3HVEB

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
195
Chain Sequence
DPQHAARLLRALSSFRERFCDAHLVEPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLEDIQDVVQAADLLLLTDLKTLCCEFLEGCIANCIGIRDFALHYCLHVHYLATEYLETHFRDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVHMKDVMSALWVSGSSYLREQMLNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gigaxonin
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
total genus 44
structure length 195
sequence length 231
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00651 BTB BTB/POZ domain
B PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveB02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveB01
4W9EB 1EOEA 1QDWA 1T1DA 1QDVA 3OHVA 3HU6A 2NN2A 5H7HA 2OVRA 4W9HH 3M5BA 2MA9C 4UIJA 2I2RA 5BXBA 1A68A 2YY9A 5BXDA 2OVPA 3LBZA 4W9FB 2EQXA 2IZVC 3ZTCB 2FNJC 1LDKD 2IF5A 3C6NA 2Z8HA 4BKSB 2C9WC 3LUTB 3M52A 4WQOC 3V7DA 3L2OA 4W9GB 5LLIB 4JGHC 4JTAB 3GA1A 3OHUA 4W9LB 1FS1B 3HTMA 4AJYC 3C6OA 4CP3A 1LQBB 5DADA 4U2NA 5BO4C 1EOFA 4B9KE 1VCBB 3I3NA 2ASSA 2P1MA 4CXJA 3OGKA 3OGMA 2P1NA 2P1QA 3M8VA 4W9KB 4AWJB 4U2MA 2P1PA 4HS2A 1S1GA 4W9HB 3C6PA 3ZRCB 3ZUNB 5DAFA 3ZKJB 1R2BA 2A79B 2E32B 4N9F5 2IHCA 3HQIA 3HVEA 4J8ZA 1LM8C 3LNMB 4APFA 3KVTA 4BKTB 1NEXA 4CRHA 2E31B 4HXIA 5H7GA 5A6RA 2NZ0B 5HYWB 1R28A 1DSXA 3OGLA 3ZTDB 4B9KB 3BIMA 4UYIA 2PPIA 1BUOA 1FQVB 1R29A 2R9RB 2JZ3C 1FS2B 1HV2A 2VPKA 1CS3A 1P22B 3M4TA 3MKSA 3DCGB 2ASTA 4ZOUA 4CXIA 4W9CB 1NN7A 1EODA 3ZNGB 5FTAA 2OVQA 4CXTA 3DRZA 5HZGC 4W9IB 3E4UA 4AP2A 4JTCB 5JH5B 2VKPA 3WSOB 1EXBE 4W9JB 4W9DB 3B84A 4BGCA 3HVEB 3ZRFB 5EUPA 4B95B 5IBKA 4U77A 4I6JC 3FKCA 4EOZA 2P1OA 5A15A 2Q81A 5BXHA 4JTDB
chains in the Genus database with same CATH superfamily
1EOEA 3CK9A 3HXCA 5ENSD 5AQ9A 2UWJG 4W9HH 2XS1A 3C98A 5FQ7A 2WM9A 3CVUA 2GRPB 2VSOE 2IZVC 2XENA 5G04J 3CK8A 5D2MC 4WQOC 4ATGA 3HTMA 4GZ6A 2VGXA 3QDNA 1V55E 2ASSA 3OGKA 1N0RA 1H2UA 1TNBA 2L0TB 5H7PA 4J8SA 1E8XA 1H2TC 1KPSB 4CRWA 1K1BA 4C0EA 3CSFA 4ANVA 2ZISA 2JEKA 5B1BE 2MHKA 2M63A 3B7UX 4GZCA 2CHZA 4L1BA 2IOSA 2BKKB 3EUVA 3VTXA 2GRRB 1GW6A 4PUCA 3VLEA 2H6IA 4E85A 2ASTA 2KXPC 4U8VD 3LCAA 3KEAA 5BW8C 1Y8MA 3FTSA 1OWNA 4KMOA 4JB8P 2IO3C 4JVSA 2OVBA 3UM3A 1TJCA 3DSVA 5BUZA 1ELWA 3FWVA 3V31A 3WSOB 4G8KA 4X8QA 4HQDA 5T8IA 5BV0A 4MRUA 3J5QB 3ASGA 4XZ4A 3U64A 3FUIA 5BXHA 5LCWC 1EDUA 3DRYA 4HB5A 4GCOA 4HFGA 4ACLA 1N9AA 2VGEA 3G2VA 1K1AA 4WWOA 3ZRHA 2OVRA 1IHGA 5ENRD 4DRXE 1D8EA 4CGWA 1Z5SC 3DPDA 2VQ2A 3EIQC 4UWHA 4LERA 5FIOA 5LLIB 4W9GB 3QKYA 1S63A 2KCVA 1QZ2A 1UN9A 4GZ3A 4GYYA 4AVXA 3PEUB 4IRUA 3FTVA 3HG0D 3I3NA 2RFMA 5HRYA 5LOZA 4DK5A 4M7CA 4GTOA 3UKRG 1YA0A 5CBNA 3ZKJB 3FU3A 1JPLA 3QK0A 5KJNA 3HQIA 3FUHA 5DBKA 2B0OE 2I1JA 3L9TA 4U96D 3UIPC 3SFYA 1MX2A 4PS3A 1DSXA 5E75A 2R2LA 2R9RB 1YMPA 4FJYA 4HOUA 3ZU7B 4AIFA 2LAIA 4C9BB 1P22B 2NSZA 2EILE 4WUYA 2R59A 1KT0A 3TWQA 3AJIA 4FU3A 4ILGA 3RJVA 3MZLB 2J8SD 2IQCA 3NOCD 2J49A 3HVEB 5FJYA 3UM1A 1N4RA 4I17A 4EOZA 2X6FA 5KJMA 4B93B 1SQMA 4BTBA 3V2XA 3D9LA 4LNBA 2DZNA 3SI5A 4I1OB 3DBSA 5FZRA 1SW6A 2R02A 3QARA 3DPYA 2AJAA 2EQXA 3ZTCB 4DX1A 2XZTG 3EU9A 4YNDA 5FWQA 4U07A 3JXJA 4AJYC 4ZHBA 2UY1A 5JA4D 2QZAA 3KAEA 2IU1A 3MX3A 2VTBB 3DSSA 3TG4A 1TN6A 1FVFA 3B13A 5DAFA 3FU6A 3ZGQA 4JHJA 5LCWJ 3KVTA 2OV8A 3D9HA 1HG5A 1LD7A 1MJ0A 2KC7A 3ZTDB 2L9BA 2KM4A 1FQVB 1R29A 3G2SA 3TWXA 3L08A 3CKBA 1OXJA 3M4TA 2LXLA 4BERA 1E7VA 3ZW3A 4M3OA 2PNNA 1HG2A 4XX5A 1MQSA 2WXOA 2DWZA 2XGMA 3BEEA 3LS8A 4I6JA 4GMLA 2X6KA 4GA2A 1TJFA 4KVOA 4I9EA 1UW4B 3PZDA 4XE0A 3NZSA 4B95B 1ELRA 3ZKJA 3PDNA 3C72A 2PL2A 1OCZE 5EILA 3PZ4A 5EN5D 1SA4A 3UT4A 5HI7A 2WQ6A 2WXPA 5ENNA 2X38A 5AQ7A 4K5CA 4JEUA 4KBQA 4DLQA 2IEJA 4AY6A 4DUIA 2RFAA 4F1PA 3LUTB 5JMND 3FP3A 4JTAB 2WXHA 2F8YA 1FS1B 1ELKA 3SZ7A 5DADA 1Q2ZA 4WNGA 1FCHA 3ASNE 3CHMA 4FADA 2P1MA 2QC9A 1UJKA 3Q78A 1JCSA 1SZAA 4HBDA 4RVBA 2WPVA 3PE3A 2H6GA 3HVEA 4GU5A 4LCTA 3HDXA 4APFA 3AU4A 3PS6A 4BKTB 1LF8A 5A6RA 4YDEA 3FUJA 3LXUX 4LG6A 4DX2A 1LTXA 4AY5A 1H19A 3AG1E 3ZUVB 3DSWA 5BV1A 2WXKA 3DRZA 1TNOA 4W9IB 4G8LA 4R7LA 2WXIA 3TAXA 3IV0A 5CRUA 3DEPA 2VKPA 2VTBA 2Y1LE 3UQ3A 4K5BA 4RLYA 4BGCA 3DRAA 4QQIA 3FULA 1H2VC 4LNGA 1O1TA 2XCCA 3ML9A 4CCAA 4CDRA 3AS4A 4TXRA 3UINC 4A63B 4EZJA 1TNZA 2CHXA 1A68A 3OAWA 2YY9A 1N11A 1U3DA 2FNJC 2ETCA 2A4ZA 4HVBA 4XKCA 4G11A 5B3SE 4W9LB 1Z6TA 2XRZA 5CCMA 1N52A 5KJKA 2CFZA 4DX7D 5DIZA 3VTYA 4QFVA 3AU5A 1QQEA 1HE8A 5EX0A 4W9KB 4J0UA 4N3BA 2VSXE 3ENEA 2E32B 4TRQA 4JXTA 4G24A 3SY2A 4EHMA 4TV3A 1BI7B 4U8YD 3KS2A 5H7GA 4FJZA 3UI2A 3LVRE 4FP7A 4HI9A 3PUKA 4UQYA 2RG8A 1MX4A 1S64A 1MYOA 4Y6CA 2HE0A 1N0QA 1NL4A 1JWGA 1IQUA 4LNUD 5FTAA 2VYIA 3FHEA 1QNFA 2AXUA 4UUCA 3RSEG 4H7YA 1BU9A 4GPMA 4CEMA 5M72A 2HO1A 3KSQA 5J90A 2IJGX 2WXRA 4UQZA 2KBXA 3UX4A 4FULA 4EBAG 2R5SA 3CHRA 4JW1A 4WNFA 3B7TA 4TXPA 3DSTA 2P1OA 2OEWA 2WXGA 2EIME 3FH7A 4FLBA 3EHMA 4ACKA 4AJWA 2I6HA 2GRNB 4UIJA 3EU5A 2WQ7A 5BXDA 3LBZA 2F8XK 1LDKD 3I4RB 3FUFA 4K5AB 2P9PG 3KEZA 4XIFA 4ILHB 2DVWA 3L2OA 4LSZE 3ML8A 3SGHA 3SD5A 1O1SA 4HLEA 3DSUA 4Y6WA 1OWMA 3J5PA 2A5EA 4A3VA 4HS2A 5ENOD 1O5MA 3ZXSA 4GA1A 3JCKC 3L17A 3W9FA 1AP7A 2DCPA 3ONLA 3HXFA 4UI9J 4AV7A 4BT8A 3QJZA 2XHEA 3BIMA 4UWLA 5ENQD 5B1AE 4GTVA 4GZ5A 1FS2B 1CS3A 2HM8A 2ONDA 5CEAA 3MKSA 2P9UG 2FO7A 4XKBA 2AXZA 1ZU2A 3Q73A 2XGOA 3LJNA 4G23A 4F3VA 3RO3A 4U0UA 1N95A 3UT8A 1HZ4A 4BWRA 1RW2A 5EUPA 2LXMA 4HI8A 5A6CA 5ANRA 1PAQA 1TN8A 3CVPA 3ZVVA 4HRNA 3UM0A 3NF1A 4W9EB 5EYPF 4PDXA 3JUEA 1QDVA 1BD8A 2C0MA 3HU6A 3S7DA 4MBGA 3CVQA 4D10C 3ASOE 1TNUA 5CECB 2Y3AA 5BXBA 2J07A 3AG2E 4W9FB 4N39A 4ZGCA 2Z8HA 2C9WC 4HOSA 2P9LG 3D9NA 1ZBPA 5FINA 2WVIA 2ETBA 1PY1A 3ZHEB 