3HVEB

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
195
Chain Sequence
DPQHAARLLRALSSFRERFCDAHLVEPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLEDIQDVVQAADLLLLTDLKTLCCEFLEGCIANCIGIRDFALHYCLHVHYLATEYLETHFRDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVHMKDVMSALWVSGSSYLREQMLNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, ligase
molecule keywords Gigaxonin
total genus 44
structure length 195
sequence length 231
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00651 BTB BTB/POZ domain
B PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveB02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveB01
3HU6A 4JGHC 4JTCB 5H7GA 2IF5A 3HVEA 2I2RA 3OHVA 4UYIA 4CXTA 4CP3A 1DSXA 3OGMA 1QDVA 3M4TA 3M52A 4ZOUA 3FKCA 4AP2A 1R2BA 4J8ZA 1VCBB 3ZNGB 4AJYC 5DAFA 4JTDB 1CS3A 1NN7A 3OHUA 1LQBB 2YY9A 4I6JC 3E4UA 5JH5B 2OVRA 4B95B 4BKSB 4JTAB 4N9F5 4HS2A 4B9KB 3MKSA 5EUPA 3ZTCB 4W9DB 5H7HA 2Z8HA 5BXBA 2IHCA 2R9RB 3C6OA 4W9CB 3LNMB 3HQIA 3GA1A 2A79B 3LUTB 1P22B 5BXDA 4W9IB 2IZVC 3OGLA 2VKPA 4CXJA 1EOFA 2JZ3C 2P1PA 5IBKA 2EQXA 5LLIB 3C6PA 5BO4C 3ZKJB 1BUOA 2NN2A 4APFA 1NEXA 3B84A 4U2NA 3C6NA 3HTMA 3I3NA 5A6RA 5FTAA 4W9EB 5DADA 5BXHA 1EOEA 4U77A 1QDWA 4W9GB 4WQOC 4EOZA 1EXBE 3DRZA 1R28A 1LDKD 4W9JB 1FS1B 3ZTDB 1EODA 1FQVB 4BGCA 2P1NA 3M8VA 4W9HB 2ASTA 1A68A 2P1MA 4U2MA 4W9FB 5HYWB 2E31B 2C9WC 2P1QA 3V7DA 4W9LB 4HXIA 3ZRFB 4AWJB 1LM8C 2P1OA 2MA9C 1HV2A 1S1GA 2FNJC 2PPIA 3BIMA 3WSOB 3ZRCB 2E32B 3DCGB 5A15A 2OVPA 2OVQA 2ASSA 4W9KB 3L2OA 2VPKA 4BKTB 4CRHA 2Q81A 3LBZA 4UIJA 3OGKA 3M5BA 3ZUNB 5HZGC 4W9HH 3HVEB 1R29A 1T1DA 1FS2B 2NZ0B 4CXIA 3KVTA 4B9KE
chains in the Genus database with same CATH superfamily
