3HVEB

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
195
Chain Sequence
DPQHAARLLRALSSFRERFCDAHLVEPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLEDIQDVVQAADLLLLTDLKTLCCEFLEGCIANCIGIRDFALHYCLHVHYLATEYLETHFRDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVHMKDVMSALWVSGSSYLREQMLNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
molecule keywords Gigaxonin
total genus 44
structure length 195
sequence length 231
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00651 BTB BTB/POZ domain
B PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveB02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveB01
4CP3A 4CXIA 4AJYC 4W9FB 5DAFA 5BXHA 3M4TA 3HU6A 4CXJA 5IBKA 2NZ0B 3OHUA 1BUOA 1QDWA 4UIJA 5H7HA 1S1GA 4APFA 4U2NA 3DRZA 4W9HH 3LUTB 2VPKA 2IZVC 4JTCB 2OVQA 2R9RB 3C6NA 4J8ZA 3WSOB 3B84A 4UYIA 4BGCA 1R28A 2IHCA 4ZOUA 2E32B 4B9KE 1P22B 3OHVA 3C6PA 3M5BA 1R2BA 5BO4C 4AWJB 3KVTA 4CXTA 4W9JB 2P1MA 3HQIA 4N9F5 5BXBA 1EODA 1DSXA 2FNJC 3ZNGB 4U77A 3HTMA 1QDVA 4JGHC 1T1DA 3HVEB 3OGKA 2P1OA 2OVPA 2Z8HA 4B95B 3LNMB 5HYWB 2ASSA 3BIMA 2P1PA 3ZTDB 1NEXA 4U2MA 5A15A 1CS3A 2ASTA 2PPIA 2IF5A 5H7GA 3L2OA 4W9HB 3HVEA 4CRHA 3E4UA 3MKSA 2OVRA 1FS2B 4W9IB 2NN2A 4BKSB 3I3NA 2E31B 4I6JC 5A6RA 4W9EB 2YY9A 1EOEA 3ZTCB 5LLIB 5JH5B 2VKPA 3FKCA 1A68A 1FQVB 4W9KB 3ZUNB 4W9GB 4W9LB 4JTAB 3GA1A 4WQOC 3ZRFB 4B9KB 3OGMA 1EOFA 1R29A 3OGLA 3V7DA 5HZGC 2A79B 4AP2A 2EQXA 3M52A 4W9DB 1HV2A 2P1NA 2MA9C 2P1QA 4W9CB 4BKTB 2I2RA 4HS2A 1LQBB 3ZKJB 1EXBE 3DCGB 3ZRCB 5BXDA 2C9WC 5FTAA 2Q81A 4EOZA 1VCBB 1FS1B 2JZ3C 4JTDB 4HXIA 1LM8C 3M8VA 3LBZA 5EUPA 1LDKD 3C6OA 5DADA 1NN7A
chains in the Genus database with same CATH superfamily
3NQPA 5G55A 4CEMA 5BXHA 4XI0A 4TXQA 3WG7E 3E34A 4FADA 3G2VA 3DRZA 4Q96A 5CBOA 3CKCA 4IN3B 4DX2A 3Q78A 2X38A 3PZ2A 4RVBA 4UWHA 3MCXA 4MBGA 3ZYQA 4L1BA 4NACA 2XRZA 3HQIA 4KXKB 3FTUA 4ANUA 3FU6A 2YHEA 1XNFA 3NOCD 4HB5A 5G2NA 4GZ3A 3X2QE 3HTMA 1QDVA 4YVOA 4RG6A 4JHRA 1KT1A 3NZUA 2RFAA 3L54A 3ZHEA 4LNUD 5AQAA 1JCRA 4GMRA 3E32A 4FHJA 4APOA 4W9EB 3HRAA 3SFXA 4WNEA 2QFCA 4JTAB 1FCHA 3R7RA 3ZGQA 3EJNA 5EILA 4BT9A 3IKOB 1N0RA 2WQ7A 2KXPC 4A63B 2F8XK 1MX6A 3ASNE 2JZ3C 1TNOA 1MYOA 3M4TA 1DC2A 5EIDA 2OVFA 2ETAA 5IBKA 3ZU7B 3IXEA 4CDMA 5KBAA 2PQRA 1KLXA 1YYHA 4XIFA 4YDOA 5BV0A 4L2LA 4UWGA 4JTCB 3KSQA 2ZIRA 5CRVA 4L7TA 3TWUA 5FWQA 3KAEA 1VDYA 5FQ8A 3HIZA 4BESA 3Q4AB 4JC8A 3PZ3A 4CXTA 4G24A 1HG5A 1O1SA 4TV3A 3RU0A 3QK0A 5BXBA 1E8XA 4I6JA 4W9RA 1O1TA 4YY8A 3UUXA 4BWRA 3CHQA 4FHKA 4JL0A 3VLDA 4JGHC 4R7LA 2KCKA 3I4GA 3CK7A 2XGMA 3S7FA 2VGYA 3JCKC 2XZDG 5CCLA 2V4LA 4HOQA 1SQMA 2H6HA 5JHAA 3HVEA 4CRHA 5ENQD 4KZ0A 4LCTA 5CERB 3PUJA 3APDA 4MS6A 4BSXA 4BSZB 4XZ4A 4B9KB 4O1OA 4U0SA 2EIKE 3BUAA 5EN5D 4YDYA 3CIAA 3CEQA 4HLLA 2P58C 2CHZA 1H6KA 3CVWA 1EDUA 3KS2A 4AM9A 2FO1E 1FT2A 3NAWA 3SD5A 3L08A 2L6JA 1NL4A 3PVLA 3DXKG 2NZ0B 4UIJA 4C9BB 4CDNA 5ANLA 4B89A 2ZXWE 3PE3A 4JA9A 4UI9J 2XZTG 2J08A 3LVRE 4HOUA 4BGCA 3KSLA 1R28A 3S7BA 2AVPA 2EINE 1IQUA 2F8YA 3UT8A 3CK9A 2VQ2A 1S63A 3AS8A 3ABME 2Y0BG 4DK5A 3TL5A 3ASGA 5D0OD 3IBEA 1V54E 1G3NB 3CHRA 2KBXA 1DSXA 4UQXA 1BPOA 3IEGA 4NQ0A 3EHNA 5D66A 3UINC 3CVLA 4FP7A 3LY8A 4JA7A 3RIBA 2P1OA 3FULA 5EYPF 2JABA 4N5CA 1UOHA 3ML8A 3T8KA 4C0MA 2NC9A 3D9MA 5G04C 4EBAG 2QY7A 2DCPA 4KMOA 4D10C 3FUFA 3EIJA 1WG0A 5LOZA 4KZCA 3HXCA 3DSTA 3CQCB 1LD8A 5KNHD 1JWGA 2OV8A 3FY4A 4HRNA 1E8ZA 3B7SA 1AP7A 4JD2G 3ZN3A 2IFUA 3MJWA 4BKTB 2VTBA 3E33A 1H6PA 2XEHA 3LVQE 4U8VD 2PM6A 5EDSA 3PZ1A 2AJAA 4FJYA 1NZNA 3BG0B 3TWSA 4GPMA 4GTMA 3FH5A 1OWMA 3JUEA 4TXRA 1O5MA 3LUTB 3O48A 4TXPA 3ZKJA 2L0TB 1WY6A 4WAFA 1Q2ZA 3FTVA 1OCRE 4B9KE 3TG5A 2GROB 4EHMA 3S7DA 1K1AA 4KT6B 3VTXA 3DRYA 1EODA 5HRYA 2XS1A 3TXMA 3LS8A 4UWFA 4KVMA 3DSVA 1HX8A 4Q69A 4E85A 3DRXA 5HKPA 4CZ2D 3U66A 2XEEA 2XGSA 2ZISA 2WMOA 3SHFA 5JA4D 2ASSA 2P1PA 3ZTDB 4U2MA 2YINA 4DX6D 4U0UA 5FZQA 4V3IA 4UWLA 1Y8MA 3E37A 5DBKA 4U0ZA 5HS0A 1AWCB 3FKCA 4WNFA 3CVXA 3JQ1A 1K8KG 2X6FA 2LXMA 5JHBA 1HV2A 2LNIA 5HQ8A 4KYOB 2MA9C 3BQOA 5KCMA 3FU3A 4UQYA 4GA0A 1L5JA 4ANXA 3ZXSA 1JWFA 4U96D 4A1GA 2EILE 4AJYC 5DAFA 2I1JA 3AG4E 3APCA 3L82A 1TN7A 2WXIA 3AG1E 3OHUA 3ML9A 3AU5A 1TYQG 5FIOA 2I6HA 3UX4A 4UYIA 4I1MA 3UXGA 3RK6A 4A3TA 1EF1C 1P22B 1DNPA 4LERA 1ZBPA 1QNFA 1HXIA 4WUYA 5ENNA 4UQZA 3RRMB 3TJPA 4QFVA 2AXZA 2GRQB 2WXJA 3FUIA 1N52A 3SFYA 2IF4A 4J6IA 4FA6A 4U77A 5H7PA 3LCAA 1ELWA 3B7TA 3Q75A 3HXBA 4AOFA 2WXFA 3N71A 2BTDA 4LRZA 2DZOA 1DCQA 2E0IA 2J9QA 4J8DA 2IQCA 1WM5A 4PDXA 4IULA 3HXFA 1EOEA 2J49A 5JH5B 1FQVB 1SA4A 4CDRA 3ZRFB 3ZUVB 1PY1A 4B94A 4JEUA 2Y3AA 3HDXA 4I2WA 4U63A 2AWIA 1H2TC 5JJ6A 1N4RA 2I2RA 4HI8A 4FJZA 3FDHA 1BLXB 2GW1A 2LAHA 1N94A 3B7UX 5J08A 4H7YA 4ZHBA 1U2VG 3EHRA 3LYAA 2X6HA 5A6CA 1KT0A 1ELRA 4JB8P 2DYSE 3Q47B 1WAO1 3CSFA 1QDWA 3SBTB 3TWXA 2P9UG 1TN6A 2B0OE 4O1PA 2VPKA 4I9CA 4P29A 2F37A 3QARA 5LX8A 1GW6A 4KVOA 5J90A 3RKVA 3ENEA 5ARGA 3C3RA 2Y4UA 5FZSA 3V30A 5B3SE 1R2BA 2QYUA 3OAWA 2VSNA 4G26A 4N9F5 3FTSA 3SFZA 2FBNA 4DX7D 4EQFA 5LCWC 1MZCA 1A5EA 2L9BA 4HRLA 4B8AA 2MYOA 3V31A 4Y6WA 2WXLA 4I1OB 4IRUA 4HOTA 2WVIA 4TRQA 1K3ZD 2ETCA 4AY6A 4U8YD 5H7GA 4KBQA 3UM0A 2WM9A 4I6JC 4GTPA 4G8LA 5LLIB 4PUCA 1DCEA 4K0RA 2JLBA 2C0MA 1R29A 3NB2A 4HI9A 5ANRA 1YA0A 2EQXA 4ACLA 4XEIG 5BXDA 4XKBA 5EX3A 4AXHA 1LDKD 3C72A 4EBAA 1K1BA 4G1TA 2WQ6A 4LNGA 5HI7A 2GRLA 4A3VA 1SA5A 1IYGA 4OVUA 4MRUA 1S1GA 4HORA 2XRYA 2F0YA 4BTBA 1N9AA 3ZYLA 2IHCA 4ZOUA 1YCSB 2E32B 2WXOA 5C1DA 1LTXA 2RG8A 3SZ7A 4B8CB 3C6PA 2AXVA 3VLEA 4WNGA 3UKRG 1MX4A 3OXLA 5AQBA 3DXMG 3NBNB 4N39A 4O60A 2FF4A 1N4QA 3CHSA 5E75A 3VTYA 2LSUA 2R05A 2VYIA 3B95A 1T1DA 2GRRB 3CHMA 