3DCAA 3M2RB 1X5PA 2XGQA 5BXBA 1NSKL 3BGFA 4NZ0A 3MEDA 2F9JA 3ZZYA 2QA1A 1VQ4S 2FLLA 3FEXB 5H9FJ 4ZVSB 2VQEJ 4W9KB 1KHWA 1I3OB 5EN1A 3DOLB 3N0VA 2P1QA 5C2GA 3PYEA 4KR0B 2QTWA 3G8TA 2OTJS 4NLDA 5I42B 1FJEB 1RQ0A 3M05A 3I0RA 1WORA 3W8GA 1Q8LA 1N36J 1X4AA 2KFYA 5AXNA 1D1UA 1C1CA 1HNZJ 3IAS9 2HW3A 3WX8A 2ATLA 4OZLA 4F67A 4NI2A 4XPCA 3P6YC 1SI9A 2VBZA 3CDEA 4Y2KA 3NS7B 3WX4A 3DKDA 4KBIA 4JI4J 2ZNYA 4YEAA 1NK6A 2BE2A 2DPIA 1NH7A 3CJKA 1T1DA 3CEDA 4DN0A 4CLPA 4GC7A 3HK2A 2RHSB 4C3KA 2QLJB 1FD8A 2IVFB 3CJRA 4EFAC 2Y3YA 2MQMA 4ANDA 1SC4B 4I7FA 4C0OC 3LOUA 5B09A 2AGPA 3F44A 4RU2A 4ZPTR 3QGIA 3HM9A 3I55S 4U9RA 1VC5A 1G4CA 1K1SA 2XZWA 3W63A 2G0CA 1IN0A 1GXUA 2JSXA 2DGUA 3A4TA 2DTJA 2MKHA 3KLIB 4U8YA 5I3PA 2W8KA 2XQCA 1SQGA 3DLEA 4UOFA 1PC5A 3G6ES 2DR5A 4ELUA 5DM6Q 3UR0A 4DR1J 2NXEA 1DRZA 2WK4A 1P27B 2GHVC 3K8WA 2JLGA 3IM9A 1L3TA 2XLJA 4K4TA 4Y0FA 5HQMA 4JB8B 4CNYA 1GMVA 2N7YA 2Z30B 5KFOA 4LF4F 1B7FA 5L1IA 1DZ5A 3TANA 3MXHP 1VQMS 3DRZA 3KWMA 4RUCA 1CC8A 3QAEA 1KVIA 3F41A 2KVQE 4WK1A 4WFNQ 1SJQA 2ZKTA 1IQZA 4J9QA 3UCUP 4F50A 2FHOB 2DNQA 3GFZA 4EUVA 4AJYC 4AUKA 4GRSA 4ZLLA 5T7LA 3VZIA 5LMNF 1FRXA 1SCJB 5BJRA 4DPOA 2I9SA 3AA9A 4ZP6A 2ACYA 2Z57B 3GONA 1Z4UA 4OJHA 1OSCA 2ZBRA 3CULA 2ZBQA 3EZUA 3FMWA 4IFYA 2ZJQQ 4O3NA 2O1PA 5J2MB 1NEEA 1TUWA 3WIUA 2XO7A 5FJ4A 3SFGA 5HQ8A 3MR6A 4KHPJ 3LA0A 1RT3A 2YWGA 5HVHA 5IS2A 2NREA 1VQNS 3FK4A 1VQKS 4DS5A 3UDEA 1TL5A 4QOTA 1HA1A 2EWHA 1VISA 3IN5A 4AWJB 3CJ4A 4ZPVR 1NAQA 3IFEA 3GFXA 4OJ3A 1BWVA 2L9DA 4Y3CA 3G6XA 2R2TA 3EGZA 3MPDA 1NDPA 2G2OA 1Y11A 5A8KB 4YB6A 2H9ZA 2ADCA 5B0FA 4NPOA 4KGXB 1Q8IA 3CJ5A 1RA7A 4YY3F 2ASTA 1T9XA 1HNIB 1B0PA 3F56A 3IP0A 4ZPAA 3T6BA 4F3QA 4W9GB 2BANB 2C3YA 5JH5B 4HH1A 4P6QA 2XEXA 5HMZA 2DHHA 1UETA 4DFJA 2KT3A 3NGRA 1RYRA 1KVJA 2DY1A 3Q0AA 1PJ6A 2F8HA 2BBEA 1RWKB 5DZ6A 1TR0A 1LWCB 4ELTA 3P4UB 3ZRCB 2W9CA 2PN6A 3Q23A 2NZ4A 1CSJA 1CS4A 2GQ2A 2IAJB 3MAAA 2HRYA 2RF2B 4M94A 4F7VA 3CCQS 3CJQA 2P1NA 4PG8A 3UDCA 3PFEA 4XK8C 4C0BA 2W8LA 1VQYA 5EUHA 2DRBA 1S5ZA 1WWHA 3CDWA 4MKYA 1R28A 2OVRA 4DPWA 1IR0A 4ZLJA 4KKOB 3R2DJ 2YKOA 3MM9B 1LW2A 2J0XA 3RRKA 3LWMA 1B64A 2HMIB 2W4CA 1NHUA 1V3RA 3TUIC 1RZMA 2V8VA 1VRUA 3MPUB 3OV7A 2N4DA 1S4EA 3HCXA 2GC8A 1V9OA 4K2JA 2YNGB 3DRRA 4DR2F 1JJ2R 1GMWD 2B9XA 2MQPA 2BJ9A 3DRYA 4JV2A 3QWUA 1BY9A 4K4YA 3G87A 1YZ7A 2WW4A 3PEJA 2LDYA 2QA4S 4QWDA 1RUSA 5CABA 4P2MA 2J7WA 4DZ6A 4OHVA 4DX5A 2W9BB 3ZZOA 4BGCA 4KV8B 3LTOA 3FSIA 2LDIA 4DPYA 4WZQA 2AYMA 2KG1A 4U95A 4DUZJ 1UVJA 3VAMA 2ZZNA 3THPA 3JSMA 2COLA 2W1BA 4IG0A 4OI6A 3L95X 1QSSA 3PJ9A 2AP6A 2Z2LA 4OI2A 3PR4A 4CIOA 2CQ0A 3U1MA 1P9QC 1X8DA 2VBXA 5CYMA 4EU0A 5ADZA 3KLFA 3NNCA 5B0GA 1DLOA 5IWAJ 1WKKA 4EZ6A 1E6YA 1PBAA 1G1XA 2UUWA 3BGRB 4UZCA 3T1YJ 4WF9Q 4TQRA 4XO0A 2Z56B 4B9UA 3M8QA 1SJ3P 1RTIA 1N4LA 3QQCD 5IT9Y 4B9KE 2GQQA 3PX4A 4O44A 4ZVQB 2NLWA 5HVFA 3OXFA 2ZHOA 4C8NA 1PAEX 1U26A 2D3UA 4RX6A 3ZO7A 5HZGC 5K14B 2ASYA 1MN9A 1LV5A 1CJTA 1T02A 4LR7A 3U1LA 1X4CA 1U48A 2R8IA 3KOAA 2R3VA 3HVTA 4EZ9A 2ZE2B 1X9SA 1F2GA 4F02A 1YLXA 2YKMB 3ET6A 1SIWB 3DOLA 2FLPA 2VC0A 4OYIA 1KHVA 1FNMA 4URSA 5I3UB 1R0BG 4PPDA 1UPPA 1HQEB 2XCAA 3BZQA 4ER8A 1YVFA 3IS9A 3E8OA 1M5PC 4B3TJ 3QIPA 3DNCA 3BKUA 4RW9A 3KLGA 2KI2A 1HNVB 1ZOTA 2WHOA 4DL2A 3NOCA 1R43A 3AAWB 3NXZA 4USVA 5F8MA 2UXBJ 3A13A 1JMTA 2XSJA 1EXBE 4JI4F 2P9EA 4CT8A 1SKWA 3DCGB 3M2UB 5F3TA 4Z7CA 3DOKB 1KLNA 3SZ2A 3D2WA 1KKHA 4HDGA 1A7GE 5L9NA 