3CEQA 2P9UG 4G24A 3FUJA 3ZPJA 2XS8A 3ULEG 4N5QA 1FCHA 1SW6A 1R2BA 3FUIA 4U95D 3CVXA 3SGHA 3SZ7A 4I6JC 1IQRA 4C0EA 3PZ4A 4JPSA 2P9PG 3FUEA 2P9LG 2KCKA 3SD5A 3OTNA 4F53A 4UQXA 4UI9J 2HR2A 4DLOA 3E37A 1P22B 2XPIA 1YA0A 4AOFA 1IHBA 4FLBA 4RVBA 5IBKA 2EQXA 2OEVA 3RJVA 2WMOA 2GROB 2H6FA 4APFA 4HRNA 3QC1A 4DPRA 4LERA 3Q78A 3CHQA 5D0OD 2BEDA 2JEKA 5BXHA 3FH7A 3LY8A 4EECA 2ZIRA 4N2SA 3NF1A 4BY6A 2QC9A 4EPZA 3RIBA 3PEUB 3EIQC 3ML9A 2X6HA 3FUDA 1KZOA 1MQSA 1HV2A 3AU4A 1OUVA 3RKVA 1O5MA 5ENOD 4U8YD 3GZ1A 5AQAA 4G11A 3C72A 3V30A 3QB2A 1H2TC 1DNPA 3HVEB 1V55E 3GYZA 4FJZA 4U96D 1OWLA 4GZ5A 2GRLA 3CVLA 4EBAG 4GZ3A 5JA4D 1OWNA 1H0AA 1HO8A 1OWOA 4B8AA 1MX2A 3Q4AB 4E85A 4ZOUA 4BWRA 4A63B 2JLBA 4HQDA 4O1PA 3ZEFA 5FT9A 3TWVA 4JB8P 1FVHA 3QWPA 3JCKC 3ASHA 4H7YA 2R17C 5EX0A 2ETCA 1G3NB 4C9BB 1L5JA 2Y1LE 3Q79A 4ILGA 4I1AA 3OAWA 4XX5A 3TL5A 3CVWA 3B7SA 4XIFA 3SFZA 4ACLA 4W9GB 4JA7A 2QZAA 2XCBA 1U2VG 1TN6A 2YHEA 3CR3A 4UI9C 2YHCA 2LXLA 2BUGA 4B93B 4N5CA 3ONLA 4FC8A 4YNDA 4AWJB 2DIWA 2NXPA 3Q75A 1K3ZD 2IOLA 4G2VA 3RO3A 2WXPA 4AVXA 2WXFA 4NURA 3L13A 1HE8A 3PUJA 3B95A 2Q81A 2OVFA 3LXUX 2KATA 5EYLA 4O1OA 5EYPF 3CK8A 2I1KA 3CVPA 3U3WA 3UT7A 4KT6B 4PH4B 5H7GA 3FU5A 4I17A 2CHWA 4QFVA 3FUKA 1NA0A 2XEHA 3UQ3A 4OAVB 3DRXA 5EIBE 4BEPA 2OCCE 4DX5D 3FU6A 3E4UA 5LFAA 1Z3YA 3CHSA 1IQUA 5H7HA 4UI9K 3S2AA 3LNMB 3GA1A 1IXVA 2J9QA 3OXFA 1EOFA 4GA2A 2B6CA 3ZYLA 3L22A 3LVRE 3CV0A 3UT8A 4HBDA 3LY9A 5FQ8A 3W9GA 2X6JA 3UIOC 3DWLG 4JW1A 3IBEA 1TNYA 3NQPA 2F0YA 4PS7A 3RO2A 5KNHD 5ANRA 4GA0A 3ULQA 5LCWJ 2J49A 5B1AE 2X6FA 3I4GA 1LTXA 2E31B 3AS8A 5ARGA 5KBAA 1KT0A 2VSXE 1NL4A 3T5XA 5ENSD 4CT0A 5CMWA 3ZXPA 3RRUA 4OYSA 3FTWA 2WM9A 3PE4A 4A55A 3CQCB 3DPYA 1HZ4A 1SA5A 3DEPA 3LKUA 3NB2A 2AXZA 3IHYA 3Q9NC 3O4ZA 3AAAC 4GPMA 3QAQA 4W9RA 1S0PA 4WWNA 2HO1A 4XE0A 1VDYA 4YVOA 5KCMA 