5ENOD 5AARA 3FUEA 3DRAA 4YNDA 4URKA 2VSXE 3EIQC 5FQ7A 3AG3E 4J8YA 2PPIA 4HLEA 2EIME 2GGFA 3MV2B 1UN9A 4CYMD 4GZCA 4LNBA 4GU5A 5B1AE 1ELKA 2OEWA 3C3OA 2IJGX 2CG2A 5T8IA 3ZW3A 3FTWA 2J09A 2RFMA 1HG2A 1SZ9A 5KJMA 3ESKA 3CLJA 4Q94A 5JJ7A 4W9CB 4DLOA 2A5EA 2LXLA 3G2TA 1VCBB 1FS1B 3DEOA 2WXRA 3ISMC 5EUPA 2MHKA 4B0ZA 5DADA 4NIKA 1UJJA 1HF8A 4ATZD 3DSUA 3RSEG 2VSOE 3QAQA 4U95D 5LFAA 4F1PA 3RAUA 3ZVVA 1H19A 4NURA 4N2SA 2UY1A 5CMYA 3ZIMA 3CQGB 4K5CA 2J4BA 1DVPA 2IEJA 3CHPA 4DJAA 3RJVA 4BERA 3TAXA 1KZOA 3CVPA 3I5PA 3PUKA 3D9NA 3FUMA 3TWTA 2FI7A 4FC8A 3SQVA 2UY1B 4UI9C 4GMJA 1TJFA 3D9JA 3NZSA 2Z8HA 5EKQD 2CHWA 1H6OA 1JUQA 3BIMA 1X81A 3QNKA 3B7RL 3NOGD 4XI9A 1TR4A 3L2OA 2KCLA 1UJKA 3EDTB 4AJWA 3G2WA 3E4BA 3GZ2A 3CVQA 3MKQB 4RLYA 3CVUA 3FH8A 5CECB 2E2EA 5ITZF 3ZTCB 2NXPA 5FTPA 1TN8A 3ZUNB 2LSVA 3RRUA 3OGMA 4AV7A 3BG1B 1OT8A 2WXNA 2YQ8A 3J5QB 1NFIE 3B13A 2R17C 2WXKA 1INZA 3Q15A 3ZKJB 4A55A 3DCGB 3AS4A 1X5BA 3L17A 2XCBA 4MKTA 4GTSA 1FVFA 3QWVA 4ZFHA 2CHXA 4BEPA 2WXMA 1RW2A 3KEZA 5EYLA 4RG9A 4F6RD 4W9FB 1E8YA 2PM7A 3V2XA 3D9IA 2BEDA 5BT1A 4Z68A 4I6EA 5A7DB 4OAUC 3IHVA 1OWPA 3C6NA 4EPZA 5JJTA 4UUCA 3PNLB 4C48B 1N11A 2HM8A 3CKBA 1QZ2A 5BV1A 3S2AA 2PZIA 5ENPD 4N3CA 3G2UA 5FJYA 4J7WA 3CK8A 4U04A 3FWVA 2FNJC 4QQIA 4DPRA 1UW4B 3ESLA 4CT4A 2XPIA 4EZJA 5CRUA 1HO8A 1BI7B 3Q9NC 3DSSA 5EX0A 1OY3D 5ENRD 2ILRA 5KJNA 5A6RA 3KD7A 1MX2A 3BU8A 3GA1A 2KZTB 5EIBE 4FULA 3ZHEB 4U8HA 5KNGA 5A23A 5CEDB 4W9DB 1NA3A 2WXQA 2X6KA 4XX5A 1QYMA 2CFZA 1LQBB 2ZGDA 1HS6A 2R2LA 3UIOC 3CGHA 2C2LA 4HXIA 1BI8B 3C6OA 2BKGA 3NF1A 2KCVA 4ANWA 4OYSA 4PH4B 5AIJA 1W3BA 4U7EB 3UQ3A 4ME2A 3TXNA 4NRHB 2QZAA 2GRPB 3Q7AA 1D8EA 2LO6A 4I9EA 3ULYA 2IZVC 2J4DA 2FULA 1UN8A 2UWJG 5AAOA 3CR3A 5G05J 2DWZA 1E90A 4M7CA 3MA5A 4PS3A 3T8MA 2L0IA 4K5BA 3CHOA 4EECA 2A5UA 1OWNA 3UTMA 2RD0A 3D9OA 1IQRA 4GZ5A 3ASHA 2P1MA 4I6GA 3R7QA 2DZNA 3D9PA 1E8WA 3UM1A 1LD7A 3ASDA 3UI2A 1OUVA 3ZNGB 2OEVA 4J8FA 3QWPA 3L13A 5FQ4A 1UG3A 2IO2C 1TEZA 3OGKA 4ILHB 4B95B 3LNMB 2Y69E 4RSYA 5HYWB 3APFA 3D3MA 4I1AA 3D9LA 1FPPA 3JQ0A 2EIJE 2H6IA 2V8SE 1FS2B 2NN2A 4H7XA 3FUKA 2YY9A 4B93B 4BFRA 1P5QA 5CBNA 1S0PA 2OVBA 3B7BA 3PH0C 1EOFA 3OGLA 2R03A 3U64A 1B89A 2XEVA 2WB2A 2P1QA 4LEUA 2ETBA 3LJNA 5G05C 1TNZA 2WPVA 3PE4A 3W9GA 3JYSA 3OXFA 4CRWA 1NN7A 2FO7A 3HU6A 3GZSA 4DI4A 1QQEA 2WXHA 5KJLA 5H7HA 4U2NA 1H2UA 2I2OA 3SGHA 3URZA 1MQSA 3HXDA 2IONA 3WSOB 1WDYA 4HOSA 2WQHA 3FTXA 4N5QA 4CCAA 2P9NG 3OHVA 5BO4C 2V0PA 1FVHA 3KVTA 3QWWA 3PS6A 1PAQA 3J5PA 5FZRA 4ZGCA 4TUMA 2XCCA 3ZFWA 3R9AB 3OXGA 4HBDA 1N0QA 3V79K 5FT9A 3VLFA 1KZPA 5CMWA 4BTAA 1Z6TA 5KWDA 4BT8A 3GYZA 2VGXB 1NEXA 4DX5D 3T5VA 3PZDA 1CS3A 2ASTA 3GW4A 4MLPA 5BUZA 4FLHA 5AQ9A 4UI9K 2CG3A 3ZNGA 2OVRA 4K03A 4W9IB 4M3OA 3I3NA 3C3QA 3MYVA 4GYYA 1SVXA 2VJ8A 1HU3A 3C98A 2VKPA 3UIPC 4DX1A 4A1SA 3ZEFA 3FEYA 4J8EA 1H0AA 3PNTB 1JPLA 3JXIA 1TNUA 4I43A 1Y6IA 4ATGA 1IXVA 1IHBA 5FTAA 4EOZA 5E76A 3RO3A 4C0EA 3Q49B 4F3VA 3QOUA 4OAVB 3LDZA 4CP3A 1Z3XA 4CXIA 5LCWJ 4GZ6A 3CSTA 2X3MA 4BETA 1BUOA 1H2VC 4W9HH 4X8QA 5BXOA 4GB9A 4ILGA 4DUIA 3FU5A 3KEAA 3ULEG 3HHMA 3AG2E 1OWOA 2AXUA 5AJLA 4WWPA 3ONKA 4AWJB 5LP0A 4HQDA 1HH8A 1SW6A 2KATA 3PEVB 4JPSA 2IOLA 3SNXA 3UT7A 2V5QC 2PQNA 5AJDA 4CT0A 4PS8A 4CGVA 2LAIA 4L2YA 3K9IA 4GA2A 3DPDA 4GYOA 1E7UA 1PC2A 4W9HB 5ENTD 3TWWA 5IY5E 3EUVA 3U4TA 2RKKA 2X6IA 1TNBA 3EU5A 3MKRA 4DLQA 4AP2A 4GMLA 3MEKA 3PEUB 3PRZA 2C0LA 3MKQA 3MZLB 2J07A 2X6JA 4WWOA 1LM8C 1OCCE 3L22A 1YMPA 5JMND 5T3RA 3SF4A 4HVBA 1JCQA 3JUIA 3QC1A 2V4HC 4EZKA 2VTBB 4J8ZA 2QC9A 5C2YA 4F53A 3O4ZA 3B84A 1KPSB 4F1SA 3UMVA 5D0QD 3LEWA 3FHEA 4TUUA 2PL2A 3SY2A 4G2VA 4W9JB 4EZLA 4XKCA 3IHYA 4HNAD 2OCCE 2L6BA 3R9MA 2OOEA 2P9LG 3DPYA 2R5SA 1BD8A 3CV0A 4I2ZA 3DWLG 3T5XA 4JEHA 3L16A 3Q7FA 2DVWA 4G11A 4YDEA 4N2QA 4I17A 2P9PG 2XPZA 1SZAA 2ONDA 3T9KA 3AAAC 3D9KA 2BKKB 3MKSA 4G25A 3QDNA 4HRMB 3DSWA 5BNWA 1V55E 3L6AA 1S70B 4AIFA 4JHJA 2BF0X 4L9PA 2Y4TA 2P2CP 2XQ0A 4GPKA 5AENA 2M63A 5CCMA 1LF8A 4GCNA 1O1RA 2NSZA 4HS2A 3LKUA 2MRIA 2C9WC 2Q81A 4U07A 3ZYKA 3UKUG 5AQ7A 1D9SA 3MGBA 3I4RB 4DRXE 4GCOA 4WWNA 2BUGA 3LBZA 1N95A 3LXUX 2P9IG 2IY0C 2R59A 4F7AA 4AY5A 2KC7A 2AW6A 4XE0A 3ASOE 4YDWA 1HFAA 4G23A 1HZ4A 2B6CA 4OVVA 3FTYA 3RO2A 3ZPJA 4JXTA 3QJZA 2HR2A 3AJIA 3PDNA 3ZYMA 1D8DA 2IU1A 3PREA 3D9HA 5M72A 1OXJA 3DSXA 1ZB1A 2R02A 4Y6CA 1TJCA 4ABNA 3QKYA 4GTVA 4LG6A 3ABLE 4K5AB 4DI3A 2Q7FA 3TWVA 5FQ6A 3EHMA 4N3BA 1OWLA 5ENSD 3TWRA 1N54A 5A15A 4ILIA 2IF5A 2WXGA 5BXUA 3LY7A 3BEEA 3E4UA 3C5RA 4PS7A 1BU9A 4J0UA 5AYWD 3PZ4A 1A68A 4W9KB 2IOSA 4N3AA 3Q9UC 2YHCA 2A79B 2P1NA 5CHEE 3TGOA 3LJ3A 5AN8A 2I1KA 4G8KA 4WNDA 1EXBE 1Z5SC 3ZRCB 4JTDB 4GTOA 1NI1A 3M8VA 4BY6A 3FU0A 2JEKA 4L23A 4CXJA 3OTNA 2ZGGA 5CEAA 1NP7A 3FUDA 3FUJA 2DIWA 3AU4A 1EPUA 1U3CA 1QBQA 2OVQA 2R9RB 2VGEA 3ASFA 5ARFA 4J8SA 4ACKA 4E6HA 2KM4A 5DIZA 3IV0A 1IHGA 2IO3C 3SBSA 5G04J 3S7JA 2I9CA 4JHKA 2MOWA 3M5BA 4GAAA 3WXXA 3UM3A 3EHQA 4AVXA 2DYRE 3LPZA 5FINA 2P9KG 3UPVA 1E7VA 2XS8A 2YNQA 1Z3YA 3MV3B 1IKND 4JVSA 1OCZE 2GRMA 2CFUA 4JW1A 3SI5A 1E96B 2VSYA 2OVPA 4FU3A 1NA0A 2GRNB 1S64A 2DBAA 3G2SA 4GA1A 4LSZE 2XGOA 3FTZA 2XHEA 3Q5MA 4BKSB 3FUNA 3EU9A 4BX8A 3P1UA 1OCOE 3AS5A 4HFGA 2LUHA 4GTRA 2PNNA 5HZGC 3JXJA 4UWKA 3FH7A 4AEZC 1TNYA 2J8SD 3U3WA 2QYJA 2HO1A 4CGWA 3CVNA 4GZDA 1N4SA 4GTTA 3TG4A 3GZ1A 3HYMB 1EYHA 5T4YA 2V5FA 3RRNB 5KJKA 3ABKE 1FT1A 3ULQA 2HE0A 3Q73A 4APFA 2A4ZA 1ZU2A 5D2MC 1N4PA 3DEPA 4GTQA 4GYWA 3SO8A 1MJ0A 2P9SG 3E30A 3V2OA 4YVQC 1JCSA 3CVVA 3TWQA 3FFLA 3ZRHA 1RZ4A 4FLBA 5BW8C 2NYJA 1A17A 2WXPA 3L9TA 2XPYA 2ZU6B 3HVEB 3QB2A 4JZYA 4RQIA 3U9WA 3Q79A 4IYPA 2H6GA 3F6QA 3DBSA 3FUHA 3ONLA 2WMNA 3MX3A 3FP3A 2KZTA 2FEZA 3FEXA 3UM2A 2H6FA 2E31B 2Y1LE 1MHQA 5BPPA 3ZXPA 3HG0D 4BX9A 4W9GB 4W9LB 1XGWA 4WQOC 4ANVA 1U3DA 3CVYA 3V7DA 4LUNU 2VGXA 4O6FA 3M52A 1HE8A 3HXEA 3LY9A 3UT4A 3W9FA 2HYZA 2XENA 5B1BE 3P2BA