3MECA 3G71S 1NK7A 1EOFA 4M5DB 2VV5A 2LQJA 3NAHA 4X62F 5JVGQ 2GIQA 3R27A 1QSYA 3AOCA 3Q2SC 1E6VA 3NOGA 1YJWS 4ZN3A 3D7SB 2Z58B 1Z2ZA 1TL4A 4KC5A 1WC0A 3MM6A 4ID8A 1Y7PA 2YKQA 3ZZUA 4DPXA 4CLUA 1YJNS 3I56S 5B0CA 1BXNA 2LECA 2DB1A 3ZNJ1 2JEFA 1IJFB 1HQ2A 4M5NA 2Y0SD 4O4RA 1RCXB 1B99A 3VR1A 1NKEA 3WBZA 4WCEQ 1JLCB 3PRDA 4EK2A 3M1VB 2H48B 2R2SA 2UVVA 2OVPA 3BO2A 4RW8B 1CQNA 3BGRA 3BSCA 2NYHA 3C8YA 4USMA 4X66F 3EPIA 1VBXA 2YXLA 2H4YB 2HVZA 5M2RA 4ECTA 1ZZNA 4HI2A 1ZAWA 3NS5A 4A46A 3DDKA 4OL8A 2IRUA 2PO4A 4Q0BA 1Q5YA 2EFPA 4DV1J 2D9OA 1TK8A 1VJWA 4EO8A 4DV3J 3IBWA 2GVZB 1UWBA 2I5JA 1V5IB 2GAGC 2JLEA 4FVCA 3AY0A 1EKSA 1MWZA 3V4IB 2ZZMA 2XMTA 4QW8A 4OYXA 2CZ9A 5JVHQ 1HI0P 3M5BA 1WUUA 3DDIA 3FZ2A 2BKOA 3QRRA 3KUGA 3R5GA 2QT7A 3M32A 1RAHB 1SC1B 1NMEB 1JQGA 1SVDA 2ACMA 2KT2A 2ZUAA 3MEKA 1NZAA 2DNNA 4DCPB 5AE1A 2CQBA 3ELHA 3D1HA 4PZVA 1VK3A 5B0AA 3MMJA 3L2OA 4EBEA 5D78A 3UFCX 4I2QA 4CLTA 1VQ9S 1N5QA 4JV5F 5CQGA 4ZOUA 3AFGA 3KG4A 3M8WA 4NCAA 4QWEA 2WOMA 2Z2YB 2DISA 2W7PA 5MLCV 3UD3P 1L3KA 1WSVA 1TKDA 3NNHA 2PA3A 5KFXA 1GTEA 1ZA1B 1RT7A 2XBPA 3IG1B 3IM8A 4Y2MA 4X64J 4ECYA 5A8WA 1NHVA 4XDDA 1CPZA 4F4KA 2LMIA 1RT7B 1F60B 1MWYA 4AYBD 3ENAA 3IXQA 1XNRF 4P75A 4OYZA 3CD5A 2A0FB 4I7FB 4J9VA 1YKWA 2HNYB 3ZTCB 3FQKA 4M5KA 2IBOA 1BQNB 1SQEA 4TQSA 3Q24A 4JYAJ 3CCWA 2Q3PA 3CDUA 1HLWA 2B5JB 2CA9A 4UIJA 3D9BA 2B6AA 1KTQA 3MMCA 5F0WA 3G8QA 4J37A 4WP3A 3SSSA 2L41A 1NH8A 3OLAA 2QGFB 2GQCA 4FYVB 4W92B 3SDEB 1JWWA 1IR2A 2ZH6A 1KNZA 1EETB 3KJVA 4AQYF 2KKHA 4X64F 4ZIVA 2UVWA 3BIMA 3SDEA 2YWFA 4N5SA 3ONQA 3GFYA 2W7AA 4KGZB 1CJKB 5D0GA 3KK1A 4LVNP 4QIGA 2YKPA 5DM7Q 4J9PA 5K8OA 3Q2TC 1VLOA 1NJIT 4DX6A 1CJVA 5G0RA 3ZZPA 2AMCB 2HIQA 3TAPA 1A9NB 3W60A 4CO5A 3FDSA 4OJ1A 1OJ4A 3H2LA 4F8RA 5SZTA 3QGHA 1R0AA 3JSBA 2CDQA 3GSDA 1N32J 1DQ8A 2CKWA 3U02A 4WP8A 3NP5A 4CCHA 1IBMJ 2Z4PA 4DCJB 2CQ2A 3KFWX 5A8RB 9ATCB 2ZEJA 5IV4A 4ED6A 3W9IA 3HMJG 3SQOP 4P2FA 4DV0J 4DL3A 5LSRA 5HI7A 5KT6A 3N6MA 1I5OB 4L3NA 5K9FA 4YDDB 1UFKA 3HTMA 4V1Ak 1AXQA 5D4PA 2BJDA 4C8ZA 2DH9A 3V7DA 3M6XA 2HWHA 2IM3A 1OIAA 2IFXA 3W66A 5J2QB 2WSFC 2F63A 4LF6J 3K5LA 1QDUB 2M5YA 2EG1A 4M5GA 4USWA 5K5MA 4KT0C 3TZWA 5EDWA 5JUMA 1QLNA 2V2KA 3D3BJ 5KG1A 3TVZA 3GILA 3KG1A 2H5EA 4DUZF 4C3LA 4WE1A 5DDPC 1IKWB 4U7CA 3NBPA 3W62A 3JTOA 1C1BA 2L3MA 4DV2J 4JI5F 4UOCA 1ZH5A 2Y8YA 2DBBA 4X4QA 4ECWA 1WG1A 1FE0A 1VCTA 2HQ3A 5IQQA 4NASA 4TNOA 3D1OA 5ETKA 3TW0A 2PGCA 5KFFA 1SKRA 3P5TL 1KSPA 3M1VA 2D41A 1TKXA 3MR7A 3D6FB 4FNHA 4NLOA 3OGMA 4Y65A 3KJNB 4WFZA 3ZKJB 3H25A 4ZHRA 3QT8A 5HK4A 2CPZA 3N01A 3GU0A 5IT9U 1DJ0A 2ASLA 1ZAVA 2PI5A 4A48A 1XMBA 2O3DA 3W5ZA 4F3MA 4ZHRB 1RBAA 5F8NA 1BLUA 1Q4RA 3DGVA 3NLCA 4CTAB 1UA1A 2E1MC 3CCJS 4DBQA 2YKMA 2X51A 3ET6B 1ZA2B 2YVSA 4JI3J 1T3NA 4OV1A 3EX7B 1K1QA 4LRAA 2CJXB 1YDLA 2GO8A 3ITHB 1JLAA 2UUAJ 2HRUA 2OPSA 1VHIA 4Q2LA 5CYQA 2WVFA 3N4WA 2KHCA 3K57A 4W4MA 2DVIA 1NPRA 1LDKD 2VQFF 1KFSA 4LT6A 2CUYA 3PKYA 2YTCA 1HW8A 2EC2A 2KXFA 2CPJA 3PO5A 3SSRA 2FIUA 3M2UA 2M8DB 5KFIA 4DX7A 4AP2A 1WHVA 1KD1T 1EARA 3GJTB 1SJFA 2ILZA 5DG9A 3PFOA 1GNKA 3BQ2A 1M5VC 2RQKA 1ICEB 4QW9A 2J8AA 3I82A 2OFHX 4KIAA 4RUHA 4JGHC 3GB0A 3QATA 4EMDA 3I0SA 4YY3J 5C25B 2XS2A 4KV8A 2F8EX 4P9SA 2OPPB 1NKCA 3LO3A 2PFDA 5FLXU 4OHZA 3OXLA 4FXWA 2VUGA 1RYSA 5DDQC 3SV3A 4IG0B 4Q43A 3NGDA 2R7UA 1DY3A 1Y3KA 3FFIA 2GIRA 4NLTA 1FRKA 4FYYB 2FUG9 4QIFA 3S01A 4J9OA 4A8QA 2M0GB 4FDFA 2J9DE 1S1UB 