3DRXA

X-ray crystal structure of human kctd5 protein crystallized in high-salt buffer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
161
Chain Sequence
ALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIEFLCVVSKELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BTB/POZ domain-containing protein KCTD5
publication title Pentameric assembly of potassium channel tetramerization domain-containing protein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 37
structure length 161
sequence length 177
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02214 BTB_2 BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drxA03
3.30.710.20 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3drxA01
4ZGCA 3DRYA 4YY8A 3DRXA
chains in the Genus database with same CATH superfamily
5DG9A 3RB4A 5GMKa 5A76A 1Q7LB 4KGMA 2XZDB 3TJ9A 4DS5A 5KFOA 4OJ1A 3JSMA 4GKJF 1SJ1A 1SKWA 2B0GA 4OMFG 1M5VC 2RT3A 2ZBRA 1VQ9S 1HBOB 4BKTB 3ENQA 3PR4A 1LW2A 2WZ1A 4FN5A 3ZZRA 5LSLA 1K9MT 3CCUS 2VBZA 4K4UA 3T9ZA 2RUSA 5HAOA 1F3FA 1R31A 2R7VA 1M5SA 1YJNS 3V4MA 1XK8A 1QLNA 4EUVA 1L3SA 1RAAB 1FVQA 3S1TA 1D9DA 1NDCA 1HLWA 4JV2A 4OHWA 4ZKAA 5HLFB 1WF0A 3PEJA 3QLHA 5KFYA 2W2MP 4DV3J 2X1BA 1S10A 2BUNA 2KRRA 5HZGC 3IXQA 2ZBQA 2FHMA 4BS2A 1T9VA 3CPWR 2I6WA 4DX5A 2OP5A 2OFHX 1SH2A 2F1FA 2I2RA 4DR6F 2CQBA 3R9LA 2DEJA 2UZAA 4RLEA 1S0MA 5KG5A 4U9RA 4OL8A 4NZ7A 3KK2B 3MTJA 4EZ9A 1U4BA 3NGKA 4HACA 4TLQA 4NLUA 2AJ2A 1T1DA 4BHQA 2YX7A 2R7RA 2HZVA 4DS4A 1N33F 4PG7A 1Y3JA 2CZVC 1IKXA 1E6VA 1RT4A 2DHSA 4URQU 2JRSA 4AYBD 3KG1A 3EVWA 3W5XA 1CJTB 1HQ2A 4CLWA 2JDJA 1YVFA 2OPQA 2RRAA 3BV8A 2R9RB 2UXDJ 2D3ZA 1BLUA 2BQRA 2DHXA 4K2XA 2QL9B 2R8IA 4ECVA 2HHPA 1BQMA 2HFOA 4LSNA 4AP2A 1H2TZ 1H3DA 3Q8QB 4C0OC 4DU8A 1PC5A 4JI6F 1XR7A 3C6OA 1UEUA 5C2GA 1WSRA 1EB0A 4ED8A 4J91A 2KDOA 3HF5A 1CC8A 3TZZA 2LXUA 2CQCA 2Y0SD 4C8ZA 2QSWA 5C25A 3UCUP 1H7WA 2WSCC 3ZTOA 1RAOA 4YY8A 4H4MB 1FDBA 1GXTA 2BKNA 4WF9Q 3T41A 5J2NB 2VKRA 1PSDA 4Z37A 1I51B 3IWXA 4CXJA 3I3NA 3I5BA 1W2IA 3US5A 1M5KC 1S1WB 4PWWA 3MPUB 1XN9A 3QJJA 4G6VB 4ATNA 3MR5A 1FHTA 3I56S 4M5MA 1QVFR 1I3OB 4YB6A 1FQVB 1QSSA 1REGX 1SQFA 2M4MA 1GX5A 1S1VB 1Q8KA 3J7ZT 1EQ0A 5EX3A 3OTEA 2DIVA 4E8UA 5AXMA 2FVSA 5LT5A 4NX9A 4FVMA 4OX7A 5DG8A 1KBRA 1REVA 5JVGQ 2N4CA 4D3GA 2B8QA 2FJVA 4J9KA 2W1BA 4DUZJ 4HT5A 4Z7CA 1J27A 2UUCF 4J8ZA 3OHBA 5CHCB 3H25A 3WQPA 1HW9A 1SBRA 4DR5F 1QDVA 4W9JB 2KRBA 1NXIA 2HHQA 1H0HB 2G2ZA 1U2CA 2LEAA 2Q6CA 1FRIA 3PRDA 4F2RA 4LF5F 3AH6A 5CYMA 5BYQA 4KGZB 1GMWA 3DRRA 1NSPA 1QJHA 1VHFA 3NBPB 4MFBA 1ZM3A 3R7SB 3F0NA 4YB1P 4MKVA 2P6TA 2Z8QA 3WC0A 1PIEA 2ZNZA 3NGRA 2XMKA 4O3SA 1S5ZA 2L9NA 4RBUA 2JZ5A 3PYGA 1S1UB 2AIRB 4B9TA 5HMWA 3G9CA 2DHAA 3VAKA 2YBVA 4W98A 1PCAA 3GG0A 1T05A 2OTJS 4B3TF 2BANB 3E3XA 4USUA 2DVIA 2QTWA 1ZA2B 4ELTA 3GFXA 3UDVA 2OPRB 4RW9A 2JOQA 4F25A 3UO0A 1F5CA 2ZBCA 1NJWA 1S9EA 1N5TA 4HEA9 1GMUA 3VF0B 4DX6A 3ZTDB 3CJ8A 1MNEA 4ETZA 1FWKA 4ZLNA 1K1QA 3DFEA 3D1QA 4J9SA 1RK8A 2RQMA 4I1TA 4PQUB 4GKKJ 1JJHA 3SMZA 2DO4A 2E5LJ 3M8VA 2AGQA 4DR2J 2J8SA 2XO6A 4JI7J 4PXCA 3V6KA 5GMDA 3G82B 2YKNA 3HCXA 3ISND 3TZXA 3SI8A 3W2VB 1VBZA 2J6UA 3WC2A 3MAAA 5F9LA 4FF2A 4Y34A 1DZ5A 2YXLA 2JWNA 5DRKA 9ATCB 3WX4A 3WSOB 1XERA 2OTLS 4IH7A 3R6LB 4UYIA 3TVZA 2R9LA 3GG1A 2EFVA 2R42A 2WBRA 4RW4A 1R2BA 3M2VA 5LL6d 2E1AA 4YS2A 4NLVA 4FNIA 2ZHBA 1LW0B 4UOGA 1WC4A 4O44A 3OJSA 1U1RA 2CPYA 2ZHAA 5L1JA 4HH0A 3QSIA 3RB3A 1ZBTA 1I1GA 3EDRB 3EYZA 5IBKA 3NS6A 5D3GA 1UJ5A 2AU0A 5K9FA 4W92B 4ZMMA 4RWWA 2APOA 1EP4B 3W8GA 5JVHQ 4ZOSA 4ENOA 1NLKL 1J5EJ 3UDEA 3MD3A 1KQFB 4E2FB 3HPOA 4LBHA 2MGZB 2GJIA 3LF0A 2CJYB 1IKVA 1VS3A 2AGOA 4RX6A 5MLCV 5ETLA 1RT6A 4LT6A 2E32B 5D0RA 3ILLA 2MHNA 3W66A 1X31C 5E33A 3OHAA 1RAFB 2DKOB 4DMZA 2HURA 1F5BA 2VG7B 2AT1B 4LIWA 4OJHA 5LMUF 3R1HA 2YH1A 1KFSA 3JTOA 2DK2A 4C8YA 2B4PA 2XC9A 5IM0A 5GAEI 1UVLA 3V6JA 5B0EA 2VPWB 5KFSA 2EWHA 2YKPA 2KJVA 2MLXA 5HQ8A 2VODA 3K57A 4K4YA 2WTFA 1YBAA 5T7LB 4NLOA 3BREA 1M5PC 3MEDA 2XYGB 2MZRA 1TKXB 4CRJA 2B5JA 3OL6A 3HHLC 4EU0A 1JLAA 1OJ4A 4OZNA 4MTPA 1H72C 1WHVA 4PWDB 3CJKA 3CF5Q 4JI8F 3QO9B 3NAIA 2F4FA 5ETNA 1U1LA 2AEFA 3PXGa 4NLTA 2MB0B 2OSQA 5KFVA 1X5OA 1TP7A 3DGPA 1Q16B 2KT5A 2CQPA 4DV6F 3TQ1A 3GQCA 3PIPQ 2MQPA 2FD2A 3OR2B 3GJRB 2KG0A 4KGVB 2DH9A 5IZHA 3MPVA 4L73A 1KHVA 1TL5A 1Q82T 3M2UB 2ATCB 4TQRA 2FJDB 1WI6A 3AHPA 3KG4A 3C15B 1GEHA 4DL3A 2MKHA 4C97A 5AJ3J 4BGCA 2NLWA 4X62F 4JP8A 5KFBA 5CYJA 4W9GB 3BF4A 3RAMA 4OQJA 2Y8YA 5I42B 4BWJA 2KM8C 1UVJA 2JVOA 4NWBA 3GCWP 4J9VA 4TY8A 2HRTA 2LMIA 3MPWA 2K2PA 2HHHF 2M0GB 4IFYB 2WW8A 4WTYA 3UN5A 1RYRA 5C42A 1XMOJ 1Z1ZA 3H20A 2JEGA 5HBMB 1R89A 1O6XA 1I5OB 2E66A 3KJVB 2YH0A 3CT9A 4APFA 3M8SA 1WOPA 1U0HB 4EBEA 1RT7A 4PXBA 3BIMA 2Z4PA 4YN3B 5KG2A 2RAQA 3LALA 1RAGB 2FDNA 2OI2A 1BUOA 3IBFB 5D4LA 3TW0A 4FP9A 3CCRS 2IVFB 2E7VA 4DWIA 1SUQA 3IS9A 5E3AA 1DQ8A 2N7CA 4XAKA 3HVTA 2HRUA 4ECZA 1HHTP 1FF2A 1VRTB 4PEOA 1DQAA 3KK3B 2YQ0A 2DT9A 2BQUA 3V2UC 4ED5A 3L4BC 2EG1A 1SKUB 1KVIA 3J7A1 2FVPA 1OY8A 3FBCA 3H90A 1Z2ZA 1E6YB 3AXKA 4MMOA 3HSDA 2VQEF 2BVZA 1FX4A 2ZUGA 1WDTA 4NLDA 3KXDA 2B56A 3O5TB 