chains in the Genus database with same CATH topology
3NQPA 2CHXA 4A1GA 5T3RA 5G55A 2WXMA 3KEZA 3SF4A 2I1JA 4RG9A 4CEMA 4W9FB 5DAFA 1E8YA 2PM7A 3APCA 3D9IA 4XI0A 4HVBA 5BT1A 2WXIA 3OHUA 3JUIA 3ML9A 3QC1A 4FADA 3G2VA 4I6EA 3DRZA 4Q96A 5A7DB 3CKCA 4IN3B 3IHVA 1OWPA 3AU5A 3C6NA 4EZKA 4EPZA 2VTBB 4J8ZA 5C2YA 4F53A 5JJTA 2I6HA 3O4ZA 3UX4A 3B84A 2X38A 4UYIA 3PNLB 4I1MA 4F1SA 2HM8A 3RK6A 4A3TA 1EF1C 3CKBA 3UMVA 1QZ2A 4RVBA 5D0QD 1P22B 1DNPA 3LEWA 4LERA 4UWHA 3FHEA 1ZBPA 3MCXA 1QNFA 3ZYQA 5BV1A 1HXIA 4WUYA 5ENNA 3S2AA 4TUUA 4L1BA 2PZIA 4UQZA 4NACA 2PL2A 3RRMB 4G2VA 4N3CA 2XRZA 4EZLA 4W9JB 4XKCA 3IHYA 4QFVA 3TJPA 3HQIA 4KXKB 2AXZA 2WXJA 3G2UA 3FUIA 5FJYA 1N52A 3FTUA 4ANUA 3FU6A 3CK8A 2YHEA 2ASTA 2OOEA 4U04A 3FWVA 2FNJC 1XNFA 2IF4A 2R5SA 4J6IA 4FA6A 4U77A 5G2NA 4GZ3A 3CV0A 4I2ZA 3HTMA 4DPRA 3LCAA 3L2OA 1UW4B 1QDVA 3ESLA 1ELWA 3T5XA 3B7TA 4JEHA 3L16A 4YVOA 4RG6A 4CT4A 4JHRA 1KT1A 2XPIA 3NZUA 4EZJA 1HO8A 4G11A 3L54A 4AOFA 3ZHEA 4N2QA 2WXFA 4I17A 2XPZA 3N71A 3ZXSA 2BTDA 1SZAA 2ONDA 4LRZA 5EX0A 3D9KA 2E0IA 4G25A 3MKSA 2J9QA 3QDNA 4J8DA 5BNWA 2ILRA 4FHJA 2IQCA 5KJNA 1WM5A 4PDXA 3KD7A 4APOA 4IULA 4W9EB 5A6RA 3L6AA 4AIFA 1EOEA 2J49A 4JHJA 5JH5B 1FQVB 2BF0X 4WNEA 4CDRA 2QFCA 2Y4TA 4JTAB 3GA1A 3ZRFB 2KZTB 1FCHA 3R7RA 4FULA 3ZHEB 2XQ0A 4U8HA 1PY1A 5A23A 4GPKA 4B94A 5AENA 3ZGQA 3EJNA 4JEUA 2M63A 4BT9A 4W9DB 1NA3A 2Y3AA 3HDXA 3IKOB 2WXQA 5CCMA 2WQ7A 2X6KA 1LF8A 4GCNA 4XX5A 4I2WA 4U63A 2CFZA 2NSZA 2AWIA 1H2TC 5JJ6A 4HS2A 1LQBB 2I2RA 1HS6A 3LKUA 2MRIA 4FJZA 2C9WC 4U07A 3ZYKA 2Q81A 3FDHA 2GW1A 3I4RB 3MGBA 2JZ3C 2LAHA 3CGHA 2C2LA 3B7UX 4GCOA 4HXIA 4H7YA 2BUGA 4WWNA 5J08A 3LBZA 3LYAA 3C6OA 3LXUX 3NF1A 2X6HA 2KCVA 4ANWA 4OYSA 4PH4B 5AIJA 1KT0A 1ELRA 5A6CA 3M4TA 2R59A 1W3BA 4F7AA 2OVFA 4AY5A 5IBKA 3Q47B 3UQ3A 2KC7A 2AW6A 1WAO1 4ME2A 3TXNA 4NRHB 4CDMA 5BXHA 3CSFA 1QDWA 4XE0A 3SBTB 2PQRA 1KLXA 2LO6A 4I9EA 4XIFA 2VPKA 4I9CA 4L2LA 4UWGA 5BV0A 2IZVC 4JTCB 4P29A 2J4DA 2FULA 1UN8A 2UWJG 3QWVA 3CR3A 3QARA 5G05J 1HFAA 4L7TA 5LX8A 1E90A 1GW6A 1HZ4A 4G23A 4KVOA 5J90A 5FWQA 3MA5A 4PS3A 3RKVA 3ENEA 3KAEA 4OVVA 3FTYA 3T8MA 5ARGA 1VDYA 2L0IA 3RO2A 5FQ8A 3ZPJA 3CHOA 4JXTA 4EECA 3HIZA 2A5UA 3QJZA 1OWNA 2Y4UA 5FZSA 1R2BA 2HR2A 3Q4AB 2RD0A 3D9OA 4JC8A 3PDNA 1IQRA 3OAWA 3ASHA 4GZ5A 4CXTA 3ZYMA 2P1MA 4G24A 1HG5A 4I6GA 2VSNA 4G26A 3R7QA 4TV3A 3D9PA 3RU0A 3QK0A 1E8WA 4N9F5 5BXBA 2IU1A 3FTSA 3PREA 3SFZA 1E8XA 4I6JA 4W9RA 5M72A 3ASDA 2FBNA 4EQFA 4YY8A 5LCWC 1OUVA 3ZNGB 3UUXA 4BWRA 3CHQA 4FHKA 2L9BA 4J8FA 4Y6CA 4JL0A 4B8AA 3QWPA 1TJCA 3VLDA 4JGHC 3L13A 4ABNA 5FQ4A 3QKYA 4R7LA 1UG3A 2KCKA 3I4GA 3CK7A 1TEZA 3OGKA 4ILHB 4DI3A 2Q7FA 5FQ6A 3EHMA 4B95B 4Y6WA 3LNMB 2XGMA 4N3BA 2WXLA 1OWLA 4RSYA 4I1OB 4IRUA 4HOTA 5HYWB 3S7FA 2WVIA 2VGYA 3APFA 3D3MA 4I1AA 1N54A 5A15A 4ILIA 3JCKC 4TRQA 3D9LA 5CCLA 2IF5A 2WXGA 2V4LA 4HOQA 4AY6A 5H7GA 1SQMA 3JQ0A 5JHAA 3LY7A 3BEEA 3HVEA 4KBQA 4CRHA 3E4UA 2V8SE 1FS2B 4PS7A 2NN2A 4H7XA 2WM9A 4I6JC 3FUKA 4J0UA 4KZ0A 5AYWD 2YY9A 4LCTA 3PUJA 3APDA 4MS6A 4BSXA 4BFRA 5LLIB 4PUCA 1A68A 1P5QA 4K0RA 4XZ4A 4W9KB 2IOSA 4N3AA 4B9KB 2JLBA 1S0PA 2OVBA 2YHCA 2C0MA 3PH0C 4U0SA 1EOFA 1R29A 3OGLA 2A79B 5ANRA 5H7HA 1YA0A 2EQXA 4ACLA 3U64A 3CIAA 1B89A 2P1NA 3CEQA 5CHEE 3TGOA 3LJ3A 2P58C 2XEVA 2CHZA 2WB2A 2I1KA 2P1QA 4LEUA 5G05C 4WNDA 3ZRCB 1EXBE 5BXDA 1H6KA 4XKBA 5KJMA 3CVWA 1EDUA 2WPVA 3PE4A 4JTDB 3KS2A 5EX3A 3JYSA 4AM9A 3M8VA 4AXHA 3OXFA 1LDKD 4CRWA 4EBAA 1NN7A 4BY6A 3SD5A 3FU0A 2FO7A 4G1TA 2WQ6A 5HI7A 2JEKA 4L23A 3HU6A 3L08A 4CXJA 3GZSA 2L6JA 2GRLA 3OTNA 4DI4A 4A3VA 3PVLA 1NP7A 1QQEA 2WXHA 1IYGA 5KJLA 2NZ0B 3FUDA 3FUJA 4C9BB 4CDNA 4UIJA 4W9HB 4OVUA 4MRUA 5ANLA 1S1GA 4HORA 1H2UA 2I2OA 2DIWA 3AU4A 4U2NA 1EPUA 1U3CA 2XRYA 3SGHA 3URZA 4B89A 1MQSA 3PE3A 4JA9A 2OVQA 2R9RB 4UI9J 2J08A 3ASFA 3LVRE 4J8SA 5ARFA 2IONA 4ACKA 4HOUA 4E6HA 3WSOB 4BGCA 4BTBA 2KM4A 5DIZA 1R28A 3ZYLA 4HOSA 2WQHA 2IHCA 3IV0A 3S7BA 1IHGA 2E32B 4ZOUA 3FTXA 3S7JA 2AVPA 2I9CA 1IQUA 2WXOA 4JHKA 2RG8A 5G04J 3SBSA 3SZ7A 4CCAA 5C1DA 3UT8A 3OHVA 4B8CB 3CK9A 2MOWA 2VQ2A 3C6PA 2AXVA 3M5BA 5BO4C 3AS8A 3VLEA 4GAAA 2V0PA 3WXXA 1FVHA 4WNGA 3KVTA 4AVXA 3QWWA 4DK5A 3LPZA 3OXLA 1PAQA 3PS6A 5FZRA 3TL5A 3ASGA 5D0OD 4N39A 3IBEA 3UPVA 1E7VA 2FF4A 3T5VA 2YNQA 1CS3A 1Z3YA 3CHSA 3CHRA 3MV3B 1DSXA 4ZGCA 5E75A 4JVSA 4UQXA 1BPOA 3IEGA 4NQ0A 2XCCA 3VTYA 2GRMA 3EHNA 2LSUA 2CFUA 3R9AB 3ZFWA 3CVLA 4FP7A 4JW1A 2VYIA 3LY8A 3OXGA 3SI5A 1E96B 1T1DA 3CHMA 4JA7A 2VSYA 3FUEA 3RIBA 5FT9A 3VLFA 2P1OA 4YNDA 5CMWA 2OVPA 3FULA 4BTAA 4N5CA 4URKA 1Z6TA 2VSXE 4BT8A 3EIQC 3GYZA 4FU3A 5FQ7A 3ML8A 4C0MA 2VGXB 2NC9A 3D9MA 1NA0A 1NEXA 5G04C 4EBAG 2QY7A 3PZDA 2DBAA 2DCPA 3G2SA 3GW4A 4HLEA 4GA1A 4FLHA 2XGOA 2GGFA 3FTZA 2XHEA 4KMOA 4MLPA 3Q5MA 5BUZA 3MV2B 4UI9K 2CG3A 1UN9A 4D10C 3FUFA 2OVRA 3EIJA 4K03A 3FUNA 4W9IB 4BKSB 4M3OA 3I3NA 3MYVA 4GZCA 4GYYA 4BX8A 3P1UA 2VJ8A 5LOZA 4KZCA 1HU3A 3C98A 3AS5A 4GU5A 2VKPA 4HFGA 1ELKA 2IJGX 2CG2A 5T8IA 3ZW3A 3FTWA 4A1SA 5HZGC 2J09A 3ZEFA 3CQCB 3FEYA 1HG2A 1JWGA 4J8EA 4UWKA 1H0AA 1SZ9A 1E8ZA 2OV8A 1JPLA 3B7SA 3FH7A 3FY4A 3PNTB 4I43A 3ESKA 3CLJA 3ZN3A 1Y6IA 2IFUA 4Q94A 4AEZC 4ATGA 3U3WA 2HO1A 5JJ7A 3MJWA 4W9CB 4BKTB 4DLOA 5FTAA 3G2TA 2VTBA 4CGWA 4EOZA 3CVNA 4GZDA 1VCBB 3TG4A 1FS1B 2WXRA 3GZ1A 3LVQE 3Q49B 5E76A 3RO3A 4C0EA 4F3VA 5EUPA 3HYMB 3QOUA 2MHKA 4B0ZA 3LDZA 1EYHA 5T4YA 5DADA 4CP3A 1Z3XA 2V5FA 2PM6A 5EDSA 1UJJA 4CXIA 1HF8A 3RRNB 5KJKA 4FJYA 5LCWJ 1NZNA 