3BG0B 3FTWA 4U2NA 3TWWA 2QYUA 1EOFA 2Y69E 4BETA 2DYRE 2GRQB 3UM2A 3ZYKA 4KZ0A 4Q96A 4U2MA 2P1PA 1FVHA 4RG9A 1OWLA 1FT2A 2X3MA 1H6KA 3LNMB 1WDYA 1Z3YA 2PZIA 1QYMA 1MZCA 2E2EA 1IKND 5KCMA 3ZFWA 2ZGGA 4Z68A 2LUHA 5ENTD 4U7EB 4RG6A 3GZ2A 1TEZA 2I2OA 2P9NG 4I9CA 2KZTB 3TJPA 4JHKA 4BEPA 3NOGD 3FTYA 3EIJA 2V8SE 2MYOA 3SF4A 1EODA 3ZNGB 4F7AA 3QB2A 3D9JA 3N71A 3MKQB 3FUEA 1Y6IA 2H6HA 3HRAA 2YQ8A 3OXGA 4A55A 3TWSA 2AXVA 1E8ZA 2CG2A 1OCCE 4W9DB 4DI4A 3CV0A 1NP7A 3S7BA 2KATA 3T9KA 1NI1A 3FTZA 3RO2A 3IEGA 1T1DA 5LFAA 4BX8A 2FEZA 3AS8A 3ASDA 4TUMA 4CT4A 4HRLA 2CFUA 3L54A 2IF5A 4BKSB 3DXKG 5JJ7A 3GYZA 2V5QC 2J08A 3G2TA 4BSZB 3CKCA 3NBNB 4PH4B 2WXJA 2WMNA 4BY6A 4W9HB 3ZRCB 3ZUNB 1D8DA 1R2BA 5BPPA 1N4PA 4N9F5 2J4DA 4XI0A 2BKGA 5ENPD 4CT0A 3T5XA 4NQ0A 3IKOB 2Y0BG 3TXNA 4XI9A 2XEHA 4B0ZA 2AW6A 3PH0C 1OY3D 2IOLA 4B9KB 3FU0A 4UYIA 2XS8A 2F37A 2C0LA 2VPKA 4KZCA 4U63A 3WG7E 2IY0C 2NYJA 1IYGA 4JA7A 3CHSA 5CMYA 4ANXA 4J8DA 4EZLA 3FUDA 3ZXPA 3I4GA 4JL0A 4A1GA 3CVVA 4AEZC 3ESKA 3MV2B 5C2YA 3ZHEA 3ASHA 3ZPJA 5KJLA 2CG3A 4G2VA 3HXDA 1E8YA 5G05C 3D9IA 1OUVA 4YVQC 4GMRA 3HYMB 3QC1A 3CLJA 4O1PA 2P9IG 4DLOA 3ISMC 4FHJA 1S70B 5H7HA 4JPSA 3ULEG 4H7XA 4BX9A 3Q49B 1OWPA 1WG0A 3ULQA 3TL5A 3F6QA 3DSXA 1IXVA 4FLHA 2XEVA 1WAO1 2X6JA 5FQ6A 4U8HA 1DVPA 2IFUA 3KD7A 4BT9A 3PRZA 3RKVA 4CP3A 2J4BA 3ZNGA 3E32A 2Q7FA 2ZXWE 1LQBB 5BO4C 4N2QA 1BLXB 2JABA 3R7QA 1HO8A 4OVUA 3MKQA 2BTDA 3C3QA 1S0PA 2HR2A 4YDWA 1FT1A 4G26A 5C1DA 1G3NB 3D9KA 3V30A 4Q94A 5JHBA 1HU3A 4GAAA 4HXIA 4BESA 1XNFA 2QY7A 4K0RA 4EZKA 5KNHD 3IHYA 4IYPA 4IN3B 2QYJA 4GMJA 5JHAA 4JD2G 1KT1A 3ZYMA 2CHWA 3CIAA 3E4UA 3CR3A 3FU5A 5LP0A 4HORA 3W9GA 3IHVA 5AN8A 3UPVA 5D66A 2J09A 5AQBA 3CSTA 1ZB1A 4A3TA 3AS5A 4G25A 4EBAA 3URZA 2P58C 4F6RD 1HH8A 3UT7A 3S2AA 1OCRE 3MEKA 4I2ZA 4P29A 2WMOA 3FUKA 3SNXA 4OAVB 3O48A 1SZ9A 2Y4UA 4NACA 5LX8A 3K9IA 3EHQA 3Q9UC 4UI9C 4ANUA 3OXLA 1P5QA 3MCXA 3UUXA 5ARGA 2I1KA 3FEXA 3Q15A 2LAHA 5G05J 3UTMA 4UWGA 1INZA 4YDYA 3IXEA 2L6BA 4GA0A 1JUQA 4N2SA 1B89A 2VGXB 3UIOC 1NEXA 1N54A 3AG4E 3NQPA 5T3RA 3U9WA 4U0ZA 3OGLA 3ABLE 5AENA 3BU8A 2R17C 2JZ3C 4URKA 3V79K 5AJLA 4DX5D 4HRMB 4ABNA 3OTNA 3GW4A 1NN7A 2FI7A 4WNDA 5CCLA 1VDYA 2MRIA 2Y4TA 2BUGA 5CHEE 3B7RL 3HXEA 1EXBE 5KNGA 3R9MA 5FZQA 3ZN3A 3R9AB 2VSNA 1N94A 3UMVA 5HQ8A 3LKUA 3ZIMA 1UN8A 4WAFA 5AIJA 1RZ4A 4DPRA 3ZYLA 3PREA 3HHMA 2I2RA 1E8WA 5G2NA 2OVPA 3G2UA 4FA6A 2GGFA 3Q47B 2WXNA 3JQ1A 3JUIA 3S7JA 3D3MA 4O60A 1L5JA 3E34A 1JCQA 4B9KE 3OGMA 2P1NA 2ZGDA 2R05A 2PQNA 2NXPA 3B95A 1JWFA 3CVYA 4APOA 1TR4A 4HOTA 2VJ8A 2V0PA 4C0MA 3CHOA 4BTAA 4I2WA 2LO6A 5EKQD 2PPIA 3LY7A 3SHFA 4I1AA 3RRUA 3WXXA 5EYLA 4W9RA 3IBEA 5BXUA 2WXMA 4GZDA 3CK7A 2J9QA 3LEWA 5BNWA 4GTRA 5EIDA 4OYSA 4TXQA 2WXQA 3B7BA 3U4TA 1E90A 4RSYA 3TWUA 4OAUC 2XQ0A 4W9JB 2EINE 3CVNA 1IHBA 2OEVA 2H6FA 3SFXA 4I6JC 3CHPA 4CDNA 5D0QD 3FUMA 3CVLA 3VLFA 1TN7A 4J6IA 2VSYA 2FF4A 1NA0A 2EIKE 4GCNA 4U95D 4F1SA 2XPYA 3FTXA 3EHNA 3L22A 3E30A 4GTSA 3M5BA 3BQOA 3X2QE 3S7FA 3M52A 1XGWA 3V7DA 3DXMG 3ZYQA 4B8AA 1A5EA 4UI9K 4CXJA 2KCKA 2WXLA 2YINA 3QWPA 3U66A 3D9OA 3Q7FA 2UY1B 3QAQA 3FDHA 4RQIA 3TWVA 4EPZA 3PNTB 4GTPA 4AOFA 4KXKB 2C2LA 1R28A 4EQFA 1QBQA 4UWKA 3RU0A 3HXBA 4I43A 2PQRA 4N3AA 1HV2A 3NAWA 4GTQA 1Z3XA 4GYWA 2BEDA 1E7UA 3KSLA 1N4SA 1WY6A 4CXTA 3EDTB 1PC2A 2BF0X 4C48B 5JJ6A 3T8KA 1A17A 3CQCB 1JCRA 1YCSB 3QNKA 4JA9A 2P2CP 2DZOA 4I6GA 4HLLA 2IO2C 2EIJE 2RD0A 2GROB 4PS8A 1TYQG 2GRLA 1O1RA 3ESLA 1QDWA 3OHVA 2XPZA 4DI3A 5CBOA 5FTPA 2MA9C 3DRXA 1OT8A 3Q75A 4CYMD 1W3BA 1E96B 4L9PA 2FO1E 2F0YA 4N5QA 4JGHC 5ARFA 4ANWA 2DIWA 2OVFA 1EPUA 2X6IA 4F53A 1VCBB 1BPOA 3PNLB 5KBAA 4MLPA 4U04A 3Q5MA 5AJDA 4K03A 2LSUA 2L6JA 4I1MA 3C6PA 2A79B 3CGHA 4XEIG 3O4ZA 3MA5A 4KT6B 2OCCE 1MHQA 3Q4AB 4DJAA 5D0OD 4I6EA 5HYWB 2V4HC 1BUOA 1UOHA 3RK6A 3MYVA 3UXGA 3T8MA 1K3ZD 4HNAD 2FULA 1EF1C 4EECA 4J8EA 2GW1A 4DX6D 2IONA 3QWVA 3T5VA 3C3OA 4LRZA 4O1OA 3V2OA 1LD8A 3FFLA 4V3IA 3FH8A 4B89A 3MJWA 4E6HA 5JH5B 2YHEA 3PUJA 1HFAA 1DNPA 1DCEA 3ZEFA 3P1UA 5FQ8A 5ANLA 5KWDA 3FUNA 1UJJA 2QFCA 3HIZA 4U0SA 1X81A 2ILRA 5IY5E 2Q81A 3QOUA 3P2BA 3PVLA 1NFIE 3Q7AA 4L7TA 4WWPA 4LEUA 3DEOA 4WNEA 2ZU6B 5G55A 4YVOA 2P9SG 5AQAA 2XRYA 3CVWA 5CERB 1OWOA 5ITZF 2HYZA 1H6OA 2FBNA 1KZOA 2LNIA 3TWRA 1H6PA 4BFRA 4WWNA 3OXFA 3LPZA 2X6HA 2PM7A 5EDSA 2IHCA 4B94A 4GYOA 2NC9A 2A5UA 2PM6A 4J8ZA 2KZTA 3GZSA 1V54E 3EJNA 3L13A 1K8KG 4NURA 3BG1B 2DBAA 4CRHA 5FQ4A 3Q79A 3LY9A 2XPIA 2B6CA 4IULA 5A23A 3CVXA 3BUAA 5CMWA 3CEQA 3DCGB 3LY8A 4CXIA 4W9CB 4CDMA 1SA5A 2OVQA 2DYSE 2XEEA 3RAUA 1DCQA 4MKTA 3SO8A 1IQRA 4N3CA 1EYHA 4A1SA 4B8CB 3LJ3A 4JZYA 1KLXA 4GB9A 2WQHA 4CGVA 5EIBE 3NB2A 2XCBA 3SFZA 3FKCA 2AWIA 1X5BA 1WM5A 4L2YA 3E33A 5FZSA 2R03A 5HS0A 3TWTA 2NN2A 1YYHA 2WXFA 3UKUG 3ABME 4OVVA 4CZ2D 3APFA 3PE4A 3ASFA 1UG3A 3CHQA 2OOEA 1NA3A 3U3WA 2GRMA 4MS6A 3ONKA 3RRMB 4J8FA 3TG5A 3GA1A 3FEYA 4ZFHA 3C6OA 4J8YA 3PZ1A 3APDA 4TUUA 1U3CA 4HOQA 2P1QA 3M8VA 3DWLG 3E4BA 4AWJB 5AYWD 3R7RA 3RRNB 4ILIA 2E31B 2V5FA 3JYSA 2NZ0B 1D9SA 2IF4A 5JJTA 3ULYA 2YNQA 5AARA 3G2WA 5E76A 3PZ2A 1DC2A 4GTTA 2ETAA 5G04C 4JHRA 4AXHA 3JQ0A 4NIKA 4GPKA 3EHRA 1U2VG 2WB2A 4Q69A 3I5PA 3MKRA 4N5CA 4AP2A 2AVPA 5BT1A 5CEDB 2JLBA 5T4YA 1NZNA 3ZRFB 2XZDG 5IBKA 4G1TA 3SBTB 1AWCB 1N4QA 4UQXA 5A15A 4BSXA 1HF8A 4FC8A 2ZIRA 5AAOA 3AAAC 3PEVB 1HX8A 3L82A 3MV3B 3FTUA 3C6NA 4GTMA 3JXIA 3APCA 3Q9NC 4JC8A 3CQGB 3OHUA 3D9PA 2I9CA 3SBSA 2V4LA 2L0IA 3VLDA 3SQVA 3LVQE 2XGSA 3FY4A 1S1GA 4YDOA 1SVXA 5HKPA 1BI8B 2KCLA 3NZUA 4FHKA 5A7DB 4AM9A 5FT9A 4PS7A 1LM8C 3D9MA 4NRHB 4L23A 1OCOE 4UWFA 3C5RA 3MGBA 3RIBA 4KYOB 2P9KG 3L6AA 3L16A 4ATZD 1FPPA 4O6FA 3GZ1A 3E37A 3PZ3A 1TNYA 1MX6A 4ZOUA 3B7SA 3LYAA 4L2LA 5J08A 4J7WA 2LSVA 1HXIA 5HZGC 3FH5A 3C3RA 2YHCA 2VGYA 3TXMA 4JTCB 3ABKE 1H0AA 3AG3E 3B84A 3TGOA 2E0IA 2MOWA 2RKKA 4U77A 3LDZA 1HS6A 4KVMA 3QWWA 5BXOA 4JEHA 4ME2A 4LUNU 1KZPA 5CRVA 5EX3A 4YY8A 4JTDB