3D4JA 2O01C 2LKZA 1F2HA 1WG4A 2OD4A 3OR2B 4DMZA 3TWZA 2DHXA 2MKYA 4CXJA 1KQFB 5DS7A 1IKYA 1BE4A 2YH1A 2CVIA 2Y8WA 3MAHA 2ZVSA 2VA2A 1IWAA 4PR6A 1FTRA 2D69A 3OXGA 3BQ1A 3AJ1A 3GYNA 2DCLA 2P6TA 3IR7B 4AXJA 2B8PA 4RW6B 2DNKA 1XERA 2ZNZA 3EMTA 2E9RX 1HL6A 3BYPA 4QZVB 1KRPA 5IOLA 1TKTB 1Z1ZA 5HAOA 1T8EA 2CIMA 3VF0B 4FVMA 3MUMP 4QIVA 1QVGR 2HVIA 1NK9A 1HBMA 2VKRA 3I5AA 4IR1A 2V63A 4M63A 3TX0A 5KG3A 2ZHAA 4DV4F 4ZVPB 4K5SA 1LOUA 2JWNA 2HHQA 1HV2A 2DXFA 2GX8A 3MCOA 4GVLA 3BV8A 1XMOF 2IRYA 2VFSA 3L4BC 3IWLA 4H4KA 4PCQA 4DR1F 4P7TA 3GP9A 5F8LA 2E7VA 5HYWB 1WEXA 3KJFB 3WHIA 3NCRA 1C0TB 3QO9B 3HP6A 2JVOA 1K0VA 3J7ZT 2CJ9A 1SXLA 3AD8C 3TEHB 4FF3A 3OFHA 2Y0BB 1H2TZ 1R8PA 3CNQP 5EWFA 2YQ0A 4E0DA 4UUWA 1JLGB 1LXNA 2GZOA 4J9NA 4OHYA 5L1JA 3PY8A 2CPHA 5KFTA 4N9F5 1VJQA 3D54A 4WE1B 2GJFA 2DR8A 4PEOA 2MKKA 1FJ7A 1ZTWA 5E41A 3RRGA 3QSIA 3BH7B 2F3JA 4Y00A 3KLFB 2MEWA 2HHXA 1S1UA 4HACB 3I96A 1GX6A 2G0JA 3R5JB 5CD4A 1QTMA 2LU1A 3CCLS 2IHR1 2VPWB 3AXKA 4YR0A 3CMAS 3FEYB 1RTJB 1S48A 3TRGA 1IKYB 4OYAA 4Q8FA 5DRKA 1MWQA 1WC6A 3NGUA 3HLUA 4NRTA 4DLEA 4B3MJ 5GADI 4M95A 4DV5F 4IUFA 4LFAF 4B9MA 3HJVA 1EQ0A 2N3LA 4U8VA 4QWAA 1RP5A 5KTQA 2RKIB 4OFZA 4CLWA 4CQ1A 4RUAA 3DLLQ 4Q0BB 2ATCB 3KVTA 3OHVA 2QSWA 2GHPA 3M9MB 3VAKA 2K7KA 3R3TA 1FKOA 4QIEA 4IKAA 2HBYB 2HFZA 4KH0B 5AXKA 1M1GA 2C2ZB 2FLOA 3SCKE 4TU9A 1V6HA 1R6VA 5DQHA 2PFFB 4W90B 1ACMB 2OD6A 1NO8A 1V5VA 2R2RA 2AT1B 2LFVA 2DCUB 1DFDA 1IWGA 1AFJA 1H98A 1MNEA 3OTOF 2W24A 1YJTA 4HYKA 2EEYA 4LR8A 1WDTA 4DV5J 1M1HA 2JC0A 2NZ0B 5G4DA 3HD1A 5KFMA 2CPYA 4G1QA 3JSRA 1UEVA 3VWSA 2C42A 4LF4J 3DMJA 2FGOA 3IO1A 3UN5A 2HWIA 2MLXA 4UZBA 1FWPA 2E1RA 3UD4P 1HKAA 1F0XA 1RSCA 5KFYA 3UD5A 1U1QA 2JFDA 1VGYA 2CZVC 1R0CB 1RADB 2HQCA 2H5JB 4XPEA 2MY8A 4NX9A 1RT4A 1K44A 3NEKA 4OZ5A 2E1CA 3W5YA 2RS2A 1RHJB 2ZDPA 2A3JA 2HAFA 1NJXA 2FHJD 2C3MA 2YY9A 4W9HB 1FO1A 3TA1A 3K8VA 3LGNA 1JLFA 4KPCA 4RW4A 3J80U 1T9TA 3TAQA 4OI0A 2VC1A 4FPIA 4W9JB 2IM1A 2MQQA 5J2NA 3DLJA 2JEIA 1MROA 2CDRB 4V19X 2BDPA 1WOSA 4OLPA 3LBZA 2GMLA 3RW7A 2I38A 1EETA 3KJVB 4DFKA 1WELA 4FPRA 4I68A 3GIRA 2KDOA 3PKMA 3MCSA 1F9FA 1RKJA 2HBRB 5HMXA 4NMXA 2OPQA 1QY7A 2DGXA 4H4OA 1F5BA 1UWBB 2I5JB 3RR7A 1HNZF 1VCBB 4B9KB 4PWDA 4LIRA 5THWA 1QAJA 2CPFA 5KFWA 5HP1A 4C3MA 4N77A 3SIPB 4EOZA 2GJIA 1X7VA 1RWVB 4KO0B 3M8YA 4ZP7A 3CUNA 2Y1IA 3EWGA 2VU5A 5GAEU 5GAGU 4URGA 1YTYA 1FDBA 2OIHA 5IFMA 2GGPA 3Q8RB 3MCNA 4KFBA 2C22A 2HEKA 2ERRA 4CP3A 3ZTRA 3MAQA 4AXIA 5KG4A 4DX8H 3AB2B 2BQ3A 1UVMA 4KFBB 4OI3A 1WHYA 1RAGB 1QAIA 3Q22A 2DHSA 5FDLA 4N41A 2DIUA 2G13A 2J0SD 4G1QB 3VTIA 1TKZA 2KJVA 1S6OA 2RB7A 3MF5A 2NPIA 1HD0A 4Z7YA 4C6AA 3M8SA 4GKJJ 4YMEA 3PX6A 1X9MA 3M6VA 2BM1A 2FD2A 2FJEB 1TFYA 3QSYB 2E44A 2Z0GA 3L7OA 3V6KA 3OSPA 3MPWA 2MHNA 2E32B 1GQEA 2RU9A 2KN4A 5HROB 2FHMA 2R7SA 4ZS6A 1S6PB 1NPPA 1RT4B 4C97A 1HWJA 2RAQA 2BACA 4ICLB 3TP2A 3PR5B 1IUJA 2E29A 2B4PA 4C8YA 4KH1B 1FK9B 4B3SJ 1H6KX 3QFWA 3BEGB 3DC2A 1FRHA 2B5JA 2SXLA 3CD7A 3M30B 4LBIA 4DQRA 2K06A 4QR1A 2IDEA 2JEGA 2HHSA 4CO3A 3CCES 4RW8A 2BJEA 2V8DA 3DYAA 3W2WB 1JB0C 1N0VC 4MYTA 3VGTA 3W8PA 2OKQA 5I42A 2I2YA 2W25A 3QJLA 1N5SA 2LA6A 2BKNA 3O1LA 3P8BB 5DADA 3BO3A 1SJRA 3W7BA 4C2MA 2XMMA 2DK2A 3R5CA 4HTJA 1SBRA 2CPIA 4KQZA 2VQFJ 4DJBA 3O2IA 2FHKA 4JI1J 4MAKA 1DTQB 1VBYA 1IBKF 1QJHA 4DHVA 2BA9A 2VFRA 4PXCA 1Q86T 2ZD1A 2B7BB 4DEZA 3HZEA 1KFDA 3KLEB 4DUYJ 3T3FA 5IV3A 2E66A 4FBUA 4BBYA 1U47A 1N56A 