3DRXA

X-ray crystal structure of human kctd5 protein crystallized in high-salt buffer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
161
Chain Sequence
ALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIEFLCVVSKELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords BTB/POZ domain-containing protein KCTD5
publication title Pentameric assembly of potassium channel tetramerization domain-containing protein 5.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 161
sequence length 177
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02214 BTB_2 BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drxA03
3.30.710.20 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3drxA01
4YY8A 3DRYA 3DRXA 4ZGCA
chains in the Genus database with same CATH superfamily
4CH7A 3EGNA 3IC1A 3QT8A 1Y00A 4ER8A 4WFAQ 4ELVA 1ELOA 4KH0B 3P5TL 3KUHA 4DR3J 4FXDA 4WIQA 1VQ8S 1EXBE 4EWTA 4C3LA 4HH1A 4LFAJ 4ID5A 3Q22A 4UOGA 1LK5A 2WK4A 4Q44A 2AJQA 4PAAA 1GH8A 4CLTA 3CCTA 4ZP6A 2NZ0B 2MQQA 4P52A 4X84A 5E3RA 2MLYA 2BQRA 3KHGA 2PA3A 2ZDOA 1VIXA 4DSKA 3GJRB 1HWKA 2JC0A 2B0GA 1VQ6S 1RGVA 4GVLA 5HYWB 1FTRA 4LFBF 1X5SA 3G6YA 3UN3A 1TL1B 4NA3A 4CI0B 2AW0A 1TL3A 1YJVA 2B56A 1R0AA 2FJXA 1L3TA 1T9UA 3X3UA 2FLPA 1RWVB 1T7PA 1CVJA 4M8LA 4CP3A 5IT9U 4NLWA 2W7OA 3LAKA 2BMBA 4RUBA 2VBZA 2KRRA 3IFEA 2VBYA 3U1LA 5B7WA 3CCWA 4HT5A 4FBUA 1NDKA 1HR0J 1CQMA 1FRHA 2GQ2A 4QR2A 5HBMB 4U95A 3MR3A 2C42A 1AT1B 2CQIA 2MGZB 3JAMY 4PG4A 1CJUB 2O5DA 4AQYJ 3R1HA 2BDPA 3AA8A 2YWWA 3D0HE 3NCQA 3IXQA 4JI2J 1FD2A 1QSLA 2GX8A 4ZVGA 2D69A 5KT6A 3MFHA 1Q79A 1ZAVA 2YKQA 4F2RA 4CDIA 3NCRA 4JGHC 2AJ1A 2MZQA 3ZZUA 1JLAB 3QT5A 1VQKS 1SC6A 4RZRA 1WSRA 1YI2S 1IUJA 2EFGA 2H4YB 2CQ1A 3PEHA 4IDKB 3W5XA 3BGRA 2MZSA 2XG8A 4DX8H 4DX6A 1U2RA 2BM0A 3PZPA 3HFZB 4X62J 3T41A 4UY85 2HHVA 4LF5F 3V6HA 5F8MA 5D15A 2MZ1A 3DRSA 4NE9C 3AY0A 2QYCA 4OL8A 3RRKA 2DNLA 2KH9A 1HWUA 2MKIA 1CBKA 3B84A 3D54A 3M7VA 2VJVA 1FF2A 1HIYA 5KFAA 4QWBA 2OPSB 2G2ZA 1R2BA 2BJ7A 2ZH4A 1XK8A 4JB8B 4L3KA 3PRDA 3HQIA 1PYTA 5LLIB 5EWFA 5E33A 3RR8A 4LJMA 1HYSB 2PSZA 4B95B 4ANDA 3OTBA 4D3HA 1NDCA 1FXRA 2RE1A 2VG7B 5MLCV 4K4YA 4ZIVA 3A3OB 2R2RA 3R5CA 3PKYA 4ED1A 1ITPA 3TUIC 4B3TF 1Y11A 3ILOA 4YB1P 4XIUA 1IBMJ 5F9NA 2BKPA 4TQSA 4U2NA 2O67A 5ADZA 3WSOB 3GIKA 2LMIA 5HSPA 4ED0A 5B0CA 2E9ZA 2LCWA 3AHPA 4WJBA 2ALYB 2VFRA 3TJAA 3WZ0A 1JLEB 4CXJA 2CFXA 2D1CA 1WEYA 4ECVA 3HULA 2W01A 1VOMA 2M9KA 2KFZA 3RAXA 1JLCA 4R5PB 1LWFA 4JI0F 2AF6A 4YHHF 5D3GA 2HIQA 1SL0A 4AL7A 1CJVB 1SIZA 2XM3A 5D4NA 3MPWA 4QPTA 1TFWA 1AW0A 2P1OA 5AJ3F 1IBLF 5IT4A 1PJ6A 3JSMA 1HMVB 4CYUA 2B6AB 2CUYA 4ECUA 2QA1A 2VUGA 4M95A 1ZM4A 4OMFG 3GONA 1FRLA 1XMOJ 1WG4A 1LDKD 4CRHA 4F7VA 5L1LA 1RT3A 4J9NA 2L9NA 3MECB 2NS1B 3IWXA 3T6BA 3N9UC 1ZETA 1EJ7L 3BH7B 3T1HF 1RT4A 2Y3YA 4LSZB 1VDHA 5EWGA 1BXNA 3NP5A 1NJIT 2E1AA 1M0SA 2HURA 4FF1A 2DNKA 4AL5A 2ABYA 4KSEB 3DU6A 1HQEA 2ZDPA 3BR9A 1VFJA 4N9F5 1UMJA 3SCJE 3E4UA 3SEOA 4LSLB 1ROFA 1FJGF 2B4PA 2P1QA 4GVBA 1EQ0A 1IBCB 4OI1A 3PYEA 2QGFB 1U2CA 3C16A 2BYCA 4J7CA 2J8AA 1NB2A 4JI8F 1T03B 3BJYA 2WHOA 4KO0A 1T9XA 1NDPA 2BE2B 4OYMA 1T05A 1NJWA 4AXJA 3KJVB 1RT6B 2UXBF 1SBRA 2KG1A 2CRLA 1T94A 2GQCA 5ETRA 3W5YA 1RHRB 3SSRA 3FZ2A 1MNEA 1VLYA 3V5RA 5J2QB 3R7NB 1HKAA 4K4VA 3CJ8A 1H98A 4RW7B 1HBOB 2BJ8A 4N47A 4MYTA 2FGCA 3SCLE 4ZKAA 2GAGC 4EI2A 3CJRA 1N5YB 2XLIA 2MQPA 5DQGA 1FDDA 1Z2ZA 1TKXB 1I3OB 4CO0A 1LQ9A 1E6YA 4DR4J 3R7SB 1W25A 2L08A 1EARA 4NLOA 1Q5YA 1D9AA 1P9YA 4CLWA 1W26A 5E5NA 2NSBA 2DO4A 1GNKA 1V5IB 4B9SA 2RMLA 2VH7A 4TVAB 1RWNB 5J2NB 1VBYA 5LMNJ 2HHXA 2AKWB 1N33J 5HLFB 4AWJB 2FZCB 3CJQA 1UVIA 5HP1B 1RT1B 1JXLA 4DS5A 1ZAXA 3DM2A 3GFYA 1RAAB 2VL1A 3WHIA 3NGTA 3LF0A 1S76D 1HBUB 2V4JA 3D68A 2YKMA 1ZH5A 1SCJB 3NS7B 5T41A 4ZJLA 5A6WA 3NAIA 4H4KC 1LXNA 3DC2A 1BLUA 1DQAA 2IAJA 4CNZA 4DJBA 4PYAA 3QGGA 3HZEA 2NZCA 2XY5A 3ZRFB 3KLGA 3ZTOA 3SXLA 2Z56B 1JIHA 2GS8A 5LL6d 4FKYA 2ZHOA 5KG5A 1R29A 5A15A 5C25A 2E29A 3J7Z5 2B43A 3TA2A 4M5JA 4NCBA 5LJ3Y 3LP0A 2P6SA 1YJWS 4C8LA 3I3NA 3N79A 1H6KX 2GCFA 1JNZB 1OY9A 1S6QB 2IVFB 4X4OA 4W9FB 2CQBA 1EP4A 2W4PA 2C3YA 4TU9A 5EUHA 1HW9A 2DPJA 3D1OA 3Q89A 3KOAA 1TL4A 1UWBA 3CCRS 3K0JA 3TO8A 2KTQA 4OYAA 4N8NA 4IH7A 1DFDA 1I5OB 5AXKA 4X65F 1CSJA 4ECRA 4C8NA 4PZVA 1JLFB 1S57A 1Z4UA 2QMWA 1F0XA 3CXCR 1AZSB 1FFSB 3FKCA 1HNIB 4NZ7A 4C6AA 1S10A 1FNOA 1WTFA 3LP2A 2FGOA 4W4MA 3MWBA 1S9FA 1H7WA 4OI0A 2RRBA 4PXBA 2XMKA 1HNVA 4NASA 1KWMA 2VFSA 3M2RA 2HNYB 3PEJA 3ZO7A 2DY1A 3TZXA 1NXIA 1OO0B 2HK3A 1WKLA 4YY3J 4A47A 1MN9A 2GC8A 3CJ3A 3CT9A 2NUHA 1M5PC 4YUDA 2DNZA 4JV1A 2YWKA 3ET6A 4LF9J 2BM1A 2B9WA 1GEHA 2IJFA 3QSIA 5KG2A 1BQMB 1JKHB 4NLSA 2PN6A 3ZNJ1 2ZE2B 2WAQD 5KFXA 3OGMA 1KRPA 2APOA 3HVTA 5HVGA 2HMIA 2ADBA 1P6TA 1NEEA 1REGX 2DNOA 3LP1A 2HFNA 1CULB 2D3O1 3BO3A 4DMZA 3F73A 2NSCA 3RU0A 3IBWA 3M32A 3HK2A 4RNMA 4M94A 1Y5NB 4C2MA 5F3ZA 2RF2A 4ZS6A 2BZ2A 2BJEA 3A8IA 3KDOA 3QQCD 4I56A 1X4CA 3PHTA 5BYRA 5JXSA 2YKNA 3NCPA 3OFHA 3LANA 3G9CA 1RT7A 1I51B 4DU8A 3K8VA 4KJIA 4Y2AA 1XN9A 4OHYA 2NXUA 1N56A 1TU0B 2E5HA 5DG9A 6FD1A 5IWAF 3RUBL 5ETNA 1FRMA 3IGNA 4CO4A 