4GZ6A 3BG0B 3CSTA 2X3MA 3ULQA 3FH5A 1BUOA 1OWMA 2VSOE 3QAQA 4APFA 2A4ZA 1H2VC 4W9HH 5LFAA 1ZU2A 3LUTB 4GB9A 3ZVVA 3O48A 4ILGA 3FU5A 1H19A 4NURA 2L0TB 1WY6A 4N2SA 2UY1A 3HHMA 5CMYA 1OWOA 4GYWA 4WAFA 3ZIMA 3CQGB 3FTVA 2J4BA 2AXUA 4B9KE 1DVPA 3TG5A 5AJLA 2PPIA 4WWPA 3ONKA 4YVQC 3CHPA 4DJAA 3CVVA 3RJVA 4AWJB 3TAXA 3S7DA 3FFLA 3CVPA 3ZRHA 5LP0A 4KT6B 3I5PA 3PUKA 1HH8A 2KATA 3D9NA 4FLBA 3VTXA 5BW8C 3FUMA 3PEVB 3DRYA 1A17A 4JPSA 1EODA 2FI7A 4FC8A 2UY1B 3TXMA 4UI9C 3LS8A 4UWFA 4KVMA 2WXPA 4GMJA 2IOLA 3SNXA 1TJFA 3UT7A 3D9JA 1HX8A 4Q69A 2XPYA 4E85A 2ZU6B 2PQNA 3HVEB 5AJDA 4CT0A 4PS8A 3QB2A 4CGVA 3NZSA 2Z8HA 2LAIA 4JZYA 3DRXA 5EKQD 2CHWA 3U9WA 2XGSA 3SHFA 3U66A 2WMOA 1JUQA 4IYPA 3K9IA 4L2YA 2ASSA 2P1PA 3BIMA 3ZTDB 4U2MA 3QNKA 4GA2A 3B7RL 3DBSA 3FUHA 3DPDA 3ONLA 2WMNA 4XI9A 2YINA 4GYOA 3MX3A 3FP3A 1E7UA 1PC2A 2FEZA 2KZTA 2KCLA 1UJKA 3EDTB 3FEXA 3G2WA 4U0UA 5FZQA 4AJWA 3E4BA 4V3IA 4AJYC 3GZ2A 3CVQA 3MKQB 4UWLA 1Y8MA 3U4TA 3FH8A 3CVUA 2E31B 5DBKA 1MHQA 2E2EA 4U0ZA 3ZTCB 2X6IA 2NXPA 5FTPA 5BPPA 4BX9A 3FKCA 3ZUNB 2LSVA 4W9GB 4W9LB 4WNFA 1XGWA 3RRUA 3CVXA 4WQOC 4ANVA 3OGMA 3JQ1A 1U3DA 3CVYA 3V7DA 3MKRA 4LUNU 4AV7A 4DLQA 4AP2A 3BG1B 2VGXA 2WXNA 2YQ8A 2X6FA 4O6FA 4GMLA 5JHBA 3M52A 1HE8A 1HV2A 3LY9A 3B13A 2LNIA 2R17C 5HQ8A 2WXKA 3MEKA 3UT4A 4KYOB 2MA9C 2HYZA 3PEUB 5KCMA 1INZA 3FU3A 3Q15A 3ZKJB 4A55A 3DCGB 3PRZA 3AS4A 2C0LA 3MKQA 3MZLB 2J07A 1X5BA 3L17A 2X6JA 4UQYA 2XCBA 4GA0A 4MKTA 4WWOA 1LM8C 1FVFA 3L22A 1L5JA 3P2BA 4ANXA 1JWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CP3 A;  4CXI A;  4AJY C;  4W9F B;  5DAF A;  5BXH A;  3M4T A;  3HU6 A;  4CXJ A;  5IBK A;  2NZ0 B;  3OHU A;  1BUO A;  1QDW A;  4UIJ A;  5H7H A;  1S1G A;  4APF A;  4U2N A;  3DRZ A;  4W9H H;  3LUT B;  2VPK A;  2IZV C;  4JTC B;  2OVQ A;  2R9R B;  3C6N A;  4J8Z A;  3WSO B;  3B84 A;  4UYI A;  4BGC A;  1R28 A;  2IHC A;  4ZOU A;  2E32 B;  4B9K E;  1P22 B;  3OHV A;  3C6P A;  3M5B A;  1R2B A;  5BO4 C;  4AWJ B;  3KVT A;  4CXT A;  4W9J B;  2P1M A;  3HQI A;  4N9F 5;  5BXB A;  1EOD A;  1DSX A;  2FNJ C;  3ZNG B;  4U77 A;  3HTM A;  1QDV A;  4JGH C;  1T1D A;  3HVE B;  3OGK A;  2P1O A;  2OVP A;  2Z8H A;  4B95 B;  3LNM B;  5HYW B;  2ASS A;  3BIM A;  2P1P A;  3ZTD B;  1NEX A;  4U2M A;  5A15 A;  1CS3 A;  2AST A;  2PPI A;  2IF5 A;  5H7G A;  3L2O A;  4W9H B;  3HVE A;  4CRH A;  3E4U A;  3MKS A;  2OVR A;  1FS2 B;  4W9I B;  2NN2 A;  4BKS B;  3I3N A;  2E31 B;  4I6J C;  5A6R A;  4W9E B;  2YY9 A;  1EOE A;  3ZTC B;  5LLI B;  5JH5 B;  2VKP A;  3FKC A;  1A68 A;  1FQV B;  4W9K B;  3ZUN B;  4W9G B;  4W9L B;  4JTA B;  3GA1 A;  4WQO C;  3ZRF B;  4B9K B;  3OGM A;  1EOF A;  1R29 A;  3OGL A;  3V7D A;  5HZG C;  2A79 B;  4AP2 A;  2EQX A;  3M52 A;  4W9D B;  1HV2 A;  2P1N A;  2MA9 C;  2P1Q A;  4W9C B;  4BKT B;  2I2R A;  4HS2 A;  1LQB B;  3ZKJ B;  1EXB E;  3DCG B;  3ZRC B;  5BXD A;  2C9W C;  5FTA A;  2Q81 A;  4EOZ A;  1VCB B;  1FS1 B;  2JZ3 C;  4JTD B;  4HXI A;  1LM8 C;  3M8V A;  3LBZ A;  5EUP A;  1LDK D;  3C6O A;  5DAD A;  1NN7 A; 
#chains in the Genus database with same CATH topology
 3NQP A;  5G55 A;  4CEM A;  5BXH A;  4XI0 A;  4TXQ A;  3WG7 E;  3E34 A;  4FAD A;  3G2V A;  3DRZ A;  4Q96 A;  5CBO A;  3CKC A;  4IN3 B;  4DX2 A;  3Q78 A;  2X38 A;  3PZ2 A;  4RVB A;  4UWH A;  3MCX A;  4MBG A;  3ZYQ A;  4L1B A;  4NAC A;  2XRZ A;  3HQI A;  4KXK B;  3FTU A;  4ANU A;  3FU6 A;  2YHE A;  1XNF A;  3NOC D;  4HB5 A;  5G2N A;  4GZ3 A;  3X2Q E;  3HTM A;  1QDV A;  4YVO A;  4RG6 A;  4JHR A;  1KT1 A;  3NZU A;  2RFA A;  3L54 A;  3ZHE A;  4LNU D;  5AQA A;  1JCR A;  4GMR A;  3E32 A;  4FHJ A;  4APO A;  4W9E B;  3HRA A;  3SFX A;  4WNE A;  2QFC A;  4JTA B;  1FCH A;  3R7R A;  3ZGQ A;  3EJN A;  5EIL A;  4BT9 A;  3IKO B;  1N0R A;  2WQ7 A;  2KXP C;  4A63 B;  2F8X K;  1MX6 A;  3ASN E;  2JZ3 C;  1TNO A;  1MYO A;  3M4T A;  1DC2 A;  5EID A;  2OVF A;  2ETA A;  5IBK A;  3ZU7 B;  3IXE A;  4CDM A;  5KBA A;  2PQR A;  1KLX A;  1YYH A;  4XIF A;  4YDO A;  5BV0 A;  4L2L A;  4UWG A;  4JTC B;  3KSQ A;  2ZIR A;  5CRV A;  4L7T A;  3TWU A;  5FWQ A;  3KAE A;  1VDY A;  5FQ8 A;  3HIZ A;  4BES A;  3Q4A B;  4JC8 A;  3PZ3 A;  4CXT A;  4G24 A;  1HG5 A;  1O1S A;  4TV3 A;  3RU0 A;  3QK0 A;  5BXB A;  1E8X A;  4I6J A;  4W9R A;  1O1T A;  4YY8 A;  3UUX A;  4BWR A;  3CHQ A;  4FHK A;  4JL0 A;  3VLD A;  4JGH C;  4R7L A;  2KCK A;  3I4G A;  3CK7 A;  2XGM A;  3S7F A;  2VGY A;  3JCK C;  2XZD G;  5CCL A;  2V4L A;  4HOQ A;  1SQM A;  2H6H A;  5JHA A;  3HVE A;  4CRH A;  5ENQ D;  4KZ0 A;  4LCT A;  5CER B;  3PUJ A;  3APD A;  4MS6 A;  4BSX A;  4BSZ B;  4XZ4 A;  4B9K B;  4O1O A;  4U0S A;  2EIK E;  3BUA A;  5EN5 D;  4YDY A;  3CIA A;  3CEQ A;  4HLL A;  2P58 C;  2CHZ A;  1H6K A;  3CVW A;  1EDU A;  3KS2 A;  4AM9 A;  2FO1 E;  1FT2 A;  3NAW A;  3SD5 A;  3L08 A;  2L6J A;  1NL4 A;  3PVL A;  3DXK G;  2NZ0 B;  4UIJ A;  4C9B B;  4CDN A;  5ANL A;  4B89 A;  2ZXW E;  3PE3 A;  4JA9 A;  4UI9 J;  2XZT G;  2J08 A;  3LVR E;  4HOU A;  4BGC A;  3KSL A;  1R28 A;  3S7B A;  2AVP A;  2EIN E;  1IQU A;  2F8Y A;  3UT8 A;  3CK9 A;  2VQ2 A;  1S63 A;  3AS8 A;  3ABM E;  2Y0B G;  4DK5 A;  3TL5 A;  3ASG A;  5D0O D;  3IBE A;  1V54 E;  1G3N B;  3CHR A;  2KBX A;  1DSX A;  4UQX A;  1BPO A;  3IEG A;  4NQ0 A;  3EHN A;  5D66 A;  3UIN C;  3CVL A;  4FP7 A;  3LY8 A;  4JA7 A;  3RIB A;  2P1O A;  3FUL A;  5EYP F;  2JAB A;  4N5C A;  1UOH A;  3ML8 A;  3T8K A;  4C0M A;  2NC9 A;  3D9M A;  5G04 C;  4EBA G;  2QY7 A;  2DCP A;  4KMO A;  4D10 C;  3FUF A;  3EIJ A;  1WG0 A;  5LOZ A;  4KZC A;  3HXC A;  3DST A;  3CQC B;  1LD8 A;  5KNH D;  1JWG A;  2OV8 A;  3FY4 A;  4HRN