3H5YA 1UP1A 1B7YB 4LF1A 2R2UA 2RHQB 1QVFR 3RAQA 2JHEA 1VHFA 2A2CA 2YY3A 4X4SA 1B70B 1KS2A 4O3PA 1RI7A 4C0HA 1YX2A 4ZVRB 5C24A 4X4OA 1VQSA 5D15A 2EG2A 2QLXA 1SV5A 2V4QA 1AYEA 2CADA 3SCLE 1FT8A 3DI6A 1RT2A 3DLKB 3MUTP 3CCZA 1VK8A 2JX2A 3BQ0A 3MM8A 2ZHBA 1NK0A 4JI6J 1U25A 2DR6A 4UF4A 1FQVB 4I6YA 3EDQB 4XAKA 4JI5J 3AT1B 5KG0A 3KLHB 2MJNA 1Q0NA 1EKRA 2HHWA 2ABYA 2OP5A 3HKZD 4J9LA 3A3PB 2UUTA 3I32A 1YBUA 5E33A 2HHTA 1FERA 4WIIA 4CRHA 4ILLA 2E1AA 2V0NA 1N8RT 1K9MT 4M5LA 1RABB 3CCRS 2MZRA 4OZ2A 2ILYA 2B7CB 2IA0A 1PIEA 2OUGA 2DEIA 4NYZA 5J2NB 3J81Y 4JTCB 4MJKA 1VRTA 2OEJA 4TYAA 4PPZA 3JB9k 4B9VA 3V2UC 3C16B 5B0BA 3JTPA 3H40A 3A1YG 3CWJA 3J7A1 2J9CA 2R7WA 4NCBA 2VPZB 4ED0A 4P2SA 3CDBA 1CULA 1O51A 1CJKA 3B54A 3FCHA 3KK1B 3K5NA 4MK7A 2IDLA 1R8AA 1IBLF 1UAWA 1WEZA 4M5IA 4IRCA 1S1GA 5F8JA 1LFWA 1W2IA 4FS1A 1H7XA 2PEHA 4TU7A 1AROP 2GFFA 1OY8A 4IH7A 3M2VA 3M52A 5GMDA 3N79A 2CNOB 5DDOC 1LWXA 4OZ0A 4ZVOB 3CC4S 3I87A 1KTVA 2AGQA 1PYTA 1X4DA 3OLBA 4ECVA 1MU2B 1U02A 4HT5A 2ZOFA 2JFKA 3AQOA 5A8RA 3IRXA 4FF1A 4UY8T 2IYIA 4DR6J 2Q66A 3RB4A 2D3O1 4C48A 2L08A 1H72C 1NCLA 3OW2R 1GT8A 2X1FA 1QDWA 2GHWA 5IBKA 2JNJA 2LCWA 3GTYX 1PG5B 4LUBA 1I51B 3GCXP 2VDIA 3FQLA 1UL3A 1SKUB 2W2MP 3C6TA 3DI6B 2BX6A 3CJ2A 3B82A 4OLOA 3R7NB 2ZC4A 3V6DA 1HHTP 3EM1A 1UPMB 4JI8J 3FJ2A 4J90A 4ZVUB 4F4WA 2K3IA 4HXIA 2HK3A 4TN2A 1NM2A 4MFBB 2EXUA 2OHDA 4YDXA 3D0IE 2NXNA 4LSLB 4PQUA 3Q83A 2IMWP 4DQSA 4X4VA 2PE8A 4ZN1A 1YQHA 2IVYA 1WKLA 1X0PA 1OPZA 3VGSA 1Y00A 3DLGA 3PM9A 1U2FA 3HVAA 4HTIA 4QIWD 2C3OA 1S1TB 2KYXA 1RTDB 2ZKUA 2W2PP 3M2RA 3PTWA 2HNZB 1DLOB 4H4MA 2J6TA 3BYRA 2MHEA 1OQ6A 3MEDB 3R9LA 2X1AA 2R7VA 3IGNA 1H3DA 3IAM9 2BVZA 1SIZA 2Z8HA 2ZITA 4CLLA 3G96A 2QEXS 2IM0A 3LP1B 5KOWA 1CJUA 4K7QA 2E5LF 3C3LA 4GVBA 2LEBA 3P96A 5HSPA 1PYSB 5M2PA 1S6UA 3HHNB 1G3OA 1MMNA 1TU0B 2KL8A 3G2XA 1S9GA 1FX2A 5IM0B 3VV2B 4P7VA 2CQ1A 1GXLA 3FBEA 2W9BA 2ZH2A 3TR5A 5K20B 2F65A 2DGQA 3D6HB 2EVZA 4FF4A 2BW7A 1TP7A 4I6WA 2BOAA 1IVZA 2LEAA 4B3SF 3PHEA 1F1BB 4NLPA 4OHXA 3MD3A 4WIQA 3JSMB 2Q1LA 5HJYA 3EE3A 4LF5F 3SQGB 1RWWB 3K89A 4RZRA 2K1RA 4MIAA 2DNRA 4DQQA 4DSIA 1HYSB 3GCWP 3ZZRA 3T5JA 3DXSX 2RJZA 2ZH3A 1NU4A 2WCXA 3QGGA 2K2PA 3WSOB 2P6SA 2XSFA 2BXJA 1ELOA 1NXIA 1T9VA 3GLJA 1OO0B 4X66J 1Q7YT 4CM2A 5DJBA 3SCJE 3DLKA 4EBDA 5H9EK 1RAIB 3BM7A 3AD9C 5CA5A 4JV1A 5HMWA 1NUEA 1QUVA 4DUTA 1N34F 3JAMY 1S7IA 2FC8A 4Y2AA 3VAIA 5BYSA 4E98A 5BR8F 1SKSA 1Q81T 3JYTB 1OY6A 3C2PA 1U1MA 4R5PA 2VJVA 1U1PA 1YBTA 3AODA 5F41A 3TA2A 1O8BA 3ZZZA 2QN6B 4ZJOA 2HVDA 4LQ3A 1XMQJ 3HJFA 3UCGA 2PPIA 2CG4A 4N7TA 4NLWA 4ZKAA 2C28A 1S77D 2AEMA 3E01A 1O5JA 2HWTA 3PW2A 4NXMJ 1LWFA 2H65B 4X62J 2BQRA 2IM2A 2QL5B 5KFUA 3CCUS 2FLNA 2KRRA 3BSAA 2DPJA 5H7HA 4P74A 2C3PA 3L7UA 2FVRA 1VIXA 2R4FA 3R6LB 3RBZA 2XMUA 7FD1A 4LF7J 2ZH9A 1L5UA 4RNFA 2ZH4A 4NEZA 2HHVA 4M5JA 5CZVA 4OI1A 1WF1A 4AD6A 5KFEA 3BSNA 2YPYA 4NL5A 1XNRJ 4L73A 4C9DA 1RTJA 1WC4A 2YX1A 3QT7A 1IM6A 2AIRB 1XJWB 1N5YA 2UXBF 4D3GA 3H2VE 3AHPA 1SJ1A 3ILJA 4I2QB 8ATCB 1R8BA 3M9OB 4YN3B 1TL7A 4QQBA 2FY1A 2EI5A 3PW4A 4GKKF 2DGSA 5L9XA 3KTQA 2B51A 4IOAQ 1URRA 2EC0A 2OGUA 4HKQA 4WBFA 3FC9A 3ZTQA 3K2YA 3CC7S 2DRAA 4F0KA 1QD1A 1U6ZA 2F1FA 2WB1D 4O3OA 2VDHA 2NUHA 2HS0A 2QMUB 3PEHA 3THTA 3PX0A 4X65J 3IBCB 1M5OC 2AWZA 5E3RA 2VPKA 3CD6S 3PIOQ 1HWKA 4RPFA 3WIVA 1TELA 1NK8A 1MSWD 3CCTA 2C1EB 3OD2A 3NL0A 2M70A 2QIFA 2WOMB 3MMCB 2BABA 4NA1A 2B9EA 3FZBA 1HBUB 