3MOZA 2FC9A 5KT4A 3PIOQ 4ZJLA 4J9MA 1Q53A 2HHUA 1FVSA 4R5PA 1R28A 3FVYA 2W25A 4UT4A 4A8KA 1EKRA 3ZTRA 3MM5A 4GVBA 2FVCA 1N34F 1C0UA 5HVFA 2ZH9A 3HSGA 4J9NA 4I0WA 4X66J 2HAFA 5G4DA 3SCIE 3KLIB 3POTB 5U47A 4MKYA 4USVA 4MT1A 3HT3A 3PJ9A 4DR7J 1Q4RA 1IKWB 2C2MB 1KD1T 3MM6B 2NXCA 2V94A 2RS2A 1NKEA 3NWGA 1JLBB 4DPUA 2F4VF 1KN6A 4KY3A 4DFPA 2WVCA 5F3ZA 5IWAJ 1LOUA 3IMQJ 7AT1B 2QA1A 5L8RC 4B95B 2JNJA 4QW8A 2F8HA 2C2RA 4IG0B 4OI4A 4OZ0A 3I82A 4OYOA 4KPCA 3ENAA 4ZITA 4GMKA 4N7TA 2BXJA 4ZA1A 3DYAA 5BYRA 2PI4A 2EKNA 3CCSS 4XDCA 1X9WA 1VYAA 4DV7F 5D0EA 4K5SA 4CI0B 3OXLA 3QWPA 5BO4C 3MURP 1QDWA 4KGXB 4OI1A 1GTEA 1FS1B 1AROP 3DGVA 3IM9A 1KQSR 1FESA 1FJEB 1SI9A 5HMXA 4B9NA 2EK6A 5A8KB 3KUHA 1JJCB 3TEHB 3LGMA 2UUAJ 3TARA 9RUBA 2P1OA 1BWVA 4ILMA 1NK9A 1T95A 3MUMP 1HNVB 4OJGA 1RA7A 2J9DE 2MZJA 3AOAA 2DH7A 4CO4A 5DJBA 2PA8D 1MU2A 3W7BA 1IBLJ 1S48A 3M8QB 3PW2A 2PGCA 4C11A 4P2XA 3MGJA 1FKAF 5IC4B 4QWEA 4WQOC 1S57A 3EZ5A 4ZPCA 4MKAA 2L41A 4C3MA 1V5VA 2MKKA 2FJBB 1WKJA 3N4WA 3O3LA 5LXRA 1FXRA 4EWTA 4FXDA 4DV0F 2HAIA 2BA9A 1FTRA 3UD3P 1TL1A 4OLOA 5IXUA 3RAQA 5B7WA 1YRTA 2CJ9A 2QA2A 4M5DB 2XCAA 2HWIA 1LWEA 4P7VA 5HP1A 4DPWA 4RNFA 2UUBJ 3DLKB 4NCGA 4WFYA 2XEXA 3QT5A 2DRDA 2KH9A 3M30B 1WELA 3JS9A 1GXLA 1EETA 3MMBA 3BSNA 4F4XA 1R6VA 2CPFA 3V5RA 4X4QA 1X60A 1HNZJ 4AQYJ 4DV1J 5FTAA 2DNYA 2QN6B 3J7Z5 2HBZB 2QRRA 2KZZA 4X65F 3MZIA 4FF3A 3DOLB 2BJ3A 3D2WA 4J9PA 4RW7A 1A9NB 4DLEA 2PMWA 3DRSA 1NHVA 2CJBA 5EWGA 1S79A 2FVQA 2V9WA 4MIAA 2UV8A 3C16B 2DXEA 2UVWA 2GO8A 1KLNA 4CNYA 3MEGA 1KC8T 1RHMB 2HPUA 2UU9F 5HROB 1TVRB 3M4TA 1C1CB 4WKRA 2IRYA 1FK9A 3KYLA 1QAYA 1Q5YA 5L38A 5D4PA 2FGCA 4H4OA 2E9TA 4BCAA 2ILYA 2IHCA 4J9LA 1SV5B 1N5YB 3RBEA 1SL1A 4LF7J 1TL3A 3DOKA 2C2OB 3DMJB 2K7JA 4NLQA 3TAPA 4ED6A 4G1IA 4UQTA 3MFIA 4U7CA 2HMIA 4NYPA 1RTIB 1TMMA 5E3RA 2K3KA 2FLOA 1P1TA 3I9V9 4DV2F 2KG1A 1VQYA 4A4JA 3O8WA 2VG6A 1BHNA 1IBKJ 4XIUA 2BJ8A 4NPOA 4ELUA 5H9EJ 2SXLA 4WU3A 4ITSA 4L75A 5AE2A 3MPYA 1JNRB 3JSRA 2CQIA 4DSJA 4LF6J 3C6NA 4Y3CA 3BGUA 2K3IA 3R5BA 1RWVB 1TV6A 1OPIA 2C2NA 2LYVA 1EOEA 3RBZA 2BEFA 4QWAA 3R6GB 1RWWB 3MECA 2X1AA 1OY6A 1QY7A 2MQMA 4Q2MA 3PYFA 1SIZA 3W1YC 2KXHA 2XZTB 1ZAWA 1FTCA 5K14B 3HKWA 3MOJB 4N8NA 2ACYA 3FZBA 3HKZD 1JLFB 2H9ZA 5KT3A 1VDHA 2GQ2A 4N47A 2HBYB 3FBFA 4URSA 2X3DA 2MDAA 1WC5A 4PG6A 2V4QA 1JKHA 3UD4P 1N32F 2MMYA 3Q22A 2VF3A 1SL0A 2QMUB 1ZH5A 3N6MA 2Y1RI 4KGKA 4Q44A 2AF6A 3LNMB 3V6DA 3CMAS 1RBOB 3EPGA 3JAMU 1N4LA 1EJ7L 3HLUA 4IG3A 4KE5A 1FDDA 4MIWA 1TK5A 4RUBA 1LDKD 1WJ9A 3GMGA 2GX8A 2FLLA 1DBDA 2PA3A 2CDQA 4WBFA 3CEDA 4DL2A 4AL6A 1DSXA 2UXBF 5IT9U 4TYAA 4FYXB 4OI3A 3OXFA 3OVSA 3GV5B 3CO0P 3K2YA 4O4RA 4ZVUB 2G1HA 7FD1A 4I6WA 4D3HA 1N6QB 3MTKA 4YDXA 5KG0A 4NLRA 1LWFB 2KKHA 2E1CA 1FXDA 3EVOA 4CP5A 3HVEB 3HHDA 3UDCA 4K5RA 2FHJA 1VIOA 4GVLA 2VL1A 2OGUA 3K5OA 1DLOA 2RU9A 3SV4A 2C3MA 2R7QA 2D9OA 3F56A 4YR2A 3C6TA 1U6ZA 3IG1B 1VJWA 1VIXA 1FDNA 1O0PA 2VICA 4U67Q 2K7KA 1PYTA 2Q81A 1WF2A 3TEGA 5HSPA 5GMEA 2DBBA 2BE2B 1N0UA 3I0RB 1VQ4S 4HLBA 1FRXA 4N56A 3ITHB 3CCJS 1VC0A 3MCMA 4DI6A 1R8PA 2NZ4A 3ULHA 4K4WA 4DR6J 4EEYA 4ID5A 4I4BA 1KLMB 3EM1A 3OLBA 3DLHA 2HHWA 5AXKA 4YP3A 1H2VZ 4ETXA 3AODA 4CT9A 3KLGB 3WX8A 4DQQA 3KLFB 4B9MA 2R2SA 1Z2LA 2MJNA 3G86A 4QYZK 3P4UB 1HQUA 3GP9A 2GGPB 3FQLA 3PFOA 1VK3A 1HWIA 4RWXA 3ADAC 4ZPTR 4F4ZA 1FO1A 4B3OA 1N33J 1X4FA 2F9JA 2DGVA 2QFJA 2DNZA 3BGFA 4FYDA 1IVZA 2BYCA 3D54A 4ANEA 5IV4A 4Z7YA 2IHR1 4F0KA 1KVKA 3HVAA 2XI3A 3MUTP 3H5UA 1U6BA 1KKHA 3E01A 2GMLA 3K5LA 4V19J 2KM8B 1F9EB 4DUZF 2MQQA 3ZFVA 1UCNA 3D28A 4FPIA 1YZ7A 1S6PB 4JI6J 3JQMA 2OEJA 4EK2A 2DD8S 1M90T 3CCLS 3FEXB 3PX4A 3FEYB 4CXTA 3FCHA 3KMQA 1FKPB 5HO4A 1HQEB 2AHOB 2YKAA 3IRXB 3LP2A 3EUNA 3B4MA 3PRBA 3VZHA 3T1HJ 3DDNA 1ITPA 2DXDA 1R0BG 1R27B 5HJYA 1ZM9A 3BH7B 1AYEA 4KO0A 1EXBE 4ECTA 1LKZA 2NSBA 2W2OP 3GIJA 2PE8A 2CPIA 4ID8A 3MEEA 1S4FA 1SL2A 2ZWOA 5E3CA 3QFWA 3I5AA 2D3UA 2WVDA 2HQ3A 2HGMA 2XB2D 4C48A 3AJDA 4LF4J 3CDWA 3AD8C 2QL7B 3QGPA 1YJ9S 1F0XA 4OHXA 2CAJA 4ZDNA 4O3PA 4EBCA 2BRKA 3EGVA 4DG1A 4MIBA 3HTMA 2IM2A 4JI5F 5F3TA 3DRZA 1P9QC 2V2QA 4FDFA 3W2WB 1U1PA 4KPYA 4ZPVR 1V6HA 3HSZA 4FVCA 2GS8A 4DFMA 4M1KA 2RHSB 3IFEA 2K1RB 2C9WC 1SQGA 4S0MA 4O0IA 4IDKA 2BX6A 1HBUA 3NNHA 4DR5J 3JSMB 2AWZA 2GIQA 4P73A 1RT2B 5DETA 1H7XA 3CNQP 2IBOA 5DDRC 4DPTA 4A47A 3CD6S 3VAFA 3T9NA 5BXBA 1IR2A 3MM9B 1JLGB 1LW2B 4BWMA 4DV5J 1F9HA 2LEPA 3TVKA 2XY5A 3PO4A 4AT1B 3KOAA 1YDLA 4UZBA 1X0PA 3EX7B 4NLSA 2E9ZA 1WG4A 3DLJA 2Z57B 4ZGCA 3CJ3A 4WYWA 3Q8SB 2QIFA 4WXOA 4U2NA 1O8BA 5KFMA 4DR3J 3LO3A 1ZM4A 2CQ2A 1H2UX 4IRDA 4LVNP 2L9DA 3P6YC 3WIVA 1JMTA 1HI8A 1FA0A 3FKCA 4B3TJ 3D3BJ 2VDIA 2Z58B 2QFIA 1NB7A 3NL0A 2UVUA 1Q79A 4RW6A 1UFLA 1P22B 2H4YB 5HJXA 1BQNA 2V2ZA 2GO9A 4RNHA 3KK1B 4RU2A 3H2VE 4F04B 3M8RA 2B4UA 4TQSA 2EW9A 2ZM6F 5J2MB 4WE1B 1T9XA 2F8MA 3JSYA 5LMNJ 3N0VA 2GHPA 4G1QB 3UPFA 4USMA 5H9FK 3EXYA 3DLEA 3DLGB 3J81Y 3ISNC 4H54A 1C2PA 2DH8A 3I96A 4UOFA 4DN9A 5CYQA 3QAUA 3U1LA 1JK9B 2F63A 3DKDA 2HNZB 4EO6A 1LWCA 5FJ4A 2FNJC 1KTVA 4MYTA 4GC7A 4UUXA 5CCMA 4I6JC 3IAM9 1VQMS 2IA6A 2IIHA 1R8BA 3MD1A 1VI7A 1FJGF 2ZD1A 4BLGA 3SQGB 