chains in the Genus database with same CATH topology
4FHJA 3AS4A 3CK9A 1EOEA 3ESLA 1QDWA 3OHVA 2UWJG 5H7HA 4J8ZA 4JPSA 2XPZA 4DI3A 4W9HH 5FTPA 4H7XA 3C98A 4EZJA 4BX9A 5FQ7A 2WM9A 3Q49B 1OWPA 2MA9C 2CHXA 3DRXA 3CVUA 2VSOE 1A68A 3OAWA 3ULQA 1W3BA 2YY9A 3TL5A 1E96B 1U3DA 2IZVC 2FNJC 5G04J 4FLHA 3CK8A 2XEVA 1WAO1 2X6JA 5FQ6A 4U8HA 1DVPA 4WQOC 2IFUA 4ATGA 3KD7A 2A4ZA 4BT9A 4JGHC 4HVBA 4XKCA 4G11A 3PRZA 4W9LB 1Z6TA 5ARFA 3HTMA 3RKVA 2XRZA 4CP3A 5CCMA 4ANWA 1N52A 2DIWA 2J4BA 4GZ6A 2Q7FA 2VGXA 1LQBB 5KJKA 2CFZA 2OVFA 1EPUA 2X6IA 3QDNA 5DIZA 4F53A 4N2QA 1VCBB 3R7QA 4QFVA 3VTYA 1BPOA 3AU5A 1HO8A 2ASSA 3OGKA 1QQEA 1HE8A 4OVUA 3PNLB 5EX0A 4W9KB 3MKQA 4MLPA 4U04A 3Q5MA 1H2UA 2BTDA 4J0UA 1S0PA 2HR2A 4K03A 5AJDA 2LSUA 2L6JA 4I1MA 4N3BA 3C6PA 2L0TB 2VSXE 4EBAA 3ENEA 4J8SA 2A79B 3CGHA 5C1DA 4G26A 2E32B 1E8XA 1H2TC 4TRQA 4JXTA 3D9KA 4CRWA 4G24A 3O4ZA 4Q94A 3MA5A 4KT6B 4C0EA 3CSFA 5JHBA 5ANLA 4ANVA 1HU3A 4GAAA 4TV3A 1MHQA 3Q4AB 4DJAA 4HXIA 5D0OD 3KS2A 5H7GA 4FJZA 2JEKA 4I6EA 5HYWB 2MHKA 2M63A 3B7UX 3LVRE 4FP7A 4GZCA 2CHZA 1XNFA 4L1BA 2IOSA 3PUKA 4UQYA 1BUOA 3RK6A 2RG8A 3MYVA 3VTXA 2QY7A 3T8MA 4K0RA 4Y6CA 1GW6A 4EZKA 2FULA 4PUCA 1EF1C 3VLEA 4E85A 2ASTA 3IHYA 1JWGA 4IYPA 4IN3B 1IQUA 3LCAA 4GMJA 4J8EA 2GW1A 4EECA 5JHAA 5BW8C 2IONA 3QWVA 5FTAA 1Y8MA 3FTSA 1OWNA 1KT1A 2VYIA 3FHEA 1QNFA 2AXUA 3ZYMA 4KMOA 3T5VA 2CHWA 2OVBA 4H7YA 4JVSA 4LRZA 1TJCA 3CIAA 3E4UA 3CR3A 3FU5A 3FFLA 4V3IA 4CEMA 5LP0A 5BUZA 5M72A 4HORA 2HO1A 1ELWA 3FH8A 3IHVA 5J90A 4B89A 3MJWA 3FWVA 4E6HA 3UPVA 5JH5B 2J09A 3WSOB 2YHEA 2IJGX 2WXRA 1HFAA 3PUJA 1DNPA 4UQZA 5T8IA 3UX4A 4FULA 3ZEFA 3P1UA 3CSTA 4EBAG 4A3TA 5FQ8A 2R5SA 3AS5A 3CHRA 4JW1A 3B7TA 4G25A 4MRUA 3FUNA 4WNFA 3ASGA 1UJJA 2P58C 2QFCA 3HIZA 3URZA 2P1OA 4XZ4A 4U0SA 3U64A 1HH8A 2ILRA 3FUIA 2Q81A 5BXHA 5LCWC 3QOUA 1EDUA 3P2BA 3PVLA 3DRYA 4GCOA 4HFGA 3UT7A 4ACLA 3G2VA 2WXGA 4WWOA 3S2AA 4L7TA 3FH7A 3ZRHA 4WWPA 3MEKA 2OVRA 4I2ZA 4LEUA 4WNEA 4FLBA 3EHMA 2ZU6B 4ACKA 4P29A 2WMOA 1IHGA 4AJWA 2I6HA 5G55A 4UIJA 4YVOA 3FUKA 3SNXA 2XRYA 2WQ7A 3O48A 3CVWA 1SZ9A 2Y4UA 5BXDA 4CGWA 3LBZA 3DPDA 2VQ2A 4NACA 3EIQC 3I4RB 5LX8A 3K9IA 3FUFA 4UWHA 1LDKD 4LERA 1OWOA 5BO4C 3KEZA 4XIFA 4ILHB 4DLOA 3L2OA 4W9GB 5LLIB 3QKYA 4UI9C 2KCVA 1QZ2A 2HYZA 4ANUA 2FBNA 3ML8A 3OXLA 3SGHA 1UN9A 4GZ3A 4GYYA 1P5QA 3SD5A 3MCXA 4AVXA 2LNIA 3PEUB 3UUXA 4HLEA 4IRUA 3FTVA 5ARGA 3I3NA 2I1KA 3FEXA 4BFRA 3Q15A 2LAHA 4WWNA 5LOZA 4Y6WA 4DK5A 1OWMA 3OXFA 5G05J 3LPZA 4A3VA 2X6HA 1YA0A 2PM7A 4HS2A 4UWGA 1INZA 3ZXSA 5EDSA 4GA0A 1JUQA 3ZKJB 3FU3A 4GA1A 1JPLA 4N2SA 3QK0A 3JCKC 5KJNA 3L17A 2IHCA 3HQIA 4B94A 4GYOA 2NC9A 2A5UA 2DCPA 2PM6A 2KZTA 1B89A 3FUHA 3GZSA 3ONLA 5DBKA 4UI9J 4AV7A 4BT8A 3EJNA 3L13A 2VGXB 4NURA 2I1JA 3BG1B 1NEXA 3QJZA 2DBAA 1N54A 4CRHA 5FQ4A 2XHEA 3LY9A 3NQPA 5T3RA 2XPIA 3U9WA 4U0ZA 4PS3A 1DSXA 3OGLA 4IULA 3BIMA 5AENA 4UWLA 5A23A 5E75A 2R9RB 2R17C 4FJYA 3CVXA 2JZ3C 4URKA 4GZ5A 4HOUA 4AIFA 1FS2B 2LAIA 4C9BB 5CMWA 1CS3A 1P22B 2NSZA 2HM8A 3CEQA 2ONDA 3MKSA 5AJLA 4WUYA 4ABNA 3OTNA 3DCGB 2FO7A 3LY8A 4XKBA 4CXIA 2R59A 4W9CB 2AXZA 4CDMA 1KT0A 1ZU2A 3GW4A 1NN7A 4FU3A 2OVQA 2FI7A 4ILGA 2XGOA 3RJVA 3MZLB 4WNDA 5CCLA 1VDYA 4MKTA 2MRIA 4G23A 1IQRA 4N3CA 2Y4TA 4F3VA 1EYHA 2BUGA 4A1SA 3RO3A 5CHEE 2IQCA 4U0UA 4B8CB 3B7RL 3UT8A 3LJ3A 1HZ4A 1KLXA 4GB9A 4JZYA 2WQHA 1EXBE 4CGVA 2J49A 3HVEB 4BWRA 5EUPA 5FJYA 2XCBA 5A6CA 5ANRA 3SFZA 1PAQA 3CVPA 4I17A 5FZQA 3FKCA 3ZN3A 4EOZA 2AWIA 2X6FA 1X5BA 3R9AB 3ZVVA 1WM5A 2VSNA 5KJMA 1SQMA 4L2YA 3UMVA 4BTBA 3LKUA 3NF1A 3D9LA 5HQ8A 3ZIMA 4W9EB 1UN8A 4PDXA 3SI5A 4I1OB 5FZSA 1QDVA 2C0MA 3HU6A 2NN2A 4WAFA 5AIJA 4DPRA 2WXFA 3S7DA 3ZYLA 3DBSA 3CVQA 5FZRA 4D10C 3PREA 3HHMA 2Y3AA 4OVVA 2I2RA 3QARA 5BXBA 3APFA 3PE4A 1E8WA 5G2NA 3ASFA 2OVPA 2J07A 3G2UA 4FA6A 2EQXA 1UG3A 4N39A 4W9FB 3CHQA 2GGFA 3ZTCB 4ZGCA 2OOEA 3Q47B 2WXNA 1NA3A 2C9WC 3JQ1A 4YNDA 3U3WA 4HOSA 2Z8HA 3D9NA 2GRMA 1ZBPA 3ONKA 4MS6A 3RRMB 2WVIA 3JUIA 4J8FA 5FWQA 4U07A 3TG5A 3FEYA 3GA1A 3S7JA 3D3MA 1PY1A 1L5JA 3ZHEB 4AJYC 2UY1A 3C6OA 3KAEA 3BG0B 3FTWA 2IU1A 4U2NA 3APDA 3MX3A 1EOFA 4B9KE 4TUUA 2VTBB 1U3CA 3OGMA 4HOQA 2P1QA 2P1NA 3E4BA 3M8VA 3ZYKA 3TG4A 4KZ0A 4Q96A 4AWJB 4U2MA 1FVFA 2PQNA 2P1PA 2NXPA 5AYWD 1FVHA 4RG9A 3R7RA 3B13A 1JWFA 5DAFA 3RRNB 1OWLA 3CVYA 3FU6A 3ZGQA 4APOA 4HOTA 2X3MA 1H6KA 3LNMB 2VJ8A 4ILIA 4JHJA 2V0PA 5LCWJ 3KVTA 4C0MA 3CHOA 4BTAA 4I2WA 1Z3YA 2PZIA 2OV8A 2E2EA 2E31B 5KCMA 2V5FA 3ZFWA 3JYSA 1HG5A 2NZ0B 2IF4A 2LO6A 5JJTA 2KC7A 5EKQD 2YNQA 3ZTDB 4RG6A 2L9BA 3GZ2A 2PPIA 1TEZA 2KM4A 2I2OA 1FQVB 3G2WA 1R29A 3LY7A 3G2SA 4I9CA 5E76A 3SHFA 2KZTB 3L08A 3CKBA 4I1AA 3TJPA 5BV0A 3M4TA 5G04C 3RRUA 4JHKA 4JHRA 4AXHA 3WXXA 3JQ0A 4W9RA 3FTYA 3IBEA 4GPKA 3EIJA 2V8SE 3SF4A 2WXMA 4GZDA 3CK7A 1EODA 3ZNGB 2J9QA 1E7VA 3ZW3A 4M3OA 4F7AA 3QB2A 3D9JA 3LEWA 3N71A 5BNWA 2WB2A 4Q69A 4OYSA 1HG2A 4XX5A 3MKQB 3FUEA 3I5PA 1MQSA 1Y6IA 2WXOA 3MKRA 2WXQA 2XGMA 3BEEA 2YQ8A 3LS8A 3OXGA 3U4TA 4I6JA 2AVPA 4GMLA 4N5CA 2X6KA 1E90A 4RSYA 4GA2A 4AP2A 2XQ0A 4A55A 5BT1A 2AXVA 1TJFA 2JLBA 1E8ZA 4KVOA 5T4YA 2CG2A 1NZNA 3CVNA 4I9EA 4DI4A 1UW4B 3CV0A 3PZDA 1NP7A 4XE0A 4W9DB 3ZRFB 3S7BA 3NZSA 2KATA 4B95B 5IBKA 4G1TA 3SBTB 4I6JC 1ELRA 3CHPA 4CDNA 5D0QD 3FUMA 3PDNA 3CVLA 4UQXA 3VLFA 5A15A 2PL2A 4BSXA 4J6IA 2VSYA 1HF8A 2FF4A 3FTZA 3RO2A 4FC8A 3IEGA 1NA0A 4GCNA 1T1DA 4F1SA 5LFAA 2XPYA 3FTXA 3EHNA 3UT4A 4BX8A 3L22A 5HI7A 2WQ6A 3PEVB 2WXPA 2FEZA 