3PW0A 6FDRA 2RU9A 4J9RA 4GO5X 2ASLA 1TMMA 4Q7AA 1T9TA 2BBEA 1FRXA 4DUZF 4FP9A 1CS4B 4L6V3 1Q8BA 1VBXA 2DRAA 4J8ZA 4AL6A 1M90T 3OQ2A 3AB2B 2FY8A 2P6TA 2VDHA 4KPCA 4ZHRB 4I6WA 1N5QA 3BBCA 1KVIA 1TL7A 4QR1A 2XNRA 4KPYA 2AYBA 3DLEB 1F2HA 4ITSA 3OXLA 4J9PA 4NEZA 3W2WA 4ZPVR 3AXKA 1OY8A 2MHNA 1NRKA 2FLNA 3KFWX 1VQ7S 1YQHA 1VQOS 5FDLA 3TUZC 1HLWA 3C6NA 4YB5A 4AFFA 2CPEA 5C42B 4DPXA 1EAYC 2YNGA 4PR6A 3K89A 4OZNA 1B64A 1RBAA 4K4UA 3MHYA 4OI4A 3I31A 3QT6A 3CJ2A 3NGRA 4WU2A 2B9EA 2D3ZA 2YX1A 3HT0A 3VAIA 5HROB 2CNLB 4WFXA 3DYAB 4H4OB 3NWRA 1C2PA 3RB0A 2AQ4A 4RX6A 1S1WA 4WF9Q 3G2XA 5KOXA 4YR2A 3GWCA 2RUSA 5IT0A 2CDQA 2QEXS 3ILLA 4M5DB 2IYGA 1N0VC 4A8SA 1ZA1B 1B70B 2V67A 1TP7A 2PMWA 4F26A 5DRKA 3BGFA 1EKSA 4LF4F 4OZ2A 1NHKL 5A8RB 4QYRA 2VIHA 2E1CA 1PAEX 3RAQA 4HHHA 3EGVA 1U09A 3I5CA 5L38A 4OHZA 3TR5A 3FBCA 2PO4A 2IF5A 2BABA 1SQEA 3I5AA 3ZXWA 1HFEL 2ZITA 2CQ3A 4IG3A 4FKXA 1QAYA 3FZBA 2DNYA 2BR0A 2YQ1A 4OZ0A 1OJ4A 3T3FA 1KHWA 3H40A 4BKTB 3BSAA 3PDNA 3MTKA 4ZVFA 5U47A 2JEIA 5GADI 4DG1A 1S49A 2PI5A 2HZCA 2CQ4A 2EWHA 3UDCA 4Y34A 4LFBJ 3GIIA 2BJDA 3I0RA 1RT2A 3CCZA 3QGPA 2A1BA 1FK9A 4USKA 1IR1A 2HHUA 2OVQA 5IOLA 3TAQA 5DS7A 1S1VB 3OR2B 4RUCA 2WOMB 2W8KA 1VQSA 1C1CA 3S1TA 3MGJA 1WHYA 2IC3A 1RTHA 2W9BB 5IV3A 5FJ4A 1WORA 4W9DB 2C2RA 3W60A 1R8AA 2H4WB 2YH1A 2J7WA 1RCXB 4ANEA 2DY9A 1Q0NA 3IM8A 4PG8A 2UVVA 1N6QB 2HFUA 4ILLA 4PG7A 3DLGB 1FI4A 4J9VA 3CCMS 4LR8A 4ZVRB 2QMXA 3KLIA 3M8QA 2GJIA 3CGIA 2BJ1A 1OIAA 2ZKTA 1Q78A 3HLUA 4LT6A 3T5HA 3NG8A 3CCVS 4B02A 4WCEQ 3IG1B 5M2UA 4CM0A 4KFBB 3V81A 4DLGA 2OEJA 3PXGa 2WVEA 1WI6A 2J9DA 4A48A 5J2MB 1U1MA 1WOPA 2ACYA 1MWYA 1S48A 2HVDA 2N4CA 2ZZMA 3UD5A 1W2BR 5HJYA 2J6TA 3HHLA 3SCIE 2QN6B 1LEOA 1WJ9A 2VKPA 2ZUGA 1HNWJ 2HAIA 5JMNA 2Y1RI 2CJAA 2C2NA 2GVZA 1WI8A 5A0YB 7FDRA 1YJRA 3T1YF 1D3WA 1EQMA 2LDYA 2GGPA 2UUBF 2JHEA 4ZVTB 2X1AA 2L9DA 1X9SA 3UPFA 2YNFA 3C19A 1FX4A 2HFOA 5KFCA 3G8SA 3OHVA 2LEPA 1N52B 4K4XA 4DV2F 4JI3F 1TV6B 3CIZA 4LRFA 3HFKA 3O1LA 1GMWA 4KH1B 1G4CA 1NJZA 3A3PB 3RZAA 4B3TJ 2DNPA 3D4JA 3H90A 4DBQA 1MMLA 1UJ6A 2B4VA 4RW8B 4LVOP 4A46A 4V1Ak 1ZBTA 2VG6B 4W9GB 3GMGA 5H9FK 2ZUAA 4J9OA 3OSPA 3TAPA 1XWLA 2B8PA 3MM7B 2IM3A 4K2JA 1E6VA 1SJQA 5EX0A 3EDQB 2R2TA 4ES1A 1Q95G 5I42B 3M4TA 3P4UB 1WACA 2CJ9A 1FVSA 3C2PA 1TK8A 4LSNB 1UVNA 5J1EB 3PR4A 3L9ZA 4NXMF 1MMDA 4RPFA 4RUAA 3GSIA 3SDEA 2G0IA 1U26A 3M4XA 1HPZB 1FRKA 4LR7A 4ID8A 2WSFC 1PYOB 4JI0J 2HNZB 5RUBA 4YHHJ 1TQLA 2V0NA 5LXYA 4YFUA 1U48A 4IOAQ 1Y0HA 4NLPA 1HNZF 3J7YU 3KVTA 3S6EA 1VJWA 4KGVB 3GJQB 4QWCA 5CH7B 2XZDB 1C4AA 2ZH8A 1HQUB 3Q2TC 2KVIA 3C14A 2EC2A 2Z4PA 2CJYB 2NXEA 1KFSA 1PBUA 3QATA 2EPIA 2F4VF 2F1FA 3OV7A 3C15A 2M88A 2XYHB 4ID5B 3I32A 2J7KA 2XYGB 2KL8A 3T1HJ 2VOOA 1Q8IA 4OZJA 3M8ZA 4NLYA 2C2ZB 3C66A 3Q24A 2BOPA 2VQEJ 4OYIA 3HHKA 1YKWA 4ZP8A 3PCOB 2FZGB 3HXMA 1U1KA 4Q45A 1ZAWA 1U25A 1HHTP 4DSIA 3IBFB 1TVRA 4RJVA 2DT9A 1FJGJ 3UR0A 2HK2A 1TL3B 3MUTP 3IM9A 2XMAA 1R0AB 1OPZA 2QSFA 3JTPA 5ETVA 3A3NB 2PI4A 4JI8J 3ZFVA 1BQNA 2XZWA 4IFVA 1VRUA 2Q3PA 4B3SF 4ERDA 4B9MA 4F3QA 2G13A 5IS2A 1WOSA 1RWWB 4OYPA 3N6MA 3FVYA 2UXBJ 3BKFA 2EKYA 4P75A 5H9EK 4F25A 1FFWB 4IFYA 4RR5A 1I94F 4DFKA 2R3VA 4LQ3A 4ZVUB 3HT3A 2NXNA 3BEGB 3TQ1A 2QJ3A 3CJ4A 3D2WA 3VAJA 5HZGC 2JWNA 3G82A 4ED6A 2C2EA 1HW8A 3T9NA 1DLOA 5B0AA 1T9VA 5CD4A 5D0GA 4DV1F 2OJ3A 3QZ8A 1WC5A 3JTOA 1JJ2R 1S1TA 4K59A 2HHTA 2C2KB 5GAHU 2VBXA 1TK0A 3PYDA 4FS1A 1JNRB 3RJMB 1Y4ZB 4EBCA 2YQ0A 3MKSA 1BUXA 4PWUA 4W90B 5HO4A 4HDHA 4ETZA 3BGRB 5JVGQ 5SZTA 3LQVA 1AXQA 2HYIB 3DRSB 2ASJA 1HARA 4P10A 4WXWA 3CC2S 2O1PA 4A8WA 2QIFA 3TVYA 1NO8A 4A8QA 3VV2B 2DEJA 4Y65A 3AD8C 3G71S 4KV8A 3H98A 1FX2A 2AU0A 4B9KE 4K0KF 4AXIA 1O5JA 1QVGR 1X60A 5CZXA 1LWCA 4TYBA 2HHHJ 3EVMA 2V8DA 2XZTB 3WX4A 3RYLA 2PMHA 4P74A 2VJUA 4DS4A 4UTGA 2RDJA 5I3PA 4QR0A 2N7YA 1NNDA 2OPRA 3NGDA 4HH0A 5B0DA 5AXMA 2VV5A 1RAJA 4FXWA 3D6FB 4Q2LA 4CLSA 3R8YA 3EX7B 3E8OA 3BR8A 4ECSA 3T5KA 2C22A 4K4ZA 4V19X 2OI2A 2DXDA 5KFJA 1RI7A 2QL9B 2GIFA 1NK5A 2KRBA 2HQGA 5K8OA 1R89A 4KIAA 1S0VA 4M5LA 5I3UA 4X65J 2UXCF 3MR2A 2KG0A 1QLNA 1VQNS 3MOJB 2DNNA 5A8WA 3LUYA 4TLQA 4QWDA 1K44A 3MXHP 2R7RA 5AXNA 1JLCB 5DGAA 2RQMA 1WTBA 3T19A 1LWFB 1S97A 1K47A 1RZMA 5D3GB 4NOHA 4EEYA 2CJXB 2EXUA 4LRBA 4DSEA 1D1UA 5GMKa 2ZM6F 1UVMA 5GVQA 2H9ZA 3PO4A 1IKWA 1UCNA 3JSMB 1D09B 4CYUB 4IO9Q 5KT2A 1YHQS 2I2RA 2HHWA 3TARA 3J80Y 1L3UA 1Y5IB 2W24A 4U7CA 5ETOA 1RT3B 3CJTA 5DGBA 2XCPA 1K1SA 3G96A 3EUNA 1HNXJ 1XNQF 4A8XA 4DN0A 1D0EA 4N56A 3AD9C 5CQGA 4DQQA 2CNOB 1Q86T 3MUMP 4JI2F 1RT4B 4C3KA 4WQOC 1RHMB 3P96A 4K4WA 1AYEA 2PEHA 5KG3A 3KLHA 3G6ES 4CIOA 3CDUA 1HQEB 1B3TA 4EU0A 4Z2XA 4DUYF 4P6QA 2KHDA 1SC1B 3TRGA 1UEKA 3L7PA 2ZJRQ 3DU5A 3GFZA 1Q5VA 4GKJJ 3QNWB 4GVBB 5IQ6A 4ECTA 2KXFA 2KDOA 3CD0A 3C16B 4IG0A 4JV2A 3EZOA 2IM0A 5LSOA 1VJQA 3N0VA 2RS8A 4DFPA 2EVZA 4OQJA 1YITS 4KO0B 3R3TA 4NEYA 5IWAJ 1T05B 2BACA 2ASYA 4OYBA 2ROGA 2QYGA 3GCXP 3RW7A 4DUZJ 2OLWA 4Y00A 2MYFA 2DD8S 2FZKB 4OI6A 1U1PA 4C9DA 1KBRA 4ZPCA 5DLFA 2AGPA 4I64A 2D3UA 2X1FA 2OVPA 4W98A 3UDLA 1NUEA 9ATCB 1N5VA 4P7TA 3VQTA 1IBMF 1SL1A 4H4KA 4IH6A 1E6YB 4IH5A 6AT1B 1YZ6A 3TAMB 