4CP3A 4GCOA 2M63A 3SBTB 3FU0A 4LRZA 1OCZE 4GMRA 3C5RA 2IQCA 3FKCA 2F8XK 3C3RA 2DWZA 1CS3A 1NN7A 3ULYA 5ENTD 3DRYA 5KWDA 4H7XA 4JTAB 1YYHA 3MYVA 1JCRA 4HS2A 4B8CB 4GTOA 2WXOA 4WWOA 3V2XA 4TXRA 3K9IA 4U8HA 1BD8A 2DVWA 2DZOA 2XPZA 4GZCA 5G2NA 3BUAA 3JXJA 1H19A 1Q2ZA 4IN3B 1H2UA 3TWQA 2VSOE 1IHGA 4OAUC 3SHFA 5A6RA 4W9EB 4CRWA 2AJAA 1OCOE 3QJZA 4GTTA 3HHMA 2UWJG 3PNLB 1JWFA 4W9JB 2IEJA 3L08A 4JVSA 3ZTDB 4WUYA 2P1MA 3CIAA 1O1TA 4HOUA 3EHMA 2EIKE 2VYIA 2NYJA 2I1JA 2C2LA 5D2MC 3UINC 3HXFA 3U64A 2V4LA 1ELWA 2PPIA 5CCMA 2WXJA 4TXPA 4UQYA 2FF4A 4M3OA 3V79K 2FBNA 2EINE 3Q49B 4GZDA 3CHOA 4NIKA 3ZUNB 4NRHB 5CERB 4ILHB 1UJKA 3V31A 2OV8A 2XEVA 3KD7A 3OHVA 2NC9A 3PREA 2PM7A 5ITZF 3CVUA 4J8ZA 1IYGA 1E8XA 4JHRA 4YY8A 1LQBB 4XEIG 3TAXA 2I6HA 2F8YA 4B9KB 3ENEA 1AWCB 4F3VA 2RFAA 3FTVA 2XRYA 2LNIA 4CT4A 2Z8HA 4LNGA 5BXBA 3DXKG 3R9AB 5BXDA 5C1DA 1H6KA 2R02A 1A17A 1K1BA 3ZU7B 3PRZA 3ZKJB 3UXGA 3RAUA 3EIJA 5FQ4A 3PE3A 2AXVA 2F37A 2L0TB 4HVBA 5ANLA 1R28A 3G2WA 3M8VA 2ASTA 3FFLA 4PS3A 4CEMA 4DX6D 4AY5A 3TG4A 4JD2G 3TG5A 2X6KA 3W9FA 2XCCA 4ZHBA 3C98A 1RW2A 2I9CA 3HDXA 5AJLA 4BFRA 1S63A 4TUUA 3MJWA 3MZLB 1LD8A 4JGHC 3CLJA 4XZ4A 2MOWA 4GTVA 1V54E 1JPLA 3ZRHA 1B89A 3ISMC 1SQMA 2EIME 2R5SA 1VCBB 2OEWA 4DK5A 4HLEA 3G2VA 5JH5B 3PZ3A 3VTYA 1ELRA 1QYMA 4G23A 1NI1A 4HI9A 4I6EA 2CHZA 1BU9A 3LDZA 2WPVA 2WXLA 3CQGB 3HQIA 4MLPA 2CHXA 2GRRB 4FU3A 4BSZB 4W9IB 3WXXA 5FZQA 3DPDA 2VKPA 4I2WA 1FPPA 1BUOA 2R59A 3UM3A 3HXCA 4D10C 1UG3A 4K0RA 2KXPC 3UM2A 4EBAA 3DRZA 2DCPA 3V2OA 4FADA 4HOQA 3SY2A 3ABME 2P1NA 3GZSA 2LSVA 4CDNA 3WG7E 3PS6A 2WXHA 3L6AA 4U8VD 5AAOA 3Q47B 2B0OE 1JUQA 3FULA 5J90A 1U3DA 3BIMA 3IXEA 4AY6A 1S64A 2KM4A 3DEOA 3ESLA 5AQ9A 2IO3C 3EDTB 5AQ7A 3D9LA 3PZ2A 1PY1A 1HF8A 2VSNA 5HZGC 4LNBA 4HNAD 3RRMB 4F1SA 