1HX8A 3M5BA 3AS8A 5ENNA 3ASDA 4CT4A 2X38A 3MV3B 3FTUA 2CFUA 3S7FA 3L54A 4JEUA 4KBQA 4DLQA 2IF5A 3C6NA 4BKSB 4AY6A 3LUTB 3M52A 3APCA 1XGWA 5JJ7A 3V7DA 3FP3A 3GYZA 4JC8A 3CQGB 4JTAB 3OHUA 3D9PA 2I9CA 3SBSA 2WXHA 1FS1B 2J08A 2V4LA 3ZYQA 4B8AA 3G2TA 1ELKA 3SZ7A 4UI9K 2L0IA 3VLDA 3CKCA 5DADA 4PH4B 4WNGA 4CXJA 1FCHA 2KCKA 3CHMA 4FADA 2P1MA 2WXLA 2YINA 2WXJA 3LVQE 2XGSA 2WMNA 3QWPA 3FY4A 1S1GA 1UJKA 4BY6A 4RVBA 1SZAA 4W9HB 3ZRCB 3ZUNB 3U66A 3D9OA 2KCLA 1R2BA 3NZUA 4FHKA 5A7DB 5BPPA 4N9F5 4AM9A 2J4DA 2WPVA 3PE3A 4GU5A 3HVEA 5FT9A 2UY1B 4LCTA 4PS7A 4XI0A 1LM8C 3HDXA 3D9MA 4NRHB 4L23A 3QAQA 3FDHA 4CT0A 4APFA 3T5XA 3AU4A 3PS6A 4NQ0A 4BKTB 4UWFA 3IKOB 4EPZA 1LF8A 3MGBA 3RIBA 4KYOB 3PNTB 4XI9A 3TXNA 2AW6A 3L6AA 3PH0C 4KXKB 4AOFA 4B0ZA 5A6RA 3L16A 2IOLA 2C2LA 1R28A 4EQFA 3RU0A 3FUJA 4UWKA 4B9KB 3FU0A 3LXUX 4CDRA 4UYIA 4I43A 4W9JB 4O6FA 3GZ1A 2PQRA 4N3AA 2C0LA 4AY5A 1HV2A 2VPKA 4KZCA 4U63A 1Z3XA 4GYWA 1H19A 4JA7A 1E7UA 3CHSA 1IYGA 5CMYA 4ZOUA 4ANXA 3B7SA 3LYAA 4J8DA 4EZLA 5BV1A 3FUDA 4L2LA 1WY6A 5J08A 2WXKA 3I4GA 4JL0A 4A1GA 3DRZA 3CVVA 4CXTA 2LSVA 1HXIA 1PC2A 3EDTB 4AEZC 5HZGC 3ESKA 4W9IB 3MV2B 4R7LA 3FH5A 5C2YA 3ASHA 3ZHEA 2BF0X 2WXIA 2YHCA 3TAXA 3ZPJA 5JJ6A 5KJLA 2CG3A 3IV0A 4G2VA 2VGYA 1E8YA 3TXMA 5G05C 4JTCB 1A17A 2VTBA 2VKPA 1H0AA 3D9IA 1OUVA 3CQCB 3UQ3A 3B84A 4BGCA 3TGOA 4YVQC 2E0IA 2MOWA 3QNKA 3HYMB 4JA9A 4U77A 3LDZA 1HS6A 4KVMA 4I6GA 3QWWA 3FULA 4JEHA 4ME2A 3QC1A 3CLJA 1H2VC 2RD0A 4LUNU 4JTDB 5EX3A 4PS8A 2GRLA 4YY8A 2XCCA 3ML9A 4CCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9E B;  1EOE A;  1QDW A;  1T1D A;  1QDV A;  3OHV A;  3HU6 A;  2NN2 A;  5H7H A;  2OVR A;  4W9H H;  3M5B A;  2MA9 C;  4UIJ A;  2I2R A;  5BXB A;  1A68 A;  2YY9 A;  5BXD A;  2OVP A;  3LBZ A;  4W9F B;  2EQX A;  2IZV C;  3ZTC B;  2FNJ C;  1LDK D;  2IF5 A;  3C6N A;  2Z8H A;  4BKS B;  2C9W C;  3LUT B;  3M52 A;  4WQO C;  3V7D A;  3L2O A;  4W9G B;  5LLI B;  4JGH C;  4JTA B;  3GA1 A;  3OHU A;  4W9L B;  1FS1 B;  3HTM A;  4AJY C;  3C6O A;  4CP3 A;  1LQB B;  5DAD A;  4U2N A;  5BO4 C;  1EOF A;  4B9K E;  1VCB B;  3I3N A;  2ASS A;  2P1M A;  4CXJ A;  3OGK A;  3OGM A;  2P1N A;  2P1Q A;  3M8V A;  4W9K B;  4AWJ B;  4U2M A;  2P1P A;  4HS2 A;  1S1G A;  4W9H B;  3C6P A;  3ZRC B;  3ZUN B;  5DAF A;  3ZKJ B;  1R2B A;  2A79 B;  2E32 B;  4N9F 5;  2IHC A;  3HQI A;  3HVE A;  4J8Z A;  1LM8 C;  3LNM B;  4APF A;  3KVT A;  4BKT B;  1NEX A;  4CRH A;  2E31 B;  4HXI A;  5H7G A;  5A6R A;  2NZ0 B;  5HYW B;  1R28 A;  1DSX A;  3OGL A;  3ZTD B;  4B9K B;  3BIM A;  4UYI A;  2PPI A;  1BUO A;  1FQV B;  1R29 A;  2R9R B;  2JZ3 C;  1FS2 B;  1HV2 A;  2VPK A;  1CS3 A;  1P22 B;  3M4T A;  3MKS A;  3DCG B;  2AST A;  4ZOU A;  4CXI A;  4W9C B;  1NN7 A;  1EOD A;  3ZNG B;  5FTA A;  2OVQ A;  4CXT A;  3DRZ A;  5HZG C;  4W9I B;  3E4U A;  4AP2 A;  4JTC B;  5JH5 B;  2VKP A;  3WSO B;  1EXB E;  4W9J B;  4W9D B;  3B84 A;  4BGC A;  3HVE B;  3ZRF B;  5EUP A;  4B95 B;  5IBK A;  4U77 A;  4I6J C;  3FKC A;  4EOZ A;  2P1O A;  5A15 A;  2Q81 A;  5BXH A;  4JTD B; 
#chains in the Genus database with same CATH topology
 1EOE A;  3CK9 A;  3HXC A;  5ENS D;  5AQ9 A;  2UWJ G;  4W9H H;  2XS1 A;  3C98 A;  5FQ7 A;  2WM9 A;  3CVU A;  2GRP B;  2VSO E;  2IZV C;  2XEN A;  5G04 J;  3CK8 A;  5D2M C;  4WQO C;  4ATG A;  3HTM A;  4GZ6 A;  2VGX A;  3QDN A;  1V55 E;  2ASS A;  3OGK A;  1N0R A;  1H2U A;  1TNB A;  2L0T B;  5H7P A;  4J8S A;  1E8X A;  1H2T C;  1KPS B;  4CRW A;  1K1B A;  4C0E A;  3CSF A;  4ANV A;  2ZIS A;  2JEK A;  5B1B E;  2MHK A;  2M63 A;  3B7U X;  4GZC A;  2CHZ A;  4L1B A;  2IOS A;  2BKK B;  3EUV A;  3VTX A;  2GRR B;  1GW6 A;  4PUC A;  3VLE A;  2H6I A;  4E85 A;  2AST A;  2KXP C;  4U8V D;  3LCA A;  3KEA A;  5BW8 C;  1Y8M A;  3FTS A;  1OWN A;  4KMO A;  4JB8 P;  2IO3 C;  4JVS A;  2OVB A;  3UM3 A;  1TJC A;  3DSV A;  5BUZ A;  1ELW A;  3FWV A;  3V31 A;  3WSO B;  4G8K A;  4X8Q A;  4HQD A;  5T8I A;  5BV0 A;  4MRU A;  3J5Q B;  3ASG A;  4XZ4 A;  3U64 A;  3FUI A;  5BXH A;  5LCW C;  1EDU A;  3DRY A;  4HB5 A;  4GCO A;  4HFG A;  4ACL A;  1N9A A;  2VGE A;  3G2V A;  1K1A A;  4WWO A;  3ZRH A;  2OVR A;  1IHG A;  5ENR D;  4DRX E;  1D8E A;  4CGW A;  1Z5S C;  3DPD A;  2VQ2 A;  3EIQ C;  4UWH A;  4LER A;  5FIO A;  5LLI B;  4W9G B;  3QKY A;  1S63 A;  2KCV A;  1QZ2 A;  1UN9 A;  4GZ3 A;  4GYY A;  4AVX A;  3PEU B;  4IRU A;  3FTV A;  3HG0 D;  3I3N A;  2RFM A;  5HRY A;  5LOZ A;  4DK5 A;  4M7C A;  4GTO A;  3UKR G;  1YA0 A;  5CBN A;  3ZKJ B;  3FU3 A;  1JPL A;  3QK0 A;  5KJN A;  3HQI A;  3FUH A;  5DBK A;  2B0O E;  2I1J A;  3L9T A;  4U96 D;  3UIP C;  3SFY A;  1MX2 A;  4PS3 A;  1DSX A;  5E75 A;  2R2L A;  2R9R B;  1YMP A;  4FJY A;  4HOU A;  3ZU7 B;  4AIF A;  2LAI A;  4C9B B;  1P22 B;  2NSZ A;  2EIL E;  4WUY A;  2R59 A;  1KT0 A;  3TWQ A;  3AJI A;  4FU3 A;  4ILG A;  3RJV A;  3MZL B;  2J8S D;  2IQC A;  3NOC D;  2J49 A;  3HVE B;  5FJY A;  3UM1 A;  1N4R A;  4I17 A;  4EOZ A;  2X6F A;  5KJM A;  4B93 B;  1SQM A;  4BTB A;  3V2X A;  3D9L A;  4LNB A;  2DZN A;  3SI5 A;  4I1O B;  3DBS A;  5FZR A;  1SW6 A;  2R02 A;  3QAR A;  3DPY A;  2AJA A;  2EQX A;  3ZTC B;  4DX1 A;  2XZT G;  3EU9 A;  4YND A;  5FWQ A;  4U07 A;  3JXJ A;  4AJY C;  4ZHB A;  2UY1 A;  5JA4 D;  2QZA A;  3KAE A;  2IU1 A;  3MX3 A;  2VTB B;  3DSS A;  3TG4 A;  1TN6 A;  1FVF A;  3B13 A;  5DAF A;  3FU6 A;  3ZGQ A;  4JHJ A;  5LCW J;  3KVT A;  2OV8 A;  3D9H A;  1HG5 A;  1LD7 A;  1MJ0 A;  2KC7 A;  3ZTD B;  2L9B A;  2KM4 A;  1FQV B;  1R29 A;  3G2S A;  3TWX A;  3L08 A;  3CKB A;  1OXJ A;  3M4T A;  2LXL A;  4BER A;  1E7V A;  3ZW3 A;  4M3O A;  2PNN A;  1HG2 