4XTTA 1RDRA 4AUKA 2NYHA 1N5SA 1YTYA 1SJFA 3TWZA 2M8DB 4ZJQA 3LGMA 1FWPA 4DDFA 2LQBA 3D9BA 3W2VA 3UN5A 3FEYB 1GTEA 3W5ZA 3QWUA 4ALZA 1QDVA 2A2CA 4PUOA 1JLGA 4BGCA 1HBNA 2YWFA 4IOBA 2ZBIA 4DR5F 2XWYA 3DM2B 3C3LA 5A8KA 2HNDA 3K5LA 3VAHA 3IP0A 3U7JA 4F3OA 4FF3A 3NOCA 3K17A 2V4JB 1QD1A 2YKMB 2N4DA 2LQ5A 3HX9A 1P22B 3CCSS 3Q2SC 2IAJB 4X64F 1G7CB 1MWZA 2DGSA 5KFRA 2HQIA 2J0XA 4CLFA 3KLGB 3MUVP 4C8ZA 4LIWA 2ZH6A 4ZLJA 2ZH2A 1R7IA 1TKDA 3PYGA 2GO9A 5C25B 3IMQJ 5M2PA 1U1LA 4CLYA 3LP0B 3KNAA 1FWLA 2VF3A 3DRPA 4ECZA 1X9MA 3BGOP 5A6PA 1QE1A 4LF4J 4I6JC 3PACA 5BJRA 5D0HA 3BGLA 2XWXA 3GYGA 1A68A 4MK9A 5K5MA 1EP4B 2H48B 4K4TA 4RL1A 4L3NA 1UWBB 5L1IA 2I2YA 1RAIB 3GFHA 3R5AA 2J7UA 2WVBA 1DRZA 1MSWD 3OUYA 4F0MA 4CLZA 5E3PA 2QT7A 4MKYA 3ETOA 1NPKA 5EHHA 3OJSA 2IA0A 3S8SA 2CQ0A 3N6LA 3W9JA 4W9CB 4J91A 4EBEA 3K5PA 3HI9A 2RU3A 3AFGA 3ADAC 3ZNGB 2BKNA 1KQSR 2Z0GA 4MT1A 3LP2B 2CADA 1PBAA 2N7CA 1NDLA 1JMTA 3VAKA 3UNGC 1HNVB 2XMJA 3MMBA 1IJEB 2BKOA 2X3DA 4QIWD 1SUQA 3M2RB 1N34F 3WC0A 2XSFA 3O8WA 4RO0A 4U9RA 3MR5A 1UVKA 3AA9A 1NB7A 1HD0A 1FJEB 3CCLS 3A8KA 2GIQA 1M5KC 3ENAA 2AJ4A 4DCPB 3FRYA 3ET6B 3O6QA 4ZVEA 1UFKA 2VPWB 2EBGA 4LBPA 5GAEI 2P8IA 1UVLA 3Q83A 4O44A 1RJJA 3FGVA 3H2VE 2HWHA 4DV6F 2JNJA 4B17A 5KG4A 3V6JA 3Q8PB 2QA4S 3HVTB 2HMIB 4NA2A 1N48A 3LP1B 4F0KA 3QRPA 4ZPAA 2XCAA 4YR0A 4RW6A 3BO4A 2YNHA 3O3LA 4P2FA 3R2DJ 5BXBA 4DV3F 3M32B 4CTAA 4DPUA 1LWXA 1YBTA 2DEIA 3F0NA 2RF2B 2KFNA 4MMOA 2OD4A 2DGTA 2JDJA 1LNQA 2C2DA 3THVA 1FJ7A 5LMNF 1UJ4A 3U27A 1KLMA 2K1RA 5EWEA 2YKNB 2AHOB 3M2UA 3A8EA 2NZ4A 1RT7B 1JJ4A 3DLHA 5ETQA 3WQPA 3TZWA 4LRAA 2LXFA 4C0BA 1NJYA 1IBKF 2GV1A 1OSCA 1FTCA 3M8RA 3ZTCB 2E31B 3JSBA 4OJ3A 2RRAA 1KD1T 1EETA 3I96A 1PJ5A 1VQLS 3MM8A 3HVEA 3D3BJ 1L3KA 1TR0A 4C98A 2LEBA 3M8PA 3AOAA 2KM8C 1LXJA 2ZD1A 2FNJC 2XLJA 3ILJA 2ZWOA 3SIPB 5DDQC 3PIPQ 3TA0A 2YWGA 4PRFA 5KG0A 1TL7B 3T1YJ 2JX2A 1U7LA 5IC4B 3POTA 3TQEA 3IR7B 2H65B 3D6TB 2EFPA 3GJSB 3W2WB 4NLGA 4DPTA 1WF0A 2RILA 5HK4A 4DV2J 2KM8B 4JI3J 4KBIA 1H74A 2E7VA 3GG0A 2NXJA 3EM1A 1SC4B 2OGUA 4UZBA 3CD7A 1S4EA 2OMOA 2V8GA 4X4PA 2ZNZA 4O3RA 5ETPA 5HQLA 3KYLA 4YEAA 5HMYA 1T1DA 2YNGB 1VCTA 3QPIA 3HJFA 2UV8A 4QIEA 3QFHA 1MW7A 4DPWA 3E3XA 2KZMA 2JFKA 3KJFB 2FHJD 4HTJA 3RB4A 2V63A 2UXDF 2FJAB 4CNYA 1YWXA 3HHDA 2FHMA 2H3EB 1KQFB 4PWDA 1UTAA 1CEZA 1S1WB 2HLTA 1U1NA 2QZ8A 1RBLA 1SJ4P 4RWWA 3CCJS 4F67A 1CJTA 1CQNA 1CJKA 3DLBA 4AE5A 2RUGA 1CPZA 3LUTB 4O3QA 1KVJA 4K5SA 2NQPA 1RQ0A 1HNZJ 3NOGA 3P45B 1VGYA 2HZVA 2CQPA 3QO9A 2Z57B 3W8GA 4O0IA 4DQPA 2IDLA 4PEOA 1TKZA 1XMBA 2C3MA 4TU7A 1WDTA 1UKUA 4RU2A 3KG0A 3C6OA 5JH5B 1RBOB 3LTOA 4WFZA 3QT7A 4ATNA 5DJBA 4CO1A 2F4VJ 3N28A 4IG3B 1M1HA 1OPIA 1TAUA 3DRZA 3DOMA 1OSDA 3KMSA 2EEYA 4PXDA 1GAOA 3SZ2A 1FKOA 2B9XA 2E9RX 5KT7A 3HSJA 3UD3P 3QJJA 3CNQP 4DG1B 3D1QA 4YB7A 4EYIB 1W2IA 4UQTA 5CYMA 4UOHA 1WHVA 5D4OA 4J9LA 1SV5A 2CAJA 3GYXB 2EI5A 4N77A 3DLKA 2FVPA 3MD3A 3I0RB 1RT2B 2NYIA 5K14A 1NZ8A 1FK9B 2VICA 3BDEA 5GMDA 5D78A 3R5BA 1R43A 5CYQA 3UCZP 3QGIA 4J9QA 3GG1A 4DF4A 1N0UA 2DK2A 1C1CB 4ES3A 2DIUA 2IC3B 1UFWA 2R8GA 2QLBB 2J5AA 1RTHB 3EMTA 4JTAB 3TZZA 4LF7F 1UA0A 3AQPA 1X5PA 2LQ9A 1I94J 4I2QA 1S6UA 3M05A 1MLAA 2DGOA 1S99A 3H59A 4YDXA 1N32F 4DR1F 5EN1A 1GK8A 5DDOC 4CH1A 4HYKA 2P9EA 3KLIB 1F9HA 3M8QB 3AAWB 3J81j 3I4PA 1RABB 3PFOA 1O0PA 2CWXA 3HHLC 3MR7A 4DV1J 3D66A 1X4DA 2CVEA 3GV8B 2YY3A 3V81B 3EJMA 4RW9A 3UN2A 2DISA 3RBXA 4MIBA 2PPIA 4WYLA 3OLAA 3HKZD 3ITHA 2OELA 5H7GA 4JI4J 2QV6A 1PSDA 3PJXA 1VLOA 5HATA 3HHLB 4DZDA 5B09A 1XJWB 2ZH7A 3IAM9 4KGKA 2WVCA 1M5HA 1VBZA 2JOQA 3OTDA 3THPA 3D67A 2RKIA 4ILRA 2CZVC 5KT3A 4WP3A 4DU7A 3PW7A 1KKHA 3DGPA 2P2CB 2GVZB 1M1KT 4JI6F 2QLJB 4A8FA 4TQRA 3R7BB 2J6SA 1VCBB 2GGPB 4K0KJ 1FS1B 3MZIA 2YNFB 2FHKA 2G1HA 3NRBA 1MU2A 1ZS6A 5HAOA 3NL0A 4R8UA 1YGYA 1UAWA 4CWBA 3EPGA 4RWXA 4U6PA 3BSNA 4IQMA 5ETKA 4O3SA 3DGVA 2JVOA 4KAIA 1XR6A 2V2ZA 3HMJG 4F02A 3BV8A 3HM9A 1D9DA 3UQSA 3L95X 3OHAA 2CYYA 2VG5A 1NH7A 2MA9C 4BLGA 5G4DA 4NZ0A 4ZGCA 4NYOA 4USVA 1T3OA 2OKQA 1R0CB 2MQNA 2R7WA 5KFKA 1VQYA 2LECA 2BQ3A 1DQ8A 2A18A 1IXKA 2E5IA 3L7UA 5F3TA 5A6RA 1OQ3A 2JEFA 3EE3A 2VA2A 4HKQA 5DADA 1E6VB 2E32B 2UXCJ 2YY9A 4F4XA 3AOBA 4Q5VA 1S12A 1S0MA 2C28A 4ZK7M 2HFVA 2B3TB 3SDEB 1NHUA 3M5BA 3PX4A 2WTFA 3FBBA 3H5YA 2ZBQA 3J7A1 1QAJA 4BWMA 2BANA 2PC6A 2ZM6J 5D77A 1RE1B 1WUUA 3EGWB 5IFMA 2YXLA 4I6AA 3UWTA 2DNQA 4DL6A 2UUWA 3C14B 1DY3A 2PT0A 1KFDA 2X51A 2HS4A 2VBWA 1FXDA 3G86A 4OJGA 3OFEA 1WWHA 5F0WA 3A8JA 1DZ5A 4W9HB 1VQ5S 3MAAA 1JB0C 2G9OA 2M52A 1XNQJ 4QIFA 1A6LA 2HLUA 3C15B 2EC0A 2FJBB 5KOWA 2W4CA 4DR7F 4FF4A 3CEDA 2J0QD 4OX9F 1QY7A 2HSEB 2Y0SD 2HHPA 4L76A 4EUVA 3M9MB 5KFNA 2H5JB 5KT5A 4DPOA 2J0SD 2QRRA 3GP9A 2WB4A 2ZNYA 4DL3A 2AD9A 2WCXA 4B3OA 3K8WA 4DUYJ 3J80U 3AJ2A 1TFYA 2HBQB 1FERA 1TVRB 2ZOFA 1RT5A 4DLEA 2ZH9A 1J27A 3EZUA 3NBPA 2NN2A 1PIEA 1WHWA 1U1OA 4OLPA 3TI0A 3PRBA 3M9OB 5KTQA 2C3PA 2PIIA 1UFLA 4UOCA 1HNWF 2KT5A 2D3OR 2JFDA 1BQNB 1GXTA 1WC1A 4IFVB 1VRUB 3U02A 5KFBA 4UOFA 1R28A 3AB4B 1S6PA 1SJRA 3KMQA 2I6WA 1X7VA 1B7YB 2F4FA 3LWMA 2DH9A 2HQ3A 5CYJA 4U2MA 4IFYB 5IM0A 1OMSA 3GIMA 4LF6F 3MMAA 