4LSNB 1YJ7A 1RTJA 2CRLA 1JLCB 4E98A 4UOHA 5EX0A 2F3JA 4ZK7M 4QOTA 1HBMA 3G87A 2VA2A 2RILA 2W2PP 1HD1A 2ZH7A 4QWBA 2WSEC 1FNOA 1Q5VA 2VONA 5HMZA 1XMBA 5C25B 2OJ3A 2MQNA 2CJKA 3CCQS 1IBCB 5L1IA 2XSFA 1MWZA 3C14A 5H7GA 5G0RB 2RNEA 5HK4A 4ILLA 3CCES 4I56A 3A8EA 4NEYA 1EZZB 2DNNA 4ZVTB 1PBAA 4GO7X 3M6VA 6AT1B 1CBKA 4KHPF 5ETKA 5ETPA 2QLJB 2AJQA 5I3UA 2EI5A 4F02A 5IQQA 2NQPA 4HL9A 3KHGA 2AZ3A 5D8HB 1X7VA 3TUJC 4IO1A 1KHWA 1QTMA 2GJ2A 2DGUA 2MQLA 1VQ8S 3OTDA 1ZOTA 3JTPA 4OHYA 2EFQA 2BABA 1XBWA 4R8UB 1N56A 4OLPA 3VAGA 2PMZD 2DR9A 1TK8A 2OPSA 5CH7B 3A12A 4PXDA 1TZ0A 2AX0A 2H48B 3CDBA 4ICLA 4YY3J 4PG8A 2YNIA 1SJQA 3V81B 2MXYA 3R2DJ 2RSQA 5B08A 1HYSB 3D1HA 1MROB 4PQAA 1M5OC 2W7OA 1VCTA 2I9SA 1MN9A 2FGOA 5DLFA 4YHHF 1M5HA 1J2VA 3DOMB 3T1YF 2QLBB 5CYMB 3BS9A 2IY5B 4LF9J 2V8VA 2VPXB 3KKFA 3Q2SC 1OYEA 1XMOF 1C1BB 3IAS9 2RF2A 3WZ0A 1JWWA 3DRXA 2J8AA 2XLKA 4JI8J 1OS5A 2LQJA 2EFNA 4XPEA 4HKQA 3BDPA 1FFSB 3L95X 5FD1A 2HVEA 1KOOA 3Q0AA 3OGLA 4EGLA 1HBOA 2ASDA 3PX0A 3BO3A 4L72B 2R2TA 1QM9A 4NZ0A 3G6XA 2M8DB 1ULRA 4DV6J 4LF8F 1SJFA 2GJFA 4MYUA 3Q8RB 3U7JA 5F8JA 3J80Y 4RW9B 4C8MA 1CJVA 4ED0A 4NA2A 4ES3A 1RLCL 3L9ZA 2P9GA 4HYKA 2FC8A 2I1RA 2IMOA 3M8ZA 4WJBA 4F3QA 1U48A 4JGHC 2UVVA 3MM8A 2EC0A 3C2PA 4X62J 5KG7A 2MLZA 4YB5A 2PO4A 5KFNA 2OLWA 4RNOA 2HFUA 1KRPA 3I0SB 4F4YA 2E5GA 5JXSA 2VH7A 2B43A 2CQ0A 4DPOA 4IOCQ 5D0HA 2HHHJ 3DI6A 1N36F 4G65A 1U8WA 3M32A 2OKQA 4KH0B 2CJAA 1G7CB 3W61A 3G2XA 3B6BA 3BB5A 4W9CB 2X51A 1K1SA 5DS7A 1TKTA 3KK2A 2MKYA 5KFRA 1WKKA 4HHUA 5B0CA 3M8WA 2IJFA 3HO1A 1TUWA 3MXHP 1UP1A 1PO6A 4RW4B 4OYWA 2ASLA 4IOAQ 3M2VB 3D6FB 2DRAA 3IO1A 3MMAA 3J7YU 4JI0J 4Y2MA 2XS7A 3O44A 4ZPWR 3TWZA 5KT5A 4CNZA 3T3FA 4JI2J 3NS5A 2AEMA 2NSCA 2EEYA 3NCRA 1XEZA 3HJFA 2MZSA 4OZLA 2MA9C 2BJ9A 1RT5A 4CLYA 2PEHA 3AD7C 4ZCLA 2FLPA 1A0OB 5LLIB 3TVYA 2FZCB 1UJ6A 3UN2A 3GYNA 4F3OA 1EAYC 4F26A 4DR1J 4PUOB 5GADU 2UV8G 3OL8A 4L3KA 1LK5A 4H4MA 1DTTB 5J2NA 1RT6B 5HVGA 3BBCA 2JX2A 1X4CA 2KYZA 3EGWB 4PRFA 1Y5NB 3H2LA 3LP0B 4BKSB 4LIRA 1S1WA 4IYQA 1N34J 2BACA 5LM7E 3D5MA 2ATLA 4AFFA 2ZC3A 3SSQA 5DDOC 4KH1B 4IFVA 4F4WA 1RE1B 2RQKA 2MZQA 3AXMA 2MLYA 1TAUA 3MPDA 5IM0B 4EYIB 1S1VA 5DQGA 3C6UB 3J7YI 4X4UA 2V8HA 2LQ9A 2RE1A 2I0XA 5FDLA 4A8MP 2QV6A 1T9YA 4L6V3 2F4VJ 1WF1A 5I3PA 4N8OA 1FCAA 2BW2A 3G8QA 5ETVA 1UTAA 2CVIA 4FXVA 3NWRA 3OGKA 1Y0HA 2ZVSA 4UQGA 2CPJA 4FKXA 1VC6A 3MR3A 1OQ3A 3QJPA 1UA1A 1WEYA 1RCXB 3DGPB 3BR9A 1W7WA 2YX4A 2YKQA 2E1PA 4USKA 1F2GA 3MMCB 4DV7J 4O23A 2XMUA 2B9WA 3VALA 4QWCA 2UUBF 1AW0A 3JTNA 2Y3YA 4LRBA 5ETMA 1HHSA 4IRCA 4AL7A 4UF4A 1NH7A 1HNZF 4PZVA 3CD5A 4DV1F 1IWAA 1R6YA 3PDNA 2GHVC 1S1UA 2Y1IA 3FGVA 3NP5A 5HVHA 3BKUA 4X84A 2VG5B 4HDHA 2P1PA 2BANA 4ZPAA 3P5BP 4URGA 2FB0A 1S0NA 3NEKA 5ITHA 3D4JA 3K8WA 2M52A 1ZS6A 1IM6A 2WVFA 2V8PA 4HVZA 3FMWA 2C28A 2LP4A 3OHUA 1IUJA 1UWAA 2XY6A 4RL1A 1S7HA 1R0AA 1RXOB 1ELOA 3MMJA 3K5MA 3OSPA 2IMWP 1X4AA 3LPEA 4DV0J 3ETOA 1FWPA 4NA1A 2XBPA 2VBYA 4P74A 1FDAA 4ZLPA 1SH3A 2OVQA 1GMWD 3G82A 1VRUB 3QWUA 5LJ5Y 1YZ6A 2WVEA 4LF7F 3ICLA 2BJDA 3IS9B 2BE7D 3FRYA 3NY0A 1NK4A 1YLXA 1RA6A 3ZO7A 1XJWB 4HT7A 1RWXB 4OX8A 3BSCA 2W9BB 4NXNF 4Q8FA 2VFUA 3TZWA 4X4OA 1LEOA 3CJ5A 4WWSA 2BOPA 2VB6A 4X65J 1TKDA 2XI2A 3CD0A 4M8LA 3F44A 2IRXA 3H42A 1WI8A 3QGIA 4PAAA 3OUYB 1T03B 1PGZA 4Y2CA 1OWXA 2XLJA 4LQ3A 4P2SA 2FHOB 1LW0A 4PYAA 2MZTA 4NRUA 1LFPA 1DTQA 3LAKA 2IBKA 1QVGR 1A6LA 4J9QA 2W24A 3TNVA 4QWDA 2OO4A 5ETOA 1KQKA 4ES1A 2UU9J 1KQGB 4YMEA 4TY9A 2LDYA 1EP4A 4Q5VA 5KFEA 3R3TA 2DGQA 3R5GA 1V3ZA 3DHXA 3RTVA 1NJYA 4LFBJ 2UXCF 4IOBA 1VISA 1ZAVA 2VPZB 3R5JB 2MGZA 3CJ4A 1TKZB 4ZLLA 4IKAA 2D3OR 4JV5F 1L3KA 3LP1B 4X4RA 1R43A 4M5GA 2KT3A 4W4MA 2YWKA 1ICEB 2HS0A 3TI0A 1B7YB 3T6JA 3PR5B 1CQMA 3HXMA 2FYXA 2DIUA 2JZ3C 1S4EA 5MAOA 4EBDA 2D69A 4DQIA 3N5FA 5L9NA 2HK2A 2ZH6A 4C8LA 1D8YA 2HNYB 2J6SA 3EDQB 2G0IA 2NYIA 3QIPA 2BZ2A 3NNAA 3TAMA 1T3NA 4NLYA 4CO3A 5KFIA 5T7LA 1UEKA 1RTZA 1S0VA 2RVJA 1NAQA 2W4PA 4CWBA 1TKXA 2KTQA 1RDRA 4ECRA 2HFSA 3ZRCB 2CPXA 1IN0A 1PJ6A 3QO9A 2CADA 3EGZA 1X8DA 1Q7YT 5JUMA 2EFGA 2XO7A 1Q8LA 2QO3A 2C3OA 1URNA 4P2MA 2V2KA 4OJ3A 4U7UD 4ZVGA 3A8JA 1UVKA 2RH3A 3DRPB 3C66A 2GA7A 1KEKA 5C24B 2CNNB 1N32J 4W9HH 3OR2A 2LQ5A 3ZZYA 4A8YA 2V68A 5FLXU 2CQ1A 2ZOFA 3OJUA 3K5NA 2LKZA 1MU2B 1FT8A 2XNQA 3M2UA 2B6AA 1FKOA 3HD1A 3C15A 1IXKA 2MJUA 2G0CA 1DARA 2AEJA 4WPAA 2WSFC 5I42A 4U7UK 1N5VA 1TL1B 2IVMA 2WCXA 4I2QB 3BJYA 8ATCB 4ZIWA 3IRWP 4IFYA 1RHKB 1ZTTA 4UTGA 1LWEB 3D67A 2OFGX 1Q8BA 3PW5A 2UXBJ 4QCLA 1EARA 4O3QA 4CLLA 5A2QY 5HBMA 1P8GA 3KJVA 4WIIA 4CLZA 2JFDA 1U0HA 4ZHRA 3DN9A 2ASJA 2R7UA 3OW2R 3EGNA 3ZTCB 1JX4A 1C4AA 4X64F 3W65A 1CJUB 4TXSA 1RT3B 4NRTA 3CWJA 4HI1A 5GAHU 2XLIA 2OAUA 1NNDA 2CUYA 4JB8B 2A3JA 4FYWB 2VKPA 4KR0B 4DFKA 1RLDA 5T41A 4LBIA 1Q95G 1RSCA 3S01A 2MKSA 1V3RA 3CDUA 2IJRA 2J7UA 3KK3A 1UA0A 3QATA 3VAMA 1UAWA 1HHQA 4L74A 3SIPB 4KRWA 2VPYB 3H59A 4JV1A 2HWHA 4LRDA 4W9DB 5KFAA 3EVMA 4DQPA 4H4OB 1FXLA 3RR8A 3HFZB 2ERRA 2QEXS 2IF5A 4DXLA 4USTA 3PJXA 1YK9A 1RWPB 2HK3A 2BR0A 3M9NB 1SVDA 4DV4J 4F50A 4OIXA 2Q3PA 5CA5A 3T1HF 2MY7A 3KTQA 4KIAA 3UCGA 1G2EA 1TL7B 2ABYA 3CB4A 