3KK3A 2E5JA 4DV3F 3S6EA 2ASJA 2CQDA 2XYHB 3KHLA 3H90A 3KMSA 3B4MA 5DLFA 4I67A 3M4TA 2DGOA 5KT5A 4AL6A 4NLSA 4RWWA 3TJ9A 1H0HB 4ITSA 1JJHA 2KFZA 2UZAA 2IJNA 4NE9C 1YG0A 1SL2A 2KFNA 1M5HA 1U0SA 2Q81A 1X4FA 5DG7A 2J8SA 1RHUB 1W26A 2LEPA 4RNMA 3ENVA 2VICA 2GMHA 2HZAA 3Q8UA 3LQVA 5A0YB 1NSPA 2B3TB 2FJBB 2K3KA 4UOGA 2H1YA 5IZHA 1S76D 4WQOC 2AEJA 1KLMB 3RU0A 3C16A 5LXYA 2AJ2A 1LW2B 2GV1A 3H59A 3TARA 5KFCA 4PYDA 2J9DA 4NXNJ 3KDOA 1YJVA 1P6TA 3TZZA 4LFAJ 5C7PA 1VQLS 5H1SV 3UN2A 1U1LA 2XG8A 2ZBCA 2AU0A 2YWHA 2RRNA 4H54A 1UJ4A 5ETRA 3TQEA 5E3QA 4LRDA 4L75A 4RNOA 2LP4A 4E8UA 1RHQB 5ETSA 1Q16B 2H4WB 1S97A 3UNYA 3CCMS 3NGTA 1X4GA 1P1LA 3TAMB 4X4NA 3RB3A 5ETVA 1TK5A 3H0PA 2FVPA 2MQ8A 3LALA 4ZOSA 2WBRA 2M3DA 1U1OA 1HHSA 2M7SA 2P2CB 5D0HA 4U2MA 3UDVA 3H4BA 1Y5IB 1NJYA 2ZOGA 3OFEA 1BQMA 1X4HA 3UO0A 4PAAA 1EQMA 4NZ7A 4N56A 2B6AB 1PC4A 2NS1B 1IM4A 3DMJB 2HVEA 4CLKA 5KG7A 2MQOA 2ZM6J 4CXTA 1HBNA 1R2BA 4AFFA 2IY5B 3C6UB 2LVWA 1LWEB 3NGKA 2D7SA 3MZIA 4GO7X 3SCIE 3JYTA 1XMOJ 3KLVA 4I56A 1VQ7S 3HQIA 3TUJC 3UE2A 5IXUA 4ZCMA 3KLHA 1VS3A 1M0SA 4IYQA 2QA2A 5IWAF 2RMLA 2MJUA 1CJTB 1DURA 4JI7F 4UUXA 2HGMA 4AL7A 1YGYA 1REVB 2XS5A 1CBKA 2D3OR 4K50A 1NLKL 3QT6A 3RG6A 5CCMA 1VQ8S 2R8JA 2MZSA 5F8IA 3R7BB 1F6TA 3RBDA 2UU9J 1IR1A 5K8PA 4RW7B 3WC0A 3OL8A 2OPRB 1FRJA 1UVIA 5EX0A 2F4VJ 3OJSA 4BKTB 3W5XA 1WC1A 2OJ3A 3RTVA 3IR5B 2XY5A 2JZ3C 1XQIA 2OPQB 1JIHA 4WJBA 1ZETA 2UU9F 3RJMB 2HVHA 1WOOA 5RUBA 1UMJA 1HR0F 3CIMA 3GIIA 2XO6A 2NZCA 7FDRA 3CDAA 3LH2S 1HBOB 3H2UB 3PW7A 4F2RA 1RWMB 1RWNB 3ZTDB 3EVMA 1S72S 1KQGB 1WACA 4TVAB 3TA0A 4JI7J 2CQGA 1FRIA 2PDAA 4RBVA 3TVKA 3FKCA 4FKYA 3W9JA 2XULA 1VLYA 4OHWA 2V8GA 1N5TA 1MG7A 3IR6B 2C2DA 1Y9OA 3NBPB 4OYWA 3BH6B 4NXMF 5B7WA 2XI2A 4F4AA 3K58A 1SV5B 3RAMA 3PW5A 3DFEA 3HULA 1GEHA 3QBCA 5FTAA 4CWBA 1FXDA 2HYIB 4DWIA 1LK5A 1SUQA 4L74A 3ZXWA 2XLKA 3KJQB 2PMZD 3ISND 2ZM6F 5KFPA 1FI4A 1CC7A 1RGVA 1KBRA 2VG6A 2U2FA 3BPDA 1Q8KA 3QLHA 1S6PA 2BYCA 4TLQA 2X3DA 4YP3A 3ZUNB 4NZ6A 1MMDA 3MEGB 4LBPA 2ZWOA 4FN5A 4LSZB 3UW1A 3LP0A 4JI2F 3KHRA 3HSGA 2QYGA 3MTKA 2VL1A 3W3SA 1S57A 3W9HA 1FNOA 1LW0A 1AUDA 4ERDA 4OX9J 1FESA 5LOQA 5LSLA 3OVSA 1RB0A 2HGLA 2VG7A 4NCGB 3MR3A 3ENWA 2FYXA 4LF5J 1VRTB 4BLGA 3EZOA 4LVOP 5DETA 1LM8C 2XC9A 2MTLA 2HAIA 3M8ZA 3D67A 4W98A 2MB0B 2G2ZA 2AD9A 2DITA 4CO0A 3H5SA 4EWTA 5LMUF 4JUZA 1PBUA 2HK2A 4A8YA 5I4MA 4ZPDA 5ITHA 1F9HA 1JJCB 2M9KA 1S9GB 2PIIA 2R7QA 3R1HA 4U96A 1UWAA 2EFVA 5B08A 3KLEA 1RHKB 3M2VB 3AQPA 4DV2F 1TL3A 2CQ3A 2EKNA 2XWYA 3KXDA 4ZCIA 3T5KA 4IH6A 5E3CA 1VQ6S 2G2YA 1TL1B 3C6OA 2V67A 3SQGA 1HYSA 5C42B 3PV8A 4DCOB 4IDKB 2HNYA 3DRXA 1Y5NB 1B0VA 5CHCB 2KG0A 5DGAA 3H4DA 2MA9C 1JLEA 5CH7B 4PWWA 3RGIA 3B6BA 2L9NA 3MCMA 4A8XA 2C2RA 4ELVA 2KHDA 4G6VB 4FYXB 4UOHA 1VBZA 3ZZTA 4U6PA 2IVMA 4S0MA 3CJTA 5BXHA 2FVCA 4UQTA 3V6DB 3JQKA 1NB7A 4CLYA 2J6SA 5CZXA 3A8IA 1X60A 2MLZA 4F0HA 4RW6A 4KAIA 4X4UA 1HI8A 1RWUA 1X31C 3B84A 3HZGA 4TKTA 2FZKB 2IJRA 2VB6A 5HATA 1S49A 4K4VA 1N32F 3GSIA 2CNNB 2DNPA 3LAMA 2DO4A 2YX4A 5FIIA 4RU9A 5L1LA 3G82A 2HS3A 1LWFB 1RTDA 4JTAB 1WSRA 3B8HA 3B78A 3EICA 2EFNA 4LF8F 2MYFA 5KFGA 5I3UA 4K4UA 3KUEA 1HARA 4OX7A 2HQFA 2YNGA 3DRRB 3G8SA 2Q6BA 3POTB 4ID5B 2HFVA 1HPZA 1PJ5A 2JH3A 2LU2A 3GV7B 1N33J 2OMLA 1N6QA 4WZMA 1XR5A 1SL1A 1HWIA 1N5YB 3GA1A 4LFBF 1X4BA 2EK1A 2RKIA 3VAFA 3VVUA 1K0TA 2XMVA 3PNIA 1JNRB 2FZCB 1BWEA 1U0HA 4ZGCA 2CQ4A 3PXGa 1FKOB 3MECB 3OUYB 2V2QA 