A;  4XX5 A;  1MQS A;  2WXO A;  2DWZ A;  2XGM A;  3BEE A;  3LS8 A;  4I6J A;  4GML A;  2X6K A;  4GA2 A;  1TJF A;  4KVO A;  4I9E A;  1UW4 B;  3PZD A;  4XE0 A;  3NZS A;  4B95 B;  1ELR A;  3ZKJ A;  3PDN A;  3C72 A;  2PL2 A;  1OCZ E;  5EIL A;  3PZ4 A;  5EN5 D;  1SA4 A;  3UT4 A;  5HI7 A;  2WQ6 A;  2WXP A;  5ENN A;  2X38 A;  5AQ7 A;  4K5C A;  4JEU A;  4KBQ A;  4DLQ A;  2IEJ A;  4AY6 A;  4DUI A;  2RFA A;  4F1P A;  3LUT B;  5JMN D;  3FP3 A;  4JTA B;  2WXH A;  2F8Y A;  1FS1 B;  1ELK A;  3SZ7 A;  5DAD A;  1Q2Z A;  4WNG A;  1FCH A;  3ASN E;  3CHM A;  4FAD A;  2P1M A;  2QC9 A;  1UJK A;  3Q78 A;  1JCS A;  1SZA A;  4HBD A;  4RVB A;  2WPV A;  3PE3 A;  2H6G A;  3HVE A;  4GU5 A;  4LCT A;  3HDX A;  4APF A;  3AU4 A;  3PS6 A;  4BKT B;  1LF8 A;  5A6R A;  4YDE A;  3FUJ A;  3LXU X;  4LG6 A;  4DX2 A;  1LTX A;  4AY5 A;  1H19 A;  3AG1 E;  3ZUV B;  3DSW A;  5BV1 A;  2WXK A;  3DRZ A;  1TNO A;  4W9I B;  4G8L A;  4R7L A;  2WXI A;  3TAX A;  3IV0 A;  5CRU A;  3DEP A;  2VKP A;  2VTB A;  2Y1L E;  3UQ3 A;  4K5B A;  4RLY A;  4BGC A;  3DRA A;  4QQI A;  3FUL A;  1H2V C;  4LNG A;  1O1T A;  2XCC A;  3ML9 A;  4CCA A;  4CDR A;  3AS4 A;  4TXR A;  3UIN C;  4A63 B;  4EZJ A;  1TNZ A;  2CHX A;  1A68 A;  3OAW A;  2YY9 A;  1N11 A;  1U3D A;  2FNJ C;  2ETC A;  2A4Z A;  4HVB A;  4XKC A;  4G11 A;  5B3S E;  4W9L B;  1Z6T A;  2XRZ A;  5CCM A;  1N52 A;  5KJK A;  2CFZ A;  4DX7 D;  5DIZ A;  3VTY A;  4QFV A;  3AU5 A;  1QQE A;  1HE8 A;  5EX0 A;  4W9K B;  4J0U A;  4N3B A;  2VSX E;  3ENE A;  2E32 B;  4TRQ A;  4JXT A;  4G24 A;  3SY2 A;  4EHM A;  4TV3 A;  1BI7 B;  4U8Y D;  3KS2 A;  5H7G A;  4FJZ A;  3UI2 A;  3LVR E;  4FP7 A;  4HI9 A;  3PUK A;  4UQY A;  2RG8 A;  1MX4 A;  1S64 A;  1MYO A;  4Y6C A;  2HE0 A;  1N0Q A;  1NL4 A;  1JWG A;  1IQU A;  4LNU D;  5FTA A;  2VYI A;  3FHE A;  1QNF A;  2AXU A;  4UUC A;  3RSE G;  4H7Y A;  1BU9 A;  4GPM A;  4CEM A;  5M72 A;  2HO1 A;  3KSQ A;  5J90 A;  2IJG X;  2WXR A;  4UQZ A;  2KBX A;  3UX4 A;  4FUL A;  4EBA G;  2R5S A;  3CHR A;  4JW1 A;  4WNF A;  3B7T A;  4TXP A;  3DST A;  2P1O A;  2OEW A;  2WXG A;  2EIM E;  3FH7 A;  4FLB A;  3EHM A;  4ACK A;  4AJW A;  2I6H A;  2GRN B;  4UIJ A;  3EU5 A;  2WQ7 A;  5BXD A;  3LBZ A;  2F8X K;  1LDK D;  3I4R B;  3FUF A;  4K5A B;  2P9P G;  3KEZ A;  4XIF A;  4ILH B;  2DVW A;  3L2O A;  4LSZ E;  3ML8 A;  3SGH A;  3SD5 A;  1O1S A;  4HLE A;  3DSU A;  4Y6W A;  1OWM A;  3J5P A;  2A5E A;  4A3V A;  4HS2 A;  5ENO D;  1O5M A;  3ZXS A;  4GA1 A;  3JCK C;  3L17 A;  3W9F A;  1AP7 A;  2DCP A;  3ONL A;  3HXF A;  4UI9 J;  4AV7 A;  4BT8 A;  3QJZ A;  2XHE A;  3BIM A;  4UWL A;  5ENQ D;  5B1A E;  4GTV A;  4GZ5 A;  1FS2 B;  1CS3 A;  2HM8 A;  2OND A;  5CEA A;  3MKS A;  2P9U G;  2FO7 A;  4XKB A;  2AXZ A;  1ZU2 A;  3Q73 A;  2XGO A;  3LJN A;  4G23 A;  4F3V A;  3RO3 A;  4U0U A;  1N95 A;  3UT8 A;  1HZ4 A;  4BWR A;  1RW2 A;  5EUP A;  2LXM A;  4HI8 A;  5A6C A;  5ANR A;  1PAQ A;  1TN8 A;  3CVP A;  3ZVV A;  4HRN A;  3UM0 A;  3NF1 A;  4W9E B;  5EYP F;  4PDX A;  3JUE A;  1QDV A;  1BD8 A;  2C0M A;  3HU6 A;  3S7D A;  4MBG A;  3CVQ A;  4D10 C;  3ASO E;  1TNU A;  5CEC B;  2Y3A A;  5BXB A;  2J07 A;  3AG2 E;  4W9F B;  4N39 A;  4ZGC A;  2Z8H A;  2C9W C;  4HOS A;  2P9L G;  3D9N A;  1ZBP A;  5FIN A;  2WVI A;  2ETB A;  1PY1 A;  3ZHE B;  3BG0 B;  3FTW A;  4U2N A;  3TWW A;  2QYU A;  1EOF A;  2Y69 E;  4BET A;  2DYR E;  2GRQ B;  3UM2 A;  3ZYK A;  4KZ0 A;  4Q96 A;  4U2M A;  2P1P A;  1FVH A;  4RG9 A;  1OWL A;  1FT2 A;  2X3M A;  1H6K A;  3LNM B;  1WDY A;  1Z3Y A;  2PZI A;  1QYM A;  1MZC A;  2E2E A;  1IKN D;  5KCM A;  3ZFW A;  2ZGG A;  4Z68 A;  2LUH A;  5ENT D;  4U7E B;  4RG6 A;  3GZ2 A;  1TEZ A;  2I2O A;  2P9N G;  4I9C A;  2KZT B;  3TJP A;  4JHK A;  4BEP A;  3NOG D;  3FTY A;  3EIJ A;  2V8S E;  2MYO A;  3SF4 A;  1EOD A;  3ZNG B;  4F7A A;  3QB2 A;  3D9J A;  3N71 A;  3MKQ B;  3FUE A;  1Y6I A;  2H6H A;  3HRA A;  2YQ8 A;  3OXG A;  4A55 A;  3TWS A;  2AXV A;  1E8Z A;  2CG2 A;  1OCC E;  4W9D B;  4DI4 A;  3CV0 A;  1NP7 A;  3S7B A;  2KAT A;  3T9K A;  1NI1 A;  3FTZ A;  3RO2 A;  3IEG A;  1T1D A;  5LFA A;  4BX8 A;  2FEZ A;  3AS8 A;  3ASD A;  4TUM A;  4CT4 A;  4HRL A;  2CFU A;  3L54 A;  2IF5 A;  4BKS B;  3DXK G;  5JJ7 A;  3GYZ A;  2V5Q C;  2J08 A;  3G2T A;  4BSZ B;  3CKC A;  3NBN B;  4PH4 B;  2WXJ A;  2WMN A;  4BY6 A;  4W9H B;  3ZRC B;  3ZUN B;  1D8D A;  1R2B A;  5BPP A;  1N4P A;  4N9F 5;  2J4D A;  4XI0 A;  2BKG A;  5ENP D;  4CT0 A;  3T5X A;  4NQ0 A;  3IKO B;  2Y0B G;  3TXN A;  4XI9 A;  2XEH A;  4B0Z A;  2AW6 A;  3PH0 C;  1OY3 D;  2IOL A;  4B9K B;  3FU0 A;  4UYI A;  2XS8 A;  2F37 A;  2C0L A;  2VPK A;  4KZC A;  4U63 A;  3WG7 E;  2IY0 C;  2NYJ A;  1IYG A;  4JA7 A;  3CHS A;  5CMY A;  4ANX A;  4J8D A;  4EZL A;  3FUD A;  3ZXP A;  3I4G A;  4JL0 A;  4A1G A;  3CVV A;  4AEZ C;  3ESK A;  3MV2 B;  5C2Y A;  3ZHE A;  3ASH A;  3ZPJ A;  5KJL A;  2CG3 A;  4G2V A;  3HXD A;  1E8Y A;  5G05 C;  3D9I A;  1OUV A;  4YVQ C;  4GMR A;  3HYM B;  3QC1 A;  3CLJ A;  4O1P A;  2P9I G;  4DLO A;  3ISM C;  4FHJ A;  1S70 B;  5H7H A;  4JPS A;  3ULE G;  4H7X A;  4BX9 A;  3Q49 B;  1OWP A;  1WG0 A;  3ULQ A;  3TL5 A;  3F6Q A;  3DSX A;  1IXV A;  4FLH A;  2XEV A;  1WAO 1;  2X6J A;  5FQ6 A;  4U8H A;  1DVP A;  2IFU A;  3KD7 A;  4BT9 A;  3PRZ A;  3RKV A;  4CP3 A;  2J4B A;  3ZNG A;  3E32 A;  2Q7F A;  2ZXW E;  1LQB B;  5BO4 C;  4N2Q A;  1BLX B;  2JAB A;  3R7Q A;  1HO8 A;  4OVU A;  3MKQ A;  2BTD A;  3C3Q A;  1S0P A;  2HR2 A;  4YDW A;  1FT1 A;  4G26 A;  5C1D A;  1G3N B;  3D9K A;  3V30 A;  4Q94 A;  5JHB A;  1HU3 A;  4GAA A;  4HXI A;  4BES A;  1XNF A;  2QY7 A;  4K0R A;  