2HHTA 4Y2AA 2HMIB 4XTTA 4QU7A 3ZTSA 4DZ6A 2XMJA 2EK1A 4Y0FA 2DHGA 5DG7A 2LA4A 5DQIA 3LUTB 4RUCA 4LFAF 2VG6B 4EZ6A 1S6QB 1CLFA 4LF4F 2IZVC 4FYYB 3RYLA 3POTA 2IA0A 3GFHA 4WZQA 2NZCA 1PJ5A 3JXOA 1XIQA 4BBYA 1MN7A 2RUGA 1IKWA 5KFQA 4LBPA 1TV6B 1VLOA 4RPFA 2YTCA 1GT8A 4JI4F 2BKPA 2HS3A 1M1GA 3QPIA 3SQOP 3HDSA 1CSJA 1X4GA 2G4BA 4KKOB 3T5KA 1B0TA 2GAGC 5F8GA 3GFZA 3FSYA 5CZXA 1KNZA 2V8DA 4IG0A 3HVRA 4W9LB 1VQSA 4CDIA 3FJ2A 1O51A 4IQXA 3RB0A 2IM0A 1H73A 2CPHA 4DV5F 1Y5LB 2LXFA 1U25A 1NK8A 2FUG9 2HQIA 3SFGA 3U02A 4ZIVA 1JKHB 2V4JB 4CH7A 2BMBA 2BKOA 4U8VA 4N5SA 2XM3A 5A8RB 1GK8A 4CO1A 3JSBA 4M5LA 2WONB 2DNPA 3HFVA 5A8KA 4DR3F 2DR8A 2ZEJA 2CQ3A 3PX6A 1XTZA 3SSRA 1S1XA 2KYXA 3JQJA 2PPIA 4IH6A 4H4KC 5E0OA 3FEZA 3DNCA 3BQ0A 1R0CB 4JI5J 1WC6A 1EIYB 2IDLA 1HNVA 1X5SA 5AE3A 3C46A 3KLVA 2G13A 4CTAB 1UZHA 3GCXP 5HQLA 2YPZA 1IM4A 1D1UA 3P3DA 1Q81T 1VBKA 4RJVA 4DPYA 4ECUA 4P9SA 1YBUA 5LMNF 2DNGA 3KVTA 3CC2S 2DGSA 2CNLB 1EX8A 4NASA 2FZGB 2MKCA 4QW9A 1NDLA 4ES2A 3NAHA 2HWTA 4P10A 3IWNC 5IC6B 5GAGU 3GU0A 3M30A 2DCUB 3BM7A 4W9IB 3MWBA 1B0VA 1UKUA 4F4AA 3P96A 2GFFA 4Y2KA 1K73T 1FE4A 4NLPA 1AZSB 3RJMB 3A3PB 3FFIA 3EZUA 1RTDB 5KFWA 3P8BB 2IAJA 2C22A 1HWLA 3KNGA 5A15A 3PO5A 3BGOP 5D4OA 2H4WB 2W2QP 1XNRF 1X4HA 4R0JA 4X4PA 3GJSB 4OYIA 2DGTA 2AJFE 4CRHA 1S99A 2NZ0B 2J0WA 2W2NP 1LK7A 4AL5A 2L3MA 2OMLA 5KG1A 4C6AA 3C16A 4Q0BA 2ZM6J 1T0TV 1RTHB 1N48A 2JEIA 3PVXA 2BW7A 2I38A 5HROA 1UEVA 4ED4A 1U1NA 1C1CA 2CG4A 2LU2A 2OD4A 5KFZA 2OVRA 1M1KT 2FJXA 4DL4A 3RUBL 3M2RB 3HJVA 3LAMA 3CULA 2N4DA 1SV5A 4C4WA 5EDWA 1S72S 5J2PB 4PABA 4QYZJ 1TFYA 4CYUB 3HD2A 3CW2C 2DPIA 2JC0A 3DMJA 4KB7A 4KV8B 5IOLA 1HA1A 1HNWJ 2YWEA 4DN0A 1RTIA 3E01B 2OEKA 5ETRA 1FJGJ 1T7PA 1X4DA 2ZHOA 4R0EA 4C0HA 5H9EK 2ALZA 4JYAF 4Z2XA 3FSIA 3DDKA 5ETSA 3MAQA 2XSJB 2VOOA 1FD2A 3UNYA 5KOWA 1DAXA 2IPOB 4I2PB 3JQKA 4U8YA 4YY3F 3OTOF 1LQ9A 3R97A 4ED3A 4NLXA 3H5YA 3K89A 2B7BB 2W9AA 2I5JB 2OEMA 4NE9C 2ASSA 4ZVOB 1GTHA 2Z8HA 2XNRA 1FEEA 2PFDA 1M0SA 1H74A 4MK9A 4LF9F 3Q89A 4CO0A 3FUYA 2D7SA 3HMJG 4NMXA 3TUZC 3KDNA 5J1EB 2HYIB 4K59A 2JLFA 4KO0B 3BPDA 3ZUNB 1DJ0A 3CIZA 2E44A 1S9GB 2WOMA 1VFJA 2VKZG 5K14A 2XY7A 3MEEB 4X4SA 2EPIA 3KFWX 2VC1A 4KHPJ 3O1LA 4UOCA 3BKFA 2MSTA 4LVOP 1NCLA 2RHQB 4MK8A 1S1TA 2U2FA 1L3TA 4CH1A 3RZAA 1JLFA 4YFUA 1CJKB 2IM3A 1NHKL 3H5SA 1N8RT 5K8PA 2VFSA 2WVBA 3PV8A 2V6AA 4DL0C 1RT1B 4DG1B 4O3NA 1RHUB 3BYRA 3T5LA 2PC6A 2Z2ZA 4DSIA 4B9VA 2DNOA 3BZQA 1APSA 4ANDA 5J2QA 3KLHA 1WDDA 1UWBB 2W7AA 1QAJA 1OMSA 2QJ3A 2NUUG 3E2EA 1SPBP 4IDKB 4QR2A 2E1MC 3GYGA 2V69A 1YJRA 2J9CA 4HHHA 1O5JA 2HIYA 3HSJA 4YHHJ 4QR0A 4J7CA 2Q43A 5IFMA 3T1YJ 2D1CA 4AWJB 1YTYA 2HVZA 4NXMF 4ZVQB 3HZGA 3EXCX 1Y10A 2W7PA 4PR6A 3G71S 2GVZA 3A3NB 1RKIA 2R4FA 5KFKA 1B0PA 3ZNJ1 2M3DA 5CQGA 1MMLA 2WB1D 2B9YA 2DNHA 2HLUA 3E8OA 1U02A 3UE2A 1F3VA 1X5PA 2GNKA 2XMAA 3OR1B 3H7HB 5CD4H 3BGLA 3ILJA 2B7CB 1K47A 2V2VA 3UDLA 4LF8J 4JI0F 2R2RA 1RP5A 3QFHA 1QDUB 2LEBA 3G8TA 3HVEA 2B9EA 4CXIA 1HNIB 3GV8B 1BQNB 4F7VA 4JI2F 3R5DA 2DNMA 3GWCA 1U1MA 5M2RA 2VZ9A 3IG1A 3F73A 3CJ2A 2ZE2B 3LW5C 2QC3A 2F5GA 1U1KA 4J5OA 3R2CJ 4UW2A 1HWKA 5KFLA 3RBDA 2BE2A 1FE0A 2XTJP 1AUSL 3DLEB 3I0RA 3ITHA 3QZ8A 4ZJQA 3HHLA 1WHWA 2DR5A 1NK0A 4DR1F 3SSSA 1UW4A 1UW9A 1N36J 5CD4A 5CYQB 1BQXA 4FBTA 4M5IA 3RW6A 5A0YB 1LWCB 1KLMA 2ZJQQ 4CH0S 4LR8A 1B4SA 3QIDA 3UN3A 3KLGA 3KLFA 2FIUA 4M95A 3BGRA 3ENWA 3PYDA 1TUGB 2W8KA 1RBLA 3KG0A 1BXNA 2AYGA 1QE1A 2GGPA 3K58A 1VQ7S 4B3RF 1YQHA 2AKWB 5LOQA 2GVDB 1JJ2R 2P2CB 2GHWA 3HVWA 2YNGB 1G1XA 4RBTA 2ZKUA 4ZVRB 3PJWA 1Y00A 2CFXA 2FHJD 1NUEA 2R7OA 1RGVA 4LR7A 1I94F 1IKYB 3GR1A 5JH5B 1KTQA 3ENVA 1FWLA 4ECQA 3TJ8A 3K5PA 1CULA 1FX2A 3S6EA 4OX6A 2MQOA 1ZAXA 2CQGA 2EVZA 2JSXA 3MI7X 3ZTPA 1Y11A 1HIYA 2MTLA 2Y0BB 4N77A 4F4KA 3GIMA 2CWKA 1AA1B 5EN1A 3D6HB 3V4IB 4DHVA 3W64A 5D78A 2R7XA 3X3UA 3NKYA 2M7SA 4LRAA 1NDKA 4O4GB 3LANA 4OYZA 1FKPA 5I3UB 4UZCA 4O0NA 1MSWD 3IRXA 4ECWA 3AQPA 2HHVA 4J37A 3CDEA 1RQ0A 4G3IA 1PAEX 1AFIA 3NGSA 1SKRA 3BN4A 2HBRB 1TELA 3KLEB 1NZ8A 1F9FA 2AYBA 3MR6A 2EFPA 3DLLQ 3PFEA 4A8SA 4DFJA 3RU0A 2R8KA 1BWEA 5CCLA 3Q2TC 4P75A 5A8WA 4LRFA 1RBAA 3BSOA 1QSYA 5F8MA 1FD8A 3QQCD 1HBNA 1T94A 5CZVA 2EG2A 2VD3A 3D0GE 2O66A 4QQBA 5KFJA 4NMLA 4ICLB 3J7AN 1PC4A 3IP0A 2BJ7A 2J7WA 3S7RA 1BC6A 1YG0A 3KHHA 2LU1A 3DM2B 1JXEA 4M5HA 3HQIA 3PRVA 1OIAA 2DGWA 5HL7Q 2LVWA 4B9LA 2F40A 3ONQA 2AJ1A 4IR9A 3W2WA 3LPYA 3UCZP 1MMDA 2XQCA 1U49A 1J5OA 1H6KX 3PKMA 4IRKA 3NRBA 2B4VA 3Q8PB 2K1RA 4QIGA 5EGYA 2RF2B 2KB2A 3FMBA 4RW8B 4PPZA 2B4OA 3HM9A 3H5XA 1RT2A 1U26A 4F3MA 3GA1A 2CJXB 3TA2A 2HVDA 4RZRA 2Q79A 1NSQA 1FRMA 3OHVA 2RS8A 2MSSA 3NMRA 3MM9A 4YB7A 2ADCA 1JLGA 1UVMA 2QA4S 2W4CA 4M63A 2DITA 4DDFA 4ZN1A 1LXJA 3GV7B 4DUYF 2A10A 2W9CA 3OQ2A 1WORA 3WIUA 4ZCMA 2KXNB 3R5AA 1CJVB 5M2PA 3GSDA 1GFWB 1RABB 1U6FA 5IQ6A 3TYTA 1TMJA 3QBCA 1VQNS 5D4NA 2PDAA 1XMQF 1EQMA 3MM8B 2AQ4A 2KXFA 5E2QA 5RUBA 3HK2A 4C3KA 1OSDA 1SC1B 3DC2A 2ZDOA 3CCWA 2NXNA 1NJIT 2J0XA 2DR7A 3G4SS 2O1PA 1U1QA 2A1BA 4C2MA 2FVRA 2QSFA 3W9JA 1NO8A 2RU3A 3DI6B 3VQTA 3KK1A 3V7DA 3M32B 3UVJA 5DM6Q 2A18A 4I6YA 5E5NA 2HFVA 5J2MA 4WE1A 2CQ4A 