A;  1E8Z A;  3B7S A;  1AP7 A;  4JD2 G;  3ZN3 A;  2IFU A;  3MJW A;  4BKT B;  2VTB A;  3E33 A;  1H6P A;  2XEH A;  3LVQ E;  4U8V D;  2PM6 A;  5EDS A;  3PZ1 A;  2AJA A;  4FJY A;  1NZN A;  3BG0 B;  3TWS A;  4GPM A;  4GTM A;  3FH5 A;  1OWM A;  3JUE A;  4TXR A;  1O5M A;  3LUT B;  3O48 A;  4TXP A;  3ZKJ A;  2L0T B;  1WY6 A;  4WAF A;  1Q2Z A;  3FTV A;  1OCR E;  4B9K E;  3TG5 A;  2GRO B;  4EHM A;  3S7D A;  1K1A A;  4KT6 B;  3VTX A;  3DRY A;  1EOD A;  5HRY A;  2XS1 A;  3TXM A;  3LS8 A;  4UWF A;  4KVM A;  3DSV A;  1HX8 A;  4Q69 A;  4E85 A;  3DRX A;  5HKP A;  4CZ2 D;  3U66 A;  2XEE A;  2XGS A;  2ZIS A;  2WMO A;  3SHF A;  5JA4 D;  2ASS A;  2P1P A;  3ZTD B;  4U2M A;  2YIN A;  4DX6 D;  4U0U A;  5FZQ A;  4V3I A;  4UWL A;  1Y8M A;  3E37 A;  5DBK A;  4U0Z A;  5HS0 A;  1AWC B;  3FKC A;  4WNF A;  3CVX A;  3JQ1 A;  1K8K G;  2X6F A;  2LXM A;  5JHB A;  1HV2 A;  2LNI A;  5HQ8 A;  4KYO B;  2MA9 C;  3BQO A;  5KCM A;  3FU3 A;  4UQY A;  4GA0 A;  1L5J A;  4ANX A;  3ZXS A;  1JWF A;  4U96 D;  4A1G A;  2EIL E;  4AJY C;  5DAF A;  2I1J A;  3AG4 E;  3APC A;  3L82 A;  1TN7 A;  2WXI A;  3AG1 E;  3OHU A;  3ML9 A;  3AU5 A;  1TYQ G;  5FIO A;  2I6H A;  3UX4 A;  4UYI A;  4I1M A;  3UXG A;  3RK6 A;  4A3T A;  1EF1 C;  1P22 B;  1DNP A;  4LER A;  1ZBP A;  1QNF A;  1HXI A;  4WUY A;  5ENN A;  4UQZ A;  3RRM B;  3TJP A;  4QFV A;  2AXZ A;  2GRQ B;  2WXJ A;  3FUI A;  1N52 A;  3SFY A;  2IF4 A;  4J6I A;  4FA6 A;  4U77 A;  5H7P A;  3LCA A;  1ELW A;  3B7T A;  3Q75 A;  3HXB A;  4AOF A;  2WXF A;  3N71 A;  2BTD A;  4LRZ A;  2DZO A;  1DCQ A;  2E0I A;  2J9Q A;  4J8D A;  2IQC A;  1WM5 A;  4PDX A;  4IUL A;  3HXF A;  1EOE A;  2J49 A;  5JH5 B;  1FQV B;  1SA4 A;  4CDR A;  3ZRF B;  3ZUV B;  1PY1 A;  4B94 A;  4JEU A;  2Y3A A;  3HDX A;  4I2W A;  4U63 A;  2AWI A;  1H2T C;  5JJ6 A;  1N4R A;  2I2R A;  4HI8 A;  4FJZ A;  3FDH A;  1BLX B;  2GW1 A;  2LAH A;  1N94 A;  3B7U X;  5J08 A;  4H7Y A;  4ZHB A;  1U2V G;  3EHR A;  3LYA A;  2X6H A;  5A6C A;  1KT0 A;  1ELR A;  4JB8 P;  2DYS E;  3Q47 B;  1WAO 1;  3CSF A;  1QDW A;  3SBT B;  3TWX A;  2P9U G;  1TN6 A;  2B0O E;  4O1P A;  2VPK A;  4I9C A;  4P29 A;  2F37 A;  3QAR A;  5LX8 A;  1GW6 A;  4KVO A;  5J90 A;  3RKV A;  3ENE A;  5ARG A;  3C3R A;  2Y4U A;  5FZS A;  3V30 A;  5B3S E;  1R2B A;  2QYU A;  3OAW A;  2VSN A;  4G26 A;  4N9F 5;  3FTS A;  3SFZ A;  2FBN A;  4DX7 D;  4EQF A;  5LCW C;  1MZC A;  1A5E A;  2L9B A;  4HRL A;  4B8A A;  2MYO A;  3V31 A;  4Y6W A;  2WXL A;  4I1O B;  4IRU A;  4HOT A;  2WVI A;  4TRQ A;  1K3Z D;  2ETC A;  4AY6 A;  4U8Y D;  5H7G A;  4KBQ A;  3UM0 A;  2WM9 A;  4I6J C;  4GTP A;  4G8L A;  5LLI B;  4PUC A;  1DCE A;  4K0R A;  2JLB A;  2C0M A;  1R29 A;  3NB2 A;  4HI9 A;  5ANR A;  1YA0 A;  2EQX A;  4ACL A;  4XEI G;  5BXD A;  4XKB A;  5EX3 A;  4AXH A;  1LDK D;  3C72 A;  4EBA A;  1K1B A;  4G1T A;  2WQ6 A;  4LNG A;  5HI7 A;  2GRL A;  4A3V A;  1SA5 A;  1IYG A;  4OVU A;  4MRU A;  1S1G A;  4HOR A;  2XRY A;  2F0Y A;  4BTB A;  1N9A A;  3ZYL A;  2IHC A;  4ZOU A;  1YCS B;  2E32 B;  2WXO A;  5C1D A;  1LTX A;  2RG8 A;  3SZ7 A;  4B8C B;  3C6P A;  2AXV A;  3VLE A;  4WNG A;  3UKR G;  1MX4 A;  3OXL A;  5AQB A;  3DXM G;  3NBN B;  4N39 A;  4O60 A;  2FF4 A;  1N4Q A;  3CHS A;  5E75 A;  3VTY A;  2LSU A;  2R05 A;  2VYI A;  3B95 A;  1T1D A;  2GRR B;  3CHM A;  5ENO D;  5AAR A;  3FUE A;  3DRA A;  4YND A;  4URK A;  2VSX E;  3EIQ C;  5FQ7 A;  3AG3 E;  4J8Y A;  2PPI A;  4HLE A;  2EIM E;  2GGF A;  3MV2 B;  1UN9 A;  4CYM D;  4GZC A;  4LNB A;  4GU5 A;  5B1A E;  1ELK A;  2OEW A;  3C3O A;  2IJG X;  2CG2 A;  5T8I A;  3ZW3 A;  3FTW A;  2J09 A;  2RFM A;  1HG2 A;  1SZ9 A;  5KJM A;  3ESK A;  3CLJ A;  4Q94 A;  5JJ7 A;  4W9C B;  4DLO A;  2A5E A;  2LXL A;  3G2T A;  1VCB B;  1FS1 B;  3DEO A;  2WXR A;  3ISM C;  5EUP A;  2MHK A;  4B0Z A;  5DAD A;  4NIK A;  1UJJ A;  1HF8 A;  4ATZ D;  3DSU A;  3RSE G;  2VSO E;  3QAQ A;  4U95 D;  5LFA A;  4F1P A;  3RAU A;  3ZVV A;  1H19 A;  4NUR A;  4N2S A;  2UY1 A;  5CMY A;  3ZIM A;  3CQG B;  4K5C A;  2J4B A;  1DVP A;  2IEJ A;  3CHP A;  4DJA A;  3RJV A;  4BER A;  3TAX A;  1KZO A;  3CVP A;  3I5P A;  3PUK A;  3D9N A;  3FUM A;  3TWT A;  2FI7 A;  4FC8 A;  3SQV A;  2UY1 B;  4UI9 C;  4GMJ A;  1TJF A;  3D9J A;  3NZS A;  2Z8H A;  5EKQ D;  2CHW A;  1H6O A;  1JUQ A;  3BIM A;  1X81 A;  3QNK A;  3B7R L;  3NOG D;  4XI9 A;  1TR4 A;  3L2O A;  2KCL A;  1UJK A;  3EDT B;  4AJW A;  3G2W A;  3E4B A;  3GZ2 A;  3CVQ A;  3MKQ B;  4RLY A;  3CVU A;  3FH8 A;  5CEC B;  2E2E A;  5ITZ F;  3ZTC B;  2NXP A;  5FTP A;  1TN8 A;  3ZUN B;  2LSV A;  3RRU A;  3OGM A;  4AV7 A;  3BG1 B;  1OT8 A;  2WXN A;  2YQ8 A;  3J5Q B;  1NFI E;  3B13 A;  2R17 C;  2WXK A;  1INZ A;  3Q15 A;  3ZKJ B;  4A55 A;  3DCG B;  3AS4 A;  1X5B A;  3L17 A;  2XCB A;  4MKT A;  4GTS A;  1FVF A;  3QWV A;  4ZFH A;  2CHX A;  4BEP A;  2WXM A;  1RW2 A;  3KEZ A;  5EYL A;  4RG9 A;  4F6R D;  4W9F B;  1E8Y A;  2PM7 A;  3V2X A;  3D9I A;  2BED A;  5BT1 A;  4Z68 A;  4I6E A;  5A7D B;  4OAU C;  3IHV A;  1OWP A;  3C6N A;  4EPZ A;  5JJT A;  4UUC A;  3PNL B;  4C48 B;  1N11 A;  2HM8 A;  3CKB A;  1QZ2 A;  5BV1 A;  3S2A A;  2PZI A;  5ENP D;  4N3C A;  3G2U A;  5FJY A;  4J7W A;  3CK8 A;  4U04 A;  3FWV A;  2FNJ C;  4QQI A;  4DPR A;  1UW4 B;  3ESL A;  4CT4 A;  2XPI A;  4EZJ A;  5CRU A;  1HO8 A;  1BI7 B;  3Q9N C;  3DSS A;  5EX0 A;  1OY3 D;  5ENR D;  2ILR A;  5KJN A;  5A6R A;  3KD7 A;  1MX2 A;  3BU8 A;  3GA1 A;  2KZT B;  5EIB E;  4FUL A;  3ZHE B;  4U8H A;  5KNG A;  5A23 A;  5CED B;  4W9D B;  1NA3 A;  2WXQ A;  2X6K A;  4XX5 A;  1QYM A;  2CFZ A;  1LQB B;  2ZGD A;  1HS6 A;  2R2L