4EZK A;  5KNH D;  3IHY A;  4IYP A;  4IN3 B;  2QYJ A;  4GMJ A;  5JHA A;  4JD2 G;  1KT1 A;  3ZYM A;  2CHW A;  3CIA A;  3E4U A;  3CR3 A;  3FU5 A;  5LP0 A;  4HOR A;  3W9G A;  3IHV A;  5AN8 A;  3UPV A;  5D66 A;  2J09 A;  5AQB A;  3CST A;  1ZB1 A;  4A3T A;  3AS5 A;  4G25 A;  4EBA A;  3URZ A;  2P58 C;  4F6R D;  1HH8 A;  3UT7 A;  3S2A A;  1OCR E;  3MEK A;  4I2Z A;  4P29 A;  2WMO A;  3FUK A;  3SNX A;  4OAV B;  3O48 A;  1SZ9 A;  2Y4U A;  4NAC A;  5LX8 A;  3K9I A;  3EHQ A;  3Q9U C;  4UI9 C;  4ANU A;  3OXL A;  1P5Q A;  3MCX A;  3UUX A;  5ARG A;  2I1K A;  3FEX A;  3Q15 A;  2LAH A;  5G05 J;  3UTM A;  4UWG A;  1INZ A;  4YDY A;  3IXE A;  2L6B A;  4GA0 A;  1JUQ A;  4N2S A;  1B89 A;  2VGX B;  3UIO C;  1NEX A;  1N54 A;  3AG4 E;  3NQP A;  5T3R A;  3U9W A;  4U0Z A;  3OGL A;  3ABL E;  5AEN A;  3BU8 A;  2R17 C;  2JZ3 C;  4URK A;  3V79 K;  5AJL A;  4DX5 D;  4HRM B;  4ABN A;  3OTN A;  3GW4 A;  1NN7 A;  2FI7 A;  4WND A;  5CCL A;  1VDY A;  2MRI A;  2Y4T A;  2BUG A;  5CHE E;  3B7R L;  3HXE A;  1EXB E;  5KNG A;  3R9M A;  5FZQ A;  3ZN3 A;  3R9A B;  2VSN A;  1N94 A;  3UMV A;  5HQ8 A;  3LKU A;  3ZIM A;  1UN8 A;  4WAF A;  5AIJ A;  1RZ4 A;  4DPR A;  3ZYL A;  3PRE A;  3HHM A;  2I2R A;  1E8W A;  5G2N A;  2OVP A;  3G2U A;  4FA6 A;  2GGF A;  3Q47 B;  2WXN A;  3JQ1 A;  3JUI A;  3S7J A;  3D3M A;  4O60 A;  1L5J A;  3E34 A;  1JCQ A;  4B9K E;  3OGM A;  2P1N A;  2ZGD A;  2R05 A;  2PQN A;  2NXP A;  3B95 A;  1JWF A;  3CVY A;  4APO A;  1TR4 A;  4HOT A;  2VJ8 A;  2V0P A;  4C0M A;  3CHO A;  4BTA A;  4I2W A;  2LO6 A;  5EKQ D;  2PPI A;  3LY7 A;  3SHF A;  4I1A A;  3RRU A;  3WXX A;  5EYL A;  4W9R A;  3IBE A;  5BXU A;  2WXM A;  4GZD A;  3CK7 A;  2J9Q A;  3LEW A;  5BNW A;  4GTR A;  5EID A;  4OYS A;  4TXQ A;  2WXQ A;  3B7B A;  3U4T A;  1E90 A;  4RSY A;  3TWU A;  4OAU C;  2XQ0 A;  4W9J B;  2EIN E;  3CVN A;  1IHB A;  2OEV A;  2H6F A;  3SFX A;  4I6J C;  3CHP A;  4CDN A;  5D0Q D;  3FUM A;  3CVL A;  3VLF A;  1TN7 A;  4J6I A;  2VSY A;  2FF4 A;  1NA0 A;  2EIK E;  4GCN A;  4U95 D;  4F1S A;  2XPY A;  3FTX A;  3EHN A;  3L22 A;  3E30 A;  4GTS A;  3M5B A;  3BQO A;  3X2Q E;  3S7F A;  3M52 A;  1XGW A;  3V7D A;  3DXM G;  3ZYQ A;  4B8A A;  1A5E A;  4UI9 K;  4CXJ A;  2KCK A;  2WXL A;  2YIN A;  3QWP A;  3U66 A;  3D9O A;  3Q7F A;  2UY1 B;  3QAQ A;  3FDH A;  4RQI A;  3TWV A;  4EPZ A;  3PNT B;  4GTP A;  4AOF A;  4KXK B;  2C2L A;  1R28 A;  4EQF A;  1QBQ A;  4UWK A;  3RU0 A;  3HXB A;  4I43 A;  2PQR A;  4N3A A;  1HV2 A;  3NAW A;  4GTQ A;  1Z3X A;  4GYW A;  2BED A;  1E7U A;  3KSL A;  1N4S A;  1WY6 A;  4CXT A;  3EDT B;  1PC2 A;  2BF0 X;  4C48 B;  5JJ6 A;  3T8K A;  1A17 A;  3CQC B;  1JCR A;  1YCS B;  3QNK A;  4JA9 A;  2P2C P;  2DZO A;  4I6G A;  4HLL A;  2IO2 C;  2EIJ E;  2RD0 A;  2GRO B;  4PS8 A;  1TYQ G;  2GRL A;  1O1R A;  3ESL A;  1QDW A;  3OHV A;  2XPZ A;  4DI3 A;  5CBO A;  5FTP A;  2MA9 C;  3DRX A;  1OT8 A;  3Q75 A;  4CYM D;  1W3B A;  1E96 B;  4L9P A;  2FO1 E;  2F0Y A;  4N5Q A;  4JGH C;  5ARF A;  4ANW A;  2DIW A;  2OVF A;  1EPU A;  2X6I A;  4F53 A;  1VCB B;  1BPO A;  3PNL B;  5KBA A;  4MLP A;  4U04 A;  3Q5M A;  5AJD A;  4K03 A;  2LSU A;  2L6J A;  4I1M A;  3C6P A;  2A79 B;  3CGH A;  4XEI G;  3O4Z A;  3MA5 A;  4KT6 B;  2OCC E;  1MHQ A;  3Q4A B;  4DJA A;  5D0O D;  4I6E A;  5HYW B;  2V4H C;  1BUO A;  1UOH A;  3RK6 A;  3MYV A;  3UXG A;  3T8M A;  1K3Z D;  4HNA D;  2FUL A;  1EF1 C;  4EEC A;  4J8E A;  2GW1 A;  4DX6 D;  2ION A;  3QWV A;  3T5V A;  3C3O A;  4LRZ A;  4O1O A;  3V2O A;  1LD8 A;  3FFL A;  4V3I A;  3FH8 A;  4B89 A;  3MJW A;  4E6H A;  5JH5 B;  2YHE A;  3PUJ A;  1HFA A;  1DNP A;  1DCE A;  3ZEF A;  3P1U A;  5FQ8 A;  5ANL A;  5KWD A;  3FUN A;  1UJJ A;  2QFC A;  3HIZ A;  4U0S A;  1X81 A;  2ILR A;  5IY5 E;  2Q81 A;  3QOU A;  3P2B A;  3PVL A;  1NFI E;  3Q7A A;  4L7T A;  4WWP A;  4LEU A;  3DEO A;  4WNE A;  2ZU6 B;  5G55 A;  4YVO A;  2P9S G;  5AQA A;  2XRY A;  3CVW A;  5CER B;  1OWO A;  5ITZ F;  2HYZ A;  1H6O A;  2FBN A;  1KZO A;  2LNI A;  3TWR A;  1H6P A;  4BFR A;  4WWN A;  3OXF A;  3LPZ A;  2X6H A;  2PM7 A;  5EDS A;  2IHC A;  4B94 A;  4GYO A;  2NC9 A;  2A5U A;  2PM6 A;  4J8Z A;  2KZT A;  3GZS A;  1V54 E;  3EJN A;  3L13 A;  1K8K G;  4NUR A;  3BG1 B;  2DBA A;  4CRH A;  5FQ4 A;  3Q79 A;  3LY9 A;  2XPI A;  2B6C A;  4IUL A;  5A23 A;  3CVX A;  3BUA A;  5CMW A;  3CEQ A;  3DCG B;  3LY8 A;  4CXI A;  4W9C B;  4CDM A;  1SA5 A;  2OVQ A;  2DYS E;  2XEE A;  3RAU A;  1DCQ A;  4MKT A;  3SO8 A;  1IQR A;  4N3C A;  1EYH A;  4A1S A;  4B8C B;  3LJ3 A;  4JZY A;  1KLX A;  4GB9 A;  2WQH A;  4CGV A;  5EIB E;  3NB2 A;  2XCB A;  3SFZ A;  3FKC A;  2AWI A;  1X5B A;  1WM5 A;  4L2Y A;  3E33 A;  5FZS A;  2R03 A;  5HS0 A;  3TWT A;  2NN2 A;  1YYH A;  2WXF A;  3UKU G;  3ABM E;  4OVV A;  4CZ2 D;  3APF A;  3PE4 A;  3ASF A;  1UG3 A;  3CHQ A;  2OOE A;  1NA3 A;  3U3W A;  2GRM A;  4MS6 A;  3ONK A;  3RRM B;  4J8F A;  3TG5 A;  3GA1 A;  3FEY A;  4ZFH A;  3C6O A;  4J8Y A;  3PZ1 A;  3APD A;  4TUU A;  1U3C A;  4HOQ A;  2P1Q A;  3M8V A;  3DWL G;  3E4B A;  4AWJ B;  5AYW D;  3R7R A;  3RRN B;  4ILI A;  2E31 B;  2V5F A;  3JYS A;  2NZ0 B;  1D9S A;  2IF4 A;  5JJT A;  3ULY A;  2YNQ A;  5AAR A;  3G2W A;  5E76 A;  3PZ2 A;  1DC2 A;  4GTT A;  2ETA A;  5G04 C;  4JHR A;  4AXH A;  3JQ0 A;  4NIK A;  4GPK A;  3EHR A;  1U2V G;  2WB2 A;  4Q69 A;  3I5P A;  3MKR A;  4N5C A;  4AP2 A;  2AVP A;  5BT1 A;  5CED B;  2JLB A;  5T4Y A;  1NZN A;  3ZRF B;  2XZD G;  5IBK A;  4G1T A;  3SBT B;  1AWC B;  1N4Q A;  4UQX A;  5A15 A;  4BSX A;  1HF8 A;  4FC8 A;  2ZIR A;  5AAO A;  3AAA C;  3PEV B;  1HX8 A;  3L82 A;  3MV3 