1TKTB 1HI1A 4YR3A 3TX0A 4OHZA 2QE5A 4G1QA 3TO8A 3ZZOA 3DLGA 3JYTB 4A48A 3MM7A 3H8YA 4LFBF 2BM1A 1XNQF 1W2BR 3MMAB 3CIMA 2HNZA 5HYWB 1R3NA 4QBUA 1VQPS 2CZ9A 3D66A 1Q0NA 2CVEA 5B0BA 3NGTA 2OHDA 1XR6A 5HQMA 2Z30B 3CE8A 3S8SA 3ZZZA 4NXNJ 2YKMA 3R7BB 4NCAA 2HGNA 2V50A 3SQGA 2NN2A 5KTQA 1JLCA 4I7FA 2F9DA 1VC5A 3QGGA 1RT5B 1WHXA 3I9ZA 1FRLA 5T14A 3VGUA 1RJJA 1L3UA 3BBBA 1UPMB 1R8HA 2ZVIA 3AFGA 2E5IA 1AXQA 1VQKS 4OYBA 4DL6A 8RUCA 4RUHA 4I68A 2CNKB 3ET6B 1UJ4A 2VV5A 3NCPA 3OV7A 2RDIA 3UQSA 2IC3B 3QT7A 5G0RA 1CS4A 3DDIA 3NGDA 5DLGA 4CLPA 2XMWA 4LF1A 2FTRA 1B99A 4RU9A 2LLZA 2KFYA 5C7PA 2UXCJ 4IFVB 3RAXA 3ZXWA 2Y8WA 5J1PA 3IGNA 1HW8A 3T5HA 4B3MF 4JV5J 1RI7A 2J9EA 4K0KJ 4KYZA 4DCJB 2C1EB 3PG9A 3ZNGB 4P6QA 2HFNA 3GSIA 3UD5A 1S77D 1XR5A 2BJ1A 3BKTA 4R8UA 5FDLB 4CP3A 1U24A 3BBFA 4ZCKA 1MWYA 1RADB 3NOCA 5EUHA 1GQEA 4ZOUA 4WYLA 2XS2A 1WEZA 3C8YA 1NZAA 3V81A 1DHMA 1HYSA 2Z56B 1Q1KA 1MROA 4WP9A 1HPZB 2A6OA 5BJRA 2J0QD 3AOCA 3DOMA 1YJWS 1Z4UA 2KHCA 4OZJA 1VBXA 4NLWA 1C0TB 4OZ5A 1S0OA 1Q86T 3KJQB 1QAXA 3KUGA 1HWUA 3CC4S 1C1BA 3Q24A 4X4VA 1D9AA 2HNDA 3OTBA 4EFAC 1T9TA 3BQ1A 4ZVPB 1FRJA 3FC9A 2GCFA 3WBZA 1OPZA 3B78A 1RAHB 1IQTA 1KVJA 3CXCR 5B0AA 3R8YA 1YI2S 3I6PA 4OV1A 4DL5A 3FBEA 1OY9A 1D09B 5DO2A 1NSAA 2O3DA 4TKTA 2GAHC 3M4XA 2DCLA 4LF2A 1R0AB 2D41A 1WOOA 1JB0C 3AT1B 4ZP9A 2AP6A 3CVKA 2Q6BA 3MKSA 5A6WA 2QT7A 5H7HA 4AD6A 4JBCA 3I0SA 2MEWA 4C8NA 5ETTA 2D9PA 1ZTWA 3D6TB 4P52A 5BYSA 2KL8A 1NEEA 3VHQA 4ZP7A 2YNFA 4DV4F 4DSFA 1HNXF 3CSKA 3C3LA 1RAEB 4U6PA 5KG6A 3MR2A 2V34A 4ZS6A 3QRQA 3BR8A 1PYOB 4XDDA 4Y2IA 2UP1A 1N54B 2M2BA 3W62A 4P71A 4IO9Q 3M05A 4MH8A 3EICA 2XGPA 2EKYA 4CLFA 4X64J 5SUHA 1K0TA 2MKJA 5C2CA 4HI2A 5GAEU 4F67A 1N5QA 1IJFB 3BQ2A 1UPPA 4P7TA 3GILA 3DRYA 3QJLA 3N01A 4ER8A 2J9DA 2YNHB 3BDEA 1RU2A 1F1BB 1DTQB 4V19X 4PG5A 2CG8A 5I3QA 4LFCF 3KMSA 3GR0A 1NRKA 5IT0A 2U1AA 3O6QA 1U2RA 5A6PA 3UI3A 1Y5IB 2A79B 2X7IA 4AXIA 3PHEA 5AT1B 5F9NA 4F8RA 3LUYA 2RMLA 4O3RA 1S9FA 4PUOA 4L3NA 4PKDB 2BDPA 5L39A 4BDPA 4KFBA 4FS2A 4CZCA 1DTTA 1QSLA 1JLEB 3P45B 1QD1A 1V9OA 2H54B 2RKIA 3IR6B 4YR0A 1YWXA 2F7VA 1S7IA 4NEZA 2QL5B 4KHRA 4EI2A 2G0JA 3QGHA 3LP0A 1LWXA 4JI3J 3M8YA 3RR7A 4B9KE 2Z2MA 4LFAJ 3W63A 1EOFA 4Y00A 4LSLA 3H2UB 2ZOMA 4LUBA 4CT8A 1D3WA 1Q78A 3VZIA 4W9EB 1ROFA 4USWA 2HW3A 4YEAA 5F0UA 2ZJPQ 2AGPA 1VK8A 2ZKTA 3C6UA 2VDHA 3CCTA 4TLRA 2BJEA 4B3SF 1SC4B 4JI4J 2ZZTA 4F2SA 3QIPB 2UUWA 4OZ2A 3TAMB 1FRKA 4QIVA 3ZRFB 1CQNA 1TR0A 1U2FA 4A8OA 4K2JA 1WTBA 3QAEA 1VOMA 4I69A 1NK6A 2E5HA 1LXNA 1IR0A 4HDGA 2VOPA 1R29A 4CLUA 1U8SA 3TP2A 4ED7A 4M94A 5E7OB 4C8OA 2HQFA 3M8PA 2PEBA 5L1KA 1JLQA 4BC9A 1NKBA 3J81j 2E1RA 1NK7A 2YWWA 1QUVA 1HR0F 2R8GA 3HULA 5H1SV 1T9WA 4K4VA 4XPCA 2IRUA 3MMCA 4FPRA 2XHCA 2OPPA 2NREA 1NKCA 3BO2A 3MEKA 5C5JA 4PPDA 3G96A 2ADBA 4I6AA 2BBEA 3GONA 1U0SA 2OVPA 1DY3A 1QAIA 1EODA 1GNKA 2CNOB 3M5BA 3QMQA 4V1Ak 2CPZA 2B6AB 3QLHB 1AUDA 1FKOB 3KJFB 3T1AA 5KFGA 2DXFA 1RHJB 3FDSA 1F2HA 3UFCX 2VG5A 3I4HX 1MWQA 5DDPC 2HHXA 2NR0A 4Q43A 4DLGA 5B0DA 4U2MA 2QX0A 4JI1J 2NPIA 2BRLA 2IJNA 1B3TA 2XCPA 2MZ1A 5AXLA 2XHWA 1QTNB 5K5MA 1TU0B 2E7WA 3K7RA 4HTJA 2KU7A 2CXEA 3ZNUA 2O67A 4HACB 2JVRA 2ZBPA 4W9HB 5K8MA 3LH2S 4GC6A 4ZHRB 4J9RA 5DADA 3UNGC 2RRBA 4NI2A 2G9OA 1VRUA 1VRQC 4B02A 4DR4J 1IKXB 3A3OB 3QZ7A 1E6VB 1RT4B 5L1LA 2CA9A 2DTJA 4AE5A 1NN7A 1V5IB 2OPQB 2JHEA 4RBVA 4Q2LA 3M1VA 1HMVA 2H5JB 1HNWF 2YPYA 1RAIB 1LQBB 2W9BA 4DX7A 3I55S 4DSKA 4OZ3A 1T3OA 4MK7A 4QIWD 1BQMB 2HG4A 1N5SA 4A8QA 1WUUA 2EFOA 2GV1A 2GQQA 6FDRA 3B54A 4Y28C 1XNRJ 2ZH4A 3KHRA 2CJQA 3RRGA 3NGUA 3OUYA 3PNIA 1T03A 4OX9J 2C3UA 2VUGA 1SC3B 1BY9A 2DPJA 2BOAA 3L7UA 2AW0A 2G2YA 4LRCA 3SDEA 2DISA 3IGVA 3OPKA 1YX2A 2HQDA 1ZZFA 4A8XA 4TU8A 3VWSA 1VQOS 4F36A 2G2OA 5KG4A 1X9MA 2YWFA 4JUZA 1RB0A 5F41A 1Y9OA 1H38A 1AFJA 2FLNA 1WHYA 4P72A 1MG7A 4UUWA 4NA3A 5BR8F 1TKZA 1YRXA 3OL7A 2KN4A 4CLSA 3VGTA 4WFAQ 3LGHA 5KFUA 4DSEA 2FHKA 2GIRA 3UW1A 1S1GA 4GRSA 2DY9A 3LP1A 3Q8UA 2FJWA 1REVB 1YKWA 1V3SA 1JXLA 4MKBA 3MCOA 3WHIA 3NXZA 1WC0A 4JYAJ 1PG5B 3FK4A 5IT4A 4KTQA 1CEZA 4WFZA 2CQHA 4ZVFA 2P6SA 3VTIA 1S97A 3D9BA 2X1FA 3I4PA 3OTOJ 4ZJOA 2ZDPA 2DY1A 3SCKE 4USIA 4JTAB 4DPXA 2L9WA 3N79A 3J81U 3IBWA 2V5HG 2HNYA 3OFGA 2DNKA 2P1QA 1Y3KA 2AJ4A 3AY0A 3DRRB 3IA0A 2VFRA 2ZH3A 4MFBB 1SKSA 1IBMF 3LWMA 3P49B 3CJ0A 3TR5A 4A8WA 2JEFA 1UETA 3D68A 3C6PA 1KR4A 3CMES 2AX1A 3Q86A 2C3PA 2WAQD 2PT0A 1FJ7A 4ZP6A 3VAJA 5EHHA 4CCHA 1PJ7A 1S1XB 1T05B 1LM8C 2VBXA 2MY8A 2R8JA 3ILIA 4OFZA 3N6NA 4OYPA 3DRPA 1NU4A 4QIEA 1YRUA 2RQ4A 4CO2A 5C24A 4FS1A 2YKOA 1AT1B 2YY3A 4C3LA 1RHRB 4RKUC 2CDRB 3KDOA 3OGMA 4WTOB 1HL6A 2AD9A 2AMCB 1S9EB 1RHQB 5HLFA 5F8NA 1WD6A 1HD0A 4F0HA 3FCVA 1G3OA 1BE4A 1ZM2A 2LA6A 3OXGA 1PILA 3TOQA 2JH3A 4Y65A 2W4DA 3AQOA 4NXMJ 1YJUA 3FCWA 3JB9k 2GIFA 4I2QA 3E51A 2ASTA 2YKNB 3R5CA 1JJ4A 3MAAB 2DO0A 1YITS 3A13A 3LOUA 2R7WA 4KQZA 1B7FA 4K4TA 3A8IA 3DCAA 3DLBA 3E4UA 2V8GA 3PM9A 2PSZA 3BH6B 2QMXA 3FFIB 2C3YA 2ZH2A 3AD9C 2IAJB 2ZNYA 4QPXA 1JXVA 2N3LA 2PI5A 1CJUA 3R27A 2JC1A 3HT0A 1RT3A 2HHSA 1K0VA 1EKSA 1I6JA 3D7SB 2ZC4A 3B4DA 2J7KA 1QUPA 1CJTA 2KO1A 2RJZA 4O44B 3RGIA 5KFXA 