A;  3UIO C;  3CGH A;  2C2L A;  4HXI A;  1BI8 B;  3C6O A;  2BKG A;  3NF1 A;  2KCV A;  4ANW A;  4OYS A;  4PH4 B;  5AIJ A;  1W3B A;  4U7E B;  3UQ3 A;  4ME2 A;  3TXN A;  4NRH B;  2QZA A;  2GRP B;  3Q7A A;  1D8E A;  2LO6 A;  4I9E A;  3ULY A;  2IZV C;  2J4D A;  2FUL A;  1UN8 A;  2UWJ G;  5AAO A;  3CR3 A;  5G05 J;  2DWZ A;  1E90 A;  4M7C A;  3MA5 A;  4PS3 A;  3T8M A;  2L0I A;  4K5B A;  3CHO A;  4EEC A;  2A5U A;  1OWN A;  3UTM A;  2RD0 A;  3D9O A;  1IQR A;  4GZ5 A;  3ASH A;  2P1M A;  4I6G A;  3R7Q A;  2DZN A;  3D9P A;  1E8W A;  3UM1 A;  1LD7 A;  3ASD A;  3UI2 A;  1OUV A;  3ZNG B;  2OEV A;  4J8F A;  3QWP A;  3L13 A;  5FQ4 A;  1UG3 A;  2IO2 C;  1TEZ A;  3OGK A;  4ILH B;  4B95 B;  3LNM B;  2Y69 E;  4RSY A;  5HYW B;  3APF A;  3D3M A;  4I1A A;  3D9L A;  1FPP A;  3JQ0 A;  2EIJ E;  2H6I A;  2V8S E;  1FS2 B;  2NN2 A;  4H7X A;  3FUK A;  2YY9 A;  4B93 B;  4BFR A;  1P5Q A;  5CBN A;  1S0P A;  2OVB A;  3B7B A;  3PH0 C;  1EOF A;  3OGL A;  2R03 A;  3U64 A;  1B89 A;  2XEV A;  2WB2 A;  2P1Q A;  4LEU A;  2ETB A;  3LJN A;  5G05 C;  1TNZ A;  2WPV A;  3PE4 A;  3W9G A;  3JYS A;  3OXF A;  4CRW A;  1NN7 A;  2FO7 A;  3HU6 A;  3GZS A;  4DI4 A;  1QQE A;  2WXH A;  5KJL A;  5H7H A;  4U2N A;  1H2U A;  2I2O A;  3SGH A;  3URZ A;  1MQS A;  3HXD A;  2ION A;  3WSO B;  1WDY A;  4HOS A;  2WQH A;  3FTX A;  4N5Q A;  4CCA A;  2P9N G;  3OHV A;  5BO4 C;  2V0P A;  1FVH A;  3KVT A;  3QWW A;  3PS6 A;  1PAQ A;  3J5P A;  5FZR A;  4ZGC A;  4TUM A;  2XCC A;  3ZFW A;  3R9A B;  3OXG A;  4HBD A;  1N0Q A;  3V79 K;  5FT9 A;  3VLF A;  1KZP A;  5CMW A;  4BTA A;  1Z6T A;  5KWD A;  4BT8 A;  3GYZ A;  2VGX B;  1NEX A;  4DX5 D;  3T5V A;  3PZD A;  1CS3 A;  2AST A;  3GW4 A;  4MLP A;  5BUZ A;  4FLH A;  5AQ9 A;  4UI9 K;  2CG3 A;  3ZNG A;  2OVR A;  4K03 A;  4W9I B;  4M3O A;  3I3N A;  3C3Q A;  3MYV A;  4GYY A;  1SVX A;  2VJ8 A;  1HU3 A;  3C98 A;  2VKP A;  3UIP C;  4DX1 A;  4A1S A;  3ZEF A;  3FEY A;  4J8E A;  1H0A A;  3PNT B;  1JPL A;  3JXI A;  1TNU A;  4I43 A;  1Y6I A;  4ATG A;  1IXV A;  1IHB A;  5FTA A;  4EOZ A;  5E76 A;  3RO3 A;  4C0E A;  3Q49 B;  4F3V A;  3QOU A;  4OAV B;  3LDZ A;  4CP3 A;  1Z3X A;  4CXI A;  5LCW J;  4GZ6 A;  3CST A;  2X3M A;  4BET A;  1BUO A;  1H2V C;  4W9H H;  4X8Q A;  5BXO A;  4GB9 A;  4ILG A;  4DUI A;  3FU5 A;  3KEA A;  3ULE G;  3HHM A;  3AG2 E;  1OWO A;  2AXU A;  5AJL A;  4WWP A;  3ONK A;  4AWJ B;  5LP0 A;  4HQD A;  1HH8 A;  1SW6 A;  2KAT A;  3PEV B;  4JPS A;  2IOL A;  3SNX A;  3UT7 A;  2V5Q C;  2PQN A;  5AJD A;  4CT0 A;  4PS8 A;  4CGV A;  2LAI A;  4L2Y A;  3K9I A;  4GA2 A;  3DPD A;  4GYO A;  1E7U A;  1PC2 A;  4W9H B;  5ENT D;  3TWW A;  5IY5 E;  3EUV A;  3U4T A;  2RKK A;  2X6I A;  1TNB A;  3EU5 A;  3MKR A;  4DLQ A;  4AP2 A;  4GML A;  3MEK A;  3PEU B;  3PRZ A;  2C0L A;  3MKQ A;  3MZL B;  2J07 A;  2X6J A;  4WWO A;  1LM8 C;  1OCC E;  3L22 A;  1YMP A;  5JMN D;  5T3R A;  3SF4 A;  4HVB A;  1JCQ A;  3JUI A;  3QC1 A;  2V4H C;  4EZK A;  2VTB B;  4J8Z A;  2QC9 A;  5C2Y A;  4F53 A;  3O4Z A;  3B84 A;  1KPS B;  4F1S A;  3UMV A;  5D0Q D;  3LEW A;  3FHE A;  4TUU A;  2PL2 A;  3SY2 A;  4G2V A;  4W9J B;  4EZL A;  4XKC A;  3IHY A;  4HNA D;  2OCC E;  2L6B A;  3R9M A;  2OOE A;  2P9L G;  3DPY A;  2R5S A;  1BD8 A;  3CV0 A;  4I2Z A;  3DWL G;  3T5X A;  4JEH A;  3L16 A;  3Q7F A;  2DVW A;  4G11 A;  4YDE A;  4N2Q A;  4I17 A;  2P9P G;  2XPZ A;  1SZA A;  2OND A;  3T9K A;  3AAA C;  3D9K A;  2BKK B;  3MKS A;  4G25 A;  3QDN A;  4HRM B;  3DSW A;  5BNW A;  1V55 E;  3L6A A;  1S70 B;  4AIF A;  4JHJ A;  2BF0 X;  4L9P A;  2Y4T A;  2P2C P;  2XQ0 A;  4GPK A;  5AEN A;  2M63 A;  5CCM A;  1LF8 A;  4GCN A;  1O1R A;  2NSZ A;  4HS2 A;  3LKU A;  2MRI A;  2C9W C;  2Q81 A;  4U07 A;  3ZYK A;  3UKU G;  5AQ7 A;  1D9S A;  3MGB A;  3I4R B;  4DRX E;  4GCO A;  4WWN A;  2BUG A;  3LBZ A;  1N95 A;  3LXU X;  2P9I G;  2IY0 C;  2R59 A;  4F7A A;  4AY5 A;  2KC7 A;  2AW6 A;  4XE0 A;  3ASO E;  4YDW A;  1HFA A;  4G23 A;  1HZ4 A;  2B6C A;  4OVV A;  3FTY A;  3RO2 A;  3ZPJ A;  4JXT A;  3QJZ A;  2HR2 A;  3AJI A;  3PDN A;  3ZYM A;  1D8D A;  2IU1 A;  3PRE A;  3D9H A;  5M72 A;  1OXJ A;  3DSX A;  1ZB1 A;  2R02 A;  4Y6C A;  1TJC A;  4ABN A;  3QKY A;  4GTV A;  4LG6 A;  3ABL E;  4K5A B;  4DI3 A;  2Q7F A;  3TWV A;  5FQ6 A;  3EHM A;  4N3B A;  1OWL A;  5ENS D;  3TWR A;  1N54 A;  5A15 A;  4ILI A;  2IF5 A;  2WXG A;  5BXU A;  3LY7 A;  3BEE A;  3E4U A;  3C5R A;  4PS7 A;  1BU9 A;  4J0U A;  5AYW D;  3PZ4 A;  1A68 A;  4W9K B;  2IOS A;  4N3A A;  3Q9U C;  2YHC A;  2A79 B;  2P1N A;  5CHE E;  3TGO A;  3LJ3 A;  5AN8 A;  2I1K A;  4G8K A;  4WND A;  1EXB E;  1Z5S C;  3ZRC B;  4JTD B;  4GTO A;  1NI1 A;  3M8V A;  4BY6 A;  3FU0 A;  2JEK A;  4L23 A;  4CXJ A;  3OTN A;  2ZGG A;  5CEA A;  1NP7 A;  3FUD A;  3FUJ A;  2DIW A;  3AU4 A;  1EPU A;  1U3C A;  1QBQ A;  2OVQ A;  2R9R B;  2VGE A;  3ASF A;  5ARF A;  4J8S A;  4ACK A;  4E6H A;  2KM4 A;  5DIZ A;  3IV0 A;  1IHG A;  2IO3 C;  3SBS A;  5G04 J;  3S7J A;  2I9C A;  4JHK A;  2MOW A;  3M5B A;  4GAA A;  3WXX A;  3UM3 A;  3EHQ A;  4AVX A;  2DYR E;  3LPZ A;  5FIN A;  2P9K G;  3UPV A;  1E7V A;  2XS8 A;  2YNQ A;  1Z3Y A;  3MV3 B;  1IKN D;  4JVS A;  1OCZ E;  2GRM A;  2CFU A;  4JW1 A;  3SI5 A;  1E96 B;  2VSY A;  2OVP A;  4FU3 A;  1NA0 A;  2GRN B;  1S64 A;  2DBA A;  3G2S A;  4GA1 A;  4LSZ E;  2XGO A;  3FTZ A;  2XHE A;  3Q5M A;  4BKS B;  3FUN A;  3EU9 A;  4BX8 A;  3P1U A;  1OCO E;  3AS5 A;  4HFG A;  2LUH A;  4GTR A;  2PNN A;  5HZG C;  3JXJ A;  4UWK A;  3FH7 A;  4AEZ C;  1TNY A;  2J8S D;  3U3W A;  2QYJ A;  2HO1 A;  4CGW A;  3CVN A;  4GZD A;  1N4S A;  4GTT A;  3TG4 A;  3GZ1 A;  3HYM B;  1EYH A;  5T4Y A;  2V5F A;  3RRN B;  5KJK A;  3ABK E;  1FT1 A;  3ULQ A;  2HE0 A;  3Q73 A;  4APF A;  2A4Z A;  1ZU2 A;  5D2M C;  1N4P A;  3DEP A;  4GTQ A;  4GYW A;  3SO8 A;  1MJ0 A;  2P9S G;  3E30 A;  3V2O A;  4YVQ C;  1JCS A;  3CVV A;  3TWQ A;  3FFL A;  3ZRH A;  1RZ4 A;  4FLB A;  5BW8 C;  2NYJ A;  1A17 A;  2WXP A;  3L9T A;  2XPY A;  2ZU6 B;  3HVE B;  3QB2 A;  4JZY A;  4RQI A;  3U9W A;  3Q79 A;  4IYP A;  2H6G A;  3F6Q A;  3DBS A;  3FUH A;  3ONL A;  2WMN A;  3MX3 A;  3FP3 A;  2KZT A;  2FEZ A;  3FEX A;  3UM2 A;  2H6F A;  2E31 B;  2Y1L E;  1MHQ A;  5BPP A;  3ZXP A;  3HG0 D;  4BX9 A;  4W9G B;  4W9L B;  1XGW A;  4WQO C;  4ANV A;  1U3D A;  3CVY A;  3V7D A;  4LUN U;  2VGX A;  4O6F A;  3M52 A;  1HE8 A;  3HXE A;  3LY9 A;  3UT4 A;  3W9F A;  2HYZ A;  2XEN A;  5B1B E;  3P2B A; 