2UP1A 1YWXA 1P9YA 4V19J 2CFXA 4ED1A 3RRHA 4JYAF 2ZOMA 1QE1B 1QTNB 4LBHA 3CCVS 2FC9A 4ALZA 4ZVHA 4DL7A 3UQSA 2CJAA 4OZ1A 3S7RA 1KWMA 4MKBA 2LXFA 2XY6A 3EJMA 3JS9A 4ZPBA 3T5HA 1BC6A 2HG4A 3VZHA 4LF9J 2KYZA 4BDPA 4HACA 2K8GA 2VA3A 1FDNA 2U1AA 1S7HA 3M8RA 5HQLA 1FJCA 4IO1A 4MKVA 4IOBA 1RJJA 2YKNA 3CMQA 4XDCA 3THVA 1N34J 2BE9B 4WFAQ 1VI7A 2XHWA 1N5VA 4JI6F 4ECUA 2HRTA 4F4XA 1HD1A 2A6MA 2Q79A 2DEJA 1RAAB 4F25A 4F2SA 2C3UA 2H51B 3ILLA 4NMLA 4ECQA 2V4JB 1HNXF 3PZPA 2AQ4A 3RBXA 2WSCC 1TFWA 3PHTA 5E2QA 3HVTB 2ZBIA 3CE8A 4O3QA 5KFHA 1FS2B 4FZVA 4IQXA 4QR0A 4UTGA 2N4CA 5BXIA 3UI3A 4FYWB 3C15A 1QAXA 4DR5F 1XNQF 4DUYF 3A3OB 1KLMA 2XY7A 1JLAB 3EUNA 2UXCF 3C15B 4WPAA 4OYMA 1JJ4A 4B3RF 1GX5A 1CJUB 2HHHJ 3GQCA 3RB6A 1RXOB 4RNHA 5IC4B 1HQEA 1F5AA 4PABA 2ZWPA 3DOKA 2L9WA 2Q6CA 1N6QB 4DL6A 1KN6A 1YJRA 3AOBA 2ADBA 5GAHI 2QLFB 2RUGA 1FDDA 4J9RA 4KB7A 3S1TA 3MM7B 2BW2A 4JI0J 4LFCJ 1WG5A 2C2NA 3T9NA 1E6VB 4OX6A 3BBCA 5ETPA 4B3OB 1UVLA 4AE5A 1D9FA 1A0OB 1BUXA 2MY7A 2VBYA 2HZVA 4WTYA 4F26A 4LREA 1T05B 1HHQA 5T41A 5A6PA 2EK6A 4K8RA 2RE1A 1XIQA 2BE7D 2OLWA 2QMXA 4LJMA 2VHGA 1FEHA 4KHMA 4Y6IA 5D77A 5KG6A 4YR2A 1WEYA 4P72A 5E3PA 3TZXA 1YJ7A 1X4EA 1SUQB 4O3SA 4IQMA 3JQMA 3OHBA 1HNXJ 3HO1A 2HSEB 4O23A 3FCVA 2FB0A 5LSOA 5JMNA 3DDNA 2AX1A 5DGBA 3ZZ0A 2XHCA 3HHLC 2BJ7A 4B3TF 1S12A 1IBCB 2NR0A 1HNWJ 4IG3A 4K4SA 1IKXB 3GFHA 3PCOB 3EPGA 4USKA 1Y4ZB 3OTEA 2FY8A 4MT1A 2VODA 4HEA9 1TTHB 1S1XB 1WHWA 3BGLA 2XCPA 3RR8A 1UW9A 1HW9A 4LRFA 1S0MA 2JOQA 3W2WA 4MIWA 1Y10A 2NXCA 4K4WA 1TUGB 2CQCA 1VRUB 3O3LA 3R97A 3GIKA 4ECXA 1VQPS 4PQAA 1V3SA 2JVRA 3AA8A 2HS4A 3QIPB 4KHRA 4IRDA 3I5CA 4I2PA 3BDPA 3WQPA 3C46A 3MMBB 4OI4A 3ENQA 3T1HJ 4A4JA 1CS3A 2EKYA 3HSZA 1TKZB 2FJWA 3W65A 2GA7A 4LFBJ 1TAUA 2XZDB 3TQ1A 1U0HB 2E5HA 2UXDJ 3CJ8A 4M8LA 8AT1B 3FBFA 2FJAB 3NCQA 4IO9Q 4QYZK 3W64A 1CEZA 2ZH8A 1C0UA 1NPKA 3R6GB 2E7XA 2QA4G 2OPPA 3OHUA 1OYDA 4DPTA 3GIJA 3GV8B 2YWKA 4DV6F 1YITS 5A2QU 4LF8J 1WI6A 3KG0A 4KRWA 3OL7A 1KOHA 1RT1B 5ETNA 1AFIA 4FBTA 1REGX 1ZPWX 1FA0A 1V3ZA 4MIBA 2VFTA 5L8RC 4ZVFA 4OYPA 2M4MA 3DXBA 3M8VA 3MMAB 3OPKA 5D8HB 4ZDNA 1AZSB 1GFWB 4ANCA 2BANA 1NEXA 4QJVA 4J9MA 2VF3A 1ZZFA 3C6UA 3PDNA 1G7CB 3GWCA 1IKVA 1EHWA 2BJ8A 3F0NA 1NJZA 2XMJA 4APFA 2KXHA 4DR2J 3CD0A 3OTBA 1VRQC 3N5FA 5C2CA 3E2EA 2QL9B 1FRLA 5K14A 1KQKA 2X1BA 2Z8QA 2A1BA 3MURP 2J76E 9RUBA 3VAGA 2B0GA 3EDRB 4A8WA 1D8ZA 6FD1A 1VOMA 1IKXA 2UUBJ 5M2UA 4B9TA 3BR9A 2BOPA 2HGNA 4ES2A 5MAOA 2YNIB 2XTJP 1WD6A 4N76A 1M1KT 1KP6A 2OAUA 3CJ0A 1HBMB 3D1QA 5L38A 1FKPA
chains in the Genus database with same CATH topology
1ZM4A 4ID5A 1R27B 2FJXA 4W9LB 5BYRA 3KLGB 5A15A 2HLTA 4IFYB 2ALZA 3DN9A 2AJ4A 2OPRA 1YBAA 4CH0S 4I2PB 4Y34A 1R29A 4O4GB 1RT3B 1HFEL 1I94F 2B9YA 2NUUG 1T3OA 1U7LA 3G9CA 1VFJA 2OTLS 1RT5B 3I0SB 2DR9A 2KZMA 2KB2A 3IG1A 1HBOA 2VKZG 3C66A 2VZ9A 2AF6A 4JBCA 1X5SA 2W4PA 3R5DA 5EGYA 1IKWA 2K7JA 3SV4A 3DU5A 3OL9A 4CXIA 1Q53A 2J9EA 4ECZA 3HF5A 3MUVP 1BGXT 5DQGA 4YY8A 2ZDOA 1Q79A 1QM9A 4K59A 2P1MA 4DSJA 2J7KA 2J5AA 2RS8A 1S1TA 2RT3A 1UA0A 2YKNB 3V6HA 1RAJA 2A10A 3SI8A 2X1GA 4BCAA 3G86A 1Q78A 1JLQA 2LYVA 2WBMA 2ZUGA 1LXJA 2MGZB 1SH2A 4PUOB 4DG1A 1S10A 3X1LB 3V4MA 1IKVB 2RRAA 3HHLA 2RQCA 3CPWR 1FHTA 2ASDA 2E9ZA 5E0OA 2DNHA 4ZCKA 2J7UA 4QYZJ 4DL0C 3H20A 1DAXA 1OS5A 1UW4A 4ILRA 2RDIA 2YNHA 1TV6A 3W2VA 4B02A 5J1EA 2IRXA 4YFUA 3K59A 4HKQA 4EBCA 4W9IB 3MTJA 5HMYA 2YNIA 2VOPA 1DQAA 