3MUVP 4TYBA 4N9F5 5LJ3Y 4Q0BB 4X4TA 2ILZA 3EE3A 5D3GB 4QU6A 3G6VA 3RW7A 1L5UA 4ZCIA 5KFHA 4Q8EA 2N82B 3PHTA 3GLJA 4USHA 3RRHA 2WBMA 1MLAA 3JAMY 2HKEA 2A0FB 2PN6A 1U7LA 2YX1A 1G4CA 1SJRA 2FPHX 3SCJE 4K8RA 2VQFJ 1IKVB 4PYDA 1R8AA 5L46A 4WK1A 2K8GA 2XG8A 5HN0A 3DU6A 3U1MA 1D0EA 4FZVA 3W9IA 4LJMA 1TL7A 5IT9Y 3TUIC 1C4CA 4M5KA 2V63A 3SV3A 1VGYA 2XWYA 3J80U 1M1HA 1ZA1B 4B3RJ 3CTRA 2R7SA 4OYAA 4KAIA 3U1NA 5KFCA 1SJ4P 1TK0A 1S6QA 1B64A 2JLGA 1RWMB 5DZ6A 2OSRA 4HH1A 5DZ7A 2ZH1A 1I94J 4AUKA 2JJ4D 1RKJA 3D6MB 2XWXA 2ZBIA 1CS3A 1GX6A 4EOZA 2KJWA 3H4DA 2XULA 2PFFB 3F41A 3G6YA 1KSPA 4U95A 3MEDB 1SIWB 1N0VC 2B5JB 2E5JA 4DSLA 1JLAB 2WOMB 2LFVA 3MCNA 3CJKB 4KKOA 3W5YA 1L3VA 3CJQA 2QZ8A 1PYSB 3KUEA 3D1OA 1X0FA 1RISA 3AA9A 3H4BA 1S1TB 1NHUA 5IS2A 1KDNA 2KHDA 5GADI 3ZC4A 3DCGB 3NBPA 3ZZPA 1S6UA 3M9MB 4QZVB 4AXJA 1BD6A 2L08A 2DNQA 1RU1A 5DGAA 3VV2B 3PKYA 4K4SA 1X4BA 1NSKL 2V4JA 3LTOA 5J2QB 3MHYA 3KLHB 4IR1A 5A8RA 3UR0A 3KNAA 2HBQB 2WONA 2M70A 1FFGB 2EBEA 3RRKA 3W8PA 5I4MA 4FBUA 3BSAA 1RYSA 3D3CJ 3OD2A 3RG6A 3IR7B 1WC3A 4DV3F 2VFTA 3VCDA 2ZWPA 3TA1A 2H51B 3AAWB 1WC1A 3GJQB 2GMJA 3KWMA 4OI0A 2DRBA 2ZJRQ 3CCMS 5K20B 4TY8B 2P1NA 2OPRA 1Y7PA 4CTAA 2VJUA 3QRRA 5C42B 2GVZB 5B0FA 1TTHB 2E29A 3SXLA 4TNOA 4TN2A 1D8ZA 1HI0P 1U47A 3FSXA 2CPDA 4DJBA 3MDFA 4GKJJ 1RT7B 4OHVA 1DRZA 1NJZA 4PQUA 2W8LA 4PCQA 2V9KA 3IN5A 2RQCA 1VLYA 3EJMA 3N6LA 3PTWA 2NS1B 2RRNA 3PCOB 5L9XA 3FKBA 1KFDA 4HXIA 1HKAA 2HVIA 3W2VA 2D74B 1SUQB 2XGQA 1S76D 1YBTA 4DUYJ 3A1YG 3HX9A 4WZMA 4HTIA 2WHOA 4FF4A 1SB6A 2F8EX 3HVTB 1U1OA 2UXDF 2KT2A 2A6MA 1VCBB 2DGXA 1NBEB 2LQBA 2W01A 1AZSA 1OO0B 2RD5C 2RDJA 1RTDA 4I67A 3KHLA 3ILOA 2LDIA 2HZCA 1XMQJ 2CKWA 3SCLE 5LSRA 1NK5A 2DEIA 1SCJB 3H98A 3NMAA 2P9CA 3HHLB 4NL5A 1XC9A 3MCSA 3QNWB 4M5NA 2DJWA 1SJ3P 1GAOA 2Y9HA 1RTHA 4CQ1A 3I87A 2HFZA 4R5PB 2L48A 2H1YA 3KJNB 4UY8T 3BGRB 2AYMA 3MM5B 2VPKA 2C42A 4GVBB 2AYEA 4C7QA 5B09A 5KFPA 4WFBQ 1NH8A 4DX8H 4YDDB 1S59A 1QE1B 1U09A 1C0UB 3M2RA 3PW0A 1A7GE 3H0PA 1YHQS 1XNQJ 4N41A 1EHWA 1KS2A 2GW8A 3PY8A 5J2PA 2XZWA 4CYUA 1NDPA 1A68A 4K0KF 4KV8A 5F0WA 1NM2A 1TL4A 3C19A 2P1MA 2Q1LA 1CULB 2HQCA 2R8HA 2M9KA 3GB0A 4OV6A 2C2KB 2Z2YB 4TU7A 2VG7A 1VQ6S 3ZKJB 4DCOB 2XSJA 2CQDA 3CDAA 4OYMA 1VQLS 4X4NA 4CIOA 2VU5A 4I2PA 2H5IB 1WEXA 4JV0A 5KT2A 2ZH5A 3CCVS 3CMQA 5DDQC 1W26A 2QA4G 1LNQA 3M6UA 2I5JA 1SC6A 4C8KA 3GPAA 2BQ3A 2IVYA 3DYAB 2E7XA 3T6BA 1BMQB 4F0MA 3BN7A 4LREA 3G8SA 4W90B 3LBZA 2HQGA 4DEZA 4M5JA 2HS4A 2BV3A 5J1EA 1NPPA 3DU5A 5J1NA 1S9GA 2JL9A 1GMVA 4A8FA 4PWDA 2E31B 5A8WB 3FRZA 3W3SA 2FZKB 1VMBA 1HBNB 4E0DA 4ED1A 1BUXA 2EBGA 2ROEA 5DM7Q 1RACB 2NXJA 4RO0A 1CJKA 1VR6A 4B3MJ 2OH2A 4RR5A 4ZPBA 5HANA 1ZZNA 4C9DA 2ZOGA 3TX8A 1RT1A 4Q7AA 2M5YA 3R7NB 2QLXA 3H40A 2MKIA 4ERDA 3TZYA 1WKLA 4ECXA 3GFYA 5GVQA 4XO0A 3N28A 1SQEA 1UWBA 1J5OB 2HEKA 2UUCJ 2NYHA 3OTCA 3NG8A 1UZDA 4C11B 2QGFB 2BE9B 3HZEA 4PG4A 2AJ0A 3L2OA 4YUDA 2MQ8A 2N7YA 3TAQA 3VR1A 1DFDA 3B82A 1YIJS 3IR5B 3B84A 4GKKF 2E5LF 1NJXA 4DR2F 4LF5J 4JI7F 1BGXT 2PD1A 3V6HA 2B8PA 2J6TA 5HP1B 5KFTA 2ZZMA 1S6OA 4NCGB 4B9KB 2W9CB 2LECA 1URRA 3Q23A 4AJYC 4G1PA 1EETB 1X4EA 3MMBB 1TFWA 1HV2A 1DQ9A 3CCZA 3L7OA 4RUAA 3OR1A 2KFNA 4W9FB 5ETQA 3SBMA 1RZMA 4FNHA 3GIRA 2QMWA 4FF1A 3X1LB 2I8EA 2ROPA 1KONA 3DXSX 4WFNQ 2NCKL 2DGOA 2P8IA 4RW7B 2FY1A 1YJVA 3DRSB 3AB4B 5A6RA 1HNIA 2CYYA 5LXYA 5D15A 4J90A 2J76E 4WU2A 2DNRA 1VRTA 1HARA 3UVJB 5M2UA 4USJC 2XS5A 3OVAA 5LSOA 1RCOB 3MEGB 1S12A 5B0GA 2ZE2A 2Y1LB 1FK9B 2DB1A 1F60B 2CZ4A 2RDDA 4WK3A 1J5EF 3VVUA 2GZOA 3M6XA 1RWUA 1NPKA 3AJ1A 3MM7B 2HRYA 1E6YA 4J9OA 2KZMA 3ISZA 3QRPA 1UMJA 3CJSA 4ZVEA 4IQMA 1TL3B 3DOKB 4C0BA 5A0YA 1HNXJ 3PACA 4ELVA 4PXEA 2AV5A 4LMZA 2MHEA 1K44A 4C98A 1U45A 1PBUA 4JI3F 3EWGA 5IV3A 2Y1JA 2YKMB 4Q45A 1OSCA 3LQVA 2LXIA 2F65A 2C2ZB 2GVDA 4I7FB 4FYVB 2E9RX 4HHJA 5BXDA 3QT8A 3ELHA 2YNGA 3AJ2A 3KLIA 2Q66A 5F8HA 4NZ6A 3OFEA 5GAHI 3HP6A 3Q8YA 3IM8A 3K59A 1IKYA 3MM6A 4ZVSB 4LFCJ 2LCWA 2HZAA 5E41A 3RB6A 3MECB 5AXNA 1JLBA 4KHMA 1CS4B 1CVJA 2O5DA 2HVHA 2ASYA 4I64A 3IC1A 3I31A 5A2QU 5D6GA 2HIQA 5D0GA 3V4IA 3HHLD 1B70B 4O4GA 5F8LA 4EYHB 4DZDA 3VVTA 1CC7A 3MR7A 4WXWA 4OZ1A 2P5VA 4WFXA 2YWHA 1WG5A 4OI6A 3VGVA 3BYPA 3KLEA 2XYHB 4TU9A 1JIHA 3AB2B 5KG3A 4QYRA 6FD1A 2VHGA 1ZPVA 1X9SA 5LMUJ 1FNMA 5K8OA 3QSYB 1CPZA 4LQ9A 4O3OA 1PKUA 1UVIA 3WDOA 3V6DB 1UFKA 5AJ3F 3FNNA 2FY8A 3W9HA 3SYZA 3DM2A 5HMYA 3OLAA 4IG3B 2K06A 2RB7A 4B3SJ 1WSVA 1SXLA 1UVNA 2CPEA 1ACMB 4JI1F 4DCPB 4A46A 1T9UA 3NNCA 2VASA 1SH0A 3M8QA 4CO5A 2A2CA 3T19A 2OD6A 4RW8A 2HNDB 2GMHA 3D0IE 2GC8A 5KFDA 1P27B 2KVQE 4EMDA 4KJIA 3HHKA 1Q8IA 4NYOA 2ALYB 1HR0J 2BM0A 1WOSA 4DQRA 3GE9A 3Q8VA 2M8HA 1P1LA 4M5DA 4ZLJA 3BPSP 1FI4A 1YSJA 2Z2LA 4DUTA 1T02A 2HLTA 4DR4F 1T11A 5KFFA 1OQ6A 3PYEA 3LWLA 3BO4A 3DLKA 1NMEB 2OUGA 1DLOB 4ZP8A 3THTA 2WW4A 2WRMA 3PEHA 1H98A 1MW7A 5EUPA 3C6TB 2VIHA 4U77A 5JMNA 3TRGA 2AZ1A 1KP6A 2B3TB 4B08A 3N9UC 4NCBA 3GTYX 2MYFA 5KOXA 2FQQB 3DOLA 4YOEA 3R1LA 2CWXA 3CD7A 2N3OA 2VFVA 4OX9F 3HHEA 3RBXA 3PW7A 2J5AA 4ID5B 4DU7A 2PIIA 5E3PA 5BXIA 1FS2B 2YNFB 4KT0C 5HATA 1VQ5S 5BXHA 4K4ZA 2JFKA 1HWJA 1VBYA 5HI7A 1S49A 