3KEZA 4I9CA 3TXNA 3CSFA 4HORA 2GRNB 3HVEA 1FT2A 4O6FA 3ZFWA 4GU5A 4DJAA 5LCWC 3M4TA 2HYZA 1X5BA 4DI3A 2KCLA 2WB2A 4RG6A 4U7EB 3UI2A 4ZFHA 1LF8A 2MHKA 4BKSB 3BEEA 4N9F5 3DSVA 1TNBA 3UKUG 3CSTA 2R9RB 3ASNE 2FO1E 4DRXE 5A7DB 3I4RB 1NFIE 4CGVA 3ML8A 2ETBA 3HXDA 5IY5E 2JZ3C 1K8KG 3ZHEA 5JHBA 3DRAA 3B84A 1KLXA 4U2NA 3I3NA 3ASOE 5FTAA 2X6IA 4FP7A 3IEGA 2IF4A 2WXMA 5BXUA 4F7AA 3JXIA 3IV0A 4GMLA 5KJNA 2HM8A 4KBQA 1HG2A 5JJTA 4JC8A 3S7JA 1EODA 2RG8A 3CK7A 2J8SD 3JUIA 2C9WC 2H6IA 3QARA 3FTXA 3SNXA 3CKBA 2PNNA 1WG0A 1LM8C 3RU0A 2MA9C 3CHPA 2A5EA 5C2YA 2DZNA 3DCGB 2BTDA 4UWFA 4J8FA 1IKND 5KNGA 4TV3A 3MV3B 3EU9A 2DYSE 1HX8A 4JL0A 4KXKB 5ENPD 4J0UA 2ZXWE 3OGKA 1H6PA 1T1DA 3EHNA 4CXIA 4B9KE 1FT1A 4HOTA 1O1RA 1OWMA 4UYIA 3LYAA 5CECB 3FEYA 4HOSA 2XZTG 2ZU6B 4BSXA 5AQBA 3LEWA 4XI0A 2PQNA 2UY1B 5G04J 3G2UA 3UM0A 3FTUA 2YY9A 2AW6A 4G1TA 4EZJA 4ATZD 1TJCA 2A4ZA 4PDXA 2AVPA 5FWQA 3JYSA 2FO7A 3LS8A 2C0LA 5FJYA 3ONKA 1XGWA 2ONDA 3E32A 2BKGA 4ANXA 5BO4C 4K03A 4J8SA 3PVLA 4N2QA 3HTMA 4DLQA 2OOEA 4N3AA 1H2VC 3ZHEB 3KSLA 4MBGA 4TUMA 3SI5A 5EILA 1TNUA 5EX3A 5FQ7A 4C48B 5ENQD 2VGEA 3JQ1A 5BPPA 4F6RD 4WWPA 4V3IA 3LCAA 1KZPA 4Q69A 1RZ4A 3G2TA 2P1OA 2LUHA 4TRQA 2IO2C 3DBSA 4DX2A 4B94A 1HU3A 1Y6IA 2LXMA 4HB5A 3M5BA 1R29A 3VTXA 4URKA 3ASDA 1EPUA 5D0QD 2DBAA 4CYMD 1EYHA 1MZCA 3ZNGA 1E7VA 3E4BA 5ENRD 3FTZA 2Q7FA 1N52A 4K5BA 2X3MA 3TWTA 1BI8B 1QDVA 2Y4TA 4U63A 4UWHA 4RLYA 1NP7A 3IKOB 2WQ6A 3ASGA 3ABKE 4FHKA 5ARFA 4XKCA 3FUNA 3FY4A 3PEVB 5JJ6A 2H6HA 1AP7A 2UY1A 3DSUA 1EDUA 3CGHA 1TNZA 1Y8MA 2JABA 1N4SA 4AEZC 5CRUA 5EIDA 3TXMA 2QY7A 2IFUA 2KZTA 4XKBA 3ZN3A 2GGFA 4KZCA 4ACKA 3PUKA 1INZA 4GYOA 3N71A 1TJFA 3ZW3A 3S7DA 1EOEA 3U66A 4GTSA 4XI9A 2IU1A 1FS1B 3L82A 4PS8A 4GPKA 4U2MA 2RFMA 5J08A 3G2SA 5JMND 2CG2A 