2O5DA 2EBGA 5FD1A 1VC6A 2QMWA 2LXIA 4PXBA 1J2VA 2JLFA 3TNVA 1FXRA 1R3NA 2RVJA 1CEZA 3HHDA 1SH0A 3TX8A 4WFBQ 4GMKA 1L3VA 1XBWA 1HPZB 2HLUA 2FGCA 3N6LA 1NKBA 3WZ0A 5GAHU 1YJUA 1BQXA 1XR7A 5KFBA 3MM7A 1ZBTA 4RBUA 3HPOA 3C6TB 2XSJB 3TOQA 1D9AA 4JTDB 2Y1JA 2KM8C 4PWUA 3MR2A 5KFSA 2XS7A 1XWLA 1HWLA 4R0JA 2HFNA 4U7UK 2RDJA 1TL1A 4JOUA 3PW0A 2B56A 3EGWB 4HVZA 4Y2CA 3RZAA 4OJGA 5CYJA 5HL7Q 3MM6B 2VBWA 1KONA 2UV8A 1S1WA 3MMAA 3KK2A 5LT5A 1S0VA 2DH8A 4G1IA 2B4OA 3BS9A 3H5UA 4ZK7M 1FCAA 4CZCA 5K8NA 4FXDA 5KFQA 3IWNC 3N5BA 2KH9A 1KEKA 1ZAXA 3FVYA 3M8QB 2AW0A 2QE5A 2VD3A 2XGPA 3DRPB 2DNMA 4WYLA 3MEGA 4C98A 5I3QA 1ZM3A 2O67A 1FKAF 1R31A 2OO4A 3LUYA 1DTTB 3O6QA 1JNZB 4B9SA 1BD6A 5IQ6A 5KFAA 5HP1B 4KGKA 1FJGF 2UUAF 3MM9A 3V4IA 5J2PB 4N8NA 1NJWA 4L6V3 4I0WA 5CYQB 2G4BA 4ECRA 1U49A 5LJ3Y 3LP2B 2RIJA 2XI3A 2EW9A 2YX7A 1A6LA 1N48A 3UWTA 4B17A 5E5NA 5KAKA 5F9LA 1C0TA 3QO9A 4EYHB 3MFIA 4Y2IA 1HMVB 3EGZA 3HFKA 3GV5B 5D3GB 2BOPA 5BXDA 3A8EA 2VG5B 3E51A 2OVQA 2B4UA 1RT2B 2DNOA 5A8WB 2CQPA 2CQHA 1C0UB 4CO2A 4K4ZA 2LQ5A 4KTQA 4Q45A 1OPIA 2KU7A 4CO1A 2E5IA 4TLRA 1S9FA 2R7XA 1U6BA 5JJBA 1QAYA 1BQNA 5A2QY 3NKYA 3IA0A 4W9CB 4PG4A 4DFPA 4PG6A 1S79A 4QPXA 3FEZA 2HPUA 3M8PB 3S8SA 4WFYA 1U1NA 2RH3A 1S99A 1JLQB 2MGZA 2I2RA 1XEZA 5AXLA 1OQ3A 3KMQA 4B9LA 3PVXA 5U47A 2HHHF 2UXDF 1S6QB 3BR8A 2R9RB 3P49B 3QPIA 3U1NA 3DRPA 3T1HF 1APSA 4CTAA 3KHGA 3KHHA 5EX3A 2DGTA 3HXMA 1IBMF 1TKTA 1EP4B 2ZE2A 1DHMA 4QU7A 2FNJC 1U1RA 1Y0HA 2AGOA 1FEEA 4A8MP 1N0UA 4DR3F 2DNLA 4HT7A 4KE5A 3B4DA 3GIMA 2XMKA 5T14A 4ED2A 4G3IA 4LSNA 2Y1RI 4J9KA 1ZM2A 3SSQA 4ZPWR 1HNVA 2FPHX 4O4GA 4X4PA 3O8WA 1HNWF 2ROPA 4K5RA 3MMBA 1GXTA 4TY8A 2IC3B 3EYZA 1NK4A 4QU6A 4EYIB 2CZ4A 4NA3A 2BE2B 4XIUA 3QZ7A 2UUCF 4DR4F 3PACA 1C2PA 3ULHA 3L7PA 4BS2A 2XNRA 5AE3A 2LQBA 3T5LA 2KT5A 3LAKA 4C8LA 2DH7A 4NWBA 4DL5A 2M8HA 1MROB 3KLIA 3DLGB 2DNZA 4BKSB 4B08A 1KQSR 4NOHA 2MZJA 2DNGA 2I8EA 2OH2A 2YQ3A 4TQSA 3CO9A 5HN0A 1FD2A 1WI8A 3FNNA 4FP9A 4OMFG 1UJ5A 1CQMA 3MFHA 1FTCA 2CJKA 3HHLB 2CQIA 3LGMA 4TU8A 2WW8A 2Q43A 1WNEA 3NCPA 1N88A 4HDHA 2GMJA 2A2DA 3MPYA 5HO4A 4NLQA 5D4OA 3UNGC 5DDRC 1XR6A 1DTTA 1I1GA 4KO0A 4DQIA 4D3HA 5FLXY 5BO4C 3QWPA 1YRTA 1MMLA 1YSJA 2GNKA 3QMQA 1AW0A 2KXNB 4PWDB 1N54B 2XMWA 1FF2A 1RK8A 1JK9B 1URNA 4KSEB 2MMYA 1LFPA 1UFLA 2CYYA 5LL6d 4UQGA 1FKPB 1JXEA 2P9GA 5FDLB 4LSNB 1X9WA 5H9EJ 2AV5A 4DSLA 3I31A 3OVAA 4Z37A 4DV1F 3DLEB 3CTRA 1YRXA 2RNEA 3DGPA 4WFXA 3D28A 4TY8B 3MEEA 2YNFA 5C25A 4C4WA 4QPTA 1XC9A 5E3AA 2BM0A 1FS1B 3KNGA 2FVQA 2XB2D 2OMOA 1J5OB 1FK9A 3MPVA 2AYEA 1FVSA 2R8GA 1TZ0A 4LF9F 2ZC3A 3CJ3A 5E7OB 5F0UA 4QR2A 4ZVEA 4YHHF 4QWCA 3CCQS 3US5A 4LIWA 1U2RA 2XNQA 4BWJA 4U67Q 2ZJRQ 4YB1P 1TK5A 1FNXH 5CXTA 4LF6F 4NYPA 3KNAA 3MI7X 4Q8EA 2XLIA 1H2VZ 3CVKA 1FRMA 2MZ1A 4IH5A 2VPYB 3E3XA 3G6VA 2W7OA 5EUPA 3QAUA 4K2XA 3OR1A 2O66A 2F8MA 2WTFA 1H7WA 2D9PA 2LA4A 4CNZA 1D0EA 2BUNA 2B43A 2EFGA 4C11B 1X5TA 3G4SS 3V81A 1X0FA 1DTQA 2RD5C 3OBIA 3HU6A 1P8GA 3RB0A 4OX9F 1N33F 3D5MA 2AYGA 4I6AA 2N7CA 1R0AB 4PG5A 4TYBA 3IRXB 3FGVA 3LP2A 2CPEA 3T1AA 3J7YI 3KYLA 4DF4A 3HDSA 2DNYA 2LXUA 1HNIA 1SC6A 2WONB 5IT0A 1Q7LB 4J5OA 1VC0A 5D3GA 2BR0A 4ATNA 2D1CA 2LLZA 2WONA 4USIA 4EGLA 2AJFE 1S1VB 3TUZC 4UY85 4B95B 2NSCA 3FRYA 2IC3A 3VALA 3GG1A 1JLBA 1NN7A 2KJWA 5EHHA 1LWCA 1JLGA 3T1YF 1TL3B 2GW8A 3V5RA 2YWEA 3MM8B 1N52B 3UDLA 1QUPA 3O5TB 4JV0A 1RT6A 2JZ5A 3SEOA 3SXLA 3LWLA 2DD8S 4CI0B 3U7JA 