4N76A 2H65B 1TVRA 3VAIA 3DXBA 3LA0A 4UIJA 2OIHA 3NOGA 3AOBA 1HQUB 3HI9A 3TJAA 2IYIA 3JYTA 1IQZA 2V4RA 1N5YA 2POKA 5DGBA 4B3OB 4NYZA 1N88A 2WB4A 1XWLA 4X66F 2DYAA 1UL3A 3T5JA 1YGYA 4IUFA 3TA0A 4WP8A 2YQ1A 4QIFA 3VGSA 3GJTB 4DR7F 4ZPDA 1YJTA 1K8AT 1WG1A 3GIKA 4H4KA 4DQSA 5GAGI 2KFZA 2EXUA 1KOHA 4GO5X 4RNMA 3MF5A 1WTFA 2IYGA 4CLKA 3SEOA 2ZUAA 1UFWA 3OFHA 1NEXA 3A4TA 4DF4A 5IWAF 2HGLA 1P9YA 2G1DA 2O01C 1IR1A 1HFEL 4LSZB 2VQEJ 3EPIA 4NLGA 4QPTA 3LP2B 3OL9A 4KFBB 3A8KA 3ET6A 5EWEA 2NXUA 3ZZ0A 2RKIB 1FERA 2V67A 2IC3A 2UUTA 5KAKA 3NLCA 2VC0A 3VAHA 1FEHA 3ETMA 4JOUA 1FNXH 3Q83A 4WIQA 1VJQA 1T8EA 2YWGA 4LSLB 2LQ8A 2ZFHA 3I5CA 5BR8J 2FJAB 4BC7A 3UWTA 2UUAF 3ZZTA 5DQHA 5FIIA 4OI2A 3DHWC 4WKYA 2NXEA 2XMMA 4K4XA 2J0SD 5EWFA 3OSNA 2M88A 3PW4A 2NUHA 4X2BA 4Y6IA 4FKYA 3LGNA 2GQCA 1KWMA 3HFKA 2XMTA 3TUPA 1R8CA 2Z0GA 2OMOA 5KT7A 2V0NA 3MAHA 1GH8A 1IBLF 4ILRA 3THVA 3K0JA 1VHIA 1CG2A 4CLTA 1HBUB 1P6TA 2VJVA 1OYDA 1FJCA 3IBCB 4ED2A 4MAKA 2KVIA 3M8PB 1ZPWX 1JLQB 1TAQA 3O2IA 2YQ3A 5CXTA 1HPZA 4EO8A 2PMHA 4ALZA 1TQLA 2FJEB 4B17A 3B8HA 4KC5A 3OBIA 4DL7A 1ZETA 1IJEB 2QYGA 4UY85 3M52A 1C0TA 2OPPB 1IBMJ 5E3QA 3W5ZA 2DNLA 4HR2A 2R3VA 3ZZUA 4XK8C 3CC7S 4P2FA 2COLA 7FDRA 2ZH8A 2OELA 2R2UA 2WK4A 5ADZA 4NOHA 4AQYF 2QLFB 3L09A 2ZITA 3CJRA 1IWGA 3K8VA 1Y4ZB 3QYYA 2IDEA 1F6TA 2ACMA 3PZPA 2MPUA 1MMNA 1N6QA 2ZZNA 3HU6A 1LWFA 1NPRA 4K50A 3IWLA 4LR9A 4RW6B 3CO9A 2C2DA 1NB2A 2YVSA 3NCQA 1FFWB 3OFFA 2D3O1 3CJTA 2C2EA 3D0HE 5D77A 4ZN3A 1X5TA 1RAJA 3M6WA 3FQKA 3MFHA 3SZ2A 4ANCA 3GIIA 4PWUA 3HHNB 4ECSA 4IH5A 3GYXB 2NPFA 5K8NA 2QG9B 1F5AA 2VA3A 2VQFF 4NI2B 3QT6A 2B51A 1FRHA 5H9FJ 4JTDB 4WCEQ 2JLEA 3AA8A 3UR3C 1DURA 2IFXA 2X1GA 4QR1A 3EMTA 3M1VB 1HMVB 4DBQA 3M7VA 1RUSA 2VBWA 2ZD1B 1RWKB 4KBIA 1RTJB 1R7IA 3L7PA 4FXWA 1HBMB 5THWA 1IBKF 4L76A 3THPA 3CUNA 1WACA 2H5EA 4JTCB 3VQSA 5AE1A 5CAAA 2B9XA 4DOZA 2JEJA 2YNHA 4LF6F 2XMVA 3CGIA 4J9UE 4B9SA 2QYCA 1RWNB 3OT9A 4TVAB 5FLXY 3SDEB 3ZTQA 3L3CA 2UVRA 2RIJA 4ECYA 1PAUB 2CIMA 3C14B 3NS7B 2XYPB 4CM2A 2YY9A 1S6PA 4B9UA 3SFUA 1G6BA 1JQGA 3M9OB 2R7TA 2X3GA 4R25A 3GZ7A 2P9EA 1WNEA 2I2YA 4OYXA 3U27A 4WP3A 3TQEA 1HQEA 4RNNA 3FZ2A 5CABA 4YQWA 5KT6A 3OVBA 3N5BA 4ZVHA 4U96A 1ZYQA 3FBBA 1JLEA 4QJVA 1JNZB 5DAFA 2KI2A 5F8IA 1D9FA 1W25A 4KSEB 3K17A 2ROGA 2H3EB 1N52B 4MJKA 1TUVA 2DHHA 1LFWA 1GXUA 4DV2J 3P5TL 2OPSB 3W60A 2DR6A 1AB8A 1XQIA 3I32A 2QLWA 4K7QA 2YNIB 1RWOB 1LV5A 5JJBA 8AT1B 2A2DA 1WWHA 4DF8A 2HSEB 4CM0A 4W9KB 3G6ES 2IM1A 3TANA 3BEGB 5SZTA 3EZOA 2EC2A
chains in the Genus database with same CATH topology
5DG9A 3RB4A 1RTHB 3FEYB 3TOQA 2JH3A 5GMKa 4Y65A 4CXTA 3FCHA 2W4DA 1N48A 3KMQA 1FKPB 2JEIA 3PVXA 1Q7LB 4KGMA 5HO4A 1HQEB 3AQOA 1YJUA 2I38A 2YKAA 1UEVA 5HROA 4I2QA 3JB9k 3E51A 1U1NA 2ASTA 3IRXB 1C1CA 2CG4A 3LP2A 2YKNB 2LU2A 2OD4A 5KFOA 5KFZA 4DS5A 4OJ1A 3JSMA 3EUNA 1SJ1A 4GKJF 2OVRA 1M1KT 3B4MA 3PRBA 3VZHA 2FJXA 4DL4A 3DDNA 3M2RB 1SKWA 3R5CA 1R27B 1JJ4A 1ZM9A 2DO0A 2B0GA 3LAMA 1YITS 2N4DA 1SV5A 3CULA 4KO0A 3LOUA 4OMFG 2R7WA 1M5VC 4C4WA 2RT3A 4KQZA 1B7FA 1EXBE 5EDWA 4K4TA 3DCAA 1HBOB 1S72S 1VQ9S 4ECTA 3DLBA 1LKZA 2NSBA 5J2PB 4QYZJ 1TFYA 4BKTB 3E4UA 3ENQA 2V8GA 3PR4A 3GIJA 2PE8A 1LW2A 2CPIA 4ID8A 3PM9A 3MEEA 1S4FA 1SL2A 2PSZA 4FN5A 5E3CA 3ZZRA 5LSLA 1K9MT 2JC0A 2QMXA 3DMJA 4KB7A 2DPIA 4KV8B 3FFIB 3CCUS 2C3YA 3I5AA 2D3UA 2ZH2A 2VBZA 2IAJB 4K4UA 2ZNYA 4QPXA 3T9ZA 2HQ3A 2HGMA 1HA1A 1R31A 2N3LA 2XB2D 2YWEA 2PI5A 2R7VA 1M5SA 1YJNS 4DN0A 3R27A 2JC1A 1RTIA 3CDWA 3V4MA 1XK8A 1QLNA 4EUVA 3E01B 1L3SA 1RT3A 2HHSA 1K0VA 1FVQA 3S1TA 3QGPA 1I6JA 1D9DA 1YJ9S 1T7PA 2ZC4A 4JV2A 1X4DA 2ZHOA 4OHWA 1F0XA 4OHXA 4R0EA 4C0HA 4ZKAA 3B4DA 4ZDNA 2J7KA 1QUPA 2ALZA 4O3PA 4EBCA 2BRKA 4Z2XA 4JYAF 5HLFB 3FSIA 1WF0A 3PEJA 4DG1A 4MIBA 3DDKA 3HTMA 2KO1A 3QLHA 2XSJB 3MAQA 2RJZA 2VOOA 2IM2A 4O44B 4JI5F 5F3TA 1FD2A 5KFYA 5KOWA 3DRZA 5KFXA 1DAXA 3MUVP 4I2PB 1P9QC 4TYBA 4N9F5 2X1BA 4YY3F 5LJ3Y 3W2WB 1S10A 3OTOF 1LQ9A 2BUNA 4ED3A 1U1PA 4KPYA 4NLXA 4ZPVR 1V6HA 4FVCA 3H5YA 4Q0BB 4X4TA 2KRRA 5HZGC 2B7BB 3IXQA 2ILZA 2FHMA 2W9AA 4DFMA 5D3GB 4BS2A 4M1KA 4QU6A 2I5JB 3IFEA 2K1RB 3G6VA 2C9WC 3CPWR 4O0IA 3RW7A 1L5UA 2ASSA 4IDKA 2OP5A 1GTHA 4ZCIA 5KFHA 4Q8EA 2N82B 2Z8HA 1HBUA 4USHA 3NNHA 2OFHX 1SH2A 3RRHA 2WBMA 2F1FA 2XNRA 1FEEA 3JSMB 2AWZA 1M0SA 2I2RA 2GIQA 4DR6F 2CQBA 4MK9A 3JAMY 4LF9F 4CO0A 1RT2B 2UZAA 2D7SA 4RLEA 5DETA 3HMJG 2PN6A 1H7XA 1S0MA 2IBOA 3TUZC 1U7LA 5KG5A 2YX1A 1SJRA 4U9RA 2FPHX 3SCJE 5DDRC 5J1EB 2HYIB 4A47A 4K59A 2JLFA 4KO0B 3CD6S 4OL8A 4NZ7A 3VAFA 3ZUNB 1DJ0A 3KK2B 3MTJA 3CIZA 1IKVB 3T9NA 4EZ9A 1R8AA 1S9GB 2E44A 5BXBA 3MM9B 1U4BA 2WOMA 3NGKA 2K8GA 4WK1A 1JLGB 1LW2B 1VFJA 2XG8A 2VKZG 5K14A 4BWMA 2XY7A 3MEEB 5HN0A 3DU6A 4X4SA 3U1MA 1D0EA 2EPIA 4TLQA 4FZVA 2LEPA 3KFWX 2VC1A 4NLUA 3O1LA 4LJMA 3TVKA 4UOCA 1T1DA 5IT9Y 2XY5A 2MSTA 3TUIC 3PO4A 1C4CA 4LVOP 3KOAA 4MK8A 1S1TA 2U2FA 4BHQA 2YX7A 1L3TA 2R7RA 4CH1A 3SV3A 4DS4A 3RZAA 1N33F 1JLFA 1VGYA 2XWYA 1X0PA 4YFUA 2IM3A 3EX7B 4NLSA 4PG7A 2E9ZA 1Y3JA 1WG4A 2CZVC 3DLJA 4ZGCA 3CJ3A 3H5SA 1N8RT 1IKXA 5K8PA 2VFSA 4WYWA 3Q8SB 1E6VA 2QIFA 1RT4A 2DHSA 4WXOA 3PV8A 4U2NA 1O8BA 3CTRA 4URQU 2JRSA 4AYBD 3KG1A 2R7SA 5KFMA 4KAIA 1RT1B 4DL0C 3U1NA 4DG1B 4O3NA 3LO3A 1ZM4A 2CQ2A 2JDJA 1YVFA 5KFCA 2OPQA 3T5LA 1SJ4P 1TK0A 1H2UX 2PC6A 4LVNP 4IRDA 2L9DA 1S6QA 2RRAA 3P6YC 1B64A 2R9RB 4DSIA 2D3ZA 2JLGA 2DNOA 4B9VA 1JMTA 1HI8A 1BLUA 3BZQA 1APSA 2BQRA 1FA0A 2DHXA 5J2QA 4K2XA 3FKCA 3KLHA 2R8IA 4ECVA 2HHPA 1BQMA 1UWBB 2HFOA 2OSRA 2W7AA 4LSNA 1NB7A 1QAJA 3NL0A 4HH1A 4AP2A 1H2TZ 2ZH1A 2UVUA 4AUKA 1Q79A 4RW6A 2NUUG 2JJ4D 1UFLA 1RKJA 3E2EA 2XWXA 1P22B 2ZBIA 4IDKB 4QR2A 1CS3A 1GX6A 1H3DA 4EOZA 3Q8QB 2KJWA 4C0OC 2E1MC 3H4DA 1BQNA 2XULA 2PFFB 1PC5A 2GO9A 1XR7A 3F41A 4JI6F 4RNHA 3C6OA 1YJRA 2J9CA 1UEUA 3KK1B 4RU2A 3G6YA 1O5JA 4ED8A 3H2VE 3M8RA 2B4UA 1KSPA 4TQSA 3MEDB 1SIWB 2EW9A 2KDOA 4QR0A 2ZM6F 3HF5A 2Q43A 5IFMA 5J2MB 1N0VC 4WE1B 1CC8A 2D1CA 2LXUA 2CQCA 2Y0SD 4C8ZA 4AWJB 2QSWA 1YTYA 2B5JB 2E5JA 5C25A 2HVZA 4DSLA 1JLAB 1H7WA 2F8MA 2WSCC 3UCUP 4NXMF 3JSYA 4YY8A 4H4MB 1FDBA 2WOMB 1GXTA 3HZGA 3EXCX 3N0VA 4WF9Q 2GHPA 3CJKB 4KKOA 5J2NB 4G1QB 3UPFA 1L3VA 3EXYA 2VKRA 2W7PA 4PR6A 3G71S 2QZ8A 3DLEA 3DLGB 3D1OA 1X0FA 1RISA 1RKIA 2R4FA 3J81Y 1PSDA 4Z37A 5KFKA 3ISNC 1B0PA 3AA9A 3H4BA 1S1TB 3IWXA 1NHUA 4CXJA 4H54A 3I3NA 2M3DA 3I5BA 1W2IA 1C2PA 1MMLA 2WB1D 2DH8A 5CQGA 3I96A 3US5A 5IS2A 3PX4A 4DN9A 1M5KC 5CYQA 3QAUA 2KHDA 1JK9B 2B9YA 1S1WB 3U1LA 5GADI 2DNHA 3ZC4A 1XN9A 2HNZB 4EO6A 3DCGB 1LWCA 2HLUA 3NBPA 3E8OA 3ZZPA 4G6VB 4ATNA 3QJJA 3MR5A 1S6UA 3M9MB 4QZVB 3UE2A 1BD6A 4AXJA 5FJ4A 1FHTA 1X5PA 2GNKA 2L08A 2FNJC 3OR1B 3I56S 1KTVA 4MYTA 5CD4H 4GC7A 2DNQA 4UUXA 3BGLA 5CCMA 2B7CB 1QVFR 4YB6A 5DGAA 4I6JC 3IAM9 3PKYA 4K4SA 1VQMS 2IA6A 1X4BA 1FQVB 3UDLA 2V4JA 5J2QB 1QSSA 3MHYA 3KLHB 2M4MA 1R8BA 4JI0F 3MD1A 1VI7A 1GX5A 4IR1A 1S1VB 1FJGF 5A8RA 3UR0A 2ZD1A 2R2RA 3J7ZT 3KNAA 1RP5A 3SQGB 4LSNB 2LEBA 5EX3A 2WONA 1RTJA 2M70A 2CRLA 1JLCB 4E98A 3G8TA 5EX0A 3HVEA 2EBEA 3OTEA 4CXIA 3RRKA 2F3JA 4FBUA 5I4MA 2DIVA 3BSAA 5AXMA 4E8UA 2FVSA 1RYSA 5LT5A 1HNIB 4NX9A 4ZK7M 4FVMA 4QOTA 4OX7A 3GV8B 1HBMA 1BQNB 5DG8A 3IR7B 4JI2F 1REVA 3R5DA 5JVGQ 2N4CA 4D3GA 2VA2A 2RILA 4DV3F 2FJVA 2DNMA 2VFTA 3GWCA 3VCDA 1U1MA 3TA1A 5M2RA 4J9KA 4HT5A 3AAWB 2VZ9A 1HD1A 3IG1A 2GMJA 3KWMA 2ZH7A 4OI0A 4QWBA 2WSEC 2DRBA 1FNOA 2UUCF 4J8ZA 2ZJRQ 3F73A 2VONA 3CCMS 3CJ2A 3OHBA 2ZE2B 3LW5C 5CHCB 4TY8B 1XMBA 5HMZA 5C25B 2OJ3A 1U1KA 4J5OA 3H25A 2P1NA 2OPRA 1HW9A 1Y7PA 2MQNA 1SBRA 4UW2A 4DR5F 1HWKA 5KFLA 2CJKA 3RBDA 4CTAA 1QDVA 2BE2A 1FE0A 3CCQS 4W9JB 5L1IA 2XSFA 5C42B 1MWZA 2KRBA 3DLEB 3I0RA 2RNEA 5G0RB 5B0FA 5H7GA 2E29A 3SXLA 4ILLA 4TNOA 3CCES 4TN2A 4I56A 2HHQA 1H0HB 3ITHA 3QZ8A 2LEAA 2Q6CA 1WHWA 1D8ZA 3A8EA 3HHLA 1HI0P 1U47A 1NK0A 2DR5A 4DR1F 1FRIA 3FSXA 3PRDA 3SSSA 2CPDA 4DJBA 4F2RA 1UW4A 4LF5F 2DNNA 3AH6A 3MDFA 5CYMA 5CYQB 1BQXA 5BYQA 4FBTA 1RT7B 3RW6A 4OHVA 3DRRA 5A0YB 1LWCB 1KLMA 1QJHA 1VHFA 3NBPB 2ZJQQ 4GO7X 1NJZA 1DRZA 4MFBA 4CH0S 4PQUA 3M6VA 2W8LA 4PCQA 2V9KA 3IN5A 4KHPF 1ZM3A 2RQCA 3QIDA 2AJQA 1VLYA 3KLGA 2EI5A 5I3UA 4F02A 3N6LA 2NS1B 5IQQA 2RRNA 4YB1P 2P6TA 3KLFA 2FIUA 2Z8QA 3WC0A 5L9XA 2NQPA 4M95A 2ZNZA 3BGRA 3ENWA 4HL9A 3KHGA 1KFDA 4O3SA 2XMKA 5D8HB 4HXIA 1X7VA 2L9NA 2W8KA 3TUJC 2HVIA 4IO1A 4RBUA 1KHWA 3KG0A 3W2VA 2JZ5A 1QTMA 2D74B 2AYGA 1SUQB 2GJ2A 1QE1A 2DGUA 2GGPA 2XGQA 2MQLA 3K58A 1VQ7S 3A1YG 3HX9A 1S76D 4WZMA 1S1UB 4B3RF 4HTIA 1YQHA 1VQ8S 3OTDA 4B9TA 5HMWA 1ZOTA 2WHOA 3G9CA 2DHAA 4FF4A 1JJ2R 1SB6A 2F8EX 3JTPA 3HVTB 3VAKA 4OHYA 2EFQA 1U1OA 2BABA 2GHWA 1XBWA 3HVWA 4R8UB 2YNGB 1N56A 1G1XA 4OLPA 3VAGA 2UXDF 2PMZD 4RBTA 2DR9A 2ZKUA 3GG0A 1T05A 2OTJS 2KT2A 3PJWA 1Y00A 2CFXA 1TK8A 4B3TF 1VCBB 2DGXA 2BANB 2OPSA 2FHJD 2LQBA 5CH7B 1OO0B 2RD5C 2RDJA 3E3XA 1RTDA 2R7OA 4I67A 1RGVA 2DVIA 4PXDA 1I94F 1IKYB 3GR1A 3KHLA 1TZ0A 2AX0A 2LDIA 5JH5B 4ELTA 1KTQA 3GFXA 2HZCA 3ENVA 3CDBA 2CKWA 4ICLA 3SCLE 4ECQA 4PG8A 2OPRB 2YNIA 1SJQA 4RW9A 5LSRA 2JOQA 4F25A 3V81B 1F5CA 3K5PA 2MXYA 1NK5A 3S6EA 2RSQA 2ZBCA 5B08A 1HYSB 3D1HA 3H98A 4OX6A 1MROB 4PQAA 2MQOA 1NJWA 1M5OC 3NMAA 1ZAXA 2CQGA 2EVZA 2P9CA 2W7OA 2JSXA 3MI7X 1S9EA 2I9SA 1N5TA 4HEA9 2FGOA 3VF0B 3HHLB 4YHHF 4NL5A 5DLFA 3ZTDB 1XC9A 1M5HA 1MNEA 1J2VA 4ETZA 4N77A 3T1YF 4F4KA 3GIMA 1K1QA 3DFEA 3MCSA 5CYMB 3D1QA 5EN1A 3BS9A 4J9SA 1RK8A 2RQMA 2V8VA 4I1TA 3V4IB 2VPXB 4DHVA 5D78A 3KKFA 4PQUB 3Q2SC 2R7XA 1JJHA 3SMZA 3NKYA 3X3UA 2DO4A 2DJWA 1SJ3P 1GAOA 2M7SA 3M8VA 1XMOF 1RTHA 4O4GB 4CQ1A 3I87A 3LANA 2AGQA 1C1BB 1FKPA 3IAS9 2HFZA 4R5PB 5I3UB 2L48A 2RF2A 3WZ0A 4PXCA 3V6KA 1MSWD 1JWWA 3DRXA 3BGRB 4UY8T 3IRXA 2AYMA 2YKNA 4ECWA 3AQPA 3MM5B 2HHVA 2C42A 2VPKA 2J8AA 3ISND 4J37A 2XLKA 3CDEA 2AYEA 4C7QA 5B09A 1RQ0A 5KFPA 1NH8A 1OS5A 3W2VB 4DX8H 4WFBQ 3SI8A 4G3IA 4YDDB 1VBZA 2LQJA 1AFIA 2EFNA 1QE1B 1U09A 4XPEA 1C0UB 1SKRA 3BN4A 4HKQA 3M2RA 2J6UA 3PW0A 3BDPA 3WC2A 3L95X 5FD1A 1A7GE 1KOOA 5F9LA 3Q0AA 1YHQS 3OGLA 3KLEB 4Y34A 4N41A 4FF2A 1F9FA 1KS2A 1DZ5A 3MR6A 2EFPA 2AYBA 4EGLA 3DLLQ 1HBOA 2GW8A 3PFEA 2JWNA 2ASDA 3PY8A 3PX0A 5DRKA 4L72B 3BO3A 2R2TA 5J2PA 4A8SA 2XZWA 4DFJA 3RU0A 2R8KA 1QM9A 4NZ0A 3G6XA 1BWEA 5CCLA 3WX4A 3Q2TC 2M8DB 3WSOB 1ULRA 1XERA 2OTLS 5A8WA 4LF8F 1SJFA 4IH7A 3BSOA 1A68A 4K0KF 1QSYA<