3DRXA

X-ray crystal structure of human kctd5 protein crystallized in high-salt buffer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
161
Chain Sequence
b'ALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIEFLCVVSKELH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BTB/POZ domain-containing protein KCTD5
publication title Pentameric assembly of potassium channel tetramerization domain-containing protein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 37
structure length 161
sequence length 177
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02214 BTB_2 BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drxA03
3.30.710.20 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3drxA01
3DRYA 4ZGCA 4YY8A 3DRXA
chains in the Genus database with same CATH superfamily
4PXCA 3I0SB 3C15B 5KFQA 4UQGA 3OUYA 1U49A 3H40A 3UVJB 4TU9A 1S4FA 1RWXB 1VC6A 1DTTB 1RCOB 1VISA 3UO0A 2RDDA 3QGHA 3ZNUA 1VBYA 1UPPA 2OEMA 2HSEB 1XMQF 4WE1A 2JFDA 3E01A 4MKYA 1G3OA 3R6GB 4QW9A 3V4IA 3PEHA 2P1PA 4YR2A 1FNOA 4DV4F 3MPDA 3HHLA 3T1HF 1R31A 5EWEA 4L3KA 1S77D 5KFSA 3HU6A 2WCXA 3C6PA 1RTHB 2W4DA 3D0IE 3HT0A 5AE1A 3AXMA 2RHSB 3BB5A 3H4DA 4U6PA 1WC3A 1HBOB 3C6TB 3NRBA 2XS5A 3U27A 1P9YA 1RB0A 2DD8S 4CP5A 1F9EB 4F3QA 1S6UA 2JSXA 1TELA 4OZNA 1SKUB 4ED8A 1U1RA 3ZNJ1 2HS0A 2KHCA 3CDWA 1X4BA 1K73T 5I3UA 4FS1A 1P22B 2FVRA 5HBMB 2PA3A 4CTAA 1HPZB 4RW9A 5DQHA 2AZ3A 1REVB 3PHTA 2VPYB 1U1KA 3ZTDB 4RBVA 4YUDA 3GJQB 2HHXA 4IFYA 3SI8A 3KLHB 4JI7F 2V4QA 1IKYA 3DRXA 2UUWA 4A46A 3TJ9A 1K9MT 2CQHA 3OXFA 4Y0FA 1K0TA 1U0HA 2G1HA 5E33A 4F0HA 3UCUP 4DUTA 2V4JB 1WHVA 5KT2A 1RAGB 5J2QA 2CXEA 1NK9A 4U2NA 3TX8A 2I1RA 2G2OA 2ZD1B 4NRTA 1SL2A 5A8RB 5J1PA 3QO9A 2UXBF 2CUYA 4H4MB 5ETQA 4Y28C 1S49A 2D69A 3T9NA 3Q89A 2VICA 3PX0A 4UOHA 4MJKA 3P49B 4NLTA 4R5PA 4F3OA 4IR9A 4RW6B 3QPIA 4V19J 5EHHA 3DC2A 1MWYA 1DQ9A 2AJ0A 2YX4A 3OJSA 4OYZA 4PQAA 3Q22A 2Z8HA 3G71S 4DR2J 2GO8A 2HYIB 1EXBE 1RKIA 3I4HX 1QUVA 4JUZA 2WONB 4ZKAA 4QWBA 1N36F 1HD0A 3C2PA 3NS5A 4YHHJ 3LA0A 5KT4A 4RJVA 2KTQA 1GT8A 4CO1A 2QL7B 1VCBB 3GJTB 2QEXS 4J9KA 2HURA 4B3MJ 2H51B 2ZKUA 1JLFB 3T9ZA 2NYIA 1RAHB 9RUBA 1F0XA 1C1BA 5ETSA 4D3GA 4KBIA 1LNQA 4H4KA 3DRYA 2UUCF 2WRMA 3V7DA 5C24A 5U47A 2RD5C 3VQTA 2P1OA 3MAHA 1Y10A 3M8SA 4USTA 2A2DA 2MLXA 4UQTA 4A8OA 2DEJA 3DCGB 2RS2A 2QSFA 2VU5A 1XN9A 4A48A 1KR4A 2ACYA 2IJRA 4LR9A 4LFCF 4EEYA 5GMEA 4JI0J 2E5GA 2R7XA 3J7A1 1QD1A 3TW0A 3M2RB 4DU8A 4E98A 4PWWA 2OMOA 2XTJP 4OI1A 1KS2A 2XSJA 3NCPA 4RUCA 5LMUF 3NG8A 1LK7A 3QYYA 2RQKA 4UUXA 2ROGA 3DGVA 3ZZYA 4B95B 2DR7A 2QJ3A 4CO4A 1KSPA 2GVZB 5CCLA 1NZAA 2R3VA 3DM2A 1UEVA 4DL5A 3VAGA 4RU9A 1C1CB 1WOOA 1WOSA 1FJ7A 3S1TA 2X1GA 1CSJA 5A6PA 1XEZA 2AMCB 4Y34A 4C0HA 1YK9A 2A18A 4HEA9 4C11A 4GKKF 3UR3C 3DLKB 3W8PA 4OX9J 5D4LA 4DR7F 2EWHA 4J9NA 1RT7B 3J7Z5 2GX8A 4LF2A 5L9XA 1RHQB 3MM5B 4B9NA 4B3RF 2V5HG 4EBCA 2VQEF 1V3SA 1N32J 3L3CA 1FDDA 2AEFA 1KNZA 2F4VJ 2HFVA 3OHUA 1MMDA 1V3ZA 3DDKA 1F3VA 4CO5A 1SH0A 2CQPA 2FIUA 1W2BR 3ETOA 3FQKA 2XGPA 1VJWA 3EXCX 4ZVRB 3OFFA 3T6BA 3G8TA 4JI6J 1L3UA 3G4SS 1C0TA 2HMIB 3GYNA 4QWCA 4I2PA 2PI5A 5FJ4A 3QWUA 3DOLA 2IC3A 1HD1A 3I0RB 4OV1A 5E3PA 2H1YA 1HV2A 4DXLA 1XK8A 4DL3A 1RKJA 1FESA 1CQMA 1J5OA 4ZJLA 2ZH1A 5KT6A 3HSZA 2AYBA 1F5AA 3C14A 2MKYA 3OBIA 1FRHA 3AOCA 4OYXA 4DS4A 3W2WA 2GFFA 3HSGA 1RTDA 2V2QA 1X5SA 2ZE2B 2B9XA 4CWBA 4LUBA 4NCGB 2IAJB 3ZXWA 1RWNB 1HW8A 3TR5A 2WVCA 4ELTA 3CE8A 2GHVC 2DGSA 2IBKA 5HVGA 5GADU 4FVCA 3OHVA 1TV6B 5C2GA 5DZ6A 3SDEA 4DPUA 2APOA 2VBYA 3G6ES 3ZTPA 2JLGA 2YNIB 1AA1B 3QMQA 5IM0B 4UIJA 2X1FA 2D3OR 4AP2A 4L73A 2Y9HA 4JTCB 3IGVA 3LWLA 1TFWA 1FI4A 2LDYA 1PILA 3K2YA 5GVQA 3RR7A 4LF1A 4NLPA 3WDOA 3WBZA 2XC9A 4X4UA 3I87A 2JZ5A 2GS8A 1FS1B 3M8PA 2PA8D 1O8BA 1Q8IA 2K7KA 5H9EJ 2QYGA 1H98A 2J8SA 4OI6A 1LDKD 3UDCA 2WB1D 4CNZA 4G1PA 2GQCA 5DQIA 3W1YC 3J81Y 3DKDA 5HO4A 1YBAA 2CQ2A 2C42A 2AQ4A 1HBUA 2DCLA 1RWMB 2VA2A 1CULA 2CQDA 2BW2A 4QIVA 3MM8B 3MUTP 4ZMMA 2CQ4A 2R2UA 5MAOA 2XEXA 4KGMA 5A8KB 3M5BA 2XZTB 4EBEA 5ETNA 4MYUA 4S0MA 1Q79A 2NREA 2ROPA 2FD2A 2NQPA 2DHAA 1HQEB 1WWHA 5HJYA 1NJZA 4CLSA 4AWJB 2XLJA 3G82A 1RHJB 2PN6A 2VFUA 2Y1RI 2FJBB 3P6YC 1QJHA 4K4SA 2DCUB 2B0GA 3DRZA 3QRPA 1QY7A 1D9FA 1GMVA 2J6TA 1FCAA 3H2LA 1VBKA 2QYCA 5GADI 1QVGR 4X64J 2B6AA 1YBTA 1S12A 4OJGA 5HQMA 4U96A 2DNOA 4EBDA 2IFXA 1S6PB 3TUPA 3DLGA 5EN1A 2WZ1A 3RB0A 4F67A 5T7LB 4ZIWA 3QLHA 4A8YA 4P9SA 2V2KA 3JSYA 4I2QB 3KUGA 1M5HA 3PW7A 4I7FA 4ID5A 3FUYA 2I38A 2M4MA 4DV6F 1TMJA 4DX7A 3H20A 4RU2A 2D3UA 3W7BA 4DUYJ 2CJQA 1J5EJ 1RT2B 4CH7A 1UJ4A 2D7SA 4U7CA 2EFVA 3U1LA 1S9GB 3K8WA 2HHWA 4OZ5A 1T9UA 1PO6A 5BXDA 1ZM9A 1ZM4A 2DK2A 1C4CA 2HFSA 2MLYA 4O4GB 2BKNA 4MKVA 1RABB 3ITHA 4RZRA 1JNZB 1CJKB 2VF3A 3OGLA 1QSSA 2JVRA 4ILMA 3A4TA 2MZ1A 3IAM9 3DLLQ 2XLKA 4K8RA 3NAIA 4MFBB 2W4PA 1FQVB 1JLQA 3W64A 2RF2A 5K8MA 2FC9A 3AOBA 1AUSL 1JLBA 2C1EB 4AQYF 5FDLB 2GAHC 1VQ7S 4FBUA 4IKAA 4RBTA 2XMWA 3G6XA 2MTLA 3MHYA 2VKZG 5FTAA 3ZZOA 3D6TB 1ITPA 1X5OA 3BKTA 4DV4J 2Q3PA 4ZHRB 3T1HJ 3HSDA 1VQSA 5BYRA 1KLMA 3RYLA 2OFHX 4IFVA 4WFYA 1WHYA 4W9EB 1HI1A 3CIZA 1A6LA 3ISND 3UN3A 1YBUA 1S6QA 2VC0A 1CJTA 4BHQA 1RYSA 4I0WA 2Q43A 2ZDOA 3ZO7A 3JTPA 3OSNA 5LOQA 5IV3A 3J81j 1VLYA 3PHEA 5EGYA 1N0UA 2B51A 3MM6B 3ETMA 3GFXA 3H42A 5ETKA 1RP5A 2R7OA 3LOUA 1Z1ZA 5L1LA 4GVLA 4USWA 1LXNA 5C42B 2RT3A 1DHMA 1OWXA 1HR0F 5KFGA 4LVNP 1R8AA 3PIOQ 1RT6B 3RBDA 3TA0A 4CP3A 3CJ3A 2K2PA 2BJ9A 4L76A 2AWZA 2UV8G 3BH6B 4ZPCA 1U26A 4JI7J 2P9CA 5B0CA 2OVQA 4OZLA 4FXVA 4ICLB 3BBCA 1JLCA 4WYWA 4WU2A 3US5A 2JLFA 2R7VA 3K5MA 1B0VA 3DMJA 2H5IB 3I5CA 3KLFA 1TP7A 2EKYA 3FDSA 5HANA 1R8CA 1NSQA 5HP1A 3S01A 2OPSB 2N7CA 1NPRA 3IS9B 3AJ1A 2HQDA 2DVIA 2PE8A 4Q43A 2FLOA 3OL6A 3ICLA 4RW4B 2ZBPA 4W4MA 4PG4A 4KKOA 3AQPA 3DRRB 4RO0A 4C3MA 2B8QA 3PJXA 5E3QA 4DR5F 2O3DA 4ECYA 4QBUA 1VIXA 3UFCX 1KC8T 3FCWA 3VVTA 2DO0A 4WYLA 3VVUA 1JX4A 1RE1B 4ED3A 1I5OB 5GMDA 4FVMA 3T19A 5HBMA 2O1PA 3MR2A 1T9YA 3GPAA 2M9KA 4P7VA 4U7UD 3CCVS 5LL6d 1N36J 4JB8B 2D3O1 4F4KA 3D6FB 4J9SA 2F1FA 4LFBF 1FEEA 1S97A 2CDQA 2KXNB 1PKUA 1CS4B 1X4HA 1HNIA 3BGFA 3JSMA 4ID8A 2ADCA 4O44B 2V68A 3KMSA 2RNEA 3QT6A 2UUCJ 3FCHA 4M5DA 3MTKA 1JK9B 4QOTA 4R8UB 4XDCA 3N6MA 4QU6A 4NZ7A 4Q7AA 3H4BA 3SCJE 4UOFA 2CYYA 3TAQA 1GTEA 1MWQA 5LXRA 3VF0B 1RLDA 1RXOB 2V8GA 4LRCA 4LFCJ 4EK2A 3DLEB 4USKA 1CQNA 2ZC4A 2UVUA 1TL7B 4RNOA 3JS9A 2JJ4D 4OQJA 3TOQA 2DYAA 4J5OA 4EYHB 5DGAA 2GC8A 2XO7A 4CDIA 1R3NA 4YMEA 1TUWA 3N5BA 3RBXA 5LMUJ 5KFAA 1VK8A 3NP5A 2X7IA 5L8RC 3MR7A 1QM9A 4J9OA 1QE1A 2I0XA 2PMZD 4RW7A 1QAYA 3OR2A 2V8HA 4J9PA 2GIFA 4U67Q 1WKKA 1MROA 3CJ8A 1WTFA 2P6TA 4NWBA 4F4ZA 5D78A 3DYAB 3QWPA 3AD9C 1RT5A 3KK1A 4ECZA 3QAEA 4GKKJ 1JLEA 3L4BC 4DN9A 2JC0A 3CPWR 4X2BA 2QMUB 5AJ3F 2G4BA 4DR7J 3SFGA 4KR0B 1JWWA 3O2IA 1WG1A 1YRTA 4B3RJ 3X3UA 1RTJB 2OKQA 1JKHA 3FCVA 1F5CA 1F6TA 1HBMA 1RK8A 4KO0A 2VG7A 5CYQA 4EMDA 3HJFA 2DR5A 5T41A 2AX1A 1QTNB 5K8NA 1FNXH 4DCJB 5KT5A 3TVZA 1GH8A 3KJVA 1R0BG 3VAMA 4B17A 3M9OB 1SKWA 1XNQF 3PJWA 2F63A 2B8PA 4USMA 2OGUA 1TL1A 5FD1A 1ZTWA 2M7SA 4F04B 1AXQA 1GXTA 4BS2A 3EGWB 1IXKA 2W9CA 1SIZA 4DN0A 3MMBB 1RDRA 1S0NA 3EPIA 3GONA 3OTOF 1IKXA 1MSWD 3MM7A 1KONA 1NHUA 2KXHA 4EUVA 3HO1A 1LQ9A 3DN9A 3OXLA 1IR0A 3P8BB 2AYEA 1RHKB 2MKSA 2HIQA 4GVBB 4UZBA 4KGKA 3AHPA 5H9EK 2M70A 3NBPB 4B3OB 1NEEA 1BQNB 4CYUB 1ZH5A 4DG1A 2POKA 5LJ3Y 5JJBA 4KY3A 4C3LA 1ZZNA 5B0AA 1JXVA 2M8HA 4F26A 3KK3B 4DR6F 1KTVA 3HVTB 3VAFA 2ZH3A 4AJYC 4ED5A 3NCRA 3K89A 3CF5Q 5KFZA 1Y11A 3MMAB 3C66A 1S1WA 1BQMB 1PJ6A 5DM7Q 2Y1LB 3EICA 2ILYA 3KJNB 4JI8F 5B0FA 3OT9A 1LK5A 2GA7A 3V6DB 2DRDA 1WHXA 3VV2B 2OIHA 2UVWA 1DTQA 4LRBA 4LJMA 1WC5A 3FBFA 1LXJA 2OMLA 3HJVA 2CPJA 1WF1A 4FF3A 1R29A 5IQQA 1F9FA 3EVWA 2JH3A 2MXYA 3PO5A 3OFEA 3MUMP 4LF6J 1LV5A 2MYFA 1HI0P 4ZP6A 1TKXB 1S76D 3FKBA 1RT1B 3QT5A 3VQSA 2RUGA 3P4UB 1FJEB 2NPFA 3AY0A 1HQUB 2BE2B 2QLJB 1R43A 2UUBF 1GXLA 5J2PB 1L5UA 5BXHA 5HZGC 4HVZA 2A3JA 5DLFA 4WU3A 2AEMA 5ADZA 1XIQA 3JYTA 4CXTA 1U45A 3LTOA 1VQNS 3TI0A 3FC9A 2EPIA 4G1IA 3FEXB 3M1VA 4NMLA 3MEGA 4DX8H 4W90B 2DHXA 5I42B 2I5JB 4MIAA 3TJ8A 3OHBA 3CC7S 1FKOA 3OHAA 1C4AA 2MKIA 2JLEA 3OV7A 4WQOC 1VR6A 5KFWA 1NSPA 2C3YA 4LF9F 4OHZA 1CLFA 3TANA 1R0AB 2NR0A 3HLUA 1VHFA 1WTBA 4X66F 1VQPS 4YP3A 1S0VA 3BKFA 2C2DA 3HT3A 3HPOA 1Y5LB 3HDSA 5L9NA 4NA3A 3C16B 3M8VA 3CCES 3DRSB 3NNAA 1BGXT 4DV6J 3D9BA 5C25A 2VZ9A 2MGZB 4Y3CA 1GXUA 3N9UC 4ED7A 3KHHA 3D0HE 3R7NB 3A3NB 3MM8A 2FJVA 2YNGA 4PYDA 3C3LA 2RB7A 4J9RA 1U4BA 1NK7A 3ENQA 4C0OC 3CGIA 3M32B 3AXKA 3EDQB 4OLPA 2Y3YA 3G96A 4FYVB 1T03A 2DNLA 1NN7A 3GIIA 4CLKA 2ZKTA 4OYWA 1N48A 2R8KA 4Z7YA 3TUJC 3PRVA 4KAIA 5CAAA 2LXIA 3O6QA 4CLUA 2NXJA 2NZ4A 7FD1A 4NLVA 2BQUA 1XBWA 1X4GA 4O3NA 4XPCA 5ETLA 4AQYJ 3LAMA 1NMEB 2F5GA 1PJ7A 4WF9Q 5KFHA 1JLGA 1SH3A 4FF4A 3ZZRA 4HR2A 4PXDA 4O3OA 2GJIA 3D68A 1GAOA 4AD6A 4JV2A 2HZVA 2ZJQQ 4JTAB 4DV0F 1HLWA 4K5SA 4O23A 1OQ3A 5CYJA 3WQPA 2YBVA 2FZKB 1FTCA 4DWIA 3I3NA 1W2IA 3FVYA 3TEHB 2OLWA 3ET6B 3E3XA 3NCQA 3LP0A 5DRKA 3NOCA 3TVYA 3LP1A 5CHCB 4WZQA 3NOGA 3H0PA 3R1HA 2YX7A 2UVRA 1WI8A 3VTIA 4YB6A 3GFYA 2D9OA 4ERDA 3PXGa 4Y00A 3B84A 2HZAA 3D6MB 1U48A 5JH5B 1VMBA 4DLEA 1QAXA 4PG6A 1UETA 4YEAA 4J9VA 1V5VA 4TQRA 1FDBA 3CDUA 3R9LA 5A8WB 3H59A 1YG0A 1XMBA 2BOPA 4JV5F 2IRXA 1Q86T 4ZLNA 4DUZF 3MD3A 2ZEJA 2L41A 3VAIA 4ZVSB 3NGKA 3OXGA 4B9UA 1EODA 2EG1A 1NM2A 3WIUA 3NMAA 1S79A 4DQSA 2VB6A 4AYBD 4ZN3A 4NI2B 3GV7B 4CLYA 4K4XA 1TMMA 5F9NA 4O3PA 1TVRB 1RT4B 1GX6A 1NSAA 4K2XA 5IC6B 1RT3A 5A76A 2KT2A 5KFTA 4RNNA 2YKMB 4WFZA 1MW7A 2V2VA 1T05A 3CMES 2OPPB 4FKXA 5F3TA 4IG0B 4DR5J 5BO4C 2VODA 3UCZP 2OELA 2W7PA 2BRKA 2CJAA 1WD6A 4WK1A 1HQ2A 4W9KB 2PIIA 1VQ8S 2WB4A 4NYOA 2WOMA 1ZTTA 3ISZA 1S9FA 1FRJA 4WTYA 4ED2A 3GYGA 5DDOC 3M2VA 1NK5A 3ZTRA 5FLXU 1RU1A 4O0NA 2EXUA 4K4WA 4LFBJ 3B54A 4C4WA 4M1KA 1MU2B 2C3UA 1SJFA 1NKEA 3GV5B 2ZUAA 4FN5A 2VOPA 1VC0A 1NBEB 2QSWA 4DX6A 1IKWB 2R7QA 5HQLA 3A8IA 2GNKA 2J7KA 1VI7A 4DSFA 4PAAA 1DURA 3BSOA 1CVJA 2R2TA 1I6JA 4N77A 4KV8A 1HMVB 4M5HA 2XYGB 3GTYX 2IYIA 3BGRB 3H7HB 4FXWA 3DU5A 3BGUA 3TZWA 2VD3A 3R7SB 2BMBA 2RQMA 1AYEA 1X4EA 3R8YA 3EGNA 5AE2A 5LT5A 1WI6A 4Y65A 1VQ4S 5F0UA 2QA4G 3C46A 5IT0A 1S9EB 4B3TF 3UN2A 1UA1A 1ULRA 2IJNA 1NDKA 5AXMA 2HNZA 4ZN1A 1NPKA 1Z2ZA 3DXBA 4ZVOB 2HQFA 2WVBA 4ZVFA 4CLZA 4Y2MA 3BQ2A 3OUYB 1DAXA 1RSCA 4U77A 3VHQA 2WBMA 1QVFR 1AFIA 3AJ2A 1FK9A 1SC1B 5B0EA 2FVPA 4LR8A 3PYEA 4IQXA 4WE1B 3E01B 1F9HA 1WHWA 5AJ3J 3I6PA 2ZOGA 2P1MA 3V4IB 2O66A 1E6YA 1VRUA 4I6YA 1X5TA 3HHLB 1MN9A 3PV8A 2E1MC 4ELVA 1R27B 5IWAF 4V19X 5HMWA 3NGSA 1OO0B 2MJNA 1M0SA 5IBKA 3CUNA 3KJFB 5G0RA 3DLEA 2BE7D 8RUCA 4DBQA 2OJ3A 3K0JA 5IT9U 4YB7A 2HS4A 5D3GA 1FRXA 1LW2A 3LGNA 3E2EA 3M6XA 3H2VE 5CD4A 1XNQJ 2DH7A 4ECVA 1Q5YA 4AXJA 3CEDA 5I3UB 1KVKA 2YPZA 4PG7A 4F7VA 4URGA 5A0YA 2VFRA 1SUQA 3PTWA 4CTAB 1NB7A 4RW9B 2JEGA 2JHEA 2LEAA 2ASYA 2ZVIA 3U7JA 3OTOJ 2BANA 1L3SA 1IBCB 5EWFA 1HHQA 2RQ4A 5ETRA 4IFYB 4O3RA 4ZVGA 1K44A 3W5YA 3M6WA 4ZIVA 1VYAA 1IKYB 5D4PA 3HVWA 3EWGA 1TKTA 3UCGA 2Z56B 1IWAA 3IR5B 4YOEA 3EVMA 3RJMB 5IS2A 2IM1A 3MCSA 4M5MA 1U0HB 3MI7X 2XY6A 1RGVA 5IV4A 2YQ0A 4JV1A 2HHUA 5J2QB 4LR7A 1D0EA 2RKIA 3ISNC 4F02A 2DTJA 2CNKB 4DR6J 3QO9B 3NKYA 3EYZA 2PMHA 2DXDA 2JWNA 2PT0A 2ZBQA 4E8UA 2V4RA 2YY9A 2CJKA 2E9ZA 4R5PB 4JI8J 4AXIA 1XERA 5E41A 1F2HA 1T94A 4DPXA 5K14A 3IBCB 2O01C 3MD1A 1OPIA 4RBUA 1NHVA 2XYHB 3NWRA 3J81U 3PIPQ 4GC6A 1SC4B 3W62A 4K4ZA 2CWKA 3VALA 1LWFA 2SXLA 5KT3A 5E2QA 1DBDA 1FNMA 1RZMA 1U09A 2MB0B 4CNYA 3QIPA 3L2OA 3PYDA 2Z8QA 3DDIA 4I4BA 4KGXB 1WC6A 4FPIA 4X4SA 2W8LA 3H5YA 4QR0A 3GR1A 2MQOA 3BSAA 4CIOA 1FDAA 6AT1B 3CDAA 5J2MA 2BYCA 3EGZA 1N54B 5DJBA 3LANA 1FFGB 2OD4A 1IBKF 3QT8A 4HLBA 2UUBJ 2JRSA 2ZH4A 2VDIA 2KRBA 2PDAA 5C24B 3A8KA 3IMQJ 2J9DA 3MCMA 2EBGA 1SJ4P 4CT9A 3OLBA 4NLSA 2EKNA 4Y2IA 5K5MA 1OIAA 2QLBB 1LKZA 1S10A 1YJ9S 1U1LA 1UFWA 2WVEA 1AB8A 3ENAA 4J37A 1NHKL 4RNMA 4YR0A 1V9OA 4M8LA 2YH0A 3ZNGB 2O5DA 1PSDA 3HHEA 1HNZF 1TK0A 4LF9J 1BXNA 2XSJB 3Q8SB 1OS5A 1EKRA 3CJ5A 4X66J 1KVIA 2EEYA 1SQGA 4X4OA 4NXMF 4URQU 4ZLPA 1NSKL 3FMWA 1RTZA 5J1NA 3KDNA 3SFUA 3M9NB 3KLIA 3DM2B 2V9KA 4W9GB 3HZEA 3DCAA 2F65A 3GG0A 5D0GA 4USUA 5L46A 4TY9A 1SC3B 5LM7E 2W7OA 1SBRA 5CA5A 1BHNA 4RR5A 4C11B 4LRAA 3LP2A 2MY7A 1Q1KA 1MLAA 4WPAA 4Q45A 3ZZ0A 2Z0GA 3RTVA 1JJHA 1T11A 2Y8YA 2XI2A 2FY8A 2CZ9A 5K20B 2VBZA 1SCJB 3GSDA 3N01A 3DFEA 4AL5A 4CI0B 3THPA 3GILA 2V69A 1VQYA 3HVAA 3KHGA 3Q8VA 2L9WA 2AP6A 2E1CA 2UXDF 4TKTA 3BO3A 4QPTA 3JB9k 3E4UA 5ETMA 1KQSR 2DY1A 2VQFF 3GSIA 4GMKA 4TU8A 2DIVA 1C0TB 3ONQA 3CNQP 4PWUA 3WZ0A 2CG8A 4I2PB 1GEHA 4KSEB 4IOBA 2B56A 1UFLA 3DOLB 2IC3B 3H5SA 1J27A 3GJSB 4DV7F 2KT3A 4DDFA 1Q81T 4Q2MA 2IA0A 1SIWB 4DV0J 3ZZZA 3MMCA 2ATCB 1QDUB 1M1GA 2H4YB 1J5OB 1T9TA 3RW6A 2OUGA 1FEHA 3GQCA 3ZZTA 4USJC 2KXFA 2CNOB 1NDPA 3LAKA 4WP3A 3C14B 1Q5VA 1OSCA 5E0OA 1FX2A 2B9YA 5J2NA 3IA0A 3FSXA 3W2WB 4QYRA 2AU0A 1Y0HA 1RTDB 3M32A 2HHTA 3CCTA 3RGIA 4ZPAA 1HNWF 3PYGA 2XNQA 1G7CB 3IWNC 1JJCB 2FB0A 3CCZA 4DPTA 2Z2ZA 2HHQA 2FY1A 3EZ5A 3SDEB 1DY3A 3VAHA 4DL0C 2P1NA 3KLGA 2L9DA 3L7OA 1SKSA 5FIIA 2EFNA 1Q53A 4DUZJ 2FNJC 1U2FA 1KWMA 4PRFA 2DITA 1SV5A 3UI3A 5CCMA 5CABA 4HACB 2V0NA 3A12A 2NCKL 2W1BA 3M8PB 2CVIA 1G1XA 3M52A 3FGVA 3MEEA 3TO8A 5L1KA 1T0TV 2GHWA 1LOUA 4LBIA 3J7YI 1I94F 4URSA 1A68A 1WF2A 3IWLA 4RKUC 1S1UA 2CPXA 5HJXA 1HBUB 1U25A 5HMZA 1GMUA 2HNYA 2IM3A 1CULB 1VDHA 4M5KA 2ILZA 4ZCMA 3TUIC 3ENVA 4LRDA 3T5JA 4N8OA 1ZAXA 3I82A 4KPYA 1FKAF 4JOUA 1W25A 3JTOA 1UAWA 2LVWA 2V8PA 4KH0B 5L38A 4OJHA 1VQMS 1UZDA 3GV8B 3R97A 4L74A 2KM8B 1W26A 2EBEA 2AT1B 1N34F 3G82B 5M2UA 3SCLE 5C2CA 2HZCA 2WSFC 4AT1B 1DFDA 1U6BA 3T5HA 4EYIB 1VQ5S 1FRLA 1GK8A 2B6AB 2ABYA 2QLXA 2R8GA 1EP4A 3M8QB 2Q66A 2G2YA 4DF8A 2V67A 4QIGA 1ICEB 3D1QA 4O4RA 2NLWA 3DLGB 4P52A 3D1HA 3F0NA 3M30A 1PAEX 4WKYA 4DV2F 1KEKA 1VK3A 1UW4A 3CCWA 4WFXA 4XDDA 3QLHB 2LQBA 1NDCA 2ZC3A 1Q78A 4I7FB 4ID5B 5KTQA 2QGFB 2DGOA 2ZUGA 5SZTA 2AX0A 3CD5A 3OTEA 2PEBA 3DI6A 2ALYB 2F3JA 3RAMA 2IHCA 3ZTCB 5AXKA 4DSIA 3HXMA 2P1QA 1KFSA 3D1OA 4B3TJ 2JL9A 4FF1A 4FXDA 2C3MA 2FGOA 3BGOP 3Q83A 2GQQA 1YITS 3KKFA 5IOLA 3ITHB 3GG1A 2MY8A 4U7UK 2QIFA 4OYBA 4DV1F 1TAQA 4KGZB 2HW3A 4Y2AA 3BN7A 3PVXA 1S5ZA 1W7WA 3GU0A 1V6HA 2HFUA 1U8WA 3HI9A 3V6JA 1JLQB 2CIMA 2RF2B 4N76A 2OO4A 2HLUA 1JLBB 1XJWB 1Q7YT 4K59A 3MWBA 2EG2A 2PPIA 3MMJA 2JEFA 4JV0A 2IF5A 3HVEA 2FVSA 4N5SA 3OVBA 3VGTA 5KG3A 1UCNA 2LXUA 3MZIA 1N4LA 3CULA 3ADAC 5AXNA 1KP6A 4OFZA 4OJ1A 3TQEA 2B43A 1N88A 1LM8C 1KLMB 3DHWC 2UZAA 3M2UA 4IFVB 1NNDA 2BJ8A 2HQGA 2DH8A 5IWAJ 2LEPA 3CWJA 3BREA 1TR0A 4TNOA 4ZCLA 2DIUA 1YKWA 1S6QB 3NGUA 1CJTB 3PACA 2Z30B 2VG5A 1HI8A 4C0BA 2XMTA 2YY3A 5KT7A 5D6GA 2XSFA 1AFJA 3T5KA 3JSRA 3PEJA 3BO2A 1RHMB 3BQ0A 3O3LA 2WK4A 2RRAA 2YKPA 2WSCC 2ADBA 4ZP8A 2DR8A 4IDKB 2CJBA 3WC0A 4GO7X 4NPOA 1RI7A 4DR4F 5D77A 3HHLD 2F9JA 3BBBA 1IQZA 2LEBA 1U8SA 5D8HB 3BS9A 4XO0A 3MECA 1JLCB 2I8EA 1B0PA 2PFFB 4L75A 4F50A 4PUOA 1BMQB 3DMJB 1CS3A 1ZA2B 3KLFB 4W9FB 2K3IA 4ANCA 2EFQA 2NSCA 4EI2A 1RWUA 5HP1B 1XR6A 2C2KB 5ETOA 3KWMA 3S7RA 3BDPA 2W8KA 1R6VA 1HA1A 1VBXA 4A8FA 3EVOA 2K7JA 2GGPA 3KG0A 2DR6A 5KFCA 4X65F 4KKOB 2P2CB 2QZ8A 1SKRA 4LF8F 3FSYA 1CEZA 2FHJA 1WACA 2AV5A 4YB5A 2XMKA 4FYYB 2QX0A 2C9WC 1CJUA 1D9AA 4DL4A 1QDVA 3G8SA 3MTJA 5KFBA 1T8EA 2DRBA 2KHDA 1D8YA 3BF4A 1HNVA 4J9MA 1S57A 3GCXP 2W2OP 3H90A 2XMMA 1Q0NA 1FS2B 2DNNA 4LF7F 3S6EA 2GAGC 5HL7Q 3O1LA 4W9IB 3PX4A 1HNIB 1NH8A 2VPWB 1UFKA 4BKSB 5D0HA 3JSMB 2CJ9A 2J6UA 1IBKJ 1PCAA 2CNNB 3C19A 2RU3A 4NYZA 3LGHA 3DRPA 5T14A 3I4PA 4M5DB 4QJVA 5KFFA 3DLHA 2JX2A 2U1AA 1H2UX 5IT4A 3BV8A 5CH7B 4YN3B 1LEOA 4Q8FA 2MZRA 4N41A 1FRMA 3FK4A 2GO9A 5JVGQ 3MR5A 2KU7A 4JTDB 4OYAA 2LLZA 1F2GA 4OI4A 1JLAA 4CXJA 2HLTA 4ATNA 3UNGC 2XI3A 2W2PP 4RW8A 4I67A 1TL3A 3D5MA 2JNJA 1HNZJ 1LWEA 1DSXA 4ILLA 3IM9A 2XMVA 2E44A 2HRYA 5H9FJ 3TARA 2ZBIA 3QRQA 4WIIA 3Q8QB 4OZJA 4NXMJ 3TZYA 4CH1A 1QE1B 2OD6A 3D2WA 1GMWA 1U0SA 4RW7B 4LT6A 3IRWP 2N7YA 3OR2B 2OEJA 1MG7A 1IR1A 2VKRA 2JFKA 3HM9A 3FFIA 2KL8A 4C98A 2CZ4A 3HKZD 2IM0A 1MROB 4TY8B 4K0KF 3DOMA 2DT9A 4PXBA 2YWFA 2KYZA 1K8AT 4UYIA 3ZRFB 1RT5B 1RAFB 3KK1B 3R3TA 1H2TZ 1UW9A 1JLEB 3NGTA 3R2DJ 2E7XA 5FLXY 2CDRB 3KMQA 1RCXB 3IR7B 1HWLA 1X60A 4XIUA 2J7WA 4X4PA 2OHDA 1H73A 4RNHA 2VFTA 1WDDA 3N6LA 1JKHB 3N0VA 3QIDA 1HKAA 4NA1A 1HWUA 1HBMB 3J7AN 4KO0B 2VG7B 3DOKA 5CYQB 2Q6CA 1XQIA 4FYXB 2MSTA 3MEDA 3QNWB 3ILJA 1TTHB 4QWAA 3OVSA 3ILOA 2UXDJ 1TKZA 3MEKA 4BC9A 3MM9A 3KJVB 2UV8A 1M5PC 1YQHA 3PW0A 2VQFJ 1OY6A 5D15A 1NB2A 1OY8A 1TAUA 2Z2YB 1TL1B 2K1RA 5B08A 2OVPA 4YQWA 4DV7J 3WC2A 1Z4UA 4QW8A 3LUTB 3LF0A 1S1GA 1GX5A 2W9CB 2AHOB 3MCNA 2NZ0B 1IKXB 1H6KX 3R5DA 3MM7B 4OX6A 4UY8T 1Q7LB 4WFBQ 1KTQA 3BZQA 1JNRB 4UTGA 4CLFA 1B99A 2UVVA 2DEIA 2V50A 1R8BA 2RS8A 1SH2A 2MZTA 4FS2A 4UUWA 3PKYA 2CQ3A 3O8WA 4CZCA 4DSEA 4DG1B 4OHYA 2H54B 3QBCA 5BJRA 2ZH2A 3I56S 3CDBA 1HNWJ 3KUEA 1NCLA 1OMSA 2XZWA 2AJFE 4ES1A 3QFWA 5THWA 3MF5A 3HVRA 2DNGA 1S1WB 1ROFA 2YQ3A 4FNHA 1WELA 4ED1A 2MZSA 4A8SA 4OZ0A 1R0CB 3B6BA 2DNMA 3SXLA 2MMYA 2V9WA 3OL7A 4DEZA 1DTQB 2PEHA 4Y6IA 2AJ4A 4IG3A 4CRJA 3MPUB 3ZFVA 2F8HA 1WG5A 4ZJQA 3CVKA 2W9AA 4ECQA 1RWOB 2L9NA 1R6YA 3KG1A 2QT7A 5IT9Y 3OR1A 4LIRA 2VPZB 3AA8A 2K06A 3IBFB 1I94J 1N5QA 2R8IA 2M3DA 3S8SA 2CPIA 5E5NA 3DLBA 2HBQB 2JZ3C 2QC3A 4B3SF 5KFEA 1XTZA 1NRKA 4ZCIA 1G4CA 3M6VA 2XO6A 5HN0A 3BN4A 1FD2A 4AL7A 4PCQA 4F4WA 4JI1J 2KT5A 1KHVA 2YQ1A 5JUMA 1WC0A 4P2XA 2HVEA 3JYTB 2OP5A 1YTYA 1UJ5A 3M1VB 3MEGB 1N34J 4DQQA 1N52B 1UKUA 1FKOB 4WK3A 2QG9B 4DFJA 3SV4A 2QMXA 4LSNA 5KFKA 7AT1B 5K9FA 1UL3A 2XB2D 3H5XA 4JI5F 1NK8A 2HVZA 2ALZA 4YY3F 3NS7B 1N33F 2RMLA 2R8HA 4HACA 4L72B 3AJDA 3D4JA 1GFWB 3SZ2A 2ASTA 1O6XA 4CO3A 4P7TA 2BVZA 2MQ8A 1FRIA 1UVKA 2YWWA 2KFZA 3BJYA 4FYDA 2CPHA 2R7UA 2H3EB 2HFZA 4DFPA 3HHDA 4O3SA 5C25B 1TFYA 3X1LB 2QV6A 2X3DA 1IBLF 1X0PA 3NWGA 3HD1A 2PFDA 2YNGB 1C0UA 5JVHQ 4ZP7A 4F25A 4ER8A 1VCTA 4FZVA 1MN7A 3W65A 2YNHA 2FLPA 3RB6A 2XY5A 4LF4F 1K47A 1T03B 5F8LA 3PJ9A 1S1XA 1T95A 4P72A 1YJUA 4DV1J 1YI2S 4M94A 2EFGA 5HROA 3W63A 3KNAA 4KRWA 2YWEA 2J6SA 3GWCA 5DDQC 5BYQA 3NNHA 2NS1B 3UWTA 1ZZFA 1ZOTA 2ASDA 1X0FA 5F8GA 1O5JA 2YH1A 1P1TA 1WEZA 4BBYA 2V94A 5L1JA 1H2VZ 2IBOA 1JLGB 3SQGA 3M8QA 4XK8C 3K8VA 1IKVA 4FBTA 1NAQA 5BXBA 4J9UE 5DZ7A 3KK2A 3QJLA 5LMNF 3PCOB 3PZPA 3KXDA 2BBEA 1SQFA 5F8NA 1HHTP 3DU6A 3UD5A 4KE5A 5HVHA 1IVZA 5KG5A 2RHQB 2GQ2A 2ZNZA 3IRXA 3U1NA 1AZSA 2Y0SD 4H4OA 3VR1A 2IJFA 1Y5IB 1Y9OA 2R9RB 1XC9A 2GVDA 3CCLS 4KHMA 1FRKA 3LP0B 2HBZB 1O51A 3TJAA 1HYSA 4HXIA 2V6AA 1CBKA 3HFVA 4FKYA 2HHSA 3LP1B 2GJFA 3EUNA 4QIEA 1QSYA 1VLOA 2C3PA 3A13A 5HI7A 1UEKA 2B5JA 1RHUB 5SUHA 4LF5F 4X4TA 1WC4A 2CQCA 2P8IA 1S1VA 2W2MP 1SJRA 3R5JB 4DR4J 3OTDA 4IO9Q 2LQ5A 4ZLLA 2MZJA 4LSLA 3QZ8A 1RU2A 1T9VA 2B3TB 3O44A 3RB4A 4DPYA 1N5TA 1YRUA 2X1AA 1M5VC 2RDJA 1XMQJ 2RDIA 1XR5A 1SXLA 4WFNQ 1N0VC 2IMOA 4DQPA 4KQZA 2QFJA 1S7HA 5IXUA 2MQLA 2IRUA 2HVDA 1B0TA 3MUVP 1FFWB 2HS3A 2LP4A 3AH6A 1RT3B 4OYOA 2G0JA 3ZC4A 1VQ9S 4X65J 4BWMA 4G6VB 5DETA 4K5RA 4LF8J 1T05B 1NZ8A 2IHR1 4NLOA 2G0IA 4AUKA 4MK8A 1ZAVA 5EWGA 1TZ0A 4Y2CA 3R5CA 4F4AA 3JAMU 1RADB 2BACA 3T3FA 3MKSA 2WOMB 1IM6A 4NL5A 3MR3A 5K8OA 3E8OA 3KFWX 1U1QA 3F56A 3CMQA 2E1AA 1X31C 4IDKA 4B02A 1P1LA 3M2VB 3OJUA 4UF4A 3BYRA 4NLXA 4EWTA 5B0BA 5JXSA 4DZ6A 4WP9A 5H9FK 4WIQA 2OH2A 2B7CB 4YDXA 3ZTOA 5A2QU 4HHHA 3CCMS 1U24A 2HKEA 3QGIA 1F3FA 3T5LA 1S4EA 2C22A 2EK1A 2AYGA 1NPPA 2ZH8A 3L95X 2RU9A 3WHIA 4KHPF 4CLPA 1KQFB 4KV8B 2BEFA 4M5LA 4ECRA 3QGGA 2ZH9A 1FERA 2R7SA 3GR0A 2UXBJ 1U6FA 3HQIA 3HKWA 3NEKA 3LW5C 1DZ5A 3CJ2A 2VFSA 2J9EA 1JIHA 4N9F5 1F1BB 1I51B 4AL6A 3H8YA 3CMAS 1Q8KA 1YDLA 4WFAQ 3AOAA 5BXIA 1DARA 1IUJA 1U6ZA 2HNZB 2HGNA 2JOQA 4HHUA 2HRTA 2AGQA 4DSJA 3PYFA 8AT1B 4JI2F 2VPKA 4TLRA 3KHLA 2OPRB 2HK2A 3IAS9 1YZ6A 1FK9B 1VJQA 5HQ8A 3TYTA 3KVTA 2KO1A 2YKAA 4K0KJ 4CH0S 4DX5A 4ZJOA 2F9DA 3BYPA 2NUUG 2RRNA 3RG6A 3HHNB 3ENWA 2FHKA 1EAYC 4TU7A 2KB2A 1FE0A 2E1PA 2VBWA 4G1QA 4CM0A 1E6YB 1VRUB 3I9ZA 3AODA 3CB4A 3HF5A 3H98A 5HAOA 1CJVA 4RUAA 3E51A 1KD1T 2H65B 2JEJA 2FPHX 1ELOA 2YTCA 3POTA 5IFMA 5G0RB 2BDPA 3CDEA 4DHVA 2C28A 3FSIA 2B4OA 4HL9A 5F8MA 1JJ4A 4PPZA 5D3GB 1LW2B 2ZDPA 2AW0A 2HVHA 2ZHBA 1X4DA 4DZDA 4W9CB 4ES2A 2EW9A 3RRKA 1Q8LA 5A0YB 5CD4H 2BZ2A 2BUNA 1SUQB 2HBRB 2XULA 3A8EA 3IGNA 6FD1A 2J9DE 1XR7A 1UJ6A 1NLKL 2BANB 1S59A 2RVJA 2MQMA 3EMTA 2H4WB 4P74A 4PABA 4TY8A 4DI6A 1TKTB 1HBNA 2D1CA 3UNYA 4DFKA 4A8QA 3J80Y 2LCWA 2W9BA 5JMNA 2BJ1A 1KLNA 3ZZUA 4B9VA 1ZS6A 5DG7A 4UOGA 3J7ZT 3BR8A 2RKIB 4USHA 1UPMB 4NLRA 4USVA 2VQEJ 4BC7A 4C8LA 5MLCV 4RX6A 2GV1A 1OSDA 2PSZA 3ZZPA 2UXCF 1H7XA 4PR6A 2AGPA 1XNRF 1YJNS 1BE4A 1XMOF 1S1TA 1H72C 1JJ2R 1WDTA 2W7AA 1YJ7A 4L6V3 1PAUB 4CCHA 1RA6A 5K14B 2RILA 2X3GA 3PM9A 2KVIA 3OSPA 2HPUA 3NS6A 4X4QA 2DGTA 2HWTA 3V81A 2XYPB 2LA6A 4JGHC 2WBRA 1LWFB 3C6OA 3HCXA 2RE1A 3HHLC 2VUGA 3QIPB 3UDEA 5BYSA 3IM8A 2GMLA 3SV3A 1L3KA 4KYZA 5J2MB 4WP8A 3PFOA 2CAJA 4LIWA 4B3SJ 5K8PA 4NLGA 1UVJA 1FX4A 3W9HA 4MTPA 4C48A 2MEWA 4MH8A 4FYWB 1T3NA 5EDWA 3F41A 2WSEC 2MKCA 5LXYA 1UA0A 3T1AA 2C2NA 3IXQA 2CQ0A 2R2RA 1TL4A 4ED0A 3TWZA 2E5IA 2OSRA 4CQ1A 4U8VA 4DV5F 1D8ZA 1UP1A 2N3OA 3LWMA 3SCKE 3FQLA 1NJYA 4H54A 3OQ2A 2R7WA 4HH1A 1VGYA 2FVQA 2ZJPQ 4IH7A 2HGMA 3Q8YA 5LLIB 4JI5J 1B4SA 3GIRA 4F4XA 1T3OA 2DNKA 1IBMF 4YY3J 4J7CA 1N33J 3HX9A 1UMJA 4I1TA 1FE4A 1IN0A 2JEIA 2HG4A 2KVQE 1RTIA 5F0WA 1EETA 2CVEA 4ZPTR 1FXLA 3KLIB 3LALA 2BE9B 1NKBA 3H5UA 1FXRA 4M5IA 1MWZA 1RWPB 2VASA 1P8GA 3C6UA 3K57A 1FWLA 1IBLJ 1Y00A 2GIRA 3EM1A 2LKZA 2FLNA 2U2FA 2ACMA 3LP2B 3KTQA 5KFUA 4KT0C 2OFGX 5GAGU 3PR4A 2HQIA 2MLZA 1T9XA 4ZP9A 2E66A 2BOAA 1GQEA 4FPRA 2VIHA 4LF4J 2OPQA 2UUTA 1YX2A 4CLWA 6FDRA 1VRTA 1KRPA 3JQKA 1KQGB 5RUBA 1WEYA 5CYMA 1DLOA 1DQAA 1YRXA 3CJRA 3N4WA 4DQIA 5D4OA 5H1SV 1UWAA 5H7GA 5EX3A 5KFXA 3A8JA 4HKQA 4Q44A 4XPEA 1WJ9A 2XHWA 1M5SA 1WC1A 1L3TA 4H4KC 1NXIA 4BCAA 3BO4A 3CC2S 3RW7A 3LPYA 1OY9A 4C2MA 4NRUA 5KFVA 3KLVA 2NPIA 4ES3A 4JI4F 1LFWA 5LMNJ 4CXIA 4J9QA 4IYQA 3MMCB 4W9DB 1KHWA 3OD2A 2HQ3A 2CQGA 5J1EA 4Q0BA 4ZGCA 4LBPA 2NUHA 2XMAA 5KFPA 4CLTA 4Q2LA 2Z2LA 2DH9A 2XNRA 2IRYA 1OYDA 3HHKA 4IQMA 4QYZJ 2EC2A 5J2NB 4MIBA 2LQJA 2DNRA 2YWKA 2GW8A 3MAAA 1N5YA 2FZCB 4B9SA 1QSLA 2ZH5A 2L48A 4RWXA 2QLWA 1RWWB 4ED6A 4B08A 5GAGI 1U47A 3HD2A 4LF5J 3QAUA 4J9LA 2GCFA 1ZM3A 1E6VA 2NXCA 5KFYA 4P71A 1L3VA 3KLGB 3CCUS 3VGVA 2R4FA 1PC5A 4IOCQ 3DGPA 1UTAA 3NGDA 3HSJA 4KC5A 1KDNA 4M63A 1SV5B 2QN6B 1S0OA 1FF2A 2KG1A 2E9TA 5DG8A 5E3AA 2DNHA 3D3CJ 2MKKA 2VPXB 3MEEB 2CKWA 4ITSA 3PW4A 2BM0A 3TAMA 3CW2C 2B4PA 1H7WA 1S1UB 2YX1A 5HMYA 2QA4S 4NOHA 5KFJA 3V6KA 2YNFA 2BV3A 5DO2A 2HNYB 2HNDA 1S72S 2VKPA 4EZ9A 2QO3A 4FP9A 1J2VA 2XY7A 2R7RA 3IWXA 2FYXA 2HWHA 2IM2A 1IJFB 4TLQA 2DGVA 1RBOB 2J76E 3RRGA 3CJKA 4B9MA 2E7VA 1M5OC 4OI2A 1IR2A 2A2CA 1HWJA 3DLJA 1FTRA 1EKSA 1VOMA 1HR0J 3IG1A 3EXYA 4PQUB 1MNEA 2ZWPA 4TVAB 2I6WA 4ENOA 4F4YA 5F3ZA 1N6QA 2YKNA 2ASLA 3V2UC 3MAQA 1EP4B 4LF6F 3PRBA 3GIJA 2ZWOA 1B3TA 3M30B 5DDRC 4ZVEA 1FXDA 2CQBA 2D9PA 4KHPJ 3D6HB 4O0IA 4BKTB 3MGJA 3K7RA 2BW7A 3K59A 3I96A 2VG6A 3EGVA 2H9ZA 1LQBB 2IVFB 1NU4A 1R89A 3MOZA 4NYPA 4UZCA 3RAQA 1TL5A 1FKPA 5IC4B 3DI6B 3VZHA 3TP2A 3UR0A 3CC4S 4UW2A 3LQVA 5M2RA 3THVA 2KH9A 4TXSA 4K4UA 1URRA 5F8JA 5ETTA 1RISA 4C3KA 5AE3A 3OTBA 4ECTA 4QCLA 3G9CA 4ETXA 3M8ZA 2C3OA 3LPEA 4A8WA 4BWJA 2UU9F 1KVJA 1OPZA 1PBUA 4NZ0A 1MMNA 4Q8EA 1T1DA 3L7PA 4EGLA 1GTHA 3EPGA 4TQSA 2HGLA 1Z2LA 4QR1A 1VRQC 3NLCA 1IQTA 1KOOA 2DJWA 4RUBA 3FJ2A 4JI2J 5HLFA 2ZITA 1N56A 2XWXA 2WVFA 2E5JA 3N5FA 4DCOB 4KIAA 4OJ3A 4PWDA 2L3MA 4NMXA 2E9RX 1TUVA 1LWCA 4F0MA 2XCPA 3HVEB 2CA9A 2QRRA 3QJJA 4X4RA 2HHVA 4YR3A 3TZXA 4NZ6A 2B9EA 1YJRA 1ZYQA 3BQ1A 1VFJA 4M95A 2QL5B 2ASJA 3HTMA 3M2UB 2FQQB 2KM8C 3CCRS 5F8IA 3CCSS 4Y2KA 3SMZA 1LW0A 1MMLA 1RYRA 2V34A 2VJVA 4FDFA 4U95A 2N82B 2M2BA 5GMKa 3FEZA 5B7WA 5DGBA 1B7FA 2VG5B 2DR9A 2NSBA 8ATCB 5L1IA 1AUDA 4IR1A 4WZMA 1FD8A 3JXOA 2W4CA 2DGXA 5KG1A 2BQRA 4MT1A 1WKJA 5LSRA 5D0EA 3CJ4A 2G0CA 2VBXA 5DDPC 1S48A 3A3OB 2CJXB 4OLOA 3FZBA 1X4AA 4GO5X 2OPRA 4PG5A 4LREA 3L7UA 1WKLA 3GE9A 3MECB 3OL9A 2GJ2A 4OI3A 4YB1P 4F0KA 2CNLB 1QTMA 4PUOB 4CRHA 4XAKA 4W9JB 4R0JA 4KFBA 1RAEB 2WHOA 4E2FB 3KLEB 3SSRA 2OEKA 1TKDA 3W2VA 3FBCA 5F8HA 2W01A 1ACMB 1EIYB 3OLAA 2KFYA 4CLLA 1UWBA 2XCAA 1SQEA 2UXCJ 1VQOS 2GGPB 1PYOB 1XNRJ 3QSIA 1JXLA 1SJQA 1XMOJ 1X9MA 4ED4A 2IMWP 2R42A 2E32B 3IP0A 3CTRA 2EVZA 3I9V9 2XLIA 3DDNA 2PMWA 1CJUB 4OHXA 4P2MA 1RAIB 3K5PA 3I0SA 2NYHA 3C15A 1X7VA 2ZOMA 5KOWA 3UVJA 4PZVA 2BQ3A 1UZHA 1SI9A 2B4VA 4D3HA 3CSKA 5CQGA 4NXNF 4DPWA 1DTTA 3MFIA 2HHHF 1HNVB 3L09A 2BJ7A 4LQ3A 1F5BA 1VQ6S 4G3IA 2AEJA 1R8PA 3RBZA 4DF4A 4IRCA 5L39A 1WSVA 2FDNA 2LA4A 3H2UB 1RTHA 3RUBL 2VC1A 3LBZA 3DRPB 3PFEA 1HBOA 5KOXA 3C6TA 2DHHA 4NLDA 2UUAF 3HMJG 4J8ZA 5CZXA 3M7VA 3MPVA 1WORA 2AKWB 2B7BB 4ECSA 2Z4PA 3R5AA 3HFZB 2DPJA 4ZPDA 4DV5J 2VOOA 3M05A 3CXCR 3VAJA 2WW8A 4NLQA 2YWHA 4HTJA 3WIVA 3PY8A 1JLAB 4KGVB 4M5JA 1TQLA 4RW8B 2MQNA 1TL3B 5GAHU 1CC7A 2E5LF 2F8MA 3T6JA 1HPZA 3AA9A 1Q8BA 1LWEB 1REVA 2HAFA 2OVRA 4QQBA 1IBMJ 2H5JB 1PIEA 1P9QC 2RRBA 2DNQA 3AB2B 4B9TA 3M8WA 3KLHA 3G6YA 2ZHAA 1I3OB 3EE3A 3T41A 2PI4A 3I55S 2BR0A 4K4YA 5A6WA 3JAMY 3ELHA 1WSRA 4WTOB 3FFIB 2C2MB 2V4JA 2FGCA 2RJZA 3DOMB 4K4VA 2J8AA 5HYWB 4UOCA 3IN5A 4IOAQ 2M0GB 1S6OA 4N7TA 2ZD1A 2Z57B 1X5PA 5A8RA 3CO9A 4OV6A 4H4MA 1YWXA 1H38A 2Q1LA 2IZVC 2ZZTA 1D3WA 3Q8UA 4Z37A 3PX6A 2Q81A 5A2QY 4TN2A 1VS3A 3H25A 4NLWA 4DJBA 3BSCA 3UW1A 4RW6A 1RACB 1HHSA 4QYZK 3DOKB 5EX0A 3RB3A 3FBEA 2H48B 3MEDB 3GCWP 4IH5A 4OYPA 1TKZB 2YPYA 1SB6A 4WBFA 2F40A 1QDWA 4EU0A 3MM9B 2WONA 1SC6A 2BJDA 1I1GA 2HFNA 4KH1B 4P2FA 4E0DA 3JQJA 3KYLA 2K1RB 1EB0A 4CM2A 2E1RA 2DNZA 3W60A 5GAHI 3R7BB 3BDEA 3WX4A 2FVCA 2ZBRA 3AB4B 4JI4J 4TYBA 3QZ7A 1JLFA 1WF0A 1X4FA 1KKHA 2XGQA 4N56A 3Q0AA 2BRLA 3NNCA 1T02A 1QUPA 5B0DA 4F8RA 1NK6A 5DM6Q 4WKRA 2HFOA 2J0WA 2AJQA 2MHNA 2C2OB 2CFXA 3KJQB 5BR8F 4KTQA 4ELUA 1XWLA 4U8YA 5I4MA 2CADA 2DO4A 5EUHA 1VBZA 2A6MA 4R25A 2W2QP 3UDVA 2NXUA 2DKOB 4GC7A 1FJCA 3CJSA 3M2RA 3TNVA 1X9SA 2AD9A 2JDJA 1V5IB 2KDOA 1FVQA 2BKPA 1X9WA 2ZM6F 2KKHA 3SSSA 3R2CJ 1H0HB 4X4NA 2AF6A 1NH7A 1SJ1A 4J90A 1YSJA 1Y4ZB 2GHPA 4IG3B 4X84A 2GVZA 4ZVQB 2G9OA 2QFIA 1EOFA 4DV3F 2ZJRQ 3R6LB 5A15A 1C1CA 3TUZC 4OX8A 3GFHA 5LSLA 1RAOA 2IA6A 3MFHA 3CD6S 3OR1B 1UVLA 3GFZA 1PC4A 3NY0A 2VHGA 3AT1B 3BGLA 2V2ZA 4K50A 3SSQA 3Q2TC 2ZHOA 4OMFG 3A1YG 4NLYA 4DR1F 1A0OB 3DLKA 2A79B 3OVAA 1RT7A 2J5AA 2KJWA 1CPZA 3MM5A 3PW5A 3GIKA 1KBRA 5KAKA 5ETVA 1QAIA 3IBWA 4C7QA 2LXFA 1M90T 1R7IA 5KFLA 4LVOP 1NKCA 3B4DA 2DPIA 4L3NA 2MA9C 3CCQS 4ZA1A 1FWKA 2G1DA 2J0QD 5KFDA 1U2RA 2QMWA 1EJ7L 3SYZA 3EZOA 4HHJA 2HMIA 2M5YA 3HFKA 2ZH7A 3R5GA 3HK2A 4LSNB 4MMOA 3I0RA 4V1Ak 2OTLS 4OZ3A 2CZVC 4JV5J 3OFHA 2ASSA 4XTTA 1RBLA 1EOEA 3GMGA 1RAJA 2DXEA 4ZK7M 4ZVTB 2QLFB 4DQRA 2D3ZA 4P75A 3W66A 1URNA 1RA7A 2C2RA 3VWSA 2IIHA 2CWXA 1G6BA 1ZA1B 2COLA 2M52A 2HWIA 4M5GA 5C5JA 3AFGA 2ZE2A 3GZ7A 2Y8WA 4NCGA 2DRAA 3GYXB 4C97A 2IAJA 1C0UB 5I3QA 5DAFA 5D0RA 2CJYB 3M9MB 4LFAF 2YKOA 2G2ZA 1TV6A 2YNHB 2YKQA 1DRZA 1IJEB 2IDEA 1APSA 3MR6A 2YNIA 2UU9J 3Q23A 1S1XB 2KI2A 5IM0A 1F60B 4LRFA 5HROB 3CJTA 1SVDA 3G6VA 2ZFHA 3C8YA 2HRUA 4PQUA 2GMHA 2YWGA 2MPUA 3UN5A 2XS7A 1RWVB 3VGSA 2LU2A 3RZAA 4ANDA 4IH6A 4EFAC 3SQGB 3BKUA 1IKVB 5KG6A 3N79A 1HL6A 1T7PA 3KK2B 4ZLJA 2GMJA 3R27A 2FUG9 3FKCA 4C8ZA 4IRKA 5AXLA 1ZBTA 4A8MP 2WVDA 3JTNA 1T9WA 4RPFA 2CG4A 3HZGA 3IRXB 1AZSB 4U9RA 2XMUA 1FT8A 3AQOA 3GIMA 4OIXA 2QE5A 3Q8RB 4H4OB 2DHSA 1FJGF 5A8KA 2ROEA 1A7GE 3CT9A 3QSYB 1PYTA 4EO6A 2GVDB 3UD4P 1HQEA 1DJ0A 5M2PA 1HYSB 3FEYB 3KOAA 2LQ9A 2J9CA 3VZIA 4ZS6A 4F2SA 2QA2A 2B5JB 3LUYA 4QWEA 1FDNA 5I3PA 3J80U 1S1VB 4NE9C 2YXLA 1LWXA 2Z2MA 1S6PA 3K17A 4NCBA 4A8KA 4LSLB 1BQXA 1BWVA 3OPKA 4W92B 4DL6A 2Q79A 3IC1A 5T7LA 3DXSX 5LSOA 2J7UA 4I2QA 4BGCA 3QRRA 1EQ0A 2IDLA 3Q24A 4C9DA 1RT2A 3A3PB 4YS2A 1YJVA 1S9GA 5KFOA 1U1PA 2R2SA 3U1MA 1YGYA 2HAIA 4AFFA 4PKDB 4DSKA 2LQ8A 1HARA 4N8NA 4I64A 3T1YF 4C8NA 1RQ0A 4O4GA 2OTJS 4HYKA 3VAKA 4JYAF 3PNIA 5KFIA 1CJKA 3THTA 1VQKS 4C8KA 2MHEA 3M4XA 1AROP 3FRYA 3W9JA 2RQCA 3DHXA 4MFBA 3V5RA 1VQLS 3ILIA 1RBAA 4NXNJ 3KG4A 2HHHJ 2FJAB 2FJDB 4QZVB 4NLUA 5FDLA 2E5HA 2ZOFA 1M1HA 3V4MA 4G65A 3AD7C 2LFVA 4IRDA 1BUXA 5HK4A 3U02A 1Q16B 3NL0A 3I5AA 4DR3F 4ZHRA 5HATA 2IVYA 4ECXA 4Q5VA 5GAEU 2DGUA 4X62F 1TK5A 3UD3P 5KG4A 3KLEA 2MJUA 2BM1A 2UUAJ 1N5SA 2FHJD 1H74A 3OW2R 4BDPA 2OI2A 1ZETA 5ITHA 3D54A 4I6AA 2AJ2A 3EDRB 3BEGB 1NJWA 4JI3F 2A1BA 1YZ7A 4TYAA 3ZTSA 3MM6A 3VGUA 4P73A 1FO1A 3NAHA 4MIWA 3B4MA 2LU1A 2X51A 4ZPBA 5C42A 5KG2A 2R9LA 1HWKA 4ZPWR 4USIA 2E5LJ 4KJIA 1N5VA 3LNMB 4W98A 3GB0A 2ZVSA 3UPFA 2B4UA 1JXEA 1RT6A 3IFEA 4GRSA 1HIYA 2DISA 2OAUA 3UDLA 3W61A 4RL1A 2XZDB 5C7PA 4IUFA 4ICLA 2E29A 2L08A 1ZPVA 4I6WA 2P9EA 3G87A 4W9HB 3F44A 4GKJF 3SCIE 5F41A 2EK6A 3Q86A 2KN4A 1Q95G 3P3DA 1D9DA 4DPOA 4W9HH 2OPSA 3TAPA 1B7YB 1RWKB 3IS9A 2HBYB 1IWGA 4G1QB 4DMZA 2M8DB 1PG5B 1AW0A 1FFSB 2MZQA 2FJEB 2BXJA 4RW4A 3DRRA 3M8YA 2CPYA 2PGCA 1BD6A 3R5BA 5GAEI 1CJVB 3ZRCB 1HNXF 2EI5A 3WX8A 3TZZA 3RBEA 1JB0C 4I6JC 3POTB 5HVFA 2FJWA 1WNEA 4KHRA 3BPSP 3OL8A 1GMWD 4J91A 2N4CA 2V8VA 2QL9B 3UQSA 3M8RA 2ZBCA 4ANEA 3QFHA 4HDGA 2FLLA 2MKHA 5DS7A 4UT4A 2V8DA 1S99A 4M5NA 1PJ5A 3BM7A 2CQ1A 1CS4A 4QWDA 1S7IA 3PR5B 3MXHP 2JVOA 1DQ8A 5B09A 2CPEA 1GNKA 1ZPWX 3CO0P 3TA2A 3I5BA 2UP1A 4O44A 4FNIA 1WUUA 2IVMA 1YLXA 2VFVA 1AT1B 4YFUA 2HIYA 1HBNB 1U7LA 3FMBA 2A0FB 4RUHA 2Y0BB 3B78A 4R8UA 4C8OA 2N3LA 2W25A 2I2YA 1YIJS 3D0GE 5LJ5Y 3MCOA 2W9BB 1QLNA 5BR8J 1LFPA 2J0XA 4WWSA 1KN6A 3FZ2A 3RRHA 2FZGB 1EX8A 2LMIA 2Y1JA 3LH2S 2KZMA 3TEGA 3IO1A 2DXFA 4DFMA 4NX9A 4P10A 2Y1IA 2E31B 3PO4A 1TL7A 3FRZA 2VL1A 2E7WA 1RLCL 2ZH6A 3NMRA 3MOJB 3N6NA 4MK7A 4EZ6A 2ZM6J 1B64A 1SL0A 1S1TB 3QGPA 3K5OA 1WOPA 4P2SA 2RIJA 1S0MA 4HTIA 1RJJA 5F9LA 3B8HA 3VCDA 1H3DA 4K2JA 4F2RA 2P6SA 4WXWA 4WCEQ 2O67A 3V81B 4DV3J 2DNYA 2F8EX 1HWIA 3OFGA 1CG2A 4NA2A 1BLUA 3RU0A 2F7VA 1X8DA 4ALZA 1JQGA 3DYAA 3DNCA 2V63A 3CJQA 5EUPA 4W9LB 2XMJA 4DR1J 3JQMA 3KNGA 1TK8A 2H5EA 3JSBA 4DSLA 4KPCA 1WG4A 2VA3A 2LECA 4HT5A 4F3MA 1RTJA 1VIOA 2EFOA 1RAAB 3HULA 1FVSA 9ATCB 1NK4A 3MPYA 2N4DA 3W8GA 2ZZNA 3EJMA 2NXEA 2GIQA 4QPXA 4ZVHA 5DADA 1BUOA 1RHRB 1SJ3P 2RUSA 3GLJA 2KZZA 2HHPA 4NCAA 1IM4A 1PGZA 5CXTA 3OGKA 1U1OA 2B9WA 3ULHA 5E3RA 1V3RA 3KUHA 2AZ1A 3R1LA 3HP6A 1U1NA 2XQCA 2M88A 4HI1A 1M1KT 5DLGA 3SIPB 3MMBA 3W3SA 2PO4A 2FC8A 4ECWA 1SL1A 4OHVA 3P5TL 4U2MA 1U1MA 1C2PA 1ZM2A 1RTIB 4LQ9A 1K0VA 3W5ZA 4YY8A 1EETB 4GVBA 1P6TA 4OYIA 2AJ1A 5KFMA 1C1BB 2XS2A 2HK3A 3NBPA 4B3OA 1KQKA 5DG9A 2WW4A 2P9GA 2DGWA 3D28A 1FHTA 1BQNA 1O0PA 4CYUA 2CQIA 3C6UB 2FHOB 3KK3A 3HVTA 2WTFA 4LFAJ 3Q8PB 3MMAA 2BJEA 4I68A 4Z7CA 3WSOB 1BQMA 3BIMA 5HMXA 4DL2A 2F4FA 3BBFA 2ATLA 5AT1B 3IR6B 2OSQA 1NK0A 2OPQB 3BR9A 3SQOP 4DCPB 1OYEA 2A10A 2MSSA 1VRTB 3V6DA 2RSQA 4ECUA 2MKJA 3CD0A 2Q6BA 2IYGA 2CPDA 3OTCA 5IZHA 3M6UA 4HI2A 2P5VA 5CYMB 1DLOB 4I69A 4ZDNA 2KRRA 4DR2F 3W9IA 4HDHA 3EZUA 1VHIA 2EC0A 4A47A 4YHHF 3QJPA 1UEUA 4EO8A 1TKXA 2X1BA 4K4TA 4B9LA 1FA0A 4DV2J 1R2BA 1P27B 3NXZA 2VONA 4OZ2A 1RT1A 4B3MF 1R28A 2VV5A 4JBCA 1HQUA 2BE2A 4BLGA 4CT8A 1U02A 5J1EB 4Q0BB 5J2PA 1ZAWA 4DS5A 2C2ZB 2DY9A 1FJGJ 1N8RT 2KYXA 2CPZA 1KOHA 3BPDA 1D09B 2RAQA 4EOZA 1CC8A 2FTRA 3K5NA 5I42A 3CJ0A 2I5JA 4OZ1A 3MAAB 3TA1A 4I56A 1N5YB 4MKAA 4RWWA 4PYAA 2G13A 3G8QA 4JI0F 3KHRA 3P96A 4WJBA 3GJRB 1E6VB 3CCJS 4ZVUB 4ZCKA 1R0AA 3J7YU 3GP9A 1NEXA 1EARA 2BX6A 5E3CA 2PC6A 3DGPB 3C16A 3DRSA 1U2CA 4UY85 1BY9A 4OX7A 2BABA 3AAWB 4DOZA 3BH7B 3G86A 2K3KA 1BWEA 2XWYA 4YDDB 7FDRA 4CO0A 4A4JA 4APFA 2BKOA 2HQCA 2KFNA 2XBPA 2MGZA 1Y5NB 1PBAA 2YVSA 5DQGA 3PG9A 3TAMB 3ZKJB 1Y3JA 1SPBP 4OX9F 4QIFA 4NASA 5D4NA 3T1YJ 3I32A 2YNFB 2LYVA 2HNDB 2IPOB 5KG0A 4C8YA 1VC5A 4JYAJ 4MYTA 1YHQS 2I2RA 3D7SB 4OYMA 1EHWA 1WEXA 2FJXA 1R8HA 1FWPA 1N32F 4ZPVR 3QATA 3ILLA 1HFEL 4PXEA 2D41A 4AE5A 2K8GA 3CJKB 3B82A 2F4VF 2CPFA 4MAKA 4C6AA 3QT7A 4R0EA 2XHCA 2ERRA 1EQMA 4ZOSA 4PPDA 3IG1B 4JI6F 4NEYA 1NJIT 3D3BJ 2C2EA 4F36A 5B0GA 1N6QB 4JP8A 2AIRB 2YKNB 2RH3A 4B9KE 4DR3J 3TRGA 4MK9A 2ZZMA 4O3QA 2VJUA 3C6NA 4OL8A 4X62J 1UVMA 2VH7A 4ZITA 1YVFA 4C8MA 1Y7PA 1K1SA 3PRDA 2NXNA 2CRLA 3W5XA 2VG6B 3ET6A 2HVIA 3ZUNB 1X4CA 3F73A 4JI3J 4QR2A 1NJXA 1BC6A 1FKPB 1UVIA 3MPWA 3N28A 4JI1F 3MDFA 2WAQD 4KB7A 3FBBA 3SBMA 2NZCA 1Y3KA 2R7TA 3AD8C 4N47A 4HT7A 1NUEA 2BJ3A 3MURP 4NEZA 1PYSB 2FHMA 1QAJA 5IQ6A 5KFRA 4OI0A 5E7OB 5A8WA 3Q2SC 3TX0A 4QU7A 5HLFB 1JMTA 4LF7J 4HH0A 4A8XA 2AYMA 4PWDB 4GKJJ 5CZVA 2QA1A 5H7HA 1LWCB 2EFPA 3RR8A 2Z58B 4RLEA 4NI2A 1YJTA 4ILRA 4ETZA 2J0SD 2QTWA 3PW2A 2D74B 4WXOA 3LO3A 2W24A 1TVRA 1RT4A 4PG8A 1RUSA 2NN2A 3O5TB 4PEOA 4LSZB 4QIWD 3EX7B 3QQCD 3PKMA 3V6HA 5ETPA 2YKMA 1A9NB 2OPPA 4OHWA 4IG0A 1LW0B 3P45B 1HNXJ 4ZVPB 1Q82T 4B9KB 3TQ1A 4P6QA 4CO2A 3I31A 2DBBA 1UVNA 3P5BP 2MQQA 1Q4RA 1TUGB 4DU7A 1NO8A 2DGQA 4K7QA 3FNNA 2IY5B 2DHGA 2XG8A 3PDNA 4IO1A 1EZZB 1MU2A 2KG0A 2AGOA 2MDAA 3GA1A 1REGX 4X64F 2A6OA 4ZOUA 3OGMA 3K5LA 4LMZA 1HW9A 2KJVA 2I9SA 3M4TA 1IKWA 4DL7A 4LBHA 1G2EA 2DNPA 2XM3A 3UE2A 1K1QA 5KG7A 3BSNA 4DLGA 3L9ZA 1M5KC 2VDHA 3RAXA 1B70B 4RNFA 4X4VA 1HMVA 4Z2XA 3G2XA 3BGRA 1NDLA 1TU0B 1YJWS 2PD1A 4KFBB 1OJ4A 2DB1A 3ZTQA 2HEKA 2R8JA 1KFDA 2W2NP 4DUYF 1J5EF 3KDOA 3W2VB 3CD7A 2LDIA 3NGRA 3TVKA 5A6RA 3K58A 5KFNA 4MKBA 3SEOA 1OQ6A 1S9EA 1UWBB 2MQPA 3D67A 2JC1A 5HSPA 3D66A 2BA9A 2ZNYA 2GZOA 1D1UA 3LGMA 4FF2A 3CIMA 5G4DA
chains in the Genus database with same CATH topology
4Y00A 1FKOB 3B84A 1TKZB 1U48A 4WK3A 4PXCA 1SB6A 4DFJA 5JH5B 3I0SB 1VMBA 2F40A 5KFQA 4UQGA 4DLEA 3SV4A 4EU0A 3OUYA 2QMXA 1QDWA 3MM9B 4LSNA 1U49A 5KFKA 1QAXA 4PG6A 2WONA 1UETA 4YEAA 3H40A 5K9FA 4TQRA 1FDBA 1SC6A 3CDUA 1UL3A 4TU9A 2BJDA 1I1GA 2HFNA 2XB2D 1S4FA 4E0DA 3H5XA 4JI5F 1NK8A 2HVZA 5A8WB 1VC6A 1DTTB 3H59A 1YG0A 1XMBA 3KYLA 2K1RB 2BOPA 4JV5F 2E1RA 2IRXA 2ALZA 4YY3F 1Q86T 2DNZA 1N33F 5GAHI 4DUZF 3QGHA 2RMLA 1VBYA 3MD3A 3BDEA 3WX4A 3EYZA 2FVCA 3AB4B 2R8HA 4TYBA 2L41A 3VAIA 3QZ7A 3NGKA 3OXGA 4L72B 1XMQF 4B9UA 1EODA 3SZ2A 2EG1A 2ASTA 1JLFA 4WE1A 2JFDA 3E01A 4MKYA 4CO3A 4P7TA 1G3OA 1WF0A 2BVZA 3NMAA 1X4FA 2XGQA 1S79A 4DQSA 1FRIA 1UVKA 2VB6A 4N56A 4QW9A 4AYBD 4K4XA 3V4IA 3GV7B 3PEHA 3BJYA 4FYDA 4YR2A 1FNOA 2CPHA 2KFZA 2P1PA 2R7UA 2HFZA 3Q0AA 4DFPA 2BRLA 5F9NA 4O3PA 3HHDA 4DV4F 1TVRB 1RT4B 3NNCA 3HHLA 1T02A 3T1HF 1R31A 5EWEA 1GX6A 1QUPA 1S77D 5KFSA 3HU6A 2WCXA 4O3SA 3C6PA 1RTHB 2W4DA 3D0IE 4K2XA 5B0DA 5AE1A 5C25B 1TFYA 4F8RA 1NK6A 5DM6Q 1RT3A 4WKRA 3BB5A 2HFOA 3X1LB 2J0WA 3H4DA 2QV6A 4U6PA 2AJQA 2MHNA 1IBLF 2KT2A 2CFXA 5KFTA 1X0PA 5BR8F 4RNNA 2YKMB 1HBOB 3NWGA 4WFZA 4KTQA 3C6TB 3NRBA 4ELUA 2XS5A 3U27A 1XWLA 2YNGB 1C0UA 2DD8S 1MW7A 5JVHQ 1T05A 3CMES 4ZP7A 5I4MA 2OPPB 5F3TA 4IG0B 2DO4A 4F25A 5BO4C 2VODA 5EUHA 4F3QA 1S6UA 2JSXA 1VBZA 4FZVA 2YNHA 2FLPA 3UCZP 3RB6A 4OZNA 2BRKA 2W7PA 2CJAA 4R25A 1WD6A 2XY5A 4ED8A 1U1RA 4WK1A 2HS0A 2NXUA 4LF4F 4W9KB 1T03B 2PIIA 4GC7A 5F8LA 2KHCA 1S1XA 1VQ8S 1FJCA 2WB4A 4NYOA 3M2RA 3TNVA 2WOMA 1X9SA 3CDWA 1T95A 1YI2S 1YJUA 4M94A 1X4BA 2EFGA 5HROA 3KNAA 4KRWA 1K73T 5I3UA 2AD9A 2JDJA 2KDOA 4FS1A 1ZTTA 3ISZA 1FVQA 1X9WA 2ZM6F 2KKHA 1S9FA 1P22B 2FVRA 5HBMB 1FRJA 4WTYA 3SSSA 4ED2A 2YWEA 2J6SA 3GWCA 2PA3A 5DDQC 5BYQA 5DDOC 3NNHA 1H0HB 4X4NA 2NS1B 3UWTA 4CTAA 3M2VA 1NK5A 1HPZB 1ZZFA 2AF6A 4RW9A 5DQHA 1NH7A 1REVB 1ZOTA 2ASDA 2VPYB 1U1KA 4K4WA 1SJ1A 3ZTDB 4C4WA 1YSJA 4RBVA 1Y4ZB 4YUDA 2GHPA 1X0FA 5F8GA 1O5JA 4IG3B 2YH1A 4M1KA 1P1TA 4X84A 1WEZA 4BBYA 2V94A 1MU2B 5L1JA 2HHXA 1H2VZ 2C3UA 2IBOA 1SJFA 4IFYA 1NKEA 2G9OA 3GV5B 1JLGB 3SI8A 3KLHB 1EOFA 3SQGA 3M8QA 4FN5A 2VOPA 4JI7F 4DV3F 2V4QA 1VC0A 4XK8C 1IKYA 3DRXA 2ZJRQ 5A15A 2UUWA 1C1CA 3K8VA 1IKVA 3TUZC 4OX8A 4FBTA 3GFHA 2QSWA 4A46A 1NAQA 5LSLA 1IKWB 5BXBA 2R7QA 1K9MT 2CQHA 3KK2A 2IA6A 3MFHA 3OXFA 3CD6S 3OR1B 1UVLA 2GNKA 3QJLA 2J7KA 3GFZA 1VI7A 1PC4A 4Y0FA 4DSFA 3BGLA 5E33A 1K0TA 3UCUP 4K50A 3SSQA 5LMNF 3Q2TC 1DURA 2ZHOA 4OMFG 3BSOA 2V4JB 1CVJA 3A1YG 4NLYA 4DR1F 3PZPA 2BBEA 1WHVA 2R2TA 5KT2A 1I6JA 4N77A 4KV8A 1HMVB 3DLKA 3DU6A 1HHTP 5F8NA 2A79B 5J2QA 4KE5A 1NK9A 2IYIA 3BGRB 4FXWA 3TX8A 3OVAA 4U2NA 2I1RA 3DU5A 1RT7A 5KG5A 2ZD1B 2GQ2A 2ZNZA 4NRTA 1SL2A 2J5AA 3BGUA 3IRXA 3U1NA 5A8RB 2KJWA 5J1PA 1CPZA 3MM5A 2VD3A 3QO9A 2Y0SD 4H4OA 3VR1A 3PW5A 2UXBF 2IJFA 1Y5IB 4H4MB 1Y9OA 4Y28C 3GIKA 1S49A 2R9RB 2RQMA 1XC9A 3T9NA 5KAKA 1QAIA 1X4EA 3CCLS 4KHMA 3EGNA 3PX0A 1FRKA 5AE2A 3IBWA 5LT5A 1WI6A 3LP0B 4C7QA 2LXFA 4MJKA 4Y65A 1VQ4S 1O51A 3P49B 4NLTA 5F0UA 4R5PA 1M90T 1HYSA 1R7IA 2QA4G 3C46A 5KFLA 4F3OA 4HXIA 5IT0A 1S9EB 4B3TF 4LVOP 2HHSA 3LP1B 4IR9A 3EUNA 1NKCA 1UA1A 3B4DA 2DPIA 4L3NA 4QIEA 4RW6B 3QPIA 4V19J 2MA9C 5EHHA 1ULRA 3DC2A 1MWYA 1DQ9A 4ZA1A 3CCQS 1QSYA 2IJNA 2G1DA 2AJ0A 2YX4A 2C3PA 2J0QD 5HI7A 5KFDA 2B5JA 5AXMA 3OJSA 2HNZA 1U2RA 2QMWA 5SUHA 4LF5F 4X4TA 1Z2ZA 2CQCA 4PQAA 3DXBA 3Q22A 2Z8HA 3G71S 1S1VA 3SYZA 1SJRA 2GO8A 4ZVFA 2HYIB 4HHJA 2HMIA 4Y2MA 2M5YA 3HFKA 1EXBE 1RKIA 3I4HX 3OTDA 2ZH7A 3BQ2A 4IO9Q 1QUVA 4JUZA 3OUYB 2LQ5A 3HK2A 1DAXA 4LSNB 4MMOA 2WONB 2MZJA 3I0RA 4LSLA 4ZKAA 3QZ8A 2OTLS 4U77A 4QWBA 2WBMA 1QVFR 1N36F 1AFIA 1HD0A 2B3TB 3C2PA 3NS5A 2CZVC 3O44A 3AJ2A 1FK9A 3RB4A 3OFHA 1N5TA 1YRUA 5KT4A 2ASSA 2KTQA 5B0EA 2X1AA 1EOEA 1M5VC 2RDJA 1GT8A 4CO1A 2FVPA 1VCBB 3GMGA 2RDIA 1RAJA 2QEXS 4J9KA 1XR5A 4ZK7M 4IQXA 1SXLA 4WFNQ 2ZKUA 1JLFB 4WE1B 3T9ZA 2NYIA 3E01B 1N0VC 4DQRA 1F0XA 2IMOA 4DQPA 1WHWA 1C1BA 4KQZA 4D3GA 2QFJA 2D3ZA 3I6PA 4KBIA 1URNA 2ZOGA 4H4KA 2P1MA 1RA7A 2O66A 1E6YA 3V4IB 1S7HA 1VRUA 4I6YA 3DRYA 1X5TA 5IXUA 2UUCF 2WRMA 2C2RA 2MQLA 3VWSA 2IRUA 3V7DA 5C24A 1B0TA 3HHLB 5U47A 2RD5C 3MUVP 3PV8A 3VQTA 1G6BA 2HS3A 2E1MC 2COLA 2P1OA 4ELVA 3MAHA 3AH6A 2M52A 2HWIA 1RT3B 1R27B 5C5JA 5IWAF 4V19X 3ZC4A 5HMWA 2ZE2A 1VQ9S 3M8SA 3GZ7A 2A2DA 1OO0B 4UQTA 4NCGA 4A8OA 4BWMA 2DRAA 3GYXB 4G6VB 4C97A 2MJNA 5DETA 3DCGB 1M0SA 2IAJA 2RS2A 1C0UB 4K5RA 2QSFA 5I3QA 5DAFA 1T05B 5IBKA 1XN9A 4A48A 3CUNA 2IHR1 3M9MB 1KR4A 5G0RA 4LFAF 2YKOA 4NLOA 3DLEA 2ACYA 4DBQA 4LFCF 1TV6A 2OJ3A 2YNHB 4EEYA 3K0JA 2YKQA 4AUKA 1IJEB 1DRZA 4MK8A 1ZAVA 1APSA 5EWGA 1TZ0A 4Y2CA 3R5CA 2E5GA 4YB7A 2HS4A 5D3GA 1FRXA 3MR6A 2R7XA 3J7A1 1LW2A 2YNIA 3LGNA 2BACA 3TW0A 3T3FA 3Q23A 3E2EA 1S1XB 3H2VE 3M6XA 2KI2A 3MKSA 3M2RB 5IM0A 4E98A 2WOMB 2DH7A 1F60B 4NL5A 3MR3A 5HROB 2OMOA 4ECVA 4AXJA 3CEDA 5I3UB 5K8OA 3E8OA 4OI1A 3KFWX 1KS2A 3G6VA 2ZFHA 4PG7A 3C8YA 2XSJA 2HRUA 4URGA 3NCPA 4RUCA 1U1QA 3F56A 5A0YA 2E1AA 5LMUF 4IDKA 2VFRA 1SUQA 3NG8A 1LK7A 3QYYA 2GMHA 4B02A 2RQKA 4UUXA 2ROGA 4PQUA 1P1LA 3M2VB 4CTAB 1NB7A 4RW9B 3ZZYA 3OJUA 4B95B 2YWGA 2DR7A 4NLXA 4EWTA 2JEGA 2MPUA 2JHEA 4CO4A 2LEAA 2XS7A 5B0BA 1KSPA 2ASYA 3U7JA 2BANA 5JXSA 1L3SA 5EWFA 5CCLA 2RQ4A 2OH2A 2LU2A 4IFYB 2B7CB 4YDXA 3RZAA 1NZAA 3CCMS 4ZVGA 1U24A 4O3RA 3QGIA 4IH6A 4EFAC 3M6WA 3SQGB 3DM2A 3T5LA 1UEVA 1IKYB 4DL5A 3VAGA 4RU9A 1C1CB 5D4PA 2C22A 1IKVB 3HVWA 1TKTA 1FJ7A 3UCGA 5KG6A 3N79A 1HL6A 1T7PA 3S1TA 2X1GA 3IR5B 2EK1A 1CSJA 5A6PA 5IS2A 1XEZA 2IM1A 2AYGA 4YOEA 3KK2B 3MCSA 4Y34A 4C0HA 2GMJA 3R27A 3L95X 3MI7X 2ZH8A 2RU9A 2A18A 2XY6A 4HEA9 4C11A 4KHPF 2FUG9 3FKCA 4C8ZA 4IRKA 4GKKF 1RGVA 1KQFB 4JV1A 5AXLA 1ZBTA 2HHUA 4KV8B 3UR3C 3DLKB 4A8MP 5J2QB 5D4LA 4DR7F 2EWHA 4ECRA 3QGGA 2ZH9A 4J9NA 1D0EA 1RT7B 1FERA 3J7Z5 2R7SA 3GR0A 2GX8A 2RKIA 3JTNA 5L9XA 3ISNC 2CG4A 4F02A 3HZGA 3IRXB 2DTJA 3MM5B 4U9RA 2XMUA 4B9NA 1U6FA 4B3RF 1FT8A 3AQOA 3GIMA 3HQIA 3HKWA 2QE5A 3QO9B 3NKYA 2DHSA 4H4OB 4OIXA 2ROEA 2PMHA 2V5HG 1A7GE 3CT9A 3LW5C 5A8KA 1FJGF 4EBCA 2VQEF 2JWNA 2PT0A 1DZ5A 4EO6A 3CJ2A 2VFSA 2J9EA 1V3SA 1JIHA 4E8UA 2V4RA 2YY9A 4N9F5 2CJKA 3L3CA 3UD4P 1HQEA 1DJ0A 4AL6A 1FDDA 2E9ZA 3H8YA 3CMAS 4R5PB 5M2PA 1HYSB 3FEYB 3KOAA 2LQ9A 2J9CA 3VZIA 4AXIA 4ZS6A 1XERA 1KNZA 5E41A 3OHUA 1MMDA 1V3ZA 1T94A 3DDKA 4CO5A 4WFAQ 1SH0A 5K14A 4F2SA 2CQPA 2O01C 2FIUA 1W2BR 3ETOA 3FQKA 3MD1A 1OPIA 2B5JB 2QA2A 3LUYA 1DARA 4RBUA 1NHVA 4QWEA 2XGPA 1IUJA 1U6ZA 2HNZB 1VJWA 3PIPQ 4GC6A 2HGNA 3EXCX 4K4ZA 1FDNA 2JOQA 5I3PA 3OFFA 1S1VB 3T6BA 3G8TA 2AGQA 4DSJA 1L3UA 3G4SS 3VALA 1LWFA 1C0TA 2HMIB 2SXLA 3GYNA 4QWCA 4I2PA 5KT3A 5E2QA 2PI5A 1DBDA 5FJ4A 2Z2MA 1FNMA 3QWUA 1S6PA 3DOLA 2IC3A 3PXGa 1U09A 4A8KA 4LSLB 3I0RB 2MB0B 4JI2F 4NCBA 1HD1A 2VPKA 1BQXA 4OV1A 4CNYA 3QIPA 4TLRA 5E3PA 3OPKA 3L2OA 4W92B 2Z8QA 4I4BA 3KHLA 2OPRB 3IAS9 4DL6A 1FK9B 5HQ8A 2Q79A 3IC1A 5T7LA 3DXSX 3TYTA 5LSOA 1HV2A 4X4SA 3KVTA 2J7UA 2KO1A 2YKAA 2W8LA 4I2QA 3H5YA 1XK8A 4QR0A 3GR1A 2MQOA 3BSAA 4CH0S 4DL3A 1RKJA 1FESA 2F9DA 1CQMA 4CIOA 1FDAA 1J5OA 4BGCA 2NUUG 2RRNA 3CDAA 2ZH1A 5J2MA 3HHNB 5KT6A 2BYCA 3ENWA 3EGZA 2AYBA 1N54B 5DJBA 2FHKA 3LANA 1F5AA 4TU7A 2KB2A 1FE0A 2OD4A 2VBWA 4G1QA 3Q24A 1IBKF 4C9DA 1RT2A 4HLBA 1E6YB 3OBIA 1VRUB 2JRSA 3I9ZA 2ZH4A 2KRBA 2PDAA 1YJVA 5C24B 1S9GA 5KFOA 3CB4A 1U1PA 1FRHA 4DS4A 2J9DA 3W2WA 2EBGA 2R2SA 1SJ4P 3U1MA 4CT9A 3OLBA 2GFFA 1YGYA 3HF5A 2HAIA 4AFFA 4PKDB 3H98A 4NLSA 1RTDA 4DSKA 4RUAA 4N8NA 1HARA 1X5SA 3E51A 2ZE2B 4I64A 2B9XA 3T1YF 1KD1T 4C8NA 1RQ0A 4LUBA 2JEJA 2FPHX 4NCGB 4Y2IA 4O4GA 2OTJS 1ELOA 2YTCA 4HYKA 2IAJB 3VAKA 4JYAF 5K5MA 3PNIA 5KFIA 3POTA 5IFMA 1HW8A 1OIAA 3TR5A 5G0RB 4ELTA 3CE8A 2GHVC 2DGSA 2BDPA 2IBK