1NCLA 3C6UA 3C8YA 1UWAA 4O23A 3EZ5A 4ZPTR 5KFWA 3DRRA 2J8SA 5MAOA 5LXRA 3G82B 2RB7A 3W3SA 5KFZA 4GC6A 2XMVA 1DLOB 4LMZA 5FIIA 4BS2A 2F3JA 1YG0A 3C6TA 1J5EF 2JC1A 4Q43A 3H4DA 1S1TB 3CCES 3M8WA 1WEXA 1UPMB 1Q8LA 1RU1A 2ZFHA 4QJVA 3CVKA 4FXVA 3US5A 3V4IA 3R97A 4USMA 5IBKA 4J5OA 3KG1A 5DDRC 1V5VA 1IJFB 2RT3A 1Y5LB 1GMWD 2BEFA 1WHXA 3J81Y 3O5TB 4ANCA 3MD1A 2GFFA 1ULRA 3ZUNB 4ZPBA 4F4AA 3W63A 1V3RA 3CJ5A 2YX7A 3R27A 3VCDA 5F8NA 1YSJA 3FDSA 4DR5J 4ZCIA 1OY6A 2VHGA 2VONA 2VB6A 2JL9A 5DZ7A 4KV8B 4RBUA 4Z7CA 1GT8A 4WKRA 3RB6A 3M8VA 3ZZYA 1LWCB 1R6YA 3GE9A 1X31C 3RW6A 4ZP9A 3NMRA 1H73A 1DSXA 2HKEA 2VPKA 4X64J 4J90A 2WVDA 1NU4A 4R0JA 4ZDNA 2C2OB 1PC5A 1EX8A 2QFIA 3MOZA 2K3IA 2OPRB 3U1MA 4CLPA 2DHXA 2XGQA 4QW8A 5T7LA 5CZVA 3MEGA 4TU8A 2RRNA 2MKSA 1LKZA 4HVZA 2RNEA 1T3NA 4ELUA 4ZLPA 2IJRA 1ZZFA 3GJTB 4JV5F 2V8PA 5KFLA 4NCAA 4WU3A 2VQEF 2GIRA 4O4GA 1YK9A 2B5JA 3QBCA 1HA1A 3LOUA 1U6ZA 4U8VA 4TKTA 2DNMA 3EYZA 3MURP 5I3UB 3R2CJ 5LM7E 1IKVA 2XBPA 3B78A 5GADU 3NY0A 3CO9A 1WC6A 1X4FA 5D4LA 4JI7F 1BMQB 5A8WB 2V50A 4KHRA 3OL9A 5BO4C 4W9JB 2Z8QA 2WVFA 1UZDA 1JWWA 1KDNA 2F8EX 1KN6A 5SUHA 3RRGA 1SL2A 1X5OA 2EW9A 3B6BA 4RNNA 3FEXB 2KHCA 1IKWB 1N34J 1P8GA 4DF8A 4MAKA 4ZIWA 2DH8A 1C1BA 4LREA 4Y2IA 1UL3A 4FVCA 3MMCA 5KG1A 1ZM9A 2E1MC 1BD6A 2W2QP 1PAUB 1FA0A 2XSJA 3P5BP 2XEXA 3IBCB 1N8RT 1YJ7A 1RAHB 3HVWA 3NNAA 2DVIA 1H2TZ 3K5OA 1RLDA 3TZYA 2M70A 4USUA 1VRTB 2OO4A 4DV6J 2CXEA 3OPKA 2FVQA 1VISA 3HPOA 1VR6A 4B3MF 1RHKB 1BUOA 3P3DA 2JLFA 3KLHB 1JQGA 4NLXA 1RA6A 1K8AT 3DLJA 4OZ1A 1SI9A 2XB2D 4DV3J 5HMWA 1F2GA 4CLUA 1H2VZ 4UT4A 2VQFJ 2AV5A 2RVJA 1F6TA 4FDFA 4W9LB 2GO8A 4DV4F 1J5OA 3ISNC 1XERA 3AH6A 1QTMA 1TUVA 4ZOUA 2EFNA 2FVCA 4L75A 4IG0B 4NZ6A 1TUWA 3GB0A 1VMBA 5ETLA 1WSVA 1G6BA 2UVWA 2IJNA 3T1AA 4NYZA 3Q8UA 5J1PA 1NK0A 2WB1D 2AJFE 1N4LA 1IBKJ 1NLKL 4I2PA 3MPDA 5CABA 1QJHA 4G1PA 1HI0P 4CZCA 2OFHX 4P7VA 5HQ8A 3ETMA 2HWIA 5C2CA 3K7RA 1U0HA 2HHHF 2NCKL 5EX3A 1WKKA 4MTPA 1F1BB 3FEZA 1GX5A 2DHHA 2U2FA 3MM6A 3HTMA 2XGPA 3BN4A 4O3OA 2XI3A 4X4TA 2HQDA 1Q16B 5HQMA 3JQMA 2BRKA 1IKYA 1D8ZA 1S4FA 5LSLA 1VK8A 2C1EB 2OUGA 2ZWPA 3Q23A 4JP8A 3MFIA 3QIPA 4KRWA 4ZN1A 3PHEA 1C4CA 2V9KA 2F63A 2EK1A 3IO1A 3ZTRA 1GXUA 3ELHA 1NHVA 1KLNA 4MK8A 2XMMA 4NLQA 3W2VB 1T8EA 1NK7A 2I5JA 2WW4A 3G6VA 3I55S 3VZIA 5HN0A 2MQLA 4MH8A 4PUOB 1L3SA 3MAHA 2W2MP 1HBNB 1C0UA 2H1YA 1RWMB 2MB0B 4DFJA 2IRYA 1G1XA 1YJUA 3BQ2A 5A8KB 2HNDB 2RJZA 3MPVA 5H9FJ 4CT9A 1RK8A 3EVWA 2YWEA 2CWKA 3LW5C 4OZ5A 1R6VA 1BGXT 1BE4A 2G2YA 2FYXA 5J2PA 4ILMA 2UXDJ 2HBYB 4X4NA 5AE1A 1IWAA 1RA7A 1U8SA 4M5MA 1F3VA 4O3PA 3HZGA 2ZEJA 4WYWA 2AEJA 1XMQF 2ATCB 4A8OA 3LBZA 2YH0A 1HNXF 2MTLA 2R9RB 5KFGA 1ICEB 1YRUA 2DRBA 3HSDA 3DRPB 3CPWR 1RTIA 4FS2A 5DLGA 2ZJQQ 2GA7A 1QE1B 1UW4A 2CDRB 1EODA 2MKKA 4N41A 3M52A 4LRCA 2P1NA 2ZKUA 1RACB 3WC2A 3VGVA 4W92B 1WC3A 3VF0B 3UVJA 1B7FA 1YIJS 3O2IA 3OUYB 2V68A 5DETA 2AJ0A 5L8RC 3JSYA 3LGHA 4GKJF 4M5KA 5KFIA 4JYAJ 1VIOA 1WEZA 3TVKA 3C46A 4RU9A 2QSWA 2MLZA 3OW2R 4KC5A 4KGMA 3QAEA 2ZC4A 1TELA 2W9AA 3OFFA 3V2UC 2OPPA 1R0BG 4BC7A 3FC9A 2K7JA 3MMBB 3RB3A 1SUQB 4DWIA 2KKHA 2HWTA 1Q4RA 2MKHA 4GO7X 3K5NA 3UNYA 2XC9A 4X66F 1IR2A 1SB6A 2OEKA 1TKTA 2BJ9A 3ONQA 3I5BA 4OHXA 1YDLA 4N8OA 4DQRA 3PM9A 3Q8YA 2YNIA 4IRKA 4MKAA 4O44B 3VTIA 3EDRB 5AXLA 1FVQA 1AUDA 4DSLA 2R7VA 3I9V9 2L48A 2FUG9 2RAQA 1C0TA 3MPUB 2DPIA 2QX0A 3E01A 4LF8F 2DR8A 4RW6B 5H9EJ 1FEHA 2YNHB 4LF7J 4K5RA 1H38A 3LPYA 2QL5B 2GW8A 4Y2MA 2CQDA 2W8LA 4ICLA 4K8RA 4CTAB 3HF5A 4KGXB 2K8GA 1N32J 4DR1J 1ZTWA 3H2UB 4ZN3A 1Y3KA 4KT0C 2UUAF 1KLMB 2K1RB 3M2UB 5DG8A 3HCXA 4YQWA 2W4DA 2EFOA 1VQ4S 4EMDA 2BX6A 2JRSA 1VYAA 3LPEA 5LT5A 4Y6IA 2A3JA 2D74B 2DTJA 1QDUB 4DPYA 3JYTA 4WE1A 3FRZA 2ROEA 2UVRA 5KG7A 3K57A 1EETB 4C7QA 2AEFA 3BQ1A 2YPZA 3MM8B 3HVEB 1WF2A 4F50A 2CVIA 3M8PB 3Q0AA 1KOHA 2EFVA 3PYFA 2ZD1B 2VKRA 3DLLQ 2Q6CA 5KFPA 2RD5C 1NKBA 4Z7YA 4JI6J 3TX8A 2ZZNA 4ECXA 2EG1A 2Z2MA 1B0PA 2QA4G 3POTB 3RR7A 2YX4A 3KK1A 4U96A 1FEEA 1NM2A 4L72B 1FRJA 3ILIA 2UV8G 2ASTA 1P9QC 3WIUA 4USIA 3BBFA 2FJVA 3PG9A 2DGQA 3M8SA 4QQBA 4QYZK 3GSDA 3M2VA 3KXDA 2EG2A 2IBOA 1NBEB 2CPJA 2GMLA 4FNHA 1MN7A 3ZZZA 1T11A 3KKFA 4WZQA 3DRYA 1IWGA 1VC0A 2V4QA 3HP6A 2Q81A 2F7VA 2AIRB 3HKWA 2G0JA 4A8KA 3P6YC 3OJUA 1TZ0A 5LMUF 1GMUA 4OI3A 1RWPB 2MMYA 3OD2A 4N5SA 1LW0A 3KJQB 4PPDA 3VGSA 3LNMB 3HFVA 4NLRA 2GJ2A 3ZZOA 4Q0BA 3SYZA 4PWDB 4OYWA 4OJHA 3AODA 4J9UE 2GVDA 4DCJB 2MEWA 2LKZA 3KG4A 5F8IA 1CJTB 1CJKB 4KQZA 4C0OC 5H7HA 3W8PA 2DXFA 2M2BA 5HJXA 4DUTA 1WD6A 5FD1A 1RXOB 3TEHB 2WBMA 3H5UA 3I82A 1P1LA 5B08A 1IR0A 3R6GB 1RTJA 3OTOJ 4WP9A 1F9FA 4Y28C 5BYSA 1UETA 3QO9B 3OR1A 3PJ9A 4HXIA 3KTQA 1TKZB 4MYUA 4ENOA 2R7SA 3W7BA 2DGUA 2IVYA 3TNVA 4URSA 4BBYA 1IVZA 3DOMB 2HBZB 4L73A 5DZ6A 1FDNA 4ZCKA 3F41A 3H20A 4JV0A 4DR7J 4B9UA 1FKOB 1X9WA 2L9WA 4L74A 3Q8RB 4OX9J 3MMJA 2EBEA 9RUBA 2PGCA 2V9WA 1IM6A 7AT1B 2DR9A 4WTYA 1K1QA 2UUTA 5A2QU 3CD5A 2YBVA 2FC8A 4EZ9A 1N36F 5CYMB 3GFXA 1H72C 1SV5B 5KFQA 2QMUB 3DLKB 5CCLA 3QAUA 4IUFA 1IQTA 5EGYA 1VK3A 2CIMA 3KK2A 3W65A 2ZC3A 1AFJA 5K14B 1XNRJ 1M5VC 4B9VA 2L41A 5FLXY 4NLDA 2K7KA 1FE4A 5CYQB 1RP5A 4LR9A 5HI7A 1LWEA 5GMEA 2C2MB 3SCKE 4AT1B 4DV5F 3GV7B 3I0SA 4USJC 5CHCB 5CA5A 2CG8A 4UY8T 2OTJS 5DO2A 3FCHA 1QAXA 4NXNF 3UE2A 3DMJA 3OTEA 3SFUA 4I2QB 4LF6J 4OI2A 3LGNA 1P1TA 1U49A 2JVRA 2Y9HA 3BZQA 3HHNB 3KUEA 1GQEA 3FMWA 2FDNA 3VVTA 5KFMA 3HHEA 3IRXA 1SQGA 1R31A 4R0EA 2ROPA 1MROA 1LW2A 3T5LA 1J5EJ 3MCMA 1H7XA 3OL6A 3N4WA 3KHRA 3G87A 4RUHA 4RW9B 1QUVA 4DL0C 3B8HA 2GQQA 3UCGA 3QLHA 4U77A 2OVRA 1WDDA 4IR9A 1W7WA 3K5MA 3ITHB 4KGZB 2ADCA 4MIWA 2LQ8A 1WELA 3HVRA 3JTNA 3A1YG 3HD2A 1SH0A 2RKIB 2CJBA 1HBMA 4AJYC 2V69A 3QFWA 1OS5A 1JX4A 3DGPB 1FO1A 4I4BA 1ZTTA 3R1LA 3RRHA 2R4FA 3QRRA 1MU2B 4DXLA 2YPYA 4R8UB 1HL6A 4F4WA 4MKBA 5KFEA 4GKKF 3IR5B 1CC8A 4DR2J 4PCQA 5F8LA 3SMZA 1X0FA 2AWZA 3OVSA 4ZVOB 4NWBA 4Y0FA 4WXOA 4KHPF 3CMQA 2E9TA 4M63A 3J81U 2ZOGA 2VG5B 4OX7A 5L1KA 1LM8C 4HHUA 8RUCA 2ZVIA 4JV5J 2CPDA 1HQ2A 2DJWA 1KNZA 1SKRA 4QW9A 2F8MA 2CQ2A 4RW4A 3ZKJB 4URGA 2H5IB 2B4OA 1MMNA 4U7UD 5HL7Q 2WRMA 1SPBP 3HO1A 4ZVQB 1L3VA 2XTJP 1YRXA 3EGZA 4JI5J 4JI7J 2YQ3A 3MAQA 2LFVA 1NSAA 4RNFA 3PFEA 2VASA 3DDKA 2CNNB 2CPIA 1JJCB 2M4MA 2XQCA 2BANB 2MJNA 1NK6A 5GAEU 3H42A 4RKUC 5GAGI 2VD3A 4G1QA 4HL9A 2E5JA 1XR7A 4JUZA 5H1SV 3OL8A 2DGXA 2OEMA 4C0HA 4V19J 2V2VA 1YBAA 1S79A 3CJSA 3I4HX 1OYEA 1XBWA 1X5TA 2AYEA 3MEDA 4CO2A 3MAAB 4WIIA 4KYZA 2IA6A 1JXVA 1X4EA 3ZZRA 2UZAA 5B0GA 3MEKA 1X0PA 4XPCA 1MG7A 1H3DA 4HACA 4ETXA 2RS2A 4F04B 4B3MJ 2XY7A 3FQKA 3BGUA 4OHWA 2R8HA 3GR1A 1RKJA 1RISA 3IRWP 5C2GA 2N3LA 3UO0A 4B3OB 3NXZA 5KAKA 4DSJA 2Z2LA 1T02A 3M6XA 2N3OA 4P2XA 2CPXA 4JI4F 3TANA 1RT5B 3FCWA 4NI2A 2EFQA 3O44A 3TAMA 2YTCA 3MM9A 4DV4J 5FTAA 5JJBA 4KKOA 3NBPB 2OFGX 1SXLA 2LYVA 4H54A 2V8HA 1V3SA 4E0DA 1XQIA 4C11A 1UEVA 3V6DA 2F65A 2KXHA 1S6PB 3PR5B 3NNHA 2BJ3A 2HRYA 4FYXB 2J76E 1X4AA 1YBUA 4QPXA 1JLBA 4BCAA 2DH7A 3KLEA 2DO0A 1DBDA 5IM0B 2F40A 3PV8A 3MMAB 3D6HB 3C6UB 2IRXA 1L5UA 3GIJA 4CLKA 4YS2A 1LK7A 4C97A 2P9CA 3I6PA 1PGZA 3DRRB 2VFTA 2AZ1A 2JZ3C 3TEGA 5KFTA 2MZJA 4X2BA 3FSIA 3KJNB 3D0IE 3W9HA 4UQGA 1YJTA 2LU2A 2KU7A 4XPEA 3VGTA 1S77D 3MEEA 4ZLNA 3QRQA 3C6TB 4PQUA 3H7HB 2J9CA 3SQGA 4B3RJ 1HI8A 4JOUA 3R9LA 4PXEA 3WDOA 1AA1B 3FJ2A 1ZYQA 3D0GE 3V4IB 1NK4A 4ED5A 1WNEA 3RTVA 3J7ZT 3MCNA 2OAUA 3FFIA 3CJ0A 4HEA9 3CC7S 3E51A 1G3OA 3BPDA 1KSPA 5IXUA 3GLJA 2JZ5A 4NMLA 1KQKA 3MR6A 2DHGA 4NCGA 2OP5A 3VZHA 2FHJA 3MCSA 2O3DA 4QIGA 3VGUA 4J37A 5C7PA 3Q8QB 4M5IA 3DDIA 3VVUA 4OX8A 2CJKA 1KVKA 2DNGA 2IHCA 3BREA 4ZLLA 5I3QA 1RADB 5BR8F 1VS3A 1DTQA 3PW4A 2HVZA 3KLFA 2R8JA 1NH8A 4HLBA 2LLZA 3CMAS 4I68A 5ETMA 4M5GA 2XMWA 2P5VA 2FIUA 4DZ6A 3FCVA 2COLA 3D3CJ 3FMBA 2HQCA 1XMQJ 3OHUA 3CJKA 2DXEA 2OD6A 3NGKA 5T7LB 1WF1A 3FBEA 5D6GA 3MEGB 1URNA 2QLWA 3CDWA 1SQFA 3I9ZA 5E2QA 1NAQA 2E7WA 2MJUA 4TNOA 2A2DA 3VHQA 5CAAA 1S72S 3I87A 2R2UA 5IQQA 4DQSA 1IM4A 4O4GB 1YVFA 2HPUA 3LALA 3TJ9A 2B5JB 4QU6A 1PC4A 3OL7A 5DM6Q 3PTWA 2LVWA 2M5YA 4MFBA 4YOEA 2IY5B 3QYYA 2LA6A 3NGSA 2XS5A 2J9EA 1IKVB 3HVAA 2K2PA 3DCAA 4P73A 2R7QA 3VQSA 4RNOA 3S7RA 3OVBA 1VHFA 3Q86A 3L4BC 5A76A 1VBKA 3A4TA 4C8YA 2CG4A 4H4MA 5F41A 1U6BA 4G6VB 1S9GA 2W7AA 4DL2A 4W9HH 2PFDA 3MDFA 2CPHA 2RDIA 3Q8VA 4DHVA 2Q43A 2MSSA 4E2FB 1C1BB 3BDPA 1O8BA 3OBIA 5HVFA 5L1JA 2MKYA 3MMCB 3PY8A 4X66J 3TVZA 3OLBA 2V2QA 3MPYA 4LVNP 2XSJB 3JQKA 2R7TA 5HANA 3IS9A 4KTQA 1RHJB 4EGLA 1JK9B 2L3MA 2NR0A 1AB8A 1SH2A 3DOKA 3RBEA 3AJ1A 1KONA 4PG6A 3G8QA 2RDDA 5K8MA 5JUMA 1S5ZA 4MIAA 2DR6A 2WZ1A 2ALZA 1DARA 2VPZB 2B9YA 2IDEA 3AJDA 2HS3A 5LJ5Y 2GJFA 2ZJPQ 1H2UX 2KB2A 5EUPA 4LF8J 4TXSA 2ILZA 3BS9A 4B9KB 1F5CA 1PILA 5BXHA 2I1RA 3L7OA 3R6LB 2KJWA 2DKOB 4J9KA 2W2PP 4UF4A 5JVHQ 2UUCF 4X4QA 5DM7Q 1ZPWX 4EK2A 1SH3A 4OZ3A 1J5OB 2E5GA 2UUAJ 1VQMS 1K9MT 2C9WC 3CD6S 1MWQA 4DEZA 4EFAC 1NZAA 2MDAA 3IGVA 2R2SA 1VQ9S 1UP1A 2QG9B 2WSEC 3MM5A 2PMZD 3FNNA 3NAHA 2HRUA 3DOLA 5E0OA 4I2PB 3H25A 1U47A 1NSKL 2LEAA 5C24A 5CD4H 3DRXA 5AE2A 4K2XA 1S1UA 5K8PA 1U0HB 3M1VA 8AT1B 1NPPA 2J0WA 3W1YC 4ED2A 3VWSA 4RBVA 4FYVB 1I1GA 3GPAA 3MM6B 1RHUB 3V6KA 1IKXA 3HJVA 3GZ7A 2Z2ZA 3SSSA 1FWKA 3TX0A 1RLCL 1IKYB 4CXTA 7FD1A 5G0RA 1S6OA 1RHQB 2GHPA 4USHA 3IAS9 2NREA 4Y2KA 4WP8A 2XS2A 2GHVC 3QIPB 3AOCA 2IM2A 3AT1B 2F9DA 3RGIA 1ZZNA 3VAMA 2ZHAA 2DCLA 4K7QA 3WBZA 1FS2B 3BPSP 2D9PA 2HS0A 1YLXA 2VZ9A 1WKJA 2X7IA 2HG4A 4ZPDA 1KEKA 5D0EA 3QMQA 2KI2A 2I5JB 1R3NA 4AYBD 2C3OA 4PG5A 3H2LA 1C0UB 2CQGA 4WFNQ 2FVSA 5L9NA 1U0SA 2JEGA 1IQZA 3B54A 5LMUJ 1KC8T 4BKSB 2Z30B 5E3QA 3PRVA 4I6YA 2W9CA 2WONA 2FLOA 2E1RA 2EK6A 2NPIA 5T14A 1PO6A 1WOOA 5J2PB 1HHQA 1YZ7A 4LBIA 1Z1ZA 3SQOP 2EKNA 5M2RA 4P2SA 3HU6A 1RTDA 2LU1A 3FUYA 4DV7F 1FNXH 4DI6A 4ZCMA 4KB7A 4P2MA 4ZMMA 1EOFA 4PABA 2FJDB 2FLLA 1S9EA 3B82A 1RTIB 4C8OA 1KTQA 3P8BB 1RAGB 5L39A 2AJ2A 2R8KA 4UUWA 3GTYX 4YP3A 3D6MB 4ZCLA 1RWOB 3UVJB 3HD1A 1APSA 4FF2A 2KO1A 4NLVA 1S7IA 2VC1A 2M0GB 3QSYB 2QLXA 2W25A 2VDIA 1H0HB 3NWGA 3BQ0A 1DTTA 1GMVA 2VQFF 4OV1A 4EO8A 1UPPA 2LA4A 5ETTA 2E5LF 2CA9A 2RQ4A 1XIQA 3PO5A 3D1HA 4LUBA 4DV0F 2OPPB 1UJ5A 1X4BA 2VKZG 1FT8A 2Y8YA 4ECQA 1REVA 2LXUA 1VQPS 4HI2A 4P9SA 2F8HA 3QGHA 1N36J 3DI6A 2ERRA 2VU5A 3VALA 2Y1IA 1ZM3A 1NJXA 3ULHA 3QWPA 4LFCF 1TKTB 2E7XA 4JI1F 4BC9A 1R8BA 1FDBA 4CXIA 1S1XA 1ZOTA 4F8RA 1WG5A 3M30A 3K58A 1Q8KA 2X3GA 1AFIA 2YNIB 2MHEA 4I7FA 4YDDB 2Z8HA 4RLEA 2D9OA 4TY8A 1PG5B 2O66A 4DV5J 2RSQA 1HD1A 4FN5A 3JAMU 4XDDA 1T9YA 4LF5J 1C0TB 2YWHA 2BXJA 2QL7B 3E01B 1DJ0A 1HWJA 3BSCA 2HFZA 3KNGA 4NXNJ 3KK3A 4X4SA 3KLVA 4CM2A 1FJCA 3QJPA 3RAMA 2UU9F 4TY9A 1JLQA 4CQ1A 2N82B 3PW2A 2B51A 3OXFA 4ICLB 1FFGB 2Y0BB 4USTA 2Z2YB 2XO6A 4I1TA 4ZOSA 2ZH3A 2OPQA 3EPIA 4C4WA 1U4BA 4TN2A 5FDLB 1Q81T 1FQVB 5DDPC 3U1NA 5FLXU 1FKPA 1B0VA 4IRDA 3R5DA 5KFVA 2HGNA 3CWJA 1XEZA 3JB9k 4R25A 3A13A 4KHMA 1BWEA 4M1KA 2ASDA 4MKVA 2HFSA 4CP5A 2JLGA 1V3ZA 3MI7X 3GYNA 4ELTA 4OYOA 3W61A 1CLFA 4WTOB 4NPOA 2HQFA 1VI7A 3JYTB 4WE1B 4DL4A 2MSTA 3BN7A 2D7SA 3NEKA 2V4RA 4EOZA 2AZ3A 3F56A 1D9FA 3ZC4A 2QC3A 3TA1A 2MY8A 3UW1A 3MF5A 4UZCA 1S1GA 2IMOA 2W2OP 5BYQA 5E3AA 4W9KB 1TL1A 3LWLA 3X1LB 5E3CA 4N76A 2I9SA 3PKMA 3VR1A 2QFJA 1U02A 3OGLA 3KK1B 4F4ZA 1RWKB 1SC3B 5HMZA 3JQJA 3SV4A 3A12A 1F3FA 4K4SA 4GKKJ 1R8PA 1Q7YT 2B4UA 2FPHX 2E44A 3EXYA 1UEUA 3SBMA 5AJ3J 1IBLJ 3M2VB 4KHPJ 2AX0A 2Y8WA 2NLWA 5HVHA 4JYAF 2GZOA 1EIYB 5HBMA 2G2OA 4KE5A 1QVFR 3GIRA 2O01C 4DOZA 3PX0A 2H51B 2G4BA 2MGZA 2D41A 1N88A 1X4GA 1T0TV 1CJUA 1LW0B 2FC9A 1NEXA 2XS7A 2V94A 2CPYA 2NUUG 5J1NA 2OH2A 1BHNA 4IR1A 5KFHA 1U1QA 4Q0BB 2R7UA 1P27B 2YKOA 3UD4P 2GVDB 2XMUA 3N5FA 2HHQA 3CTRA 1FRIA 1JLAA 3WIVA 1B4SA 5L46A 4JTDB 2RH3A 3ZTPA 1M5OC 1NN7A 1RCOB 1R8HA 1S7HA 2ZBPA 3GQCA 2U1AA 3DNCA 2NXCA 4JBCA 4IDKA 3KDNA 4CH0S 3CSKA 3RG6A 3OXGA 1EB0A 1RTJB 3OR1B 2QA2A 4YR3A 4EYHB 1KQGB 3IWLA 1J2VA 2OPSA 3CULA 2HVIA 1YJNS 2RQKA 4PYDA 1U45A 3DHWC 3FSXA 2QE5A 2BV3A 4AD6A 4A8YA 1U24A 1CC7A 1NPRA 4PKDB 1QSSA 1HYSA 2ATLA 3TUPA 3HSGA 1OWXA 1URRA 4O3NA 2ASSA 5D0RA 5I4MA 4OFZA 1YJ9S 4DR6F 2BOAA 2VG7A 5D4PA 2FY1A 1TUGB 4AP2A 1Y9OA 2Q1LA 3VAFA 2M7SA 4B9TA 2MXYA 2GMJA 4ED8A 2DRDA 1KS2A 1HI1A 3KK2B 1QUPA 1UVJA 1OYDA 1NKCA 3DHXA 1B99A 3ZTDB 5F0UA 2VFVA 2SXLA 2IBKA 1LWEB 3V7DA 5KT4A 1CG2A 3MCOA 2CPZA 3F44A 2XHWA 2C3UA 4E98A 4DL7A 1JLEA 3I0SB 2B8QA 4DX5A 4M5HA 2OSRA 2OIHA 1G2EA 1RWUA 2KZZA 2BW2A 4KY3A 1UA1A 4R5PA 5KG6A 2BQUA 1LV5A 3DMJB 2ILYA 2FD2A 2X1GA 4HTIA 4ZVPB 1F5AA 3CB4A 3D28A 1CJVA 1RU2A 4WFBQ 4GMKA 5AE3A 1AROP 2F5GA 3MTJA 2DITA 3H5SA 4F3MA 2P9GA 3UDVA 4NX9A 4FPRA 2IHR1 1HMVA 3IRXB 2B6AA 2FJWA 2YKAA 4Q8FA 5E7OB 2FB0A 1MROB 1LW2B 3ISZA 3UCUP 3FBFA 3OFGA 1TL5A 1K0TA 3MECA 3IN5A 4BDPA 4G3IA 1GX6A 3QLHB 4WKYA 4Y3CA 4DR3F 4F4KA 2PFFB 2HGMA 2RHQB 3TUJC 4LFAF 4ZA1A 4XDCA 1NK8A 5IT9Y 3M9NB 2Y1LB 1SKUB 2FTRA 3OT9A 3NKYA 3C6PA 3ZZPA 4DX7A 2K3KA 1NSQA 2CZ4A 3NLCA 1SVDA 5IC6B 1U6FA 1HBMB 2MQMA 5KFSA 1LQBB 4UYIA 4W9EB 3I56S 1DURA 3ZTSA 1XC9A 4LSLA 5KFUA 3DCGB 5BR8J 1FNMA 2MZTA 4G65A 5A2QY 5BXDA 1KP6A 2HVEA 1T95A 2CQHA 3IR6B 3OTOF 2ZBCA 2BW7A 1Y7PA 1HHSA 3KHLA 4I0WA 2WSCC 1T03A 5F8HA 4GRSA 2R7OA 2BA9A 4EBDA 4IRCA 3EVOA 3D5MA 5ITHA 4QIVA 2GMHA 2XY6A 2A6OA 2BE2A 3CW2C 4DL5A 3KJVA 1RT6A 1ZA2B 1HR0F 5LOQA 2IYIA 4A4JA 2FQQB 2HBRB 3GV5B 2V34A 4ZVSB 3E2EA 3CF5Q 5THWA 2ZH5A 3L2OA 2V6AA 1M5SA 3CMES 4NRUA 4C8KA 1RWXB 5F9LA 1TMJA 3ZRCB 3BYRA 4AQYF 1U8WA 2JJ4D 2BE7D 2HAFA 1EHWA 5J2QA 3N6NA 4XK8C 4RW4B 2MQOA 4RW7A 1HBOA 1VRTA 2W7PA 2AEMA 3NMAA 4OYZA 1N5YA 3FSYA 2VPYB 2YVSA 3DKDA 4PPZA 3D7SB 3TYTA 1TKXA 1RAEB 1XNRF 4WFYA 2XLKA 1X4HA 2AGOA 3CDEA 1RKIA 1A0OB 1FXLA 4APFA 3LO3A 5KFFA 4QU7A 3WX8A 3Q8SB 2UVUA 1FD8A 3CE8A 4YN3B 4G1QB 4X62F 3SV3A 1YRTA 5J2NA 3N5BA 2NPFA 2AYMA 5HLFA 2IMWP 4OIXA 2G1DA 2XHCA 5HP1A 1KOOA 4E8UA 1RT1A 1TAQA 1LFPA 3B4DA 3ZTQA 2VOPA 3TP2A 1GFWB 3BKUA 3TOQA 3HHLD 2J6UA 4U8YA 1HBUA 3MEDB 2OHDA 2XULA 3THTA 2QTWA 3PIOQ 4CT8A 3NS5A 4ZPWR 2DHSA 3H0PA 2A6MA 3LH2S 1BQXA 4HACB 2I0XA 2H54B 2MKCA 4B08A 1V6HA 4CO3A 4YB6A 2MZRA 4RBTA 1NK9A 1Y3JA 3NS6A 5DQHA 3S01A 2AMCB 5D8HB 1F60B 3NGUA 2H5EA 1S6QA 2X1BA 4FBTA 4PWWA 2UUCJ 4DCOB 4NI2B 3MM9B 4OJ1A 3IA0A 2PDAA 4KKOB 3T6JA 3AQOA 1KHVA 2AGQA 1VRQC 4UW2A 1S59A 4WK1A 1RUSA 3M8YA 4HT7A 4C11B 2GAHC 3V6DB 4U67Q 1JLFA 4WZMA 1IN0A 4ZP7A 2LXIA 3M6UA 1AZSA 4C3MA 2AP6A 1SJ1A 1HNIA 1JLBB 3CCQS 2MY7A 2POKA 1EKRA 2AX1A 4C48A 3KLEB 1KTVA 1WC4A 4WBFA 1HWIA 1DQ9A 4NMXA 1ACMB 5IV4A 4UIJA 5F8JA 4DR2F 3ICLA 3SSQA 4FYWB 2IIHA 3BO2A 2B7BB 1V9OA 2HNYA 3BH6B 1R8CA 2FHOB 2ACMA 3DN9A 1XMOF 1RTZA 4LQ9A 3MEEB 2CKWA 2R8IA 5K20B 4PQUB 4KR0B 2JSXA 3SQGB 5KFDA 3KUGA 2CNKB 4ECWA 2DCUB 4QZVB 3B4MA 5EDWA 4HI1A 5LSRA 1BQMA 1JKHA 3J7YI 2ZE2A 3FFIB 5B0FA 4EO6A 1BY9A 3LA0A 1S0OA 4QYZJ 1B0TA 1O6XA 5AT1B 2DIVA 1AUSL 3GR0A 3W64A 3BIMA 4JI5F 3OTCA 4NCGB 1CULA 2VPXB 1WC0A 2RHSB 2DBBA 4BWJA 1FKAF 1U1RA 4ECYA 4S0MA 4QWAA 2YKPA 1FCAA 1Q1KA 4XO0A 3DXBA 4DFMA 4LBHA 1HV2A 4I67A 2K06A 5K9FA 1DTQB 1FHTA 1EZZB 2CJQA 4FYYB 2DGVA 2M3DA 4O0NA 4IOCQ 3TW0A 2LQJA 5CCMA 2KYZA 3KLFB 4OYXA 2R9LA 4NA1A 3CC4S 4OLOA 4WPAA 4DV7J 3GA1A 1YX2A 4F0HA 2VODA 3ENQA 2ZBRA 1A9NB 3CJKB 2PA8D 5CXTA 2KT3A 2V5HG 4ED4A 1M1GA 4P71A 2HGLA 2JEJA 4IQXA 3QZ7A 4A8MP 1Y10A 1CS4A 3JS9A 4ZVHA 3KWMA 1UW9A 3ZZTA 1PKUA 1X8DA 3RBZA 3GU0A 4MFBB 1QTNB 3T9ZA 1RSCA 4B9LA 4ZHRA 4TLRA 4USWA 2OTLS 2KYXA 2UP1A 3SI8A 3BKTA 2B7CB 4XAKA 4DR4F 2F9JA 1QDWA 2MQ8A 1DAXA 2DNHA 2HZAA 2IPOB 1HWLA 4Y2CA 2DHAA 3BM7A 3DLEA 3FK4A 4Q2MA 4DSFA 1Z2LA 4H4MB 2E5LJ 1S9GB 2KN4A 2A0FB 4OX6A 3UFCX 4DV0J 4OV6A 4CLLA 2LDIA 3CDBA 2XNQA 1VC6A 5E41A 3G8TA 4I69A 5GAHI 2BUNA 2CQCA 1N33F 3UDEA 2OSQA 3DDNA 5C42A 4ZITA 2P1PA 4LFCJ 3IWNC 2MPUA 4JI1J 3BBBA 3VAGA 5B0EA 3RBDA 2XI2A 3IS9B 4B9NA 4D3GA 3GCWP 1O51A 3DOKB 3PW5A 2ZZTA 5ETSA 2V2KA 4GC7A 4CO5A 2AYGA 4HR2A 3W62A 1F5BA 3M6VA 4EZ6A 3FQLA 2G0CA 5HROA 3UR3C 3DYAA 1RYRA 4H4OA 4NLTA 1GXLA 2FJEB 4ZJOA 3V4MA 4YMEA 2DNRA 2R7XA 5F8GA 4B3RF 1XTZA 3W9IA 2W2NP 4M5DA 3QIDA 1ZM2A 4UUXA 2V8VA 2UU9J 1LOUA 5KFYA 4FNIA 2IFXA 1SKWA 2A79B 1DHMA 2J9DE 2UUBJ 1BC6A 4QCLA 3EICA 2CZ9A 5DAFA 5A8RA 4X4UA 4ES2A 3ZNUA 2I38A 1JLGB 2IZVC 2BE9B 1JJHA 4NLUA 2PD1A 3BF4A 2HRTA 1RB0A 3MM5B 4CCHA 2KT2A 2JH3A 3DOLB 3JXOA 4F4YA 2DR7A 1PYSB 5L9XA 5C24B 1F9EB 3CDAA 2PE8A 4MK7A 1S1UB 1VHIA 2VA3A 3M1VB 4IYQA 3G6XA 4URQU 2GHWA 2M8HA 2OMLA 3P49B 1N54B 3ENWA 3SFGA 1KR4A 4WK3A 1PJ7A 2I8EA 2KFYA 1IKXB 3OGKA 1Q7LB 3DFEA 1SJ3P 2KVQE 2DYAA 1QM9A 4ED3A 3H8YA 1K0VA 4YY3F 4HDGA 5G0RB 3EWGA 4W9IB 4Q8EA 3ENVA 4X4VA 3BYPA 3ZZ0A 3KHHA 3LAMA 4X4RA 3QJLA 2QLFB 4IO1A 4DN9A 4LF9F 1JXEA 2WW8A 4NXMJ 3NNCA 4LF2A 2RQCA 1S0NA 4NYPA 3H4BA 4QOTA 1S1VA 4MJKA 4OHVA 4DQIA 4FPIA 3OR2A 2WOMA 2AT1B 5KFOA 5DQIA 8ATCB 1BWVA 2R42A 3J7AN 4QBUA 2MLXA 4TYAA 2W9BA 5C5JA 2E1PA 2RIJA 2GNKA 3AXMA 2IVMA 2XYPB 4N7TA 3TJ8A 1N6QA 4QWEA 2IRUA 1FDAA 3DLGA 3GILA 4JTCB 3R5GA 1RAFB 4PXCA 5B0BA 4Z37A 4LRDA 3W66A 1QAIA 3L09A 2KJVA 2HW3A 2IM1A 2W9CB 2HHSA 2WONB 2Q66A 2DR5A 4C8MA 1TK5A 2KXNB 2BRLA 5GAGU 3K2YA 3PNIA 3EXCX 1RTDB 3IG1A 1Q53A 4KFBA 4BHQA 1NMEB 2VC0A 3K59A 4FYDA 5J2MA 4P72A 1S9EB 2HEKA 1NSPA 2E66A 2ZHBA 4LIRA 1LFWA 3OSNA 3T5JA 4IKAA 1Q82T 1T9WA 3JSRA 4NRTA 4F36A 3ISND 3N01A 5A0YA 4B3SJ 3CO0P 2HIYA 3M6WA 3L3CA 1D8YA 3PX6A 4YY8A 1DTTB 3CCUS 2Y1JA 1SKSA 2MKJA 3AD7C 3BB5A 2FVRA 2ZOMA 4PQAA 4NL5A 4CRJA 1U2FA 1TV6A 1REVB 1RAOA 3H5XA 2A10A 4DR6J 2CPFA 2Q6BA 3DI6B 4FZVA 5HMXA 4ED7A 3OHBA 1OQ6A 2DB1A 4O4RA 2WBRA 4LF1A 2JLEA 1QSYA 1S1XB 4RW8A 1TTHB 3M30B 1XR5A 2PEBA 2VG6A 2HVHA 2ZVSA 4M5NA 4F2SA 1K73T 3G4SS 2DGWA 4I7FB 3MM7A 1GTHA 2QO3A 1PCAA 2Z58B 3UI3A 1ZPVA 4FVMA 4TY8B 1SIWB 5I42A 1RYSA 2BVZA 1FE0A 4J9MA 1N5TA 4LSNA 1CS3A 3CIMA 2W1BA 4G1IA 1R27B 5J1EA 1I6JA 4U7UK 3BSOA 3PVXA 1VC5A 2XO7A 1FESA 3KK3B 3CUNA 1HPZA 4J9SA 5K8NA 1JLQB 3DXSX 5IZHA 2HNZA 5DG7A 3HSZA 2VFUA 2ZH1A 3PJWA 5BXIA 1NKEA 4OZLA 3HDSA 1A7GE 2Q79A 3OVAA 4K50A 2OPQB 2P1MA 3R5JB 2LP4A 1WG1A 1FKPB 4HHJA 3FKBA 4WWSA 1HQUA 1UZHA 1EOEA 4RNHA 2XMTA
chains in the Genus database with same CATH topology
4CH7A 3HU6A 1RTDA 2LU1A 3P3DA 2ASJA 1BUOA 1HARA 2JLFA 3EGNA 4WXWA 3KLHB 3IC1A 3CC2S 4NLXA 2O1PA 4DV7F 1RA6A 1FNXH 4ZCMA 4KB7A 1Y00A 4A8WA 1K8AT 4WFAQ 3DLJA 2QIFA 3TVYA 4ZMMA 4ELVA 1NO8A 4OZ1A 1SI9A 1EOFA 2FJDB 4A8QA 2XB2D 1ELOA 2FLLA 1S9EA 3P5TL 3B82A 5HMWA 4Y65A 3G71S 4KV8A 1F2GA 3H98A 1H2VZ 4FXDA 1VQ8S 2AU0A 1EXBE 1RTIB 4EWTA 4B9KE 4C3LA 4HH1A 4K0KF 4ID5A 4AXIA 1O5JA 3Q22A 1QVGR 2AV5A 4C8OA 5CZXA 1LK5A 1LWCA 2RVJA 1KTQA 2WK4A 4W9LB 2GO8A 4TYBA 4Q44A 4DV4F 1J5OA 3ISNC 1XERA 3AH6A 1QTMA 5L39A 1TUVA 4ZOUA 2EFNA 2R8KA 4UUWA 2FVCA 2AJQA 4IG0B 1GH8A 4NZ6A 3CCTA 4YP3A 4ZP6A 2NZ0B 3GB0A 2V8DA 2MQQA 1VMBA 3WX4A 4X84A 1G6BA 5E3RA 2UVWA 4ZCLA 2BQRA 2IJNA 3RYLA 3T1AA 2PMHA 4NYZA 3KHGA 2PA3A 4DS4A 2ZDOA 1VIXA 1APSA 2RDJA 5J1PA 4DSKA 5I3PA 4FF2A 2KO1A 4NLVA 2VC1A 1HWKA 2JC0A 2B0GA 4QR0A 2N7YA 2M0GB 1VQ6S 2QLXA 1NK0A 1NNDA 2WB1D 1RGVA 2AJFE 2W25A 1N4LA 5HYWB 2OPRA 1FTRA 3NGDA 4LFBF 1X5SA 1H0HB 4HH0A 3NWGA 5B0DA 3G6YA 5AXMA 4I2PA 3BQ0A 1DTTA 1QJHA 2VV5A 4G1PA 1HI0P 1RAJA 4FXWA 4CZCA 2VQFF 2OFHX 4OV1A 4P7VA 5HQ8A 1TL1B 4NA3A 4CI0B 4Q2LA 4EO8A 2AW0A 3EX7B 2HWIA 3E8OA 1TL3A 3BR8A 3K7RA 4ECSA 3T5KA 2C22A 4K4ZA 1YJVA 2B56A 4V19X 2HHHF 1R0AA 2FJXA 2LA4A 1L3TA 2E5LF 5EX3A 2RQ4A 3PO5A 3X3UA 5KFJA 1RI7A 4MTPA 3D1HA 2FLPA 3FEZA 1GX5A 4LUBA 4DV0F 1T7PA 1CVJA 4M8LA 2OPPB 1NK5A 2U2FA 1UJ5A 2KRBA 1X4BA 2VKZG 3MM6A 3HTMA 1FT8A 5K8OA 2XGPA 3BN4A 4CP3A 1R89A 4ECQA 4NLWA 2W7OA 4O3OA 1REVA 4KIAA 1S0VA 5I3UA 2LXUA 3LAKA 3MR2A 1VQPS 2UXCF 2KG0A 4HI2A 2XI3A 4X4TA 1Q16B 2F8HA 3QGHA 2BRKA 3DI6A 1IKYA 2ERRA 1QLNA 2VBZA 1D8ZA 1S4FA 2KRRA 3VALA 3IFEA 5LSLA 1VK8A 2VBYA 2Y1IA 3U1LA 5B7WA 2DNNA 1ZM3A 3CCWA 4HT5A 1NJXA 4FBUA 1VQNS 3ULHA 3MOJB 5A8WA 1CQMA 3LUYA 1FRHA 3QWPA 4LFCF 2GQ2A 4QR2A 5HBMB 3Q23A 4TLQA 1TKTB 2E7XA 4JI1F 3MR3A 3MFIA 3QIPA 4QWDA 4KRWA 4BC9A 1R8BA 1FDBA 2C42A 3MXHP 4CXIA 3PHEA 2R7RA 1S1XA 1JLCB 5AXNA 1ZOTA 1C4CA 5DGAA 2CQIA 2RQMA 2MGZB 1WTBA 2V9KA 1WG5A 3M30A 3T19A 4F8RA 1LWFB 3K58A 1S97A 2EK1A 3IO1A 3JAMY 5D3GB 1GXUA 1NHVA 4PG4A 4NOHA 4EEYA 2O5DA 2X3GA 3R1HA 1AFIA 2YNIB 1KLNA 2BDPA 2MHEA 3AA8A 4I7FA 4YDDB 4DSEA 2Z8HA 1D1UA 4MK8A 3D0HE 5GMKa 4RLEA 2ZM6F 2D9OA 1UVMA 3NCQA 3IXQA 2XMMA 4NLQA 4TY8A 5GVQA 2H9ZA 3PO4A 1IKWA 1FD2A 1QSLA 2GX8A 3W2VB 3JSMB 2O66A 1T8EA 4ZVGA 4IO9Q 1NK7A 5KT2A 2RSQA 1YHQS 1HD1A 2I5JA 4FN5A 5KT6A 2HHWA 2I2RA 3MFHA 1Q79A 1ZAVA 4XDDA 3TARA 3J80Y 2YKQA 3G6VA 3I55S 1C0TB 2YWHA 4F2RA 3VZIA 2BXJA 5HN0A 2MQLA 1L3UA 4MH8A 1Y5IB 3E01B 1DJ0A 1HWJA 3BSCA 1L3SA 3MAHA 4PUOB 2HFZA 3KNGA 1HBNB 2W24A 1C0UA 4U7CA 4X4SA 3KLVA 3NCRA 3KK3A 2MB0B 3QJPA 1FJCA 1RT3B 4DFJA 4JGHC 2AJ1A 2MZQA 3RAMA 2IRYA 3ZZUA 1JLAB 1G1XA 2UU9F 1YJUA 1VQKS 5DGBA 2XCPA 3BQ2A 4TY9A 1JLQA 1K1SA 4CQ1A 1SC6A 5A8KB 2HNDB 2N82B 3G96A 3EUNA 4RZRA 2B51A 3PW2A 3OXFA 1XNQF 4A8XA 4ICLB 1IUJA 2EFGA 1YI2S 2RJZA 3MPVA 4DN0A 1D0EA 5H9FJ 2CQ1A 4N56A 5CQGA 4DQQA 3PEHA 4CT9A 1Q86T 1RK8A 4I1TA 4ZOSA 4IDKB 3MUMP 2ZH3A 2OPQA 4JI2F 2YWEA 1RT4B 3LW5C 3EPIA 4OZ5A 3BGRA 2MZSA 1BGXT 2XG8A 4DX8H 4C4WA 1U4BA 4C3KA 1U2RA 5J2PA 4WQOC 2BM0A 4TN2A 3PZPA 4ILMA 5FDLB 1Q81T 1FQVB 5DDPC 3U1NA 1FKPA 4UY85 2HHVA 1B0VA 4X4NA 4LF5F 3V6HA 5F8MA 4IRDA 3P96A 3R5DA 5KFVA 2MZ1A 5AE1A 4K4WA 2HGNA 3DRSA 1U8SA 1RA7A 3AY0A 3CWJA 1XEZA 2QYCA 2PEHA 4R25A 5KG3A 3JB9k 4OL8A 3RRKA 3KLHA 2DNLA 4O3PA 3G6ES 4CIOA 3HZGA 3CDUA 2KH9A 4WYWA 1HWUA 1XMQF 1HQEB 4A8OA 3LBZA 4KHMA 2YH0A 2MKIA 4EU0A 4Z2XA 1HNXF 1BWEA 3B84A 3D54A 4DUYF 4P6QA 2R9RB 2KHDA 1FF2A 4M1KA 2ASDA 5KFGA 3TRGA 5KFAA 4QWBA 2OPSB 1YRUA 2DRBA 1R2BA 2JLGA 1V3ZA 3L7PA 3MI7X 1XK8A 3DRPB 2ZH4A 3CPWR 3DU5A 3GYNA 2ZJRQ 1RTIA 4FS2A 3PRDA 4ELTA 5DLGA 2ZJQQ 3HQIA 3GFZA 2GA7A 1QE1B 1CLFA 1UW4A 4NPOA 5IQ6A 4ECTA 5LLIB 1VI7A 3JYTB 4WE1B 4DL4A 2KXFA 2KDOA 1EODA 2MSTA 3CD0A 3BN7A 2D7SA 5EWFA 5E33A 2MKKA 3RR8A 4N41A 3M52A 4IG0A 4JV2A 2V4RA 2P1NA 2ZKUA 4LJMA 4EOZA 3WC2A 3F56A 2IM0A 5LSOA 4W92B 3VF0B 3N0VA 1D9FA 3ZC4A 1HYSB 2PSZA 2RS8A 4B95B 4DFPA 3OTBA 4D3HA 3TA1A 1FXRA 2MY8A 1B7FA 1YIJS 3O2IA 3OUYB 2EVZA 3UW1A 4OQJA 2RE1A 2VG7B 5MLCV 1YITS 4K4YA 3MF5A 1S1GA 5DETA 4KO0B 3R3TA 2AJ0A 2IMOA 5L8RC 2R2RA 3R5CA 5BYQA 1T05B 3JSYA 3PKYA 2BACA 4ED1A 5E3AA 4W9KB 3TUIC 4B3TF 2ASYA 4YB1P 5KFIA 4XIUA 4GKJF 1TL1A 1VIOA 1WEZA 3TVKA 3C46A 3LWLA 4RU9A 2QSWA 3X1LB 5E3CA 5F9NA 2I9SA 4N76A 3PKMA 3OW2R 3VR1A 4TQSA 4KC5A 2QFJA 4KGMA 3QAEA 4U2NA 2ROGA 3OGLA 2O67A 2ZC4A 5ADZA 3KK1B 3WSOB 3GIKA 2LMIA 2W9AA 4F4ZA 3RW7A 4ED0A 3OFFA 5HMZA 2OLWA 4Y00A 5B0CA 2MYFA 3V2UC 3SV4A 2DD8S 2OPPA 4BC7A 4K4SA 2E9ZA 1R8PA 4OI6A 1U1PA 1Q7YT 2LCWA 3AHPA 4WJBA 2K7JA 4C9DA 3MMBB 2VFRA 4ZPCA 3RB3A 5DLFA 2AGPA 1SUQB 2B4UA 2E44A 2FPHX 3EXYA 4I64A 4DWIA 1UEUA 2KKHA 3WZ0A 2HWTA 2D3UA 1Q4RA 2MKHA 4GO7X 1JLEB 2X1FA 2OVPA 4CXJA 3M2VB 2CFXA 3UDLA 3K5NA 2AX0A 2XC9A 2D1CA 4X66F 2NLWA 4JYAF 1WEYA 1N5VA 1SB6A 4P7TA 3VQTA 1IBMF 1SL1A 5HBMA 1TKTA 4KE5A 3ONQA 4H4KA 4ECVA 4IH6A 1QVFR 3I5BA 1E6YB 1VOMA 4IH5A 4OHXA 2M9KA 3TAMB 2KFZA 2O01C 3RAXA 1JLCA 4DOZA 3PX0A 4R5PB 1RDRA 2G4BA 2MGZA 4AUKA 1LWFA 2D41A 1N88A 4N8OA 1N5SA 4JI0F 1YTYA 4DQRA 2AF6A 3PM9A 1SJFA 4YHHF 1X4GA 5D3GA 2HIQA 1SL0A 2M8DB 4AL7A 3LGMA 1SIZA 2YNIA 4IRKA 1LW0B 2FC9A 4MKAA 4O44B 5D4NA 3VTIA 3MPWA 1NEXA 4QPTA 2XS7A 4DDFA 1TFWA 5AXLA 1FVQA 1AUDA 1AW0A 2P1OA 2LQBA 2V94A 2CPYA 5AJ3F 4DSLA 1IBLF 5IT4A 2NUUG 5J1NA 3W2VA 2OH2A 3JSMA 1HMVB 2R7VA 3FEYB 3I9V9 2B6AB 1GTEA 4ECUA 2QA1A 2VUGA 4IR1A 2L48A 2FUG9 5KFHA 3QWUA 1ZM4A 4OMFG 4ALZA 4M95A 1U1QA 4Q0BB 2R7UA 1C0TA 2DPIA 1QDVA 1FRLA 1P27B 2YKOA 1WG4A 3E01A 1LDKD 3UD4P 2A2CA 2XMUA 3N5FA 4PUOA 4LF8F 2DR8A 1JLGA 4RW6B 5H9EJ 2HHQA 1FEHA 1HBNA 2YNHB 2YWFA 4BGCA 4CRHA 5L1LA 4IOBA 3CTRA 2ZBIA 1RT3A 4K5RA 4J9NA 4DR5F 1H38A 3LPYA 2L9NA 1FRIA 1JLAA 2XWYA 4JTDB 3MECB 2NS1B 3DM2B 3C3LA 2RH3A 2GW8A 5A8KA 3IWXA 4Y2MA 2HNDA 3K5LA 1M5OC 1NN7A 2CQDA 3VAHA 2W8LA 3T6BA 1R8HA 3N9UC 4ICLA 3U7JA 4CTAB 1ZETA 4F3OA 1S7HA 4FF3A 3GQCA 3HF5A 2U1AA 2K8GA 3DNCA 2V4JB 4JBCA 1ZTWA 2YKMB 3H2UB 4IDKA 2N4DA 3T1HF 4CH0S 2LQ5A 1RT4A 3CSKA 1Y3KA 4KT0C 3HX9A 1P22B 2UUAF 3CCSS 3OXGA 3Q2SC 2IAJB 5EWGA 1RTJB 3NP5A 4X64F 1G7CB 1KLMB 1NJIT 2K1RB 1MWZA 3M2UB 5DG8A 2E1AA 1M0SA 2DGSA 5KFRA 2HQIA 4YQWA 2W4DA 2DNKA 2EFOA 3OR1B 4FF1A 2J0XA 4AL5A 2ABYA 3KLGB 3MUVP 4C8ZA 2QA2A 1VQ4S 4YR3A 4KSEB 4LIWA 4EYHB 2ZH6A 3DU6A 2ZH2A 1KQGB 1R7IA 1TKDA 1HQEA 3IWLA 2GO9A 2JRSA 2ZDPA 5C25B 3BR9A 1VFJA 1J2VA 4N9F5 5LT5A 1UMJA 4Y6IA 5M2PA 1U1LA 2A3JA 2D74B 2OPSA 3SCJE 3CULA 3LP0B 3KNAA 2DTJA 3E4UA 3DRPA 3SEOA 2HVIA 4LSLB 1ROFA 4ECZA 2B4PA 1FJGF 2P1QA 1X9MA 5A6PA 1QE1A 4I6JC 1YJNS 3PACA 2RQKA 5BJRA 1U45A 3BGLA 3DHWC 2XWXA 3FSXA 2QE5A 3JYTA 4WE1A 2BV3A 4OI1A 1A68A 4A8YA 4MK9A 5K5MA 1EP4B 3FRZA 2ROEA 2UVRA 1U24A 1CC7A 5KG7A 3K57A 1EETB 4C7QA 4K4TA 3BQ1A 4L3NA 4PKDB 2BYCA 2J8AA 1QSSA 1UWBB 3MM8B 3HVEB 1WF2A 1HYSA 2ATLA 4JI8F 5L1IA 2I2YA 3GFHA 3R5AA 4F50A 2CVIA 1OWXA 1URRA 2J7UA 3M8PB 4O3NA 1T03B 3Q0AA 1DRZA 1KOHA 1MSWD 3OUYA 3BJYA 2EFVA 2ASSA 2ZD1B 5I4MA 2VKRA 4OFZA 1YJ9S 4DR6F 2VG7A 2WHOA 5D4PA 5E3PA 3DLLQ 2Q6CA 2QT7A 5KFPA 2FY1A 2RD5C 4MKYA 3ETOA 4KO0A 1NKBA 4AP2A 3TI0A 1Y9OA 5EHHA 2BE2B 2Q1LA 3OJSA 3VAFA 1T05A 1NJWA 2M7SA 4B9TA 4AXJA 2MXYA 3TX8A 3KJVB 1RT6B 2ZZNA 2UXBF 2GMJA 4ECXA 2EG1A 2IA0A 3S8SA 1SBRA 2Z2MA 4ED8A 1B0PA 2KG1A 2CRLA 2CQ0A 2QA4G 1T94A 3N6LA 1KS2A 1HI1A 4W9CB 3POTB 3KK2B 4EBEA 2GQCA 3K5PA 3HI9A 2RU3A 1QUPA 1UVJA 3RR7A 2YX4A 3ZNGB 1NKCA 3DHXA 1KQSR 3KK1A 1FEEA 2Z0GA 3ZTDB 3LP2B 5F0UA 3SSRA 2VFVA 4L72B 2N7CA 3FZ2A 1FRJA 2SXLA 2UV8G 1MNEA 1VLYA 2ASTA 3V5RA 1JMTA 3VAKA 2IBKA 1LWEB 3UNGC 1HNVB 3V7DA 2XMJA 1CG2A 5KT4A 2CPZA 1IJEB 3F44A 3MMBA 5J2QB 1P9QC 2XHWA 4USIA 4QIWD 1SUQA 2C3UA 2FJ