3JUEA 1HFAA 1TEZA 4FULA 4UQZA 3Q9UC 4GZ6A 5DIZA 2XZDG 3QKYA 1QQEA 3KEAA 4UIJA 4JHKA 4W9HH 2V5QC 1SA4A 3URZA 2V4HC 4EZKA 1A5EA 4B0ZA 3NAWA 5E75A 3HU6A 4IULA 3NOCD 3FU3A 4QQIA 1OXJA 1DSXA 3TWSA 3ZNGB 4UWKA 3UM1A 2IY0C 2KC7A 2LAIA 4U0SA 3FTYA 4ANUA 4B95B 1O1SA 4JZYA 2PM6A 4PUCA 5HRYA 2IOSA 1WAO1 2CFUA 3S7BA 2L6JA 3TWWA 1UOHA 4EQFA 1P5QA 3DSWA 2P1PA 3HIZA 1ZB1A 2L9BA 3Q73A 1NEXA 1PC2A 1TN7A 4EZLA 4YDYA 5EDSA 4YDWA 5DADA 4FJYA 3Q15A 3ZKJA 4JXTA 1FVFA 4ILIA 3EU5A 3E33A 3J5PA 4W9HB 2KCVA 1A68A 3VLDA 3GZ2A 2QFCA 2P1QA 2L0IA 4HXIA 5FZSA 1QZ2A 2XGSA 4IRUA 3D9MA 2FNJC 1SZAA 2XGOA 1S70B 3LVQE 3MGBA 3PNTB 4IYPA 5CMYA 4BETA 1DCQA 3SO8A 2GW1A 3FWVA 1MYOA 4LUNU 5A6CA 4UWGA 3OXLA 2VTBA 1FS2B 1Z6TA 3KVTA 1OT8A 1N95A 3CVQA 4P29A 3APDA 3AS5A 4KVMA 1N0RA 1DCEA 4CXTA 2Y69E 4HFGA 3ZIMA 4I43A 1JWGA 3MCXA 3SBSA 4AP2A 3AG1E 4AJYC 5HQ8A 5HKPA 1MHQA 5DAFA 3KSQA 3GW4A 3NZUA 3T9KA 5FINA 4LEUA 1N4RA 3CVVA 2I2OA 2AWIA 1ZU2A 4L2YA 4YDOA 4NACA 3MKQB 4G26A 3R7RA 2IZVC 3HXBA 2QYJA 3L17A 5A23A 2V0PA 5LLIB 5T8IA 3Q7FA 3TGOA 5CRVA 3C6NA 2P9KG 4KYOB 4G25A 4JEHA 5E76A 2R05A 5LOZA 5AYWD 4U0UA 4BGCA 4GB9A 1ELKA 3AU5A 2H6GA 4KVOA 3AG4E 3PH0C 5HI7A 4LCTA 1QBQA 2WXKA 3DXMG 4LNUD 4J7WA 5BV1A 4ABNA 1S1GA 1TYQG 2A5UA 3ZYKA 2ASSA 1U3CA 1WM5A 2EILE 4CDRA 3L2OA 3P2BA 2ZGGA 4I1MA 3TJPA 4FHJA 4Y6WA 3ZYQA 4BT8A 3ZRCB 1HXIA 1SZ9A 4L1BA 3AG3E 2VTBB 2I2RA 3HYMB 1N4QA 3S7FA 3UUXA 5BXOA 2IONA 1TN8A 3MA5A 4N3CA 3UT4A 2VGXB 5M72A 3FP3A 5EUPA 3ZTCB 3U9WA 3RRNB 1MX4A 5ENNA 4WAFA 1N94A 4CZ2D 4W9CB 3ZYMA 2WMNA 1UN8A 1HH8A 3LUTB 3CHRA 2P2CP 3PZ1A 1K1AA 2WQHA 3D3MA 3C3QA 4CGWA 4ANVA 2XPYA 3ZVVA 3C6PA 1JCSA 3AS4A 1LD7A 4CDMA 4TXQA 3MKQA 2P9IG 2R03A 1N11A 3EJNA 3NBNB 4N3BA 1N54A 4U77A 3UMVA 1QDWA 3UKRG 4EOZA 2YQ8A 1EXBE 3FUMA 2OVBA 3ZXSA 4HRLA 1E8WA 3AJIA 3D9NA 2DYRE 4APOA 3F6QA 5AN8A 5LX8A 4R7LA 1BLXB 2LAHA 4M7CA 3ZUVB 5G05J 5FIOA 5CEAA 2R2LA 4RG9A 4HI8A 2XQ0A 2V5FA 2YINA 2E2EA 3EHQA 4CRHA 4JEUA 1ZBPA 5BUZA 2IJGX 4KZ0A 5AJDA 3LJNA 2NZ0B 3APFA 3FH5A 3FH8A 3D9IA 3KAEA 4JTCB 3B13A 2J09A 3B7BA 2GRQB 4I6GA 5B3SE 4G8LA 3OGMA 3FTSA 2BKKB 3M52A 1WDYA 3SFXA 2VJ8A 3JQ0A 4ZGCA 1KPSB 3Q7AA 5G04C 1Z5SC 4JTDB 5FTPA 4I2ZA 3UX4A 3OHUA 4BX8A 2FULA 2OVRA 1JCQA 2Y4UA 2WXGA 3SFYA 1E96B 3QNKA 4GYYA 2VGXA 3C3OA 2VQ2A 4N39A 1TNOA 4GAAA 2HE0A 4CXJA 4B89A 3B7UX 2V8SE 1SVXA 3O48A 2WVIA 4U07A 3BG0B 5CBOA 4BX9A 3MKRA 3T8MA 4FLHA 4GTRA 4YVQC 2WQ7A 4BESA 3D9JA 1UW4B 5CBNA 5G55A 4BT9A 4ME2A 4HRMB 4WNFA 1E8YA 3D9KA 3E30A 5JHAA 4GYWA 5KJMA 2EIJE 2P9SG 4W9LB 2XGMA 4NQ0A 4RQIA 5T4YA 3MV2B 4AM9A 3WSOB 5A15A 2J4DA 2P9NG 3U4TA 3HG0D 1UN9A 2WXNA 1MJ0A 4UUCA 5KJLA 5CCLA 3BG1B 3UIPC 5G05C 3R7QA 1GW6A 4Y6CA 2AXUA 3VLEA 4ANWA 2IF5A 4GTMA 2VGYA 2ZISA 3PDNA 3IHVA 4C0MA 5AENA 1N9AA 2L6BA 2PZIA 3HXEA 4YDEA 5JJ7A 3UPVA 1QNFA 4J8YA 5T3RA 4OVVA 4BTAA 4I6JA 1D9SA 3MKSA 4GTQA 4KMOA 3UTMA 2IHCA 2RD0A 1BI7B 1TR4A 3J5QB 4F1PA 3QDNA 5CEDB 3TWXA 4L23A 4AV7A 2C0MA 3EHRA 2NN2A 2XENA 4BTBA 2CFZA 1OY3D 2J07A 2KZTB 3AG2E 2J08A 4L2LA 4Q96A 4AXHA 2MYOA 4WQOC 3L9TA 1WY6A 4OVUA 3APCA 4K5AB 5DBKA 5KJKA 4J6IA 1EF1C 1N4PA 3QWWA 4GMJA 3CVYA 3MX3A 4X8QA 4EHMA 4LG6A 1X81A 3SQVA 4JA9A 4BERA 1XNFA 3CVNA 2YNQA 4Z68A 4I1OB 2CG3A 3QWVA 3OXGA 2KBXA 3FDHA 1OCCE 2WXIA 2WXRA 4I9EA 3T5VA 3MEKA 3P1UA 3PZDA 2NSZA 5FZRA 4GA1A 4WNDA 2LSUA 3RK6A 4J8DA 1YMPA 3QOUA 2PL2A 4U04A 3T8KA 4AIFA 3NZSA 2Y3AA 4AJWA 2MRIA 5BV0A 3D9HA 4W9DB 3RSEG 3BQOA 4JHJA 2A79B 4A3TA 1OCRE 3OGLA 1OWPA 2RKKA 2Y0BG 2X38A 3FHEA 3CHMA 5CHEE 3ZGQA 1PAQA 2BF0X 4HLLA 4G8KA 3ASFA 1NZNA 4A1SA 4UWLA 3X2QE 5D66A 3FEXