3HVEB

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
195
Chain Sequence
DPQHAARLLRALSSFRERFCDAHLVEPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLEDIQDVVQAADLLLLTDLKTLCCEFLEGCIANCIGIRDFALHYCLHVHYLATEYLETHFRDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVHMKDVMSALWVSGSSYLREQMLNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
molecule keywords Gigaxonin
total genus 44
structure length 195
sequence length 231
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00651 BTB BTB/POZ domain
B PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveB02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveB01
3FKCA 4B9KE 5H7HA 2Q81A 1BUOA 1S1GA 3M5BA 5IBKA 3OHUA 3WSOB 1R2BA 2NN2A 4B95B 4BGCA 3M8VA 4U77A 4CRHA 4U2NA 5BXBA 2I2RA 4AP2A 2A79B 2ASTA 3OGMA 3KVTA 3LBZA 4W9JB 1LM8C 2OVRA 5HYWB 4JTCB 1VCBB 1EXBE 4W9CB 3ZNGB 1NN7A 2E31B 3C6NA 3HU6A 2YY9A 3MKSA 2JZ3C 4AJYC 1FS1B 3GA1A 3LUTB 2OVPA 4JTDB 3M52A 3OHVA 4ZOUA 3ZTDB 2R9RB 5HZGC 4W9IB 4CXTA 3B84A 4I6JC 3ZKJB 2IHCA 2VPKA 3HVEA 4W9DB 1EOFA 4W9HH 2E32B 5H7GA 1R28A 3OGLA 3LNMB 4HXIA 1LQBB 3ZUNB 5BO4C 4AWJB 4WQOC 1FS2B 3C6OA 2PPIA 3DCGB 5EUPA 5LLIB 1QDWA 3C6PA 5BXDA 1EOEA 1QDVA 2P1PA 4JTAB 4U2MA 5A6RA 5DAFA 1DSXA 1FQVB 4W9KB 2MA9C 3ZRFB 3OGKA 1P22B 4BKTB 4JGHC 1LDKD 3HQIA 4N9F5 4W9EB 1NEXA 2EQXA 1HV2A 2P1OA 2IZVC 3M4TA 4EOZA 2P1NA 5FTAA 1A68A 5JH5B 2Z8HA 3ZRCB 1EODA 5DADA 2P1QA 4CXJA 2VKPA 4J8ZA 3ZTCB 3L2OA 4CP3A 2FNJC 2ASSA 3BIMA 4B9KB 5BXHA 4W9HB 4W9GB 2OVQA 2IF5A 4CXIA 3V7DA 4W9FB 4HS2A 3E4UA 4UYIA 4W9LB 2NZ0B 1CS3A 3DRZA 4UIJA 4BKSB 4APFA 3I3NA 3HTMA 1R29A 5A15A 3HVEB 1T1DA 2P1MA 2C9WC
chains in the Genus database with same CATH superfamily
2GRMA 3ZN3A 1S1GA 4AVXA 5KBAA 2P9LG 1R2BA 3E4BA 1JWGA 4RG9A 4Y6CA 3CEQA 3CSFA 5BXBA 4UWHA 4N5QA 1LF8A 1A17A 3Q5MA 3I5PA 3PNLB 3WG7E 5E75A 4YY8A 3BG0B 1JUQA 4WWPA 4JA7A 2WXPA 3ZHEB 2J08A 3EHRA 1KT1A 1Y8MA 4GTVA 4JTDB 3SF4A 2I1JA 3C5RA 2EIJE 5JJTA 3FEXA 2GROB 2NXPA 2YHCA 3ZIMA 4GYWA 3FUFA 3SQVA 3ML9A 5BXOA 4HLEA 4A3VA 2ZISA 4LUNU 5JMND 1SQMA 1QDVA 4FULA 4U2MA 4KT6B 4N5CA 3FU5A 3TWQA 3P2BA 3CHQA 4I2WA 2L6JA 3CKCA 3TWVA 4FA6A 3FP3A 2WXOA 2VKPA 3PUJA 4U95D 3TJPA 5EIBE 1DC2A 3TWWA 4TUUA 4U0ZA 2X3MA 3F6QA 2FO1E 3FEYA 4J8FA 1JCSA 3X2QE 5BNWA 1FT2A 3G2SA 2F37A 2IOSA 4APFA 1WAO1 4K5CA 4H7XA 3UUXA 1OY3D 4XI9A 1HZ4A 5G55A 4YDYA 4MS6A 1OWMA 4ZHBA 3SBSA 5FIOA 2OVBA 3DSSA 2B6CA 5B3SE 2BUGA 4IYPA 3CK8A 3DRYA 3OTNA 1UOHA 3ML8A 4K5AB 1H2VC 4YVQC 1NA0A 2UY1B 4FHKA 1IXVA 4U8VD 3OAWA 1E8ZA 4CEMA 2V5QC 3FU3A 2WQ6A 1QNFA 4XKBA 3U4TA 3B84A 3SZ7A 2DCPA 1MX6A 5FQ8A 1TNBA 4ATGA 5DBKA 5IY5E 2OEWA 1OWPA 2NYJA 2V5FA 2YQ8A 3GZSA 2V4HC 1LQBB 3ZUNB 1N4RA 5JHBA 3SBTB 3U64A 1S0PA 2L0TB 3DSWA 2DYSE 2VJ8A 3BUAA 4BESA 4EPZA 4XEIG 2GRQB 1IKND 4I6EA 4XE0A 4GPKA 3VLEA 3GW4A 2MA9C 3HDXA 3FUJA 2WXIA 5KJLA 4I1AA 2Z8HA 3ZRCB 3ZRHA 3FTXA 3L6AA 1QYMA 2HYZA 2J4BA 2ASSA 4ATZD 3OXGA 2QZAA 1UJJA 3KAEA 3FUMA 2J4DA 4W9LB 2PM6A 2ZXWE 1JPLA 4UIJA 4DPRA 5J08A 4G26A 3RRNB 1U3DA 4N3BA 1BLXB 2LNIA 1E7VA 2I9CA 1TNOA 1BD8A 5ENRD 2C9WC 1NP7A 4B9KE 3R9MA 3AS8A 3M5BA 3LYAA 4RQIA 3JQ1A 1S70B 1HX8A 4CRHA 1OCOE 1U2VG 2IO3C 3EUVA 1LM8C 1H0AA 3QK0A 1D9SA 4F6RD 1OXJA 2WM9A 1ZBPA 2QYUA 2R59A 3NQPA 1EYHA 2FBNA 3T5VA 4P29A 3U9WA 3B13A 5T4YA 3GA1A 4AEZC 3ZTDB 3CGHA 4G25A 3B7BA 2KCLA 2VPKA 4GCNA 4U7EB 2DWZA 1EOFA 4UI9K 3G2UA 2PM7A 1E8XA 3FH5A 3QOUA 4L7TA 2LSVA 3NOGD 4U0SA 4ZFHA 5D0OD 3PVLA 1SA5A 4UI9C 3UKUG 3ZRFB 1HS6A 2KZTB 1TR4A 2XCBA 1LD8A 1N4QA 2P1OA 1E90A 2HO1A 2X6HA 2P1QA 3L13A 3L2OA 4BSXA 3KEZA 2WXNA 1N54A 3N71A 5CEDB 4UYIA 4HQDA 1FVHA 4J0UA 3P1UA 1DVPA 4G11A 3JXJA 1N0RA 3W9FA 3PREA 3ZU7B 4A1GA 2RKKA 5KNHD 3CHRA 5LCWJ 3CHMA 1JCQA 3FKCA 2F0YA 2XEVA 5C2YA 4MBGA 2XEHA 3M8VA 4L9PA 5AYWD 3D3MA 3EIJA 3ABME 4FC8A 5EYLA 3Q7FA 1EPUA 4CGVA 3R7RA 5FQ4A 1G3NB 2CFZA 3ZNGB 4DX2A 3DXMG 1TN6A 4ABNA 3SHFA 3L08A 5EN5D 5LCWC 1FS1B 2P9UG 2KBXA 2P9IG 4ILHB 3M52A 2XS1A 3CV0A 2YINA 2QY7A 5HZGC 3S7JA 4DJAA 5C1DA 4W9DB 5AAOA 4CRWA 4WUYA 2UWJG 5H7GA 3DSTA 5CCLA 1UN9A 1HH8A 2DVWA 2GRNB 2KXPC 2LAIA 3MEKA 3DCGB 5EILA 4GTRA 2Y1LE 3L17A 2XEEA 4N39A 5ARGA 2KCVA 2RG8A 4GZ5A 3R7QA 4YDOA 4R7LA 3CQCB 3B7TA 2VGYA 4C0MA 5KJNA 4TXQA 2IZVC 4DX6D 2VSXE 4BT9A 4J8ZA 4K5BA 4I9CA 2J07A 3EHMA 3PZ4A 4I1MA 4W9GB 4GTPA 4DX1A 4WNFA 3TWSA 2IF5A 1UJKA 5CRUA 2L6BA 1DNPA 2WXRA 3MYVA 1IQRA 3KD7A 3QJZA 2P1MA 2IQCA 4K03A 3TWTA 5JHAA 3ABLE 4PUCA 3APCA 3ESLA 2H6HA 2M63A 2I2RA 2WXJA 3T5XA 4GYYA 4GTSA 1VCBB 3FUIA 1OWOA 2XPZA 2AXVA 1K3ZD 1QBQA 3ZNGA 4MLPA 5FZRA 1BPOA 2VTBB 3PE3A 4JPSA 2AWIA 4KZ0A 3IHYA 3FDHA 1N11A 5AN8A 4BT8A 4QFVA 3CVWA 2XGSA 1GW6A 5JJ6A 3ZYLA 3DEPA 3FULA 5AIJA 3Q4AB 4GMRA 4U8HA 5A6RA 3SFYA 3PEVB 2NSZA 4JA9A 3S7DA 3ZVVA 3UI2A 1KPSB 4CDNA 4FJYA 2UY1A 4CYMD 5CMWA 2KC7A 4U07A 1N4PA 3CVXA 3MKQB 4CXIA 3ZYMA 2AXZA 3R9AB 4ACKA 4V3IA 3OXLA 3I3NA 1Z3XA 4BERA 5KJKA 3ZHEA 4JXTA 1V54E 3ABKE 2NN2A 4UQYA 4J8EA 5ITZF 4JEHA 2RFAA 2F8YA 2ASTA 4FLHA 4HB5A 4HRNA 4KVMA 5HYWB 3UPVA 4HOTA 3C3OA 5FZQA 2GRLA 3LCAA 1D8EA 1Z5SC 4ANXA 4AJYC 1SW6A 4CDMA 1K1AA 4HI9A 4GU5A 5ARFA 2F8XK 4F1PA 2AVPA 3V30A 5ENPD 2E32B 4YNDA 4U63A 4BSZB 3FFLA 4HXIA 3QC1A 4APOA 3Q9NC 1OCRE 2IO2C 5BXDA 5CEAA 4NURA 4I6GA 4CT0A 4I2ZA 5HKPA 2AXUA 2CHWA 3G2VA 2PQNA 4OAUC 4W9KB 1P22B 1IHBA 2DBAA 2BF0X 4MRUA 1NEXA 3E30A 4J6IA 5M72A 1TNYA 3NB2A 5JJ7A 1WY6A 2HM8A 1X81A 3MKQA 3V79K 3AG4E 3NZUA 2L9BA 3TWRA 3L54A 3FTVA 3ZKJA 1ZU2A 3CVPA 3SNXA 3FH8A 3LVQE 5H7PA 5AQAA 5A6CA 3SGHA 1YA0A 4BKSB 4JB8P 4CZ2D 4FJZA 2ZGDA 4C0EA 5BXUA 3FH7A 1YMPA 2R03A 4B94A 2Y4TA 3MV3B 4JHKA 3MZLB 3ASNE 4YVOA 2IY0C 3HXFA 5HI7A 4HOSA 1A5EA 2DYRE 4WNEA 5FQ7A 3LBZA 1KZOA 1KLXA 2IONA 3FWVA 5CECB 2DZNA 4W9CB 4B8AA 5A7DB 2X6KA 4EBAA 2NC9A 4Q94A 3AU5A 4X8QA 4OAVB 1L5JA 2J49A 2QYJA 4ZOUA 1D8DA 2XHEA 1OCCE 3MA5A 3FTSA 4DX7D 4D10C 4PS7A 2IFUA 3CVVA 2VGEA 4UUCA 1R28A 3RO3A 4F1SA 5ANRA 4XKCA 5BT1A 2J8SD 3AG3E 3GZ1A 3UINC 4B0ZA 3S7BA 1DSXA 2FF4A 4OVUA 4GAAA 1MHQA 4JC8A 3CKBA 2LAHA 2P9NG 4EQFA 2BKKB 1FPPA 4GCOA 3PZDA 4DRXE 3Q7AA 3JUEA 3ZGQA 5CMYA 3APDA 4BEPA 1EDUA 1N0QA 2Y0BG 3GZ2A 4RG6A 3OXFA 5FTPA 3Q15A 3LXUX 2WXHA 1MYOA 3DPDA 3BEEA 1N94A 4GZDA 5B1BE 4N2QA 1MX4A 4BGCA 3MGBA 2ONDA 2GGFA 1DCEA 3HRAA 2EIME 2FULA 3MCXA 1E96B 4C9BB 4I6JA 3DWLG 5DIZA 4WNGA 3T9KA 2JZ3C 3LY9A 3EU5A 4LNGA 4ACLA 3NOCD 3OHVA 2CG3A 2ETCA 4W9IB 2IOLA 3T8KA 3PS6A 2OVFA 3CHSA 2Y69E 3AG1E 4L2YA 3DSXA 1HF8A 3JCKC 5BO4C 3I4GA 4GA1A 3E33A 3VLFA 1MQSA 3D9HA 3E37A 4Y6WA 3PE4A 5LLIB 2JLBA 4JTAB 2LUHA 2BEDA 4WWOA 4XI0A 3HG0D 3T8MA 3RAUA 5LFAA 5BPPA 4N9F5 3IV0A 4RSYA 1SA4A 4YDEA 3Q78A 5ENTD 5FTAA 1N9AA 1NFIE 1W3BA 4IN3B 3B7UX 2LSUA 5BUZA 4JHRA 2BTDA 1CS3A 5CBNA 5T3RA 4F53A 2FEZA 3J5PA 3HXDA 2KCKA 2I6HA 3QB2A 3BG1B 2WXQA 4A55A 3URZA 3RSEG 3LDZA 3MX3A 2HR2A 2DIWA 2Q81A 3RRUA 3RO2A 5IBKA 1TNUA 4ILIA 3KSLA 4ANWA 1TJFA 5LX8A 4JZYA 2C0MA 5LP0A 1E7UA 1INZA 4NIKA 3ASOE 3ULQA 4GB9A 3PNTB 4U8YD 2A4ZA 4BX9A 3QWPA 4EZLA 1PY1A 3ULYA 4DLQA 4G24A 5ENNA 3ZKJB 1NL4A 3WXXA 4LG6A 4I43A 4GTOA 4LSZE 4U04A 4GTMA 1MX2A 3MJWA 5ENSD 3UM3A 4HRLA 3EHNA 4XZ4A 5EX0A 4XX5A 2PPIA 2R17C 3B7RL 3PZ1A 1OCZE 1FCHA 2PZIA 1PAQA 4LNBA 1FQVB 3UTMA 1JCRA 3G2WA 5EDSA 4EOZA 1A68A 3TG5A 2E2EA 1EODA 3L22A 5DADA 1RW2A 4LCTA 3MV2B 3RJVA 4KVOA 3JQ0A 2DZOA 3ZW3A 3E4UA 4O1OA 3FTUA 3CLJA 1U3CA 4LNUD 2C0LA 5CHEE 2YNQA 2CG2A 4EZJA 2ETBA 2QFCA 4PS3A 2E0IA 1TN7A 4HOQA 3B7SA 5EYPF 1S64A 3O4ZA 3UXGA 4U77A 3TXNA 1YCSB 3OGMA 2OOEA 2PQRA 3JXIA 3SO8A 3QDNA 3SFZA 4AJWA 4LEUA 2VSNA 2E31B 4J8DA 3VTYA 4HORA 4O1PA 3V31A 3EJNA 3U3WA 3D9KA 3VTXA 1AP7A 4DI3A 2B0OE 3RIBA 4O6FA 1H6PA 4FU3A 4AM9A 1BU9A 3ONKA 3LKUA 4UWLA 2VTBA 2WXGA 4AWJB 4U96D 3TAXA 4C48B 1FS2B 3KEAA 5EUPA 3RU0A 4L1BA 5T8IA 2EILE 1SZAA 4TUMA 2WXFA 1LDKD 1RZ4A 2R2LA 3EHQA 3JYSA 3L82A 3CVQA 1EF1C 5HS0A 5BV1A 4AV7A 2FNJC 3D9PA 1UG3A 1NA3A 3DSVA 4MKTA 4ME2A 3L9TA 2QC9A 3B95A 3V7DA 1ELKA 3NF1A 4IULA 1K8KG 2R05A 4JD2G 4UWFA 4M3OA 1R29A 3PDNA 3CVUA 3ASHA 5CCMA 2IF4A 4HNAD 4H7YA 3UQ3A 2PNNA 3LJ3A 2MYOA 3D9IA 2P58C 2VGXB 2XQ0A 3AG2E 1Y6IA 2XZTG 2A79B 2R02A 3KVTA 1FT1A 4GMJA 3TWUA 3FHEA 2OVRA 2XPIA 5ANLA 4HLLA 3UT4A 1EXBE 4FLBA 1H19A 3HU6A 4HBDA 3AJIA 2IEJA 2LXMA 4WWNA 2P9SG 1QQEA 3ZYQA 1V55E 4BTAA 4DLOA 5KJMA 4W9HH 4Q96A 1BI8B 4W9RA 4CCAA 3LNMB 3CSTA 3ESKA 3QNKA 3V2OA 3Q75A 4ZGCA 4BX8A 4M7CA 1EOEA 3PH0C 5ENQD 3ISMC 4EBAG 5DAFA 2P9PG 3ULEG 4JGHC 3GYZA 3S2AA 5KWDA 1X5BA 3C3RA 1IQUA 3K9IA 5BXHA 2WQ7A 2MHKA 5AJDA 3CVLA 2P9KG 2PL2A 4WNDA 4NQ0A 1IYGA 5BW8C 2V8SE 1TN8A 1WM5A 4GZCA 3DRZA 4O60A 1QZ2A 5B1AE 4Q69A 3QWVA 4N3CA 2XCCA 2J09A 2V0PA 4RVBA 4TXRA 3WSOB 4HRMB 3V2XA 3Q47B 2IJGX 4B93B 4UQZA 4GA2A 1SZ9A 3RK6A 3SD5A 1S63A 4EECA 1Z3YA 1UW4B 3FTWA 4I9EA 3E34A 2OEVA 1N95A 4JW1A 4CGWA 4KXKB 2OVPA 5KCMA 3IEGA 2I1KA 3IXEA 2Y3AA 2BKGA 5AJLA 3UIPC 3FUNA 1E8WA 3FTYA 2H6IA 4E85A 4BWRA 2I2OA 4TV3A 2XRZA 3C6PA 4U0UA 1H2TC 2FO7A 1O5MA 5EX3A 1TNZA 3UM1A 4GMLA 4G8KA 3UM2A 4GYOA 3SFXA 5HQ8A 5AARA 4W9EB 3C98A 1LTXA 5FQ6A 3ZXSA 4EZKA 4BY6A 5JH5B 4F7AA 3NAWA 4CXJA 3UKRG 1MZCA 4CP3A 1AWCB 4TXPA 4XIFA 3UT7A 4W9HB 4B9KB 3Q49B 2A5EA 2J9QA 2OVQA 3ENEA 3ONLA 3D9JA 2NZ0B 2VSYA 4ANUA 2X38A 3FU6A 1ELRA 3O48A 3DPYA 3D9OA 1O1TA 5A23A 3DRAA 1KT0A 2JABA 3KSQA 5CBOA 1HE8A 2GRRB 1BUOA 2WQHA 4YDWA 3UM0A 3AU4A 1OUVA 3AS5A 2VGXA 5AENA 3D9NA 3FU0A 5AQ7A 4BFRA 2LXLA 3AAAC 4OYSA 4PDXA 3DSUA 3I4RB 3UMVA 4URKA 5E76A 4BTBA 4NACA 2KATA 1XGWA 3DBSA 3L16A 3IBEA 3C6NA 2YY9A 3MKSA 1KZPA 3Q73A 4A3TA 4AXHA 3HYMB 1UN8A 4GA0A 4CXTA 3EIQC 4I6JC 4AIFA 2AW6A 1BI7B 3CIAA 3HVEA 2WB2A 3ASDA 2EINE 4EHMA 2KZTA 2WXKA 3HXEA 5KNGA 3MKRA 2L0IA 3APFA 3PRZA 3C72A 1QDWA 2XZDG 3CHPA 3CHOA 4JL0A 3ZUVB 2P1PA 3LEWA 4J8YA 2KM4A 4I1OB 4BKTB 1ZB1A 3DEOA 2EIKE 2FI7A 3BU8A 2IU1A 4B8CB 3ASGA 5G04C 3QKYA 3ZFWA 1P5QA 1O1SA 3D9LA 3BIMA 2MRIA 2X6IA 2RD0A 3HXBA 2MOWA 2ZIRA 1H6KA 4GZ3A 3S7FA 2YHEA 2H6FA 2ILRA 1TYQG 3HTMA 3HVEB 1DCQA 4B89A 4UQXA 5G2NA 2OCCE 3TWXA 3LVRE 2A5UA 2AJAA 4A63B 2LO6A 4DX5D 3DXKG 2XGMA 5FINA 5FT9A 1N52A 4HOUA 1HO8A 4TRQA 4ILGA 2CHZA 5G05C 3TXMA 2Q7FA 3LS8A 4FHJA 4J7WA 4GTQA 4G1TA 3LUTB 2OV8A 1LD7A 5CRVA 3NZSA 2XRYA 1ELWA 5EKQD 3QAQA 3NBNB 5CERB 5G05J 1MJ0A 1K1BA 3PZ2A 3C6OA 4GZ6A 4KBQA 4HVBA 3IKOB 4AY5A 3FUKA 2WXMA 3HQIA 3D9MA 2EQXA 3CVNA 4AOFA 2P1NA 4DUIA 2CFUA 3UX4A 4E6HA 4G23A 4G8LA 3ZTCB 1HXIA 2C2LA 3CK7A 4F3VA 5AQBA 4HS2A 3RRMB 5AQ9A 4LRZA 1HG5A 5A15A 4QQIA 1SVXA 3Q79A 3FUDA 3ZPJA 4CDRA 2WVIA 1HG2A 3FTZA 3OHUA 3PUKA 1VDYA 1H6OA 3HXCA 3C3QA 1JWFA 1XNFA 4U2NA 3KS2A 1O1RA 4Z68A 4AP2A 2R5SA 4W9JB 4HI8A 4G2VA 5LOZA 2WMNA 3VLDA 4RLYA 3UT8A 1NN7A 1N4SA 3ASFA 5JA4D 3QWWA 3U66A 4LERA 2R9RB 2P2CP 3J5QB 1OWLA 2IHCA 5FWQA 3LPZA 1OT8A 2CHXA 2ZGGA 1PC2A 3SY2A 4IRUA 3OGLA 4UWKA 3JUIA 5D2MC 4I17A 2ZU6B 3CVYA 2JEKA 1HFAA 3ZXPA 3W9GA 1TJCA 2X6JA 5BV0A 2HE0A 1B89A 4FP7A 3OGKA 4JVSA 3FUHA 2ETAA 1HV2A 4J8SA 4JHJA 1WDYA 3SI5A 4ANVA 3PZ3A 2XENA 3HIZA 2X6FA 4OVVA 5D66A 3TG4A 2VQ2A 3LY7A 3DRXA 1T1DA 4PS8A 2WMOA 1HU3A 2XGOA 4KYOB 5H7HA 4PH4B 1OWNA 2XS8A 4B95B 3CK9A 5EIDA 3TGOA 4KZCA 1TEZA 1FVFA 4JTCB 3PEUB 1YYHA 2VSOE 5FJYA 2GRPB 4L23A 1Z6TA 4CT4A 4AY6A 4NRHB 4UWGA 3IHVA 4KMOA 3LY8A 4GTTA 3CQGB 4FADA 5HRYA 3CR3A 2XPYA 5G04J 4A1SA 3ZYKA 2WXLA 3FUEA 3E32A 3G2TA 5ENOD 3LJNA 2V4LA 4GPMA 4WQOC 1H2UA 2VYIA 5D0QD 2H6GA 3UIOC 4N2SA 3Q9UC 4DI4A 1NZNA 3EU9A 5FZSA 4DK5A 1Q2ZA 3RKVA 3HHMA 5J90A 2GW1A 3ZEFA 3M4TA 2RFMA 3EDTB 3BQOA 3AS4A 2WPVA 4L2LA 4JEUA 4UI9J 4WAFA 1WG0A 4W9FB 4BETA 3TL5A 1IHGA 4N3AA 3QARA 4K0RA 2Y4UA 4HFGA 3FY4A 1NI1A 1E8YA
chains in the Genus database with same CATH topology
4K03A 1KT0A 3LDZA 2GRMA 3MX3A 1HE8A 2HR2A 5JHAA 2DIWA 2Q81A 3ZN3A 1BUOA 1S1GA 3RRUA 3RO2A 4AVXA 5IBKA 2WQHA 4PUCA 3APCA 1R2BA 3AU4A 3ESLA 3E4BA 2M63A 1JWGA 4RG9A 4Y6CA 3CEQA 3CSFA 1OUVA 4ILIA 3AS5A 4ANWA 2VGXA 2I2RA 5BXBA 4UWHA 5AENA 1TJFA 2WXJA 3D9NA 3FU0A 3T5XA 5LX8A 4JZYA 4BFRA 1LF8A 1A17A 4GYYA 2C0MA 3Q5MA 4OYSA 4PDXA 3I4RB 3I5PA 3UMVA 4URKA 5LP0A 1VCBB 3PNLB 5E76A 1E7UA 4BTBA 5E75A 4NACA 1INZA 2KATA 4YY8A 3FUIA 1OWOA 2XPZA 2AXVA 1XGWA 3BG0B 3DBSA 1JUQA 3IBEA 3L16A 4WWPA 4JA7A 2WXPA 3PNTB 4GB9A 3C6NA 2YY9A 3ZHEB 2A4ZA 4BX9A 3MKSA 2J08A 4MLPA 5FZRA 1BPOA 1KT1A 3QWPA 1Y8MA 2VTBB 4EZLA 4JTDB 4A3TA 1PY1A 4AXHA 3SF4A 4DLQA 3HYMB 3PE3A 1UN8A 4G24A 4GA0A 5ENNA 4JPSA 2AWIA 3EIQC 2I1JA 4KZ0A 4I6JC 4AIFA 2AW6A 3ZKJB 4CXTA 3CIAA 5JJTA 3FEXA 3HVEA 2NXPA 2YHCA 3ZIMA 2WB2A 3IHYA 3FDHA 3ASDA 4GYWA 3WXXA 3FUFA 4BT8A 4QFVA 3CVWA 2XGSA 2KZTA 2WXKA 3ML9A 4I43A 4HLEA 4U04A 1GW6A 3MKRA 5JJ6A 4A3VA 3MJWA 4LUNU 3EHNA 2L0IA 3ZYLA 3APFA 4XZ4A 5EX0A 4XX5A 2PPIA 3PRZA 1SQMA 2R17C 3B7RL 3FULA 1QDWA 5AIJA 3CHPA 1QDVA 3Q4AB 4FULA 3CHOA 4JL0A 1FCHA 2P1PA 2PZIA 4U2MA 3LEWA 4KT6B 4U8HA 5A6RA 1PAQA 2KM4A 4N5CA 3PEVB 1FQVB 4I1OB 3FU5A 4BKTB 3P2BA 2NSZA 4JA9A 3CHQA 4I2WA 2FI7A 2IU1A 3S7DA 4B8CB 3ASGA 3ZVVA 5G04C 2L6JA 3CKCA 3G2WA 5EDSA 4FA6A 3QKYA 4EOZA 3ZFWA 1A68A 4CDNA 3TG5A 2E2EA 1EODA 3L22A 4FJYA 5DADA 3FP3A 2WXOA 4LCTA 1P5QA 3MV2B 3PUJA 3RJVA 2VKPA 4KVOA 2UY1A 3TJPA 3D9LA 3BIMA 3JQ0A 5CMWA 2MRIA 2KC7A 2X6IA 4TUUA 4U07A 3ZW3A 2RD0A 3CVXA 4U0ZA 3MKQB 2MOWA 3ZYMA 4CXIA 2X3MA 3E4UA 3FEYA 2AXZA 4J8FA 3R9AB 4ACKA 5BNWA 1H6KA 3G2SA 4GZ3A 2IOSA 3OXLA 4V3IA 3S7FA 2YHEA 3CLJA 1U3CA 2ILRA 3FTUA 4APFA 1WAO1 3I3NA 1Z3XA 4H7XA 2C0LA 5KJKA 3HTMA 5CHEE 3UUXA 2YNQA 2CG2A 3HVEB 4B89A 4UQXA 4XI9A 4EZJA 3ZHEA 1HZ4A 5G55A 5G2NA 4MS6A 1OWMA 4JXTA 2QFCA 3SBSA 3LVRE 2A5UA 4PS3A 3ULQA 2E0IA 2OVBA 2LO6A 3B7SA 4HOQA 2NN2A 3O4ZA 2BUGA 4IYPA 4U77A 4UQYA 4J8EA 2XGMA 5FT9A 1N52A 3CK8A 4JEHA 3TXNA 3DRYA 4HOUA 3OTNA 3ML8A 2ASTA 1HO8A 4FLHA 3OGMA 2OOEA 2PQRA 4TRQA 4ILGA 2CHZA 4KVMA 5HYWB 5G05C 3UPVA 3QDNA 1H2VC 4YVQC 3SFZA 1NA0A 2UY1B 4HOTA 4AJWA 3TXMA 2Q7FA 4LEUA 4FHKA 3LS8A 2VSNA 2E31B 4FHJA 4J8DA 5FZQA 3OAWA 2GRLA 3VTYA 4HORA 4G1TA 1E8ZA 3LCAA 4ANXA 4AJYC 3EJNA 4CEMA 3LUTB 4CDMA 3U3WA 3D9KA 3FU3A 4GU5A 5ARFA 3VTXA 1QNFA 4DI3A 2WQ6A 4XKBA 3U4TA 3B84A 3SZ7A 2OV8A 2AVPA 2DCPA 3NZSA 3RIBA 5FQ8A 2E32B 2XRYA 4O6FA 4YNDA 4ATGA 1ELWA 5DBKA 4U63A 1OWPA 5EKQD 2V5FA 2YQ8A 3GZSA 3QAQA 4FU3A 4AM9A 3FFLA 4HXIA 3ONKA 1LQBB 3ZUNB 3LKUA 4UWLA 5G05J 5JHBA 3QC1A 3SBTB 2VTBA 2WXGA 4AWJB 3TAXA 3U64A 1FS2B 4APOA 1S0PA 2L0TB 3C6OA 4GZ6A 4KBQA 5EUPA 2VJ8A 5BXDA 4HVBA 4NURA 4I6GA 4EPZA 4CT0A 3RU0A 4L1BA 5T8IA 4I2ZA 3IKOB 4I6EA 4AY5A 4XE0A 2AXUA 2CHWA 3G2VA 2PQNA 4GPKA 3VLEA 3GW4A 4W9KB 1SZAA 2MA9C 2WXFA 3HDXA 3FUKA 1P22B 2WXMA 2DBAA 3URZA 1LDKD 3HQIA 2BF0X 4MRUA 3D9MA 3FUJA 1NEXA 2WXIA 2EQXA 4J6IA 5M72A 3JYSA 3CVNA 4AOFA 5KJLA 4I1AA 2P1NA 2CFUA 3UX4A 2Z8HA 5JJ7A 4E6HA 3ZRCB 3ZRHA 3CVQA 1WY6A 3FTXA 4G23A 1EF1C 3ZTCB 1HXIA 2HM8A 3L6AA 5BV1A 4AV7A 2C2LA 3CK7A 2HYZA 2J4BA 3D9PA 2ASSA 2FNJC 3MKQA 1UG3A 4F3VA 3NZUA 1NA3A 2L9BA 3OXGA 4MKTA 3L54A 3FTVA 4ME2A 1UJJA 3KAEA 1ZU2A 3CVPA 3FUMA 3SNXA 3FH8A 3LVQE 3V7DA 2J4DA 4HS2A 2PM6A 5A6CA 4W9LB 3SGHA 1JPLA 1YA0A 3RRMB 1ELKA 4UIJA 3NF1A 4DPRA 5J08A 4IULA 4BKSB 4FJZA 4G26A 3RRNB 4LRZA 1HG5A 1U3DA 4N3BA 4UWFA 4C0EA 4M3OA 3FH7A 1R29A 3PDNA 5A15A 4B94A 2LNIA 3CVUA 2Y4TA 3ASHA 1E7VA 5CCMA 2I9CA 2C9WC 2IF4A 1NP7A 4H7YA 3FUDA 3MV3B 4JHKA 3UQ3A 3ZPJA 4B9KE 3MZLB 3LJ3A 4CDRA 2WVIA 3AS8A 3D9IA 4YVOA 3M5BA 2P58C 1HG2A 2VGXB 3FTZA 3OHUA 3LYAA 3PUKA 1VDYA 3JQ1A 5HI7A 4HOSA 2XQ0A 1HX8A 1JWFA 4CRHA 4WNEA 1XNFA 4U2NA 3KS2A 1Y6IA 4AP2A 2A79B 5FQ7A 3KVTA 2R5SA 4GMJA 3LBZA 4W9JB 3FHEA 4G2VA 1KLXA 2IONA 1H0AA 5LOZA 1LM8C 3QK0A 3FWVA 2OVRA 2XPIA 2WM9A 1ZBPA 2WMNA 3VLDA 5ANLA 3UT4A 1EXBE 4W9CB 4B8AA 2R59A 4FLBA 5A7DB 2X6KA 1H19A 3NQPA 3UT8A 1EYHA 4EBAA 1NN7A 3HU6A 2NC9A 3ASFA 4Q94A 2FBNA 3T5VA 4P29A 3AU5A 3QWWA 3B13A 5T4YA 3U9WA 3U66A 3GA1A 4LERA 1L5JA 2J49A 4AEZC 3CGHA 4ZOUA 3ZTDB 4G25A 2R9RB 4WWNA 1OWLA 2KCLA 2XHEA 2IHCA 5FWQA 3LPZA 4GCNA 2VPKA 3MA5A 3FTSA 4DLOA 1QQEA 3ZYQA 4D10C 4BTAA 5KJMA 2CHXA 4PS7A 1EOFA 2IFUA 4Q96A 4W9HH 3CVVA 4UI9K 1PC2A 4W9RA 3G2UA 1R28A 2PM7A 1E8XA 4IRUA 3RO3A 4CCAA 3OGLA 3LNMB 3FH5A 3CSTA 4UWKA 3JUIA 3QOUA 3ESKA 3QNKA 4I17A 2ZU6B 4F1SA 5ANRA 3CVYA 4XKCA 2JEKA 5BT1A 4L7TA 4ZGCA 2LSVA 4U0SA 1HFAA 3GZ1A 4BX8A 1EOEA 1TJCA 2X6JA 4B0ZA 5D0OD 3PVLA 3PH0C 5BV0A 4EBAG 3S7BA 5DAFA 4UI9C 1B89A 1DSXA 4FP7A 3ZRFB 3OGKA 1HS6A 4JVSA 2KZTB 3FUHA 2FF4A 4JGHC 4OVUA 2XCBA 3GYZA 1HV2A 4GAAA 3S2AA 2P1OA 1MHQA 1E90A 4JC8A 1X5BA 2HO1A 4J8SA 3CKBA 2X6HA 2LAHA 4EQFA 4JHJA 2P1QA 3L13A 1IQUA 3SI5A 3L2OA 4ANVA 3K9IA 3KEZA 4BSXA 2WXNA 5BXHA 2WQ7A 1N54A 3N71A 2MHKA 5AJDA 4GCOA 3PZDA 3HIZA 2X6FA 3CVLA 4OVVA 2PL2A 4WNDA 4NQ0A 1IYGA 5BW8C 4UYIA 2V8SE 1FVHA 4J0UA 3ZGQA 5CMYA 3APDA 1WM5A 3P1UA 4GZCA 3DRZA 1EDUA 1DVPA 1QZ2A 3TG4A 4Q69A 3GZ2A 4G11A 3QWVA 4RG6A 2VQ2A 3LY7A 3PREA 4N3CA 2XCCA 3OXFA 3DRXA 4A1GA 1T1DA 5FTPA 3Q15A 4PS8A 3LXUX 2WXHA 2WMOA 3CHRA 5LCWJ 1HU3A 3CHMA 2J09A 3DPDA 2XGOA 3BEEA 4KYOB 2XEVA 4GZDA 3FKCA 2V0PA 5H7HA 4RVBA 5C2YA 4PH4B 3WSOB 4N2QA 1OWNA 3Q47B 4B95B 4BGCA 3M8VA 2IJGX 3MGBA 5AYWD 2ONDA 3CK9A 3D3MA 3EIJA 4UQZA 2GGFA 4GA2A 1SZ9A 3RK6A 3SD5A 4FC8A 3TGOA 4KZCA 4EECA 1TEZA 2FULA 3MCXA 1E96B 1EPUA 1FVFA 1Z3YA 4CGVA 4JTCB 1UW4B 3PEUB 3R7RA 2VSOE 5FQ4A 3FTWA 4I6JA 5FJYA 4I9EA 4C9BB 4L23A 1Z6TA 2CFZA 3ZNGB 4CT4A 5DIZA 4AY6A 4NRHB 4ABNA 4WNGA 4JW1A 3SHFA 3L08A 4CGWA 2JZ3C 3LY9A 5LCWC 3IHVA 4KMOA 4KXKB 4ILHB 4UWGA 1FS1B 3LY8A 2OVPA 4ACLA 5KCMA 3M52A 3CV0A 3OHVA 2YINA 2QY7A 2CG3A 5HZGC 4W9IB 3S7JA 2IOLA 3CQGB 3IEGA 2I1KA 3PS6A 4DJAA 4FADA 2OVFA 5C1DA 4W9DB 3CHSA 3CR3A 4WUYA 2UWJG 2XPYA 4CRWA 4L2YA 2Y3AA 5H7GA 5AJLA 5G04J 1HF8A 4A1SA 3ZYKA 2WXLA 3FUNA 3FUEA 3JCKC 5BO4C 5CCLA 3G2TA 1MQSA 1E8WA 3FTYA 1UN9A 1HH8A 3I4GA 3MEKA 4GA1A 2LAIA 2I2OA 3VLFA 4BWRA 4E85A 4Y6WA 4WQOC 2V4LA 3DCGB 4TV3A 3PE4A 1H2UA 2VYIA 2XRZA 4U0UA 5D0QD 3C6PA 5LLIB 2JLBA 3L17A 1H2TC 4N39A 2FO7A 5ARGA 2KCVA 4N2SA 4JTAB 5EX3A 2RG8A 4WWOA 4GZ5A 4XI0A 3R7QA 4DI4A 3T8MA 4GMLA 1NZNA 5FZSA 4R7LA 5LFAA 3CQCB 3B7TA 2VGYA 4GYOA 4DK5A 3RKVA 4C0MA 5BPPA 5HQ8A 4N9F5 5KJNA 4W9EB 3IV0A 3HHMA 5J90A 4RSYA 2GW1A 3ZEFA 2IZVC 3M4TA 3C98A 3EDTB 4BY6A 5FQ6A 3ZXSA 4EZKA 5FTAA 5JH5B 4F7AA 3AS4A 2VSXE 4BT9A 4CXJA 4J8ZA 4CP3A 4I9CA 2J07A 1W3BA 2WPVA 3EHMA 4IN3B 4L2LA 4JEUA 4XIFA 3UT7A 4W9HB 4B9KB 3B7UX 3Q49B 4I1MA 4W9GB 2J9QA 2OVQA 3ENEA 2LSUA 4WNFA 5BUZA 4JHRA 2IF5A 4UI9J 4WAFA 1UJKA 3ONLA 2BTDA 4W9FB 3D9JA 2NZ0B 1CS3A 2VSYA 3TL5A 5T3RA 1IHGA 4N3AA 4ANUA 1DNPA 2X38A 3QARA 4K0RA 4F53A 2WXRA 2Y4UA 3FU6A 2FEZA 3MYVA 1IQRA 1ELRA 3KD7A 3O48A 4HFGA 3FY4A 2KCKA 2I6HA 3QB2A 3QJZA 1E8YA 3BG1B 2WXQA 4A55A 3D9OA 2P1MA 5A23A 2IQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKC A;  4B9K E;  5H7H A;  2Q81 A;  1BUO A;  1S1G A;  3M5B A;  5IBK A;  3OHU A;  3WSO B;  1R2B A;  2NN2 A;  4B95 B;  4BGC A;  3M8V A;  4U77 A;  4CRH A;  4U2N A;  5BXB A;  2I2R A;  4AP2 A;  2A79 B;  2AST A;  3OGM A;  3KVT A;  3LBZ A;  4W9J B;  1LM8 C;  2OVR A;  5HYW B;  4JTC B;  1VCB B;  1EXB E;  4W9C B;  3ZNG B;  1NN7 A;  2E31 B;  3C6N A;  3HU6 A;  2YY9 A;  3MKS A;  2JZ3 C;  4AJY C;  1FS1 B;  3GA1 A;  3LUT B;  2OVP A;  4JTD B;  3M52 A;  3OHV A;  4ZOU A;  3ZTD B;  2R9R B;  5HZG C;  4W9I B;  4CXT A;  3B84 A;  4I6J C;  3ZKJ B;  2IHC A;  2VPK A;  3HVE A;  4W9D B;  1EOF A;  4W9H H;  2E32 B;  5H7G A;  1R28 A;  3OGL A;  3LNM B;  4HXI A;  1LQB B;  3ZUN B;  5BO4 C;  4AWJ B;  4WQO C;  1FS2 B;  3C6O A;  2PPI A;  3DCG B;  5EUP A;  5LLI B;  1QDW A;  3C6P A;  5BXD A;  1EOE A;  1QDV A;  2P1P A;  4JTA B;  4U2M A;  5A6R A;  5DAF A;  1DSX A;  1FQV B;  4W9K B;  2MA9 C;  3ZRF B;  3OGK A;  1P22 B;  4BKT B;  4JGH C;  1LDK D;  3HQI A;  4N9F 5;  4W9E B;  1NEX A;  2EQX A;  1HV2 A;  2P1O A;  2IZV C;  3M4T A;  4EOZ A;  2P1N A;  5FTA A;  1A68 A;  5JH5 B;  2Z8H A;  3ZRC B;  1EOD A;  5DAD A;  2P1Q A;  4CXJ A;  2VKP A;  4J8Z A;  3ZTC B;  3L2O A;  4CP3 A;  2FNJ C;  2ASS A;  3BIM A;  4B9K B;  5BXH A;  4W9H B;  4W9G B;  2OVQ A;  2IF5 A;  4CXI A;  3V7D A;  4W9F B;  4HS2 A;  3E4U A;  4UYI A;  4W9L B;  2NZ0 B;  1CS3 A;  3DRZ A;  4UIJ A;  4BKS B;  4APF A;  3I3N A;  3HTM A;  1R29 A;  5A15 A;  3HVE B;  1T1D A;  2P1M A;  2C9W C; 
#chains in the Genus database with same CATH topology
 2GRM A;  3ZN3 A;  1S1G A;  4AVX A;  5KBA A;  2P9L G;  1R2B A;  3E4B A;  1JWG A;  4RG9 A;  4Y6C A;  3CEQ A;  3CSF A;  5BXB A;  4UWH A;  4N5Q A;  1LF8 A;  1A17 A;  3Q5M A;  3I5P A;  3PNL B;  3WG7 E;  5E75 A;  4YY8 A;  3BG0 B;  1JUQ A;  4WWP A;  4JA7 A;  2WXP A;  3ZHE B;  2J08 A;  3EHR A;  1KT1 A;  1Y8M A;  4GTV A;  4JTD B;  3SF4 A;  2I1J A;  3C5R A;  2EIJ E;  5JJT A;  3FEX A;  2GRO B;  2NXP A;  2YHC A;  3ZIM A;  4GYW A;  3FUF A;  3SQV A;  3ML9 A;  5BXO A;  4HLE A;  4A3V A;  2ZIS A;  4LUN U;  5JMN D;  1SQM A;  1QDV A;  4FUL A;  4U2M A;  4KT6 B;  4N5C A;  3FU5 A;  3TWQ A;  3P2B A;  3CHQ A;  4I2W A;  2L6J A;  3CKC A;  3TWV A;  4FA6 A;  3FP3 A;  2WXO A;  2VKP A;  3PUJ A;  4U95 D;  3TJP A;  5EIB E;  1DC2 A;  3TWW A;  4TUU A;  4U0Z A;  2X3M A;  3F6Q A;  2FO1 E;  3FEY A;  4J8F A;  1JCS A;  3X2Q E;  5BNW A;  1FT2 A;  3G2S A;  2F37 A;  2IOS A;  4APF A;  1WAO 1;  4K5C A;  4H7X A;  3UUX A;  1OY3 D;  4XI9 A;  1HZ4 A;  5G55 A;  4YDY A;  4MS6 A;  1OWM A;  4ZHB A;  3SBS A;  5FIO A;  2OVB A;  3DSS A;  2B6C A;  5B3S E;  2BUG A;  4IYP A;  3CK8 A;  3DRY A;  3OTN A;  1UOH A;  3ML8 A;  4K5A B;  1H2V C;  4YVQ C;  1NA0 A;  2UY1 B;  4FHK A;  1IXV A;  4U8V D;  3OAW A;  1E8Z A;  4CEM A;  2V5Q C;  3FU3 A;  2WQ6 A;  1QNF A;  4XKB A;  3U4T A;  3B84 A;  3SZ7 A;  2DCP A;  1MX6 A;  5FQ8 A;  1TNB A;  4ATG A;  5DBK A;  5IY5 E;  2OEW A;  1OWP A;  2NYJ A;  2V5F A;  2YQ8 A;  3GZS A;  2V4H C;  1LQB B;  3ZUN B;  1N4R A;  5JHB A;  3SBT B;  3U64 A;  1S0P A;  2L0T B;  3DSW A;  2DYS E;  2VJ8 A;  3BUA A;  4BES A;  4EPZ A;  4XEI G;  2GRQ B;  1IKN D;  4I6E A;  4XE0 A;  4GPK A;  3VLE A;  3GW4 A;  2MA9 C;  3HDX A;  3FUJ A;  2WXI A;  5KJL A;  4I1A A;  2Z8H A;  3ZRC B;  3ZRH A;  3FTX A;  3L6A A;  1QYM A;  2HYZ A;  2J4B A;  2ASS A;  4ATZ D;  3OXG A;  2QZA A;  1UJJ A;  3KAE A;  3FUM A;  2J4D A;  4W9L B;  2PM6 A;  2ZXW E;  1JPL A;  4UIJ A;  4DPR A;  5J08 A;  4G26 A;  3RRN B;  1U3D A;  4N3B A;  1BLX B;  2LNI A;  1E7V A;  2I9C A;  1TNO A;  1BD8 A;  5ENR D;  2C9W C;  1NP7 A;  4B9K E;  3R9M A;  3AS8 A;  3M5B A;  3LYA A;  4RQI A;  3JQ1 A;  1S70 B;  1HX8 A;  4CRH A;  1OCO E;  1U2V G;  2IO3 C;  3EUV A;  1LM8 C;  1H0A A;  3QK0 A;  1D9S A;  4F6R D;  1OXJ A;  2WM9 A;  1ZBP A;  2QYU A;  2R59 A;  3NQP A;  1EYH A;  2FBN A;  3T5V A;  4P29 A;  3U9W A;  3B13 A;  5T4Y A;  3GA1 A;  4AEZ C;  3ZTD B;  3CGH A;  4G25 A;  3B7B A;  2KCL A;  2VPK A;  4GCN A;  4U7E B;  2DWZ A;  1EOF A;  4UI9 K;  3G2U A;  2PM7 A;  1E8X A;  3FH5 A;  3QOU A;  4L7T A;  2LSV A;  3NOG D;  4U0S A;  4ZFH A;  5D0O D;  3PVL A;  1SA5 A;  4UI9 C;  3UKU G;  3ZRF B;  1HS6 A;  2KZT B;  1TR4 A;  2XCB A;  1LD8 A;  1N4Q A;  2P1O A;  1E90 A;  2HO1 A;  2X6H A;  2P1Q A;  3L13 A;  3L2O A;  4BSX A;  3KEZ A;  2WXN A;  1N54 A;  3N71 A;  5CED B;  4UYI A;  4HQD A;  1FVH A;  4J0U A;  3P1U A;  1DVP A;  4G11 A;  3JXJ A;  1N0R A;  3W9F A;  3PRE A;  3ZU7 B;  4A1G A;  2RKK A;  5KNH D;  3CHR A;  5LCW J;  3CHM A;  1JCQ A;  3FKC A;  2F0Y A;  2XEV A;  5C2Y A;  4MBG A;  2XEH A;  3M8V A;  4L9P A;  5AYW D;  3D3M A;  3EIJ A;  3ABM E;  4FC8 A;  5EYL A;  3Q7F A;  1EPU A;  4CGV A;  3R7R A;  5FQ4 A;  1G3N B;  2CFZ A;  3ZNG B;  4DX2 A;  3DXM G;  1TN6 A;  4ABN A;  3SHF A;  3L08 A;  5EN5 D;  5LCW C;  1FS1 B;  2P9U G;  2KBX A;  2P9I G;  4ILH B;  3M52 A;  2XS1 A;  3CV0 A;  2YIN A;  2QY7 A;  5HZG C;  3S7J A;  4DJA A;  5C1D A;  4W9D B;  5AAO A;  4CRW A;  4WUY A;  2UWJ G;  5H7G A;  3DST A;  5CCL A;  1UN9 A;  1HH8 A;  2DVW A;  2GRN B;  2KXP C;  2LAI A;  3MEK A;  3DCG B;  5EIL A;  4GTR A;  2Y1L E;  3L17 A;  2XEE A;  4N39 A;  5ARG A;  2KCV A;  2RG8 A;  4GZ5 A;  3R7Q A;  4YDO A;  4R7L A;  3CQC B;  3B7T A;  2VGY A;  4C0M A;  5KJN A;  4TXQ A;  2IZV C;  4DX6 D;  2VSX E;  4BT9 A;  4J8Z A;  4K5B A;  4I9C A;  2J07 A;  3EHM A;  3PZ4 A;  4I1M A;  4W9G B;  4GTP A;  4DX1 A;  4WNF A;  3TWS A;  2IF5 A;  1UJK A;  5CRU A;  2L6B A;  1DNP A;  2WXR A;  3MYV A;  1IQR A;  3KD7 A;  3QJZ A;  2P1M A;  2IQC A;  4K03 A;  3TWT A;  5JHA A;  3ABL E;  4PUC A;  3APC A;  3ESL A;  2H6H A;  2M63 A;  2I2R A;  2WXJ A;  3T5X A;  4GYY A;  4GTS A;  1VCB B;  3FUI A;  1OWO A;  2XPZ A;  2AXV A;  1K3Z D;  1QBQ A;  3ZNG A;  4MLP A;  5FZR A;  1BPO A;  2VTB B;  3PE3 A;  4JPS A;  2AWI A;  4KZ0 A;  3IHY A;  3FDH A;  1N11 A;  5AN8 A;  4BT8 A;  4QFV A;  3CVW A;  2XGS A;  1GW6 A;  5JJ6 A;  3ZYL A;  3DEP A;  3FUL A;  5AIJ A;  3Q4A B;  4GMR A;  4U8H A;  5A6R A;  3SFY A;  3PEV B;  2NSZ A;  4JA9 A;  3S7D A;  3ZVV A;  3UI2 A;  1KPS B;  4CDN A;  4FJY A;  2UY1 A;  4CYM D;  5CMW A;  2KC7 A;  4U07 A;  1N4P A;  3CVX A;  3MKQ B;  4CXI A;  3ZYM A;  2AXZ A;  3R9A B;  4ACK A;  4V3I A;  3OXL A;  3I3N A;  1Z3X A;  4BER A;  5KJK A;  3ZHE A;  4JXT A;  1V54 E;  3ABK E;  2NN2 A;  4UQY A;  4J8E A;  5ITZ F;  4JEH A;  2RFA A;  2F8Y A;  2AST A;  4FLH A;  4HB5 A;  4HRN A;  4KVM A;  5HYW B;  3UPV A;  4HOT A;  3C3O A;  5FZQ A;  2GRL A;  3LCA A;  1D8E A;  1Z5S C;  4ANX A;  4AJY C;  1SW6 A;  4CDM A;  1K1A A;  4HI9 A;  4GU5 A;  5ARF A;  2F8X K;  4F1P A;  2AVP A;  3V30 A;  5ENP D;  2E32 B;  4YND A;  4U63 A;  4BSZ B;  3FFL A;  4HXI A;  3QC1 A;  4APO A;  3Q9N C;  1OCR E;  2IO2 C;  5BXD A;  5CEA A;  4NUR A;  4I6G A;  4CT0 A;  4I2Z A;  5HKP A;  2AXU A;  2CHW A;  3G2V A;  2PQN A;  4OAU C;  4W9K B;  1P22 B;  1IHB A;  2DBA A;  2BF0 X;  4MRU A;  1NEX A;  3E30 A;  4J6I A;  5M72 A;  1TNY A;  3NB2 A;  5JJ7 A;  1WY6 A;  2HM8 A;  1X81 A;  3MKQ A;  3V79 K;  3AG4 E;  3NZU A;  2L9B A;  3TWR A;  3L54 A;  3FTV A;  3ZKJ A;  1ZU2 A;  3CVP A;  3SNX A;  3FH8 A;  3LVQ E;  5H7P A;  5AQA A;  5A6C A;  3SGH A;  1YA0 A;  4BKS B;  4JB8 P;  4CZ2 D;  4FJZ A;  2ZGD A;  4C0E A;  5BXU A;  3FH7 A;  1YMP A;  2R03 A;  4B94 A;  2Y4T A;  3MV3 B;  4JHK A;  3MZL B;  3ASN E;  4YVO A;  2IY0 C;  3HXF A;  5HI7 A;  4HOS A;  1A5E A;  2DYR E;  4WNE A;  5FQ7 A;  3LBZ A;  1KZO A;  1KLX A;  2ION A;  3FWV A;  5CEC B;  2DZN A;  4W9C B;  4B8A A;  5A7D B;  2X6K A;  4EBA A;  2NC9 A;  4Q94 A;  3AU5 A;  4X8Q A;  4OAV B;  1L5J A;  2J49 A;  2QYJ A;  4ZOU A;  1D8D A;  2XHE A;  1OCC E;  3MA5 A;  3FTS A;  4DX7 D;  4D10 C;  4PS7 A;  2IFU A;  3CVV A;  2VGE A;  4UUC A;  1R28 A;  3RO3 A;  4F1S A;  5ANR A;  4XKC A;  5BT1 A;  2J8S D;  3AG3 E;  3GZ1 A;  3UIN C;  4B0Z A;  3S7B A;  1DSX A;  2FF4 A;  4OVU A;  4GAA A;  1MHQ A;  4JC8 A;  3CKB A;  2LAH A;  2P9N G;  4EQF A;  2BKK B;  1FPP A;  4GCO A;  3PZD A;  4DRX E;  3Q7A A;  3JUE A;  3ZGQ A;  5CMY A;  3APD A;  4BEP A;  1EDU A;  1N0Q A;  2Y0B G;  3GZ2 A;  4RG6 A;  3OXF A;  5FTP A;  3Q15 A;  3LXU X;  2WXH A;  1MYO A;  3DPD A;  3BEE A;  1N94 A;  4GZD A;  5B1B E;  4N2Q A;  1MX4 A;  4BGC A;  3MGB A;  2OND A;  2GGF A;  1DCE A;  3HRA A;  2EIM E;  2FUL A;  3MCX A;  1E96 B;  4C9B B;  4I6J A;  3DWL G;  5DIZ A;  4WNG A;  3T9K A;  2JZ3 C;  3LY9 A;  3EU5 A;  4LNG A;  4ACL A;  3NOC D;  3OHV A;  2CG3 A;  2ETC A;  4W9I B;  2IOL A;  3T8K A;  3PS6 A;  2OVF A;  3CHS A;  2Y69 E;  3AG1 E;  4L2Y A;  3DSX A;  1HF8 A;  3JCK C;  5BO4 C;  3I4G A;  4GA1 A;  3E33 A;  3VLF A;  1MQS A;  3D9H A;  3E37 A;  4Y6W A;  3PE4 A;  5LLI B;  2JLB A;  4JTA B;  2LUH A;  2BED A;  4WWO A;  4XI0 A;  3HG0 D;  3T8M A;  3RAU A;  5LFA A;  5BPP A;  4N9F 5;  3IV0 A;  4RSY A;  1SA4 A;  4YDE A;  3Q78 A;  5ENT D;  5FTA A;  1N9A A;  1NFI E;  1W3B A;  4IN3 B;  3B7U X;  2LSU A;  5BUZ A;  4JHR A;  2BTD A;  1CS3 A;  5CBN A;  5T3R A;  4F53 A;  2FEZ A;  3J5P A;  3HXD A;  2KCK A;  2I6H A;  3QB2 A;  3BG1 B;  2WXQ A;  4A55 A;  3URZ A;  3RSE G;  3LDZ A;  3MX3 A;  2HR2 A;  2DIW A;  2Q81 A;  3RRU A;  3RO2 A;  5IBK A;  1TNU A;  4ILI A;  3KSL A;  4ANW A;  1TJF A;  5LX8 A;  4JZY A;  2C0M A;  5LP0 A;  1E7U A;  1INZ A;  4NIK A;  3ASO E;  3ULQ A;  4GB9 A;  3PNT B;  4U8Y D;  2A4Z A;  4BX9 A;  3QWP A;  4EZL A;  1PY1 A;  3ULY A;  4DLQ A;  4G24 A;  5ENN A;  3ZKJ B;  1NL4 A;  3WXX A;  4LG6 A;  4I43 A;  4GTO A;  4LSZ E;  4U04 A;  4GTM A;  1MX2 A;  3MJW A;  5ENS D;  3UM3 A;  4HRL A;  3EHN A;  4XZ4 A;  5EX0 A;  4XX5 A;  2PPI A;  2R17 C;  3B7R L;  3PZ1 A;  1OCZ E;  1FCH A;  2PZI A;  1PAQ A;  4LNB A;  1FQV B;  3UTM A;  1JCR A;  3G2W A;  5EDS A;  4EOZ A;  1A68 A;  3TG5 A;  2E2E A;  1EOD A;  3L22 A;  5DAD A;  1RW2 A;  4LCT A;  3MV2 B;  3RJV A;  4KVO A;  3JQ0 A;  2DZO A;  3ZW3 A;  3E4U A;  4O1O A;  3FTU A;  3CLJ A;  1U3C A;  4LNU D;  2C0L A;  5CHE E;  2YNQ A;  2CG2 A;  4EZJ A;  2ETB A;  2QFC A;  4PS3 A;  2E0I A;  1TN7 A;  4HOQ A;  3B7S A;  5EYP F;  1S64 A;  3O4Z A;  3UXG A;  4U77 A;  3TXN A;  1YCS B;  3OGM A;  2OOE A;  2PQR A;  3JXI A;  3SO8 A;  3QDN A;  3SFZ A;  4AJW A;  4LEU A;  2VSN A;  2E31 B;  4J8D A;  3VTY A;  4HOR A;  4O1P A;  3V31 A;  3EJN A;  3U3W A;  3D9K A;  3VTX A;  1AP7 A;  4DI3 A;  2B0O E;  3RIB A;  4O6F A;  1H6P A;  4FU3 A;  4AM9 A;  1BU9 A;  3ONK A;  3LKU A;  4UWL A;  2VTB A;  2WXG A;  4AWJ B;  4U96 D;  3TAX A;  4C48 B;  1FS2 B;  3KEA A;  5EUP A;  3RU0 A;  4L1B A;  5T8I A;  2EIL E;  1SZA A;  4TUM A;  2WXF A;  1LDK D;  1RZ4 A;  2R2L A;  3EHQ A;  3JYS A;  3L82 A;  3CVQ A;  1EF1 C;  5HS0 A;  5BV1 A;  4AV7 A;  2FNJ C;  3D9P A;  1UG3 A;  1NA3 A;  3DSV A;  4MKT A;  4ME2 A;  3L9T A;  2QC9 A;  3B95 A;  3V7D A;  1ELK A;  3NF1 A;  4IUL A;  1K8K G;  2R05 A;  4JD2 G;  4UWF A;  4M3O A;  1R29 A;  3PDN A;  3CVU A;  3ASH A;  5CCM A;  2IF4 A;  4HNA D;  4H7Y A;  3UQ3 A;  2PNN A;  3LJ3 A;  2MYO A;  3D9I A;  2P58 C;  2VGX B;  2XQ0 A;  3AG2 E;  1Y6I A;  2XZT G;  2A79 B;  2R02 A;  3KVT A;  1FT1 A;  4GMJ A;  3TWU A;  3FHE A;  2OVR A;  2XPI A;  5ANL A;  4HLL A;  3UT4 A;  1EXB E;  4FLB A;  1H19 A;  3HU6 A;  4HBD A;  3AJI A;  2IEJ A;  2LXM A;  4WWN A;  2P9S G;  1QQE A;  3ZYQ A;  1V55 E;  4BTA A;  4DLO A;  5KJM A;  4W9H H;  4Q96 A;  1BI8 B;  4W9R A;  4CCA A;  3LNM B;  3CST A;  3ESK A;  3QNK A;  3V2O A;  3Q75 A;  4ZGC A;  4BX8 A;  4M7C A;  1EOE A;  3PH0 C;  5ENQ D;  3ISM C;  4EBA G;  5DAF A;  2P9P G;  3ULE G;  4JGH C;  3GYZ A;  3S2A A;  5KWD A;  1X5B A;  3C3R A;  1IQU A;  3K9I A;  5BXH A;  2WQ7 A;  2MHK A;  5AJD A;  3CVL A;  2P9K G;  2PL2 A;  4WND A;  4NQ0 A;  1IYG A;  5BW8 C;  2V8S E;  1TN8 A;  1WM5 A;  4GZC A;  3DRZ A;  4O60 A;  1QZ2 A;  5B1A E;  4Q69 A;  3QWV A;  4N3C A;  2XCC A;  2J09 A;  2V0P A;  4RVB A;  4TXR A;  3WSO B;  4HRM B;  3V2X A;  3Q47 B;  2IJG X;  4B93 B;  4UQZ A;  4GA2 A;  1SZ9 A;  3RK6 A;  3SD5 A;  1S63 A;  4EEC A;  1Z3Y A;  1UW4 B;  3FTW A;  4I9E A;  3E34 A;  2OEV A;  1N95 A;  4JW1 A;  4CGW A;  4KXK B;  2OVP A;  5KCM A;  3IEG A;  2I1K A;  3IXE A;  2Y3A A;  2BKG A;  5AJL A;  3UIP C;  3FUN A;  1E8W A;  3FTY A;  2H6I A;  4E85 A;  4BWR A;  2I2O A;  4TV3 A;  2XRZ A;  3C6P A;  4U0U A;  1H2T C;  2FO7 A;  1O5M A;  5EX3 A;  1TNZ A;  3UM1 A;  4GML A;  4G8K A;  3UM2 A;  4GYO A;  3SFX A;  5HQ8 A;  5AAR A;  4W9E B;  3C98 A;  1LTX A;  5FQ6 A;  3ZXS A;  4EZK A;  4BY6 A;  5JH5 B;  4F7A A;  3NAW A;  4CXJ A;  3UKR G;  1MZC A;  4CP3 A;  1AWC B;  4TXP A;  4XIF A;  3UT7 A;  4W9H B;  4B9K B;  3Q49 B;  2A5E A;  2J9Q A;  2OVQ A;  3ENE A;  3ONL A;  3D9J A;  2NZ0 B;  2VSY A;  4ANU A;  2X38 A;  3FU6 A;  1ELR A;  3O48 A;  3DPY A;  3D9O A;  1O1T A;  5A23 A;  3DRA A;  1KT0 A;  2JAB A;  3KSQ A;  5CBO A;  1HE8 A;  2GRR B;  1BUO A;  2WQH A;  4YDW A;  3UM0 A;  3AU4 A;  1OUV A;  3AS5 A;  2VGX A;  5AEN A;  3D9N A;  3FU0 A;  5AQ7 A;  4BFR A;  2LXL A;  3AAA C;  4OYS A;  4PDX A;  3DSU A;  3I4R B;  3UMV A;  4URK A;  5E76 A;  4BTB A;  4NAC A;  2KAT A;  1XGW A;  3DBS A;  3L16 A;  3IBE A;  3C6N A;  2YY9 A;  3MKS A;  1KZP A;  3Q73 A;  4A3T A;  4AXH A;  3HYM B;  1UN8 A;  4GA0 A;  4CXT A;  3EIQ C;  4I6J C;  4AIF A;  2AW6 A;  1BI7 B;  3CIA A;  3HVE A;  2WB2 A;  3ASD A;  2EIN E;  4EHM A;  2KZT A;  2WXK A;  3HXE A;  5KNG A;  3MKR A;  2L0I A;  3APF A;  3PRZ A;  3C72 A;  1QDW A;  2XZD G;  3CHP A;  3CHO A;  4JL0 A;  3ZUV B;  2P1P A;  3LEW A;  4J8Y A;  2KM4 A;  4I1O B;  4BKT B;  1ZB1 A;  3DEO A;  2EIK E;  2FI7 A;  3BU8 A;  2IU1 A;  4B8C B;  3ASG A;  5G04 C;  3QKY A;  3ZFW A;  1P5Q A;  1O1S A;  3D9L A;  3BIM A;  2MRI A;  2X6I A;  2RD0 A;  3HXB A;  2MOW A;  2ZIR A;  1H6K A;  4GZ3 A;  3S7F A;  2YHE A;  2H6F A;  2ILR A;  1TYQ G;  3HTM A;  3HVE B;  1DCQ A;  4B89 A;  4UQX A;  5G2N A;  2OCC E;  3TWX A;  3LVR E;  2A5U A;  2AJA A;  4A63 B;  2LO6 A;  4DX5 D;  3DXK G;  2XGM A;  5FIN A;  5FT9 A;  1N52 A;  4HOU A;  1HO8 A;  4TRQ A;  4ILG A;  2CHZ A;  5G05 C;  3TXM A;  2Q7F A;  3LS8 A;  4FHJ A;  4J7W A;  4GTQ A;  4G1T A;  3LUT B;  2OV8 A;  1LD7 A;  5CRV A;  3NZS A;  2XRY A;  1ELW A;  5EKQ D;  3QAQ A;  3NBN B;  5CER B;  5G05 J;  1MJ0 A;  1K1B A;  3PZ2 A;  3C6O A;  4GZ6 A;  4KBQ A;  4HVB A;  3IKO B;  4AY5 A;  3FUK A;  2WXM A;  3HQI A;  3D9M A;  2EQX A;  3CVN A;  4AOF A;  2P1N A;  4DUI A;  2CFU A;  3UX4 A;  4E6H A;  4G23 A;  4G8L A;  3ZTC B;  1HXI A;  2C2L A;  3CK7 A;  4F3V A;  5AQB A;  4HS2 A;  3RRM B;  5AQ9 A;  4LRZ A;  1HG5 A;  5A15 A;  4QQI A;  1SVX A;  3Q79 A;  3FUD A;  3ZPJ A;  4CDR A;  2WVI A;  1HG2 A;  3FTZ A;  3OHU A;  3PUK A;  1VDY A;  1H6O A;  3HXC A;  3C3Q A;  1JWF A;  1XNF A;  4U2N A;  3KS2 A;  1O1R A;  4Z68 A;  4AP2 A;  2R5S A;  4W9J B;  4HI8 A;  4G2V A;  5LOZ A;  2WMN A;  3VLD A;  4RLY A;  3UT8 A;  1NN7 A;  1N4S A;  3ASF A;  5JA4 D;  3QWW A;  3U66 A;  4LER A;  2R9R B;  2P2C P;  3J5Q B;  1OWL A;  2IHC A;  5FWQ A;  3LPZ A;  1OT8 A;  2CHX A;  2ZGG A;  1PC2 A;  3SY2 A;  4IRU A;  3OGL A;  4UWK A;  3JUI A;  5D2M C;  4I17 A;  2ZU6 B;  3CVY A;  2JEK A;  1HFA A;  3ZXP A;  3W9G A;  1TJC A;  2X6J A;  5BV0 A;  2HE0 A;  1B89 A;  4FP7 A;  3OGK A;  4JVS A;  3FUH A;  2ETA A;  1HV2 A;  4J8S A;  4JHJ A;  1WDY A;  3SI5 A;  4ANV A;  3PZ3 A;  2XEN A;  3HIZ A;  2X6F A;  4OVV A;  5D66 A;  3TG4 A;  2VQ2 A;  3LY7 A;  3DRX A;  1T1D A;  4PS8 A;  2WMO A;  1HU3 A;  2XGO A;  4KYO B;  5H7H A;  4PH4 B;  1OWN A;  2XS8 A;  4B95 B;  3CK9 A;  5EID A;  3TGO A;  4KZC A;  1TEZ A;  1FVF A;  4JTC B;  3PEU B;  1YYH A;  2VSO E;  5FJY A;  2GRP B;  4L23 A;  1Z6T A;  4CT4 A;  4AY6 A;  4NRH B;  4UWG A;  3IHV A;  4KMO A;  3LY8 A;  4GTT A;  3CQG B;  4FAD A;  5HRY A;  3CR3 A;  2XPY A;  5G04 J;  4A1S A;  3ZYK A;  2WXL A;  3FUE A;  3E32 A;  3G2T A;  5ENO D;  3LJN A;  2V4L A;  4GPM A;  4WQO C;  1H2U A;  2VYI A;  5D0Q D;  2H6G A;  3UIO C;  4N2S A;  3Q9U C;  4DI4 A;  1NZN A;  3EU9 A;  5FZS A;  4DK5 A;  1Q2Z A;  3RKV A;  3HHM A;  5J90 A;  2GW1 A;  3ZEF A;  3M4T A;  2RFM A;  3EDT B;  3BQO A;  3AS4 A;  2WPV A;  4L2L A;  4JEU A;  4UI9 J;  4WAF A;  1WG0 A;  4W9F B;  4BET A;  3TL5 A;  1IHG A;  4N3A A;  3QAR A;  4K0R A;  2Y4U A;  4HFG A;  3FY4 A;  1NI1 A;  1E8Y A; 
#chains in the Genus database with same CATH homology
 4K03 A;  1KT0 A;  3LDZ A;  2GRM A;  3MX3 A;  1HE8 A;  2HR2 A;  5JHA A;  2DIW A;  2Q81 A;  3ZN3 A;  1BUO A;  1S1G A;  3RRU A;  3RO2 A;  4AVX A;  5IBK A;  2WQH A;  4PUC A;  3APC A;  1R2B A;  3AU4 A;  3ESL A;  3E4B A;  2M63 A;  1JWG A;  4RG9 A;  4Y6C A;  3CEQ A;  3CSF A;  1OUV A;  4ILI A;  3AS5 A;  4ANW A;  2VGX A;  2I2R A;  5BXB A;  4UWH A;  5AEN A;  1TJF A;  2WXJ A;  3D9N A;  3FU0 A;  3T5X A;  5LX8 A;  4JZY A;  4BFR A;  1LF8 A;  1A17 A;  4GYY A;  2C0M A;  3Q5M A;  4OYS A;  4PDX A;  3I4R B;  3I5P A;  3UMV A;  4URK A;  5LP0 A;  1VCB B;  3PNL B;  5E76 A;  1E7U A;  4BTB A;  5E75 A;  4NAC A;  1INZ A;  2KAT A;  4YY8 A;  3FUI A;  1OWO A;  2XPZ A;  2AXV A;  1XGW A;  3BG0 B;  3DBS A;  1JUQ A;  3IBE A;  3L16 A;  4WWP A;  4JA7 A;  2WXP A;  3PNT B;  4GB9 A;  3C6N A;  2YY9 A;  3ZHE B;  2A4Z A;  4BX9 A;  3MKS A;  2J08 A;  4MLP A;  5FZR A;  1BPO A;  1KT1 A;  3QWP A;  1Y8M A;  2VTB B;  4EZL A;  4JTD B;  4A3T A;  1PY1 A;  4AXH A;  3SF4 A;  4DLQ A;  3HYM B;  3PE3 A;  1UN8 A;  4G24 A;  4GA0 A;  5ENN A;  4JPS A;  2AWI A;  3EIQ C;  2I1J A;  4KZ0 A;  4I6J C;  4AIF A;  2AW6 A;  3ZKJ B;  4CXT A;  3CIA A;  5JJT A;  3FEX A;  3HVE A;  2NXP A;  2YHC A;  3ZIM A;  2WB2 A;  3IHY A;  3FDH A;  3ASD A;  4GYW A;  3WXX A;  3FUF A;  4BT8 A;  4QFV A;  3CVW A;  2XGS A;  2KZT A;  2WXK A;  3ML9 A;  4I43 A;  4HLE A;  4U04 A;  1GW6 A;  3MKR A;  5JJ6 A;  4A3V A;  3MJW A;  4LUN U;  3EHN A;  2L0I A;  3ZYL A;  3APF A;  4XZ4 A;  5EX0 A;  4XX5 A;  2PPI A;  3PRZ A;  1SQM A;  2R17 C;  3B7R L;  3FUL A;  1QDW A;  5AIJ A;  3CHP A;  1QDV A;  3Q4A B;  4FUL A;  3CHO A;  4JL0 A;  1FCH A;  2P1P A;  2PZI A;  4U2M A;  3LEW A;  4KT6 B;  4U8H A;  5A6R A;  1PAQ A;  2KM4 A;  4N5C A;  3PEV B;  1FQV B;  4I1O B;  3FU5 A;  4BKT B;  3P2B A;  2NSZ A;  4JA9 A;  3CHQ A;  4I2W A;  2FI7 A;  2IU1 A;  3S7D A;  4B8C B;  3ASG A;  3ZVV A;  5G04 C;  2L6J A;  3CKC A;  3G2W A;  5EDS A;  4FA6 A;  3QKY A;  4EOZ A;  3ZFW A;  1A68 A;  4CDN A;  3TG5 A;  2E2E A;  1EOD A;  3L22 A;  4FJY A;  5DAD A;  3FP3 A;  2WXO A;  4LCT A;  1P5Q A;  3MV2 B;  3PUJ A;  3RJV A;  2VKP A;  4KVO A;  2UY1 A;  3TJP A;  3D9L A;  3BIM A;  3JQ0 A;  5CMW A;  2MRI A;  2KC7 A;  2X6I A;  4TUU A;  4U07 A;  3ZW3 A;  2RD0 A;  3CVX A;  4U0Z A;  3MKQ B;  2MOW A;  3ZYM A;  4CXI A;  2X3M A;  3E4U A;  3FEY A;  2AXZ A;  4J8F A;  3R9A B;  4ACK A;  5BNW A;  1H6K A;  3G2S A;  4GZ3 A;  2IOS A;  3OXL A;  4V3I A;  3S7F A;  2YHE A;  3CLJ A;  1U3C A;  2ILR A;  3FTU A;  4APF A;  1WAO 1;  3I3N A;  1Z3X A;  4H7X A;  2C0L A;  5KJK A;  3HTM A;  5CHE E;  3UUX A;  2YNQ A;  2CG2 A;  3HVE B;  4B89 A;  4UQX A;  4XI9 A;  4EZJ A;  3ZHE A;  1HZ4 A;  5G55 A;  5G2N A;  4MS6 A;  1OWM A;  4JXT A;  2QFC A;  3SBS A;  3LVR E;  2A5U A;  4PS3 A;  3ULQ A;  2E0I A;  2OVB A;  2LO6 A;  3B7S A;  4HOQ A;  2NN2 A;  3O4Z A;  2BUG A;  4IYP A;  4U77 A;  4UQY A;  4J8E A;  2XGM A;  5FT9 A;  1N52 A;  3CK8 A;  4JEH A;  3TXN A;  3DRY A;  4HOU A;  3OTN A;  3ML8 A;  2AST A;  1HO8 A;  4FLH A;  3OGM A;  2OOE A;  2PQR A;  4TRQ A;  4ILG A;  2CHZ A;  4KVM A;  5HYW B;  5G05 C;  3UPV A;  3QDN A;  1H2V C;  4YVQ C;  3SFZ A;  1NA0 A;  2UY1 B;  4HOT A;  4AJW A;  3TXM A;  2Q7F A;  4LEU A;  4FHK A;  3LS8 A;  2VSN A;  2E31 B;  4FHJ A;  4J8D A;  5FZQ A;  3OAW A;  2GRL A;  3VTY A;  4HOR A;  4G1T A;  1E8Z A;  3LCA A;  4ANX A;  4AJY C;  3EJN A;  4CEM A;  3LUT B;  4CDM A;  3U3W A;  3D9K A;  3FU3 A;  4GU5 A;  5ARF A;  3VTX A;  1QNF A;  4DI3 A;  2WQ6 A;  4XKB A;  3U4T A;  3B84 A;  3SZ7 A;  2OV8 A;  2AVP A;  2DCP A;  3NZS A;  3RIB A;  5FQ8 A;  2E32 B;  2XRY A;  4O6F A;  4YND A;  4ATG A;  1ELW A;  5DBK A;  4U63 A;  1OWP A;  5EKQ D;  2V5F A;  2YQ8 A;  3GZS A;  3QAQ A;  4FU3 A;  4AM9 A;  3FFL A;  4HXI A;  3ONK A;  1LQB B;  3ZUN B;  3LKU A;  4UWL A;  5G05 J;  5JHB A;  3QC1 A;  3SBT B;  2VTB A;  2WXG A;  4AWJ B;  3TAX A;  3U64 A;  1FS2 B;  4APO A;  1S0P A;  2L0T B;  3C6O A;  4GZ6 A;  4KBQ A;  5EUP A;  2VJ8 A;  5BXD A;  4HVB A;  4NUR A;  4I6G A;  4EPZ A;  4CT0 A;  3RU0 A;  4L1B A;  5T8I A;  4I2Z A;  3IKO B;  4I6E A;  4AY5 A;  4XE0 A;  2AXU A;  2CHW A;  3G2V A;  2PQN A;  4GPK A;  3VLE A;  3GW4 A;  4W9K B;  1SZA A;  2MA9 C;  2WXF A;  3HDX A;  3FUK A;  1P22 B;  2WXM A;  2DBA A;  3URZ A;  1LDK D;  3HQI A;  2BF0 X;  4MRU A;  3D9M A;  3FUJ A;  1NEX A;  2WXI A;  2EQX A;  4J6I A;  5M72 A;  3JYS A;  3CVN A;  4AOF A;  5KJL A;  4I1A A;  2P1N A;  2CFU A;  3UX4 A;  2Z8H A;  5JJ7 A;  4E6H A;  3ZRC B;  3ZRH A;  3CVQ A;  1WY6 A;  3FTX A;  4G23 A;  1EF1 C;  3ZTC B;  1HXI A;  2HM8 A;  3L6A A;  5BV1 A;  4AV7 A;  2C2L A;  3CK7 A;  2HYZ A;  2J4B A;  3D9P A;  2ASS A;  2FNJ C;  3MKQ A;  1UG3 A;  4F3V A;  3NZU A;  1NA3 A;  2L9B A;  3OXG A;  4MKT A;  3L54 A;  3FTV A;  4ME2 A;  1UJJ A;  3KAE A;  1ZU2 A;  3CVP A;  3FUM A;  3SNX A;  3FH8 A;  3LVQ E;  3V7D A;  2J4D A;  4HS2 A;  2PM6 A;  5A6C A;  4W9L B;  3SGH A;  1JPL A;  1YA0 A;  3RRM B;  1ELK A;  4UIJ A;  3NF1 A;  4DPR A;  5J08 A;  4IUL A;  4BKS B;  4FJZ A;  4G26 A;  3RRN B;  4LRZ A;  1HG5 A;  1U3D A;  4N3B A;  4UWF A;  4C0E A;  4M3O A;  3FH7 A;  1R29 A;  3PDN A;  5A15 A;  4B94 A;  2LNI A;  3CVU A;  2Y4T A;  3ASH A;  1E7V A;  5CCM A;  2I9C A;  2C9W C;  2IF4 A;  1NP7 A;  4H7Y A;  3FUD A;  3MV3 B;  4JHK A;  3UQ3 A;  3ZPJ A;  4B9K E;  3MZL B;  3LJ3 A;  4CDR A;  2WVI A;  3AS8 A;  3D9I A;  4YVO A;  3M5B A;  2P58 C;  1HG2 A;  2VGX B;  3FTZ A;  3OHU A;  3LYA A;  3PUK A;  1VDY A;  3JQ1 A;  5HI7 A;  4HOS A;  2XQ0 A;  1HX8 A;  1JWF A;  4CRH A;  4WNE A;  1XNF A;  4U2N A;  3KS2 A;  1Y6I A;  4AP2 A;  2A79 B;  5FQ7 A;  3KVT A;  2R5S A;  4GMJ A;  3LBZ A;  4W9J B;  3FHE A;  4G2V A;  1KLX A;  2ION A;  1H0A A;  5LOZ A;  1LM8 C;  3QK0 A;  3FWV A;  2OVR A;  2XPI A;  2WM9 A;  1ZBP A;  2WMN A;  3VLD A;  5ANL A;  3UT4 A;  1EXB E;  4W9C B;  4B8A A;  2R59 A;  4FLB A;  5A7D B;  2X6K A;  1H19 A;  3NQP A;  3UT8 A;  1EYH A;  4EBA A;  1NN7 A;  3HU6 A;  2NC9 A;  3ASF A;  4Q94 A;  2FBN A;  3T5V A;  4P29 A;  3AU5 A;  3QWW A;  3B13 A;  5T4Y A;  3U9W A;  3U66 A;  3GA1 A;  4LER A;  1L5J A;  2J49 A;  4AEZ C;  3CGH A;  4ZOU A;  3ZTD B;  4G25 A;  2R9R B;  4WWN A;  1OWL A;  2KCL A;  2XHE A;  2IHC A;  5FWQ A;  3LPZ A;  4GCN A;  2VPK A;  3MA5 A;  3FTS A;  4DLO A;  1QQE A;  3ZYQ A;  4D10 C;  4BTA A;  5KJM A;  2CHX A;  4PS7 A;  1EOF A;  2IFU A;  4Q96 A;  4W9H H;  3CVV A;  4UI9 K;  1PC2 A;  4W9R A;  3G2U A;  1R28 A;  2PM7 A;  1E8X A;  4IRU A;  3RO3 A;  4CCA A;  3OGL A;  3LNM B;  3FH5 A;  3CST A;  4UWK A;  3JUI A;  3QOU A;  3ESK A;  3QNK A;  4I17 A;  2ZU6 B;  4F1S A;  5ANR A;  3CVY A;  4XKC A;  2JEK A;  5BT1 A;  4L7T A;  4ZGC A;  2LSV A;  4U0S A;  1HFA A;  3GZ1 A;  4BX8 A;  1EOE A;  1TJC A;  2X6J A;  4B0Z A;  5D0O D;  3PVL A;  3PH0 C;  5BV0 A;  4EBA G;  3S7B A;  5DAF A;  4UI9 C;  1B89 A;  1DSX A;  4FP7 A;  3ZRF B;  3OGK A;  1HS6 A;  4JVS A;  2KZT B;  3FUH A;  2FF4 A;  4JGH C;  4OVU A;  2XCB A;  3GYZ A;  1HV2 A;  4GAA A;  3S2A A;  2P1O A;  1MHQ A;  1E90 A;  4JC8 A;  1X5B A;  2HO1 A;  4J8S A;  3CKB A;  2X6H A;  2LAH A;  4EQF A;  4JHJ A;  2P1Q A;  3L13 A;  1IQU A;  3SI5 A;  3L2O A;  4ANV A;  3K9I A;  3KEZ A;  4BSX A;  2WXN A;  5BXH A;  2WQ7 A;  1N54 A;  3N71 A;  2MHK A;  5AJD A;  4GCO A;  3PZD A;  3HIZ A;  2X6F A;  3CVL A;  4OVV A;  2PL2 A;  4WND A;  4NQ0 A;  1IYG A;  5BW8 C;  4UYI A;  2V8S E;  1FVH A;  4J0U A;  3ZGQ A;  5CMY A;  3APD A;  1WM5 A;  3P1U A;  4GZC A;  3DRZ A;  1EDU A;  1DVP A;  1QZ2 A;  3TG4 A;  4Q69 A;  3GZ2 A;  4G11 A;  3QWV A;  4RG6 A;  2VQ2 A;  3LY7 A;  3PRE A;  4N3C A;  2XCC A;  3OXF A;  3DRX A;  4A1G A;  1T1D A;  5FTP A;  3Q15 A;  4PS8 A;  3LXU X;  2WXH A;  2WMO A;  3CHR A;  5LCW J;  1HU3 A;  3CHM A;  2J09 A;  3DPD A;  2XGO A;  3BEE A;  4KYO B;  2XEV A;  4GZD A;  3FKC A;  2V0P A;  5H7H A;  4RVB A;  5C2Y A;  4PH4 B;  3WSO B;  4N2Q A;  1OWN A;  3Q47 B;  4B95 B;  4BGC A;  3M8V A;  2IJG X;  3MGB A;  5AYW D;  2OND A;  3CK9 A;  3D3M A;  3EIJ A;  4UQZ A;  2GGF A;  4GA2 A;  1SZ9 A;  3RK6 A;  3SD5 A;  4FC8 A;  3TGO A;  4KZC A;  4EEC A;  1TEZ A;  2FUL A;  3MCX A;  1E96 B;  1EPU A;  1FVF A;  1Z3Y A;  4CGV A;  4JTC B;  1UW4 B;  3PEU B;  3R7R A;  2VSO E;  5FQ4 A;  3FTW A;  4I6J A;  5FJY A;  4I9E A;  4C9B B;  4L23 A;  1Z6T A;  2CFZ A;  3ZNG B;  4CT4 A;  5DIZ A;  4AY6 A;  4NRH B;  4ABN A;  4WNG A;  4JW1 A;  3SHF A;  3L08 A;  4CGW A;  2JZ3 C;  3LY9 A;  5LCW C;  3IHV A;  4KMO A;  4KXK B;  4ILH B;  4UWG A;  1FS1 B;  3LY8 A;  2OVP A;  4ACL A;  5KCM A;  3M52 A;  3CV0 A;  3OHV A;  2YIN A;  2QY7 A;  2CG3 A;  5HZG C;  4W9I B;  3S7J A;  2IOL A;  3CQG B;  3IEG A;  2I1K A;  3PS6 A;  4DJA A;  4FAD A;  2OVF A;  5C1D A;  4W9D B;  3CHS A;  3CR3 A;  4WUY A;  2UWJ G;  2XPY A;  4CRW A;  4L2Y A;  2Y3A A;  5H7G A;  5AJL A;  5G04 J;  1HF8 A;  4A1S A;  3ZYK A;  2WXL A;  3FUN A;  3FUE A;  3JCK C;  5BO4 C;  5CCL A;  3G2T A;  1MQS A;  1E8W A;  3FTY A;  1UN9 A;  1HH8 A;  3I4G A;  3MEK A;  4GA1 A;  2LAI A;  2I2O A;  3VLF A;  4BWR A;  4E85 A;  4Y6W A;  4WQO C;  2V4L A;  3DCG B;  4TV3 A;  3PE4 A;  1H2U A;  2VYI A;  2XRZ A;  4U0U A;  5D0Q D;  3C6P A;  5LLI B;  2JLB A;  3L17 A;  1H2T C;  4N39 A;  2FO7 A;  5ARG A;  2KCV A;  4N2S A;  4JTA B;  5EX3 A;  2RG8 A;  4WWO A;  4GZ5 A;  4XI0 A;  3R7Q A;  4DI4 A;  3T8M A;  4GML A;  1NZN A;  5FZS A;  4R7L A;  5LFA A;  3CQC B;  3B7T A;  2VGY A;  4GYO A;  4DK5 A;  3RKV A;  4C0M A;  5BPP A;  5HQ8 A;  4N9F 5;  5KJN A;  4W9E B;  3IV0 A;  3HHM A;  5J90 A;  4RSY A;  2GW1 A;  3ZEF A;  2IZV C;  3M4T A;  3C98 A;  3EDT B;  4BY6 A;  5FQ6 A;  3ZXS A;  4EZK A;  5FTA A;  5JH5 B;  4F7A A;  3AS4 A;  2VSX E;  4BT9 A;  4CXJ A;  4J8Z A;  4CP3 A;  4I9C A;  2J07 A;  1W3B A;  2WPV A;  3EHM A;  4IN3 B;  4L2L A;  4JEU A;  4XIF A;  3UT7 A;  4W9H B;  4B9K B;  3B7U X;  3Q49 B;  4I1M A;  4W9G B;  2J9Q A;  2OVQ A;  3ENE A;  2LSU A;  4WNF A;  5BUZ A;  4JHR A;  2IF5 A;  4UI9 J;  4WAF A;  1UJK A;  3ONL A;  2BTD A;  4W9F B;  3D9J A;  2NZ0 B;  1CS3 A;  2VSY A;  3TL5 A;  5T3R A;  1IHG A;  4N3A A;  4ANU A;  1DNP A;  2X38 A;  3QAR A;  4K0R A;  4F53 A;  2WXR A;  2Y4U A;  3FU6 A;  2FEZ A;  3MYV A;  1IQR A;  1ELR A;  3KD7 A;  3O48 A;  4HFG A;  3FY4 A;  2KCK A;  2I6H A;  3QB2 A;  3QJZ A;  1E8Y A;  3BG1 B;  2WXQ A;  4A55 A;  3D9O A;  2P1M A;  5A23 A;  2IQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...