#chains in the Genus database with same CATH homology
 3NQP A;  2CHX A;  4A1G A;  5T3R A;  5G55 A;  2WXM A;  3KEZ A;  3SF4 A;  2I1J A;  4RG9 A;  4CEM A;  4W9F B;  5DAF A;  1E8Y A;  2PM7 A;  3APC A;  3D9I A;  4XI0 A;  4HVB A;  5BT1 A;  2WXI A;  3OHU A;  3JUI A;  3ML9 A;  3QC1 A;  4FAD A;  3G2V A;  4I6E A;  3DRZ A;  4Q96 A;  5A7D B;  3CKC A;  4IN3 B;  3IHV A;  1OWP A;  3AU5 A;  3C6N A;  4EZK A;  4EPZ A;  2VTB B;  4J8Z A;  5C2Y A;  4F53 A;  5JJT A;  2I6H A;  3O4Z A;  3UX4 A;  3B84 A;  2X38 A;  4UYI A;  3PNL B;  4I1M A;  4F1S A;  2HM8 A;  3RK6 A;  4A3T A;  1EF1 C;  3CKB A;  3UMV A;  1QZ2 A;  4RVB A;  5D0Q D;  1P22 B;  1DNP A;  3LEW A;  4LER A;  4UWH A;  3FHE A;  1ZBP A;  3MCX A;  1QNF A;  3ZYQ A;  5BV1 A;  1HXI A;  4WUY A;  5ENN A;  3S2A A;  4TUU A;  4L1B A;  2PZI A;  4UQZ A;  4NAC A;  2PL2 A;  3RRM B;  4G2V A;  4N3C A;  2XRZ A;  4EZL A;  4W9J B;  4XKC A;  3IHY A;  4QFV A;  3TJP A;  3HQI A;  4KXK B;  2AXZ A;  2WXJ A;  3G2U A;  3FUI A;  5FJY A;  1N52 A;  3FTU A;  4ANU A;  3FU6 A;  3CK8 A;  2YHE A;  2AST A;  2OOE A;  4U04 A;  3FWV A;  2FNJ C;  1XNF A;  2IF4 A;  2R5S A;  4J6I A;  4FA6 A;  4U77 A;  5G2N A;  4GZ3 A;  3CV0 A;  4I2Z A;  3HTM A;  4DPR A;  3LCA A;  3L2O A;  1UW4 B;  1QDV A;  3ESL A;  1ELW A;  3T5X A;  3B7T A;  4JEH A;  3L16 A;  4YVO A;  4RG6 A;  4CT4 A;  4JHR A;  1KT1 A;  2XPI A;  3NZU A;  4EZJ A;  1HO8 A;  4G11 A;  3L54 A;  4AOF A;  3ZHE A;  4N2Q A;  2WXF A;  4I17 A;  2XPZ A;  3N71 A;  3ZXS A;  2BTD A;  1SZA A;  2OND A;  4LRZ A;  5EX0 A;  3D9K A;  2E0I A;  4G25 A;  3MKS A;  2J9Q A;  3QDN A;  4J8D A;  5BNW A;  2ILR A;  4FHJ A;  2IQC A;  5KJN A;  1WM5 A;  4PDX A;  3KD7 A;  4APO A;  4IUL A;  4W9E B;  5A6R A;  3L6A A;  4AIF A;  1EOE A;  2J49 A;  4JHJ A;  5JH5 B;  1FQV B;  2BF0 X;  4WNE A;  4CDR A;  2QFC A;  2Y4T A;  4JTA B;  3GA1 A;  3ZRF B;  2KZT B;  1FCH A;  3R7R A;  4FUL A;  3ZHE B;  2XQ0 A;  4U8H A;  1PY1 A;  5A23 A;  4GPK A;  4B94 A;  5AEN A;  3ZGQ A;  3EJN A;  4JEU A;  2M63 A;  4BT9 A;  4W9D B;  1NA3 A;  2Y3A A;  3HDX A;  3IKO B;  2WXQ A;  5CCM A;  2WQ7 A;  2X6K A;  1LF8 A;  4GCN A;  4XX5 A;  4I2W A;  4U63 A;  2CFZ A;  2NSZ A;  2AWI A;  1H2T C;  5JJ6 A;  4HS2 A;  1LQB B;  2I2R A;  1HS6 A;  3LKU A;  2MRI A;  4FJZ A;  2C9W C;  4U07 A;  3ZYK A;  2Q81 A;  3FDH A;  2GW1 A;  3I4R B;  3MGB A;  2JZ3 C;  2LAH A;  3CGH A;  2C2L A;  3B7U X;  4GCO A;  4HXI A;  4H7Y A;  2BUG A;  4WWN A;  5J08 A;  3LBZ A;  3LYA A;  3C6O A;  3LXU X;  3NF1 A;  2X6H A;  2KCV A;  4ANW A;  4OYS A;  4PH4 B;  5AIJ A;  1KT0 A;  1ELR A;  5A6C A;  3M4T A;  2R59 A;  1W3B A;  4F7A A;  2OVF A;  4AY5 A;  5IBK A;  3Q47 B;  3UQ3 A;  2KC7 A;  2AW6 A;  1WAO 1;  4ME2 A;  3TXN A;  4NRH B;  4CDM A;  5BXH A;  3CSF A;  1QDW A;  4XE0 A;  3SBT B;  2PQR A;  1KLX A;  2LO6 A;  4I9E A;  4XIF A;  2VPK A;  4I9C A;  4L2L A;  4UWG A;  5BV0 A;  2IZV C;  4JTC B;  4P29 A;  2J4D A;  2FUL A;  1UN8 A;  2UWJ G;  3QWV A;  3CR3 A;  3QAR A;  5G05 J;  1HFA A;  4L7T A;  5LX8 A;  1E90 A;  1GW6 A;  1HZ4 A;  4G23 A;  4KVO A;  5J90 A;  5FWQ A;  3MA5 A;  4PS3 A;  3RKV A;  3ENE A;  3KAE A;  4OVV A;  3FTY A;  3T8M A;  5ARG A;  1VDY A;  2L0I A;  3RO2 A;  5FQ8 A;  3ZPJ A;  3CHO A;  4JXT A;  4EEC A;  3HIZ A;  2A5U A;  3QJZ A;  1OWN A;  2Y4U A;  5FZS A;  1R2B A;  2HR2 A;  3Q4A B;  2RD0 A;  3D9O A;  4JC8 A;  3PDN A;  1IQR A;  3OAW A;  3ASH A;  4GZ5 A;  4CXT A;  3ZYM A;  2P1M A;  4G24 A;  1HG5 A;  4I6G A;  2VSN A;  4G26 A;  3R7Q A;  4TV3 A;  3D9P A;  3RU0 A;  3QK0 A;  1E8W A;  4N9F 5;  5BXB A;  2IU1 A;  3FTS A;  3PRE A;  3SFZ A;  1E8X A;  4I6J A;  4W9R A;  5M72 A;  3ASD A;  2FBN A;  4EQF A;  4YY8 A;  5LCW C;  1OUV A;  3ZNG B;  3UUX A;  4BWR A;  3CHQ A;  4FHK A;  2L9B A;  4J8F A;  4Y6C A;  4JL0 A;  4B8A A;  3QWP A;  1TJC A;  3VLD A;  4JGH C;  3L13 A;  4ABN A;  5FQ4 A;  3QKY A;  4R7L A;  1UG3 A;  2KCK A;  3I4G A;  3CK7 A;  1TEZ A;  3OGK A;  4ILH B;  4DI3 A;  2Q7F A;  5FQ6 A;  3EHM A;  4B95 B;  4Y6W A;  3LNM B;  2XGM A;  4N3B A;  2WXL A;  1OWL A;  4RSY A;  4I1O B;  4IRU A;  4HOT A;  5HYW B;  3S7F A;  2WVI A;  2VGY A;  3APF A;  3D3M A;  4I1A A;  1N54 A;  5A15 A;  4ILI A;  3JCK C;  4TRQ A;  3D9L A;  5CCL A;  2IF5 A;  2WXG A;  2V4L A;  4HOQ A;  4AY6 A;  5H7G A;  1SQM A;  3JQ0 A;  5JHA A;  3LY7 A;  3BEE A;  3HVE A;  4KBQ A;  4CRH A;  3E4U A;  2V8S E;  1FS2 B;  4PS7 A;  2NN2 A;  4H7X A;  2WM9 A;  4I6J C;  3FUK A;  4J0U A;  4KZ0 A;  5AYW D;  2YY9 A;  4LCT A;  3PUJ A;  3APD A;  4MS6 A;  4BSX A;  4BFR A;  5LLI B;  4PUC A;  1A68 A;  1P5Q A;  4K0R A;  4XZ4 A;  4W9K B;  2IOS A;  4N3A A;  4B9K B;  2JLB A;  1S0P A;  2OVB A;  2YHC A;  2C0M A;  3PH0 C;  4U0S A;  1EOF A;  1R29 A;  3OGL A;  2A79 B;  5ANR A;  5H7H A;  1YA0 A;  2EQX A;  4ACL A;  3U64 A;  3CIA A;  1B89 