2R7RA 3I4HX 4Q7AA 1C1BB 4CH7A 1T7PA 2HNZA 4H4MB 2DHAA 2YKAA 1U24A 2MXYA 4ILMA 5GAGI 3P3DA 3M6WA 3MDFA 1HQUB 2J0QD 4DSKA 1S4FA 4I6JC 1BUOA 2A79B 4NLGA 3OFFA 1DQ9A 3QIDA 3BSOA 4ED7A 1ZM9A 4OIXA 4RBTA 3CGIA 3OR1B 2APOA 2G9OA 1XK8A 3G6YA 3MM5A 3HVEA 3HHKA 2IAJA 4BWMA 1KC8T 5G0RB 4NRUA 5KT2A 1SJ4P 4H4OB 2J6UA 4OZNA 2E31B 4R8UB 3DHXA 1RISA 1M5SA 3W2VB 5J1EB 3LANA 3PO4A 3FSYA 5DO2A 1T03A 2MKIA 3KKFA 4Q44A 4MTPA 2HMIA 2MZQA 3ITHA 4MYUA 1WF2A 2GGPB 4WU3A 3J80Y 1UJ6A 1R7IA 3F73A 1K73T 2IBKA 3POTA 4IOCQ 3PJXA 4CH1A 4A8KA 2B4VA 5H7GA 5D4NA 1JKHA 4ZCLA 5KFVA 4DLGA 2KZZA 1RA6A 2KVIA 3AH6A 3J7Z5 4DQPA 3ETOA 5LLIB 3GZ7A 1LKZA 4CT9A 1D3WA 1E6YB 5F9NA 3TVYA 4WU2A 2ROEA 3BN7A 2WSEC 2M52A 5J2QA 1JLBB 3MOJB 4IFVB 4FXVA 3Q8QB 2N3OA 4RNNA 4C7QA 5F8HA 2JRSA 1J5OA 2NN2A 3I9ZA 4YR3A 1M5KC 4LSLA 4BC7A 1S9EB 4MMOA 4Z2XA 4YQWA 1R89A 3PJWA 1UVKA 2IHCA 3NMAA 1S9EA 2DT9A 2DHGA 3M6UA 4DF8A 3NS6A 1DARA 1R6YA 4NLUA 4PG7A 4ES1A 3UPFA 4DR7F 3DRSA 3OR2A 3TYTA 1DBDA 3LP1A 2BQUA 1U4BA 3X3UA 4EEYA 1JLCA 1UVNA 1YHQS 1VIOA 4PXEA 5KFNA 4DOZA 3MWBA 4QBUA 3I0RB 3O44A 4DL4A 5J1NA 2RU3A 4RW7A 3V81B 4NXNF 4GKJF 4W9FB 3H8YA 3SFUA 1D8YA 1S6QA 2D3ZA 2NPFA 4KHPF 4FNIA 2F4VF 4X4TA 5CCLA 3IWXA 4W9HH 2I0XA 3DLHA 2QYCA 1U6FA 3CJKB 4HHJA 4AL5A 3HHEA 2WB4A 5J2PA 4LMZA 2D74B 2P1PA 2B9WA 3BJYA 3NWGA 2GO9A 5AE2A 1JKHB 3I9V9 3CXCR 3K5OA 3D0HE 2AYBA 3BN4A 2NXUA 3DM2B 2HNDA 2R7UA 1F5CA 3HKWA 2R7VA 2MQNA 4I64A 5D6GA 1PO6A 2FJDB 3NNAA 2AJ1A 3N9UC 5HROA 2FJVA 1TVRA 4X65F 3ZC4A 4B3OA 4C8MA 4G1PA 2P5VA 2UVUA 4GC6A 2IMOA 4RKUC 1WTBA 1B0TA 2IYGA 2V4RA 4ZPCA 4B9NA 2C9WC 3C6NA 4USJC 3PIPQ 1KR4A 1UFWA 2RQMA 3M30A 1QDVA 2GCFA 4X4RA 2EFQA 3BF4A 4L72B 1LW0B 1PILA 3R5BA 1HQUA 3VCDA 1WTFA 4ED5A 3N6NA 1MW7A 4I1TA 4A8SA 5J2MA 3LF0A 3PRBA 3VAJA 2V8HA 1FVQA 4F4ZA 1ZYQA 1X5OA 4MKAA 4TXSA 2CRLA 5KFRA 2J0WA 2MPUA 2LQ9A 5A6RA 1FXLA 5DQIA 1ULRA 5IM0A 5F8GA 1P22B 3EGNA 2NYIA 2VQEF 2ZJPQ 5KT3A 3GR1A 2NSBA 3NAIA 2ZD1B 4K0KF 3MOZA 3IC1A 4URQU 2MQLA 2RILA 3LNMB 1Q1KA 4N8OA 3K7RA 4F3OA 3ICLA 4ZP8A 1S1VA 3CSKA 1T94A 2IJFA 3HHLD 2VG5A 4O0IA 4ETXA 5C24B 1JX4A 4DV7F 5AXMA 4ZA1A 2EBEA 2A18A 2RQ4A 2PSZA 4NLYA 2PT0A 3C6PA 3R5AA 3EXCX 1TUVA 1Y5LB 3MEEB 3QJJA 2VG6B 1KOOA 4I4BA 1EOEA 2OSRA 3I6PA 3N28A 3OTCA 2X3GA 3T19A 5KT4A 1VQOS 1NRKA 1C4CA 3H5XA 5JXSA 2E5GA 3NG8A 2KRBA 5KOXA 2EFOA 4LQ9A 1S0NA 2FTRA 4OZJA 3HX9A 4Y2KA 3FMBA 2OSQA 3M8PA 3DOMA 2VG7B 3QGPA 4NCGA 4QWBA 3WDOA 1I6JA 4R0EA 5KFLA 1CLFA 1R8HA 4A47A 3RYLA 3IGVA 4J9SA 3OGKA 3DYAB 1C1CB 5KG5A 2PD1A 3R1LA 3ISNC 3CCSS 2VKPA 1L3UA 4HI1A 4WK3A 2HZCA 4X2BA 1JXLA 2W4DA 4I69A 2UVRA 4OQJA 4C11A 2MSTA 5HLFA 2F9DA 5GAEI 1T03B 3T6JA 1FE4A 4ZMMA 4R25A 3GYXB 4U2NA 2MZTA 4RLEA 2UUBF 3TAMA 5DG8A 2PI4A 4LF7F 1GAOA 4WKRA 3JTNA 2E7WA 4C8OA 1XN9A 5C42A 5LXRA 3MD1A 3OSNA 1R8CA 2MKCA 2DGVA 2IF5A 1M90T 4ECSA 1LK7A 4RWXA 2DR7A 1JLEB 2HFOA 4W9DB 6FDRA 2BV3A 2CPXA 4KJIA 1WHXA 1Q82T 1XMQF 3K5PA 2QFJA 3I3NA 1ZPVA 5L1KA 1RT5A 2F40A 2MKJA 5HBMA 2YNFB 4HL9A 1FDAA 3BO4A 3CIZA 4PQUB 2N82B 4UYIA 4QYRA 4O44B 1T95A 1A68A 4IR9A 3OHAA 3I5BA 2YH0A 4A8OA 2RF2A 2CJQA 2CPDA 4ICLA 2C2EA 3U27A 3L09A 3FFIB 2JEJA 3GE9A 3DLBA 3DRSB 3UCZP 2GJ2A 2POKA 2EPIA 2FDNA 4ED3A 1TK0A 1D9DA 1HWUA 4YUDA 1REVA 1TKXB 2OPSB 3AB4B 3GG0A 2W9AA 2CJBA 4OX8A 2V9KA 2QO3A 4DG1B 3K0JA 3ZNGB 4ETZA 5SUHA 3LPYA 4YB7A 5DAFA 1Q8BA 1N36F 4Q2MA 5AJ3F 1G6BA 2FHJA 3QYYA 1TV6B 3HI9A 4PXDA 4R8UA 2XWXA 2G1DA