B;  3FTU A;  3C6N A;  4GTM A;  3JXI A;  3APC A;  3Q9N C;  4JC8 A;  3CQG B;  3OHU A;  3D9P A;  2I9C A;  3SBS A;  2V4L A;  2L0I A;  3VLD A;  3SQV A;  3LVQ E;  2XGS A;  3FY4 A;  1S1G A;  4YDO A;  1SVX A;  5HKP A;  1BI8 B;  2KCL A;  3NZU A;  4FHK A;  5A7D B;  4AM9 A;  5FT9 A;  4PS7 A;  1LM8 C;  3D9M A;  4NRH B;  4L23 A;  1OCO E;  4UWF A;  3C5R A;  3MGB A;  3RIB A;  4KYO B;  2P9K G;  3L6A A;  3L16 A;  4ATZ D;  1FPP A;  4O6F A;  3GZ1 A;  3E37 A;  3PZ3 A;  1TNY A;  1MX6 A;  4ZOU A;  3B7S A;  3LYA A;  4L2L A;  5J08 A;  4J7W A;  2LSV A;  1HXI A;  5HZG C;  3FH5 A;  3C3R A;  2YHC A;  2VGY A;  3TXM A;  4JTC B;  3ABK E;  1H0A A;  3AG3 E;  3B84 A;  3TGO A;  2E0I A;  2MOW A;  2RKK A;  4U77 A;  3LDZ A;  1HS6 A;  4KVM A;  3QWW A;  5BXO A;  4JEH A;  4ME2 A;  4LUN U;  1KZP A;  5CRV A;  5EX3 A;  4YY8 A;  4JTD B; 
#chains in the Genus database with same CATH homology
 4FHJ A;  3AS4 A;  3CK9 A;  1EOE A;  3ESL A;  1QDW A;  3OHV A;  2UWJ G;  5H7H A;  4J8Z A;  4JPS A;  2XPZ A;  4DI3 A;  4W9H H;  5FTP A;  4H7X A;  3C98 A;  4EZJ A;  4BX9 A;  5FQ7 A;  2WM9 A;  3Q49 B;  1OWP A;  2MA9 C;  2CHX A;  3DRX A;  3CVU A;  2VSO E;  1A68 A;  3OAW A;  3ULQ A;  1W3B A;  2YY9 A;  3TL5 A;  1E96 B;  1U3D A;  2IZV C;  2FNJ C;  5G04 J;  4FLH A;  3CK8 A;  2XEV A;  1WAO 1;  2X6J A;  5FQ6 A;  4U8H A;  1DVP A;  4WQO C;  2IFU A;  4ATG A;  3KD7 A;  2A4Z A;  4BT9 A;  4JGH C;  4HVB A;  4XKC A;  4G11 A;  3PRZ A;  4W9L B;  1Z6T A;  5ARF A;  3HTM A;  3RKV A;  2XRZ A;  4CP3 A;  5CCM A;  4ANW A;  1N52 A;  2DIW A;  2J4B A;  4GZ6 A;  2Q7F A;  2VGX A;  1LQB B;  5KJK A;  2CFZ A;  2OVF A;  1EPU A;  2X6I A;  3QDN A;  5DIZ A;  4F53 A;  4N2Q A;  1VCB B;  3R7Q A;  4QFV A;  3VTY A;  1BPO A;  3AU5 A;  1HO8 A;  2ASS A;  3OGK A;  1QQE A;  1HE8 A;  4OVU A;  3PNL B;  5EX0 A;  4W9K B;  3MKQ A;  4MLP A;  4U04 A;  3Q5M A;  1H2U A;  2BTD A;  4J0U A;  1S0P A;  2HR2 A;  4K03 A;  5AJD A;  2LSU A;  2L6J A;  4I1M A;  4N3B A;  3C6P A;  2L0T B;  2VSX E;  4EBA A;  3ENE A;  4J8S A;  2A79 B;  3CGH A;  5C1D A;  4G26 A;  2E32 B;  1E8X A;  1H2T C;  4TRQ A;  4JXT A;  3D9K A;  4CRW A;  4G24 A;  3O4Z A;  4Q94 A;  3MA5 A;  4KT6 B;  4C0E A;  3CSF A;  5JHB A;  5ANL A;  4ANV A;  1HU3 A;  4GAA A;  4TV3 A;  1MHQ A;  3Q4A B;  4DJA A;  4HXI A;  5D0O D;  3KS2 A;  5H7G A;  4FJZ A;  2JEK A;  4I6E A;  5HYW B;  2MHK A;  2M63 A;  3B7U X;  3LVR E;  4FP7 A;  4GZC A;  2CHZ A;  1XNF A;  4L1B A;  2IOS A;  3PUK A;  4UQY A;  1BUO A;  3RK6 A;  2RG8 A;  3MYV A;  3VTX A;  2QY7 A;  3T8M A;  4K0R A;  4Y6C A;  1GW6 A;  4EZK A;  2FUL A;  4PUC A;  1EF1 C;  3VLE A;  4E85 A;  2AST A;  3IHY A;  1JWG A;  4IYP A;  4IN3 B;  1IQU A;  3LCA A;  4GMJ A;  4J8E A;  2GW1 A;  4EEC A;  5JHA A;  5BW8 C;  2ION A;  3QWV A;  5FTA A;  1Y8M A;  3FTS A;  1OWN A;  1KT1 A;  2VYI A;  3FHE A;  1QNF A;  2AXU A;  3ZYM A;  4KMO A;  3T5V A;  2CHW A;  2OVB A;  4H7Y A;  4JVS A;  4LRZ A;  1TJC A;  3CIA A;  3E4U A;  3CR3 A;  3FU5 A;  3FFL A;  4V3I A;  4CEM A;  5LP0 A;  5BUZ A;  5M72 A;  4HOR A;  2HO1 A;  1ELW A;  3FH8 A;  3IHV A;  5J90 A;  4B89 A;  3MJW A;  3FWV A;  4E6H A;  3UPV A;  5JH5 B;  2J09 A;  3WSO B;  2YHE A;  2IJG X;  2WXR A;  1HFA A;  3PUJ A;  1DNP A;  4UQZ A;  5T8I A;  3UX4 A;  4FUL A;  3ZEF A;  3P1U A;  3CST A;  4EBA G;  4A3T A;  5FQ8 A;  2R5S A;  3AS5 A;  3CHR A;  4JW1 A;  3B7T A;  4G25 A;  4MRU A;  3FUN A;  4WNF A;  3ASG A;  1UJJ A;  2P58 C;  2QFC A;  3HIZ A;  3URZ A;  2P1O A;  4XZ4 A;  4U0S A;  3U64 A;  1HH8 A;  2ILR A;  3FUI A;  2Q81 A;  5BXH A;  5LCW C;  3QOU A;  1EDU A;  3P2B A;  3PVL A;  3DRY A;  4GCO A;  4HFG A;  3UT7 A;  4ACL A;  3G2V A;  2WXG A;  4WWO A;  3S2A A;  4L7T A;  3FH7 A;  3ZRH A;  4WWP A;  3MEK A;  2OVR A;  4I2Z A;  4LEU A;  4WNE A;  4FLB A;  3EHM A;  2ZU6 B;  4ACK A;  4P29 A;  2WMO A;  1IHG A;  4AJW A;  2I6H A;  5G55 A;  4UIJ A;  4YVO A;  3FUK A;  3SNX A;  2XRY A;  2WQ7 A;  3O48 A;  3CVW A;  1SZ9 A;  2Y4U A;  5BXD A;  4CGW A;  3LBZ A;  3DPD A;  2VQ2 A;  4NAC A;  3EIQ C;  3I4R B;  5LX8 A;  3K9I A;  3FUF A;  4UWH A;  1LDK D;  4LER A;  1OWO A;  5BO4 C;  3KEZ A;  4XIF A;  4ILH B;  4DLO A;  3L2O A;  4W9G B;  5LLI B;  3QKY A;  4UI9 C;  2KCV A;  1QZ2 A;  2HYZ A;  4ANU A;  2FBN A;  3ML8 A;  3OXL A;  3SGH A;  1UN9 A;  4GZ3 A;  4GYY A;  1P5Q A;  3SD5 A;  3MCX A;  4AVX A;  2LNI A;  3PEU B;  3UUX A;  4HLE A;  4IRU A;  3FTV A;  5ARG A;  3I3N A;  2I1K A;  3FEX A;  4BFR A;  3Q15 A;  2LAH A;  4WWN A;  5LOZ A;  4Y6W A;  4DK5 A;  1OWM A;  3OXF A;  5G05 J;  3LPZ A;  4A3V A;  2X6H A;  1YA0 A;  2PM7 A;  4HS2 A;  4UWG A;  1INZ A;  3ZXS A;  5EDS A;  4GA0 A;  1JUQ A;  3ZKJ B;  3FU3 A;  4GA1 A;  1JPL A;  4N2S A;  3QK0 A;  3JCK C;  5KJN A;  3L17 A;  2IHC A;  3HQI A;  4B94 A;  4GYO A;  2NC9 A;  2A5U A;  2DCP A;  2PM6 A;  2KZT A;  1B89 A;  3FUH A;  3GZS A;  3ONL A;  5DBK A;  4UI9 J;  4AV7 A;  4BT8 A;  3EJN A;  3L13 A;  2VGX B;  4NUR A;  2I1J A;  3BG1 B;  1NEX A;  3QJZ A;  2DBA A;  1N54 A;  4CRH A;  5FQ4 A;  2XHE A;  3LY9 A;  3NQP A;  5T3R A;  2XPI A;  3U9W A;  4U0Z A;  4PS3 A;  1DSX A;  3OGL A;  4IUL A;  3BIM A;  5AEN A;  4UWL A;  5A23 A;  5E75 A;  2R9R B;  2R17 C;  4FJY A;  3CVX A;  2JZ3 C;  4URK A;  4GZ5 A;  4HOU A;  4AIF A;  1FS2 B;  2LAI A;  4C9B B;  5CMW A;  1CS3 A;  1P22 B;  2NSZ A;  2HM8 A;  3CEQ A;  2OND A;  3MKS A;  5AJL A;  4WUY A;  4ABN A;  3OTN A;  3DCG B;  2FO7 A;  3LY8 A;  4XKB A;  4CXI A;  2R59 A;  4W9C B;  2AXZ A;  4CDM A;  1KT0 A;  1ZU2 A;  3GW4 A;  1NN7 A;  4FU3 A;  2OVQ A;  2FI7 A;  4ILG A;  2XGO A;  3RJV A;  3MZL B;  4WND A;  5CCL A;  1VDY A;  4MKT A;  2MRI A;  4G23 A;  1IQR A;  