A;  2P1N A;  3CEQ A;  5CHE E;  3TGO A;  3LJ3 A;  2P58 C;  2XEV A;  2CHZ A;  2WB2 A;  2I1K A;  2P1Q A;  4LEU A;  5G05 C;  4WND A;  3ZRC B;  1EXB E;  5BXD A;  1H6K A;  4XKB A;  5KJM A;  3CVW A;  1EDU A;  2WPV A;  3PE4 A;  4JTD B;  3KS2 A;  5EX3 A;  3JYS A;  4AM9 A;  3M8V A;  4AXH A;  3OXF A;  1LDK D;  4CRW A;  4EBA A;  1NN7 A;  4BY6 A;  3SD5 A;  3FU0 A;  2FO7 A;  4G1T A;  2WQ6 A;  5HI7 A;  2JEK A;  4L23 A;  3HU6 A;  3L08 A;  4CXJ A;  3GZS A;  2L6J A;  2GRL A;  3OTN A;  4DI4 A;  4A3V A;  3PVL A;  1NP7 A;  1QQE A;  2WXH A;  1IYG A;  5KJL A;  2NZ0 B;  3FUD A;  3FUJ A;  4C9B B;  4CDN A;  4UIJ A;  4W9H B;  4OVU A;  4MRU A;  5ANL A;  1S1G A;  4HOR A;  1H2U A;  2I2O A;  2DIW A;  3AU4 A;  4U2N A;  1EPU A;  1U3C A;  2XRY A;  3SGH A;  3URZ A;  4B89 A;  1MQS A;  3PE3 A;  4JA9 A;  2OVQ A;  2R9R B;  4UI9 J;  2J08 A;  3ASF A;  3LVR E;  4J8S A;  5ARF A;  2ION A;  4ACK A;  4HOU A;  4E6H A;  3WSO B;  4BGC A;  4BTB A;  2KM4 A;  5DIZ A;  1R28 A;  3ZYL A;  4HOS A;  2WQH A;  2IHC A;  3IV0 A;  3S7B A;  1IHG A;  2E32 B;  4ZOU A;  3FTX A;  3S7J A;  2AVP A;  2I9C A;  1IQU A;  2WXO A;  4JHK A;  2RG8 A;  5G04 J;  3SBS A;  3SZ7 A;  4CCA A;  5C1D A;  3UT8 A;  3OHV A;  4B8C B;  3CK9 A;  2MOW A;  2VQ2 A;  3C6P A;  2AXV A;  3M5B A;  5BO4 C;  3AS8 A;  3VLE A;  4GAA A;  2V0P A;  3WXX A;  1FVH A;  4WNG A;  3KVT A;  4AVX A;  3QWW A;  4DK5 A;  3LPZ A;  3OXL A;  1PAQ A;  3PS6 A;  5FZR A;  3TL5 A;  3ASG A;  5D0O D;  4N39 A;  3IBE A;  3UPV A;  1E7V A;  2FF4 A;  3T5V A;  2YNQ A;  1CS3 A;  1Z3Y A;  3CHS A;  3CHR A;  3MV3 B;  1DSX A;  4ZGC A;  5E75 A;  4JVS A;  4UQX A;  1BPO A;  3IEG A;  4NQ0 A;  2XCC A;  3VTY A;  2GRM A;  3EHN A;  2LSU A;  2CFU A;  3R9A B;  3ZFW A;  3CVL A;  4FP7 A;  4JW1 A;  2VYI A;  3LY8 A;  3OXG A;  3SI5 A;  1E96 B;  1T1D A;  3CHM A;  4JA7 A;  2VSY A;  3FUE A;  3RIB A;  5FT9 A;  3VLF A;  2P1O A;  4YND A;  5CMW A;  2OVP A;  3FUL A;  4BTA A;  4N5C A;  4URK A;  1Z6T A;  2VSX E;  4BT8 A;  3EIQ C;  3GYZ A;  4FU3 A;  5FQ7 A;  3ML8 A;  4C0M A;  2VGX B;  2NC9 A;  3D9M A;  1NA0 A;  1NEX A;  5G04 C;  4EBA G;  2QY7 A;  3PZD A;  2DBA A;  2DCP A;  3G2S A;  3GW4 A;  4HLE A;  4GA1 A;  4FLH A;  2XGO A;  2GGF A;  3FTZ A;  2XHE A;  4KMO A;  4MLP A;  3Q5M A;  5BUZ A;  3MV2 B;  4UI9 K;  2CG3 A;  1UN9 A;  4D10 C;  3FUF A;  2OVR A;  3EIJ A;  4K03 A;  3FUN A;  4W9I B;  4BKS B;  4M3O A;  3I3N A;  3MYV A;  4GZC A;  4GYY A;  4BX8 A;  3P1U A;  2VJ8 A;  5LOZ A;  4KZC A;  1HU3 A;  3C98 A;  3AS5 A;  4GU5 A;  2VKP A;  4HFG A;  1ELK A;  2IJG X;  2CG2 A;  5T8I A;  3ZW3 A;  3FTW A;  4A1S A;  5HZG C;  2J09 A;  3ZEF A;  3CQC B;  3FEY A;  1HG2 A;  1JWG A;  4J8E A;  4UWK A;  1H0A A;  1SZ9 A;  1E8Z A;  2OV8 A;  1JPL A;  3B7S A;  3FH7 A;  3FY4 A;  3PNT B;  4I43 A;  3ESK A;  3CLJ A;  3ZN3 A;  1Y6I A;  2IFU A;  4Q94 A;  4AEZ C;  4ATG A;  3U3W A;  2HO1 A;  5JJ7 A;  3MJW A;  4W9C B;  4BKT B;  4DLO A;  5FTA A;  3G2T A;  2VTB A;  4CGW A;  4EOZ A;  3CVN A;  4GZD A;  1VCB B;  3TG4 A;  1FS1 B;  2WXR A;  3GZ1 A;  3LVQ E;  3Q49 B;  5E76 A;  3RO3 A;  4C0E A;  4F3V A;  5EUP A;  3HYM B;  3QOU A;  2MHK A;  4B0Z A;  3LDZ A;  1EYH A;  5T4Y A;  5DAD A;  4CP3 A;  1Z3X A;  2V5F A;  2PM6 A;  5EDS A;  1UJJ A;  4CXI A;  1HF8 A;  3RRN B;  5KJK A;  4FJY A;  5LCW J;  1NZN A;  4GZ6 A;  3BG0 B;  3CST A;  2X3M A;  3ULQ A;  3FH5 A;  1BUO A;  1OWM A;  2VSO E;  3QAQ A;  4APF A;  2A4Z A;  1H2V C;  4W9H H;  5LFA A;  1ZU2 A;  3LUT B;  4GB9 A;  3ZVV A;  3O48 A;  4ILG A;  3FU5 A;  1H19 A;  4NUR A;  2L0T B;  1WY6 A;  4N2S A;  2UY1 A;  3HHM A;  5CMY A;  1OWO A;  4GYW A;  4WAF A;  3ZIM A;  3CQG B;  3FTV A;  2J4B A;  2AXU A;  4B9K E;  1DVP A;  3TG5 A;  5AJL A;  2PPI A;  4WWP A;  3ONK A;  4YVQ C;  3CHP A;  4DJA A;  3CVV A;  3RJV A;  4AWJ B;  3TAX A;  3S7D A;  3FFL A;  3CVP A;  3ZRH A;  5LP0 A;  4KT6 B;  3I5P A;  3PUK A;  1HH8 A;  2KAT A;  3D9N A;  4FLB A;  3VTX A;  5BW8 C;  3FUM A;  3PEV B;  3DRY A;  1A17 A;  4JPS A;  1EOD A;  2FI7 A;  4FC8 A;  2UY1 B;  3TXM A;  4UI9 C;  3LS8 A;  4UWF A;  4KVM A;  2WXP A;  4GMJ A;  2IOL A;  3SNX A;  1TJF A;  3UT7 A;  3D9J A;  1HX8 A;  4Q69 A;  2XPY A;  4E85 A;  2ZU6 B;  2PQN A;  3HVE B;  5AJD A;  4CT0 A;  4PS8 A;  3QB2 A;  4CGV A;  3NZS A;  2Z8H A;  2LAI A;  4JZY A;  3DRX A;  5EKQ D;  2CHW A;  3U9W A;  2XGS A;  3SHF A;  3U66 A;  2WMO A;  1JUQ A;  4IYP A;  3K9I A;  4L2Y A;  2ASS A;  2P1P A;  3BIM A;  3ZTD B;  4U2M A;  3QNK A;  4GA2 A;  3B7R L;  3DBS A;  3FUH A;  3DPD A;  3ONL A;  2WMN A;  4XI9 A;  2YIN A;  4GYO A;  3MX3 A;  3FP3 A;  1E7U A;  1PC2 A;  2FEZ A;  2KZT A;  2KCL A;  1UJK A;  3EDT B;  3FEX A;  3G2W A;  4U0U A;  5FZQ A;  4AJW A;  3E4B A;  4V3I A;  4AJY C;  3GZ2 A;  3CVQ A;  3MKQ B;  4UWL A;  1Y8M A;  3U4T A;  3FH8 A;  3CVU A;  2E31 B;  5DBK A;  1MHQ A;  2E2E A;  4U0Z A;  3ZTC B;  2X6I A;  2NXP A;  5FTP A;  5BPP A;  4BX9 A;  3FKC A;  3ZUN B;  2LSV A;  4W9G B;  4W9L B;  4WNF A;  1XGW A;  3RRU A;  3CVX A;  4WQO C;  4ANV A;  3OGM A;  3JQ1 A;  1U3D A;  3CVY A;  3V7D A;  3MKR A;  4LUN U;  4AV7 A;  4DLQ A;  4AP2 A;  3BG1 B;  2VGX A;  2WXN A;  2YQ8 A;  2X6F A;  4O6F A;  4GML A;  5JHB A;  3M52 A;  1HE8 A;  1HV2 A;  3LY9 A;  3B13 A;  2LNI A;  2R17 C;  5HQ8 A;  2WXK A;  3MEK A;  3UT4 A;  4KYO B;  2MA9 C;  2HYZ A;  3PEU B;  5KCM A;  1INZ A;  3FU3 A;  3Q15 A;  3ZKJ B;  4A55 A;  3DCG B;  3PRZ A;  3AS4 A;  2C0L A;  3MKQ A;  3MZL B;  2J07 A;  1X5B A;  3L17 A;  2X6J A;  4UQY A;  2XCB A;  4GA0 A;  4MKT A;  4WWO A;  1LM8 C;  1FVF A;  3L22 A;  1L5J A;  3P2B A;  4ANX A;  1JWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...