4N3C A;  2Y4T A;  4F3V A;  1EYH A;  2BUG A;  4A1S A;  3RO3 A;  5CHE E;  2IQC A;  4U0U A;  4B8C B;  3B7R L;  3UT8 A;  3LJ3 A;  1HZ4 A;  1KLX A;  4GB9 A;  4JZY A;  2WQH A;  1EXB E;  4CGV A;  2J49 A;  3HVE B;  4BWR A;  5EUP A;  5FJY A;  2XCB A;  5A6C A;  5ANR A;  3SFZ A;  1PAQ A;  3CVP A;  4I17 A;  5FZQ A;  3FKC A;  3ZN3 A;  4EOZ A;  2AWI A;  2X6F A;  1X5B A;  3R9A B;  3ZVV A;  1WM5 A;  2VSN A;  5KJM A;  1SQM A;  4L2Y A;  3UMV A;  4BTB A;  3LKU A;  3NF1 A;  3D9L A;  5HQ8 A;  3ZIM A;  4W9E B;  1UN8 A;  4PDX A;  3SI5 A;  4I1O B;  5FZS A;  1QDV A;  2C0M A;  3HU6 A;  2NN2 A;  4WAF A;  5AIJ A;  4DPR A;  2WXF A;  3S7D A;  3ZYL A;  3DBS A;  3CVQ A;  5FZR A;  4D10 C;  3PRE A;  3HHM A;  2Y3A A;  4OVV A;  2I2R A;  3QAR A;  5BXB A;  3APF A;  3PE4 A;  1E8W A;  5G2N A;  3ASF A;  2OVP A;  2J07 A;  3G2U A;  4FA6 A;  2EQX A;  1UG3 A;  4N39 A;  4W9F B;  3CHQ A;  2GGF A;  3ZTC B;  4ZGC A;  2OOE A;  3Q47 B;  2WXN A;  1NA3 A;  2C9W C;  3JQ1 A;  4YND A;  3U3W A;  4HOS A;  2Z8H A;  3D9N A;  2GRM A;  1ZBP A;  3ONK A;  4MS6 A;  3RRM B;  2WVI A;  3JUI A;  4J8F A;  5FWQ A;  4U07 A;  3TG5 A;  3FEY A;  3GA1 A;  3S7J A;  3D3M A;  1PY1 A;  1L5J A;  3ZHE B;  4AJY C;  2UY1 A;  3C6O A;  3KAE A;  3BG0 B;  3FTW A;  2IU1 A;  4U2N A;  3APD A;  3MX3 A;  1EOF A;  4B9K E;  4TUU A;  2VTB B;  1U3C A;  3OGM A;  4HOQ A;  2P1Q A;  2P1N A;  3E4B A;  3M8V A;  3ZYK A;  3TG4 A;  4KZ0 A;  4Q96 A;  4AWJ B;  4U2M A;  1FVF A;  2PQN A;  2P1P A;  2NXP A;  5AYW D;  1FVH A;  4RG9 A;  3R7R A;  3B13 A;  1JWF A;  5DAF A;  3RRN B;  1OWL A;  3CVY A;  3FU6 A;  3ZGQ A;  4APO A;  4HOT A;  2X3M A;  1H6K A;  3LNM B;  2VJ8 A;  4ILI A;  4JHJ A;  2V0P A;  5LCW J;  3KVT A;  4C0M A;  3CHO A;  4BTA A;  4I2W A;  1Z3Y A;  2PZI A;  2OV8 A;  2E2E A;  2E31 B;  5KCM A;  2V5F A;  3ZFW A;  3JYS A;  1HG5 A;  2NZ0 B;  2IF4 A;  2LO6 A;  5JJT A;  2KC7 A;  5EKQ D;  2YNQ A;  3ZTD B;  4RG6 A;  2L9B A;  3GZ2 A;  2PPI A;  1TEZ A;  2KM4 A;  2I2O A;  1FQV B;  3G2W A;  1R29 A;  3LY7 A;  3G2S A;  4I9C A;  5E76 A;  3SHF A;  2KZT B;  3L08 A;  3CKB A;  4I1A A;  3TJP A;  5BV0 A;  3M4T A;  5G04 C;  3RRU A;  4JHK A;  4JHR A;  4AXH A;  3WXX A;  3JQ0 A;  4W9R A;  3FTY A;  3IBE A;  4GPK A;  3EIJ A;  2V8S E;  3SF4 A;  2WXM A;  4GZD A;  3CK7 A;  1EOD A;  3ZNG B;  2J9Q A;  1E7V A;  3ZW3 A;  4M3O A;  4F7A A;  3QB2 A;  3D9J A;  3LEW A;  3N71 A;  5BNW A;  2WB2 A;  4Q69 A;  4OYS A;  1HG2 A;  4XX5 A;  3MKQ B;  3FUE A;  3I5P A;  1MQS A;  1Y6I A;  2WXO A;  3MKR A;  2WXQ A;  2XGM A;  3BEE A;  2YQ8 A;  3LS8 A;  3OXG A;  3U4T A;  4I6J A;  2AVP A;  4GML A;  4N5C A;  2X6K A;  1E90 A;  4RSY A;  4GA2 A;  4AP2 A;  2XQ0 A;  4A55 A;  5BT1 A;  2AXV A;  1TJF A;  2JLB A;  1E8Z A;  4KVO A;  5T4Y A;  2CG2 A;  1NZN A;  3CVN A;  4I9E A;  4DI4 A;  1UW4 B;  3CV0 A;  3PZD A;  1NP7 A;  4XE0 A;  4W9D B;  3ZRF B;  3S7B A;  3NZS A;  2KAT A;  4B95 B;  5IBK A;  4G1T A;  3SBT B;  4I6J C;  1ELR A;  3CHP A;  4CDN A;  5D0Q D;  3FUM A;  3PDN A;  3CVL A;  4UQX A;  3VLF A;  5A15 A;  2PL2 A;  4BSX A;  4J6I A;  2VSY A;  1HF8 A;  2FF4 A;  3FTZ A;  3RO2 A;  4FC8 A;  3IEG A;  1NA0 A;  4GCN A;  1T1D A;  4F1S A;  5LFA A;  2XPY A;  3FTX A;  3EHN A;  3UT4 A;  4BX8 A;  3L22 A;  5HI7 A;  2WQ6 A;  3PEV B;  2WXP A;  2FEZ A;  1HX8 A;  3M5B A;  3AS8 A;  5ENN A;  3ASD A;  4CT4 A;  2X38 A;  3MV3 B;  3FTU A;  2CFU A;  3S7F A;  3L54 A;  4JEU A;  4KBQ A;  4DLQ A;  2IF5 A;  3C6N A;  4BKS B;  4AY6 A;  3LUT B;  3M52 A;  3APC A;  1XGW A;  5JJ7 A;  3V7D A;  3FP3 A;  3GYZ A;  4JC8 A;  3CQG B;  4JTA B;  3OHU A;  3D9P A;  2I9C A;  3SBS A;  2WXH A;  1FS1 B;  2J08 A;  2V4L A;  3ZYQ A;  4B8A A;  3G2T A;  1ELK A;  3SZ7 A;  4UI9 K;  2L0I A;  3VLD A;  3CKC A;  5DAD A;  4PH4 B;  4WNG A;  4CXJ A;  1FCH A;  2KCK A;  3CHM A;  4FAD A;  2P1M A;  2WXL A;  2YIN A;  2WXJ A;  3LVQ E;  2XGS A;  2WMN A;  3QWP A;  3FY4 A;  1S1G A;  1UJK A;  4BY6 A;  4RVB A;  1SZA A;  4W9H B;  3ZRC B;  3ZUN B;  3U66 A;  3D9O A;  2KCL A;  1R2B A;  3NZU A;  4FHK A;  5A7D B;  5BPP A;  4N9F 5;  4AM9 A;  2J4D A;  2WPV A;  3PE3 A;  4GU5 A;  3HVE A;  5FT9 A;  2UY1 B;  4LCT A;  4PS7 A;  4XI0 A;  1LM8 C;  3HDX A;  3D9M A;  4NRH B;  4L23 A;  3QAQ A;  3FDH A;  4CT0 A;  4APF A;  3T5X A;  3AU4 A;  3PS6 A;  4NQ0 A;  4BKT B;  4UWF A;  3IKO B;  4EPZ A;  1LF8 A;  3MGB A;  3RIB A;  4KYO B;  3PNT B;  4XI9 A;  3TXN A;  2AW6 A;  3L6A A;  3PH0 C;  4KXK B;  4AOF A;  4B0Z A;  5A6R A;  3L16 A;  2IOL A;  2C2L A;  1R28 A;  4EQF A;  3RU0 A;  3FUJ A;  4UWK A;  4B9K B;  3FU0 A;  3LXU X;  4CDR A;  4UYI A;  4I43 A;  4W9J B;  4O6F A;  3GZ1 A;  2PQR A;  4N3A A;  2C0L A;  4AY5 A;  1HV2 A;  2VPK A;  4KZC A;  4U63 A;  1Z3X A;  4GYW A;  1H19 A;  4JA7 A;  1E7U A;  3CHS A;  1IYG A;  5CMY A;  4ZOU A;  4ANX A;  3B7S A;  3LYA A;  4J8D A;  4EZL A;  5BV1 A;  3FUD A;  4L2L A;  1WY6 A;  5J08 A;  2WXK A;  3I4G A;  4JL0 A;  4A1G A;  3DRZ A;  3CVV A;  4CXT A;  2LSV A;  1HXI A;  1PC2 A;  3EDT B;  4AEZ C;  5HZG C;  3ESK A;  4W9I B;  3MV2 B;  4R7L A;  3FH5 A;  5C2Y A;  3ASH A;  3ZHE A;  2BF0 X;  2WXI A;  2YHC A;  3TAX A;  3ZPJ A;  5JJ6 A;  5KJL A;  2CG3 A;  3IV0 A;  4G2V A;  2VGY A;  1E8Y A;  3TXM A;  5G05 C;  4JTC B;  1A17 A;  2VTB A;  2VKP A;  1H0A A;  3D9I A;  1OUV A;  3CQC B;  3UQ3 A;  3B84 A;  4BGC A;  3TGO A;  4YVQ C;  2E0I A;  2MOW A;  3QNK A;  3HYM B;  4JA9 A;  4U77 A;  3LDZ A;  1HS6 A;  4KVM A;  4I6G A;  3QWW A;  3FUL A;  4JEH A;  4ME2 A;  3QC1 A;  3CLJ A;  1H2V C;  2RD0 A;  4LUN U;  4JTD B;  5EX3 A;  4PS8 A;  2GRL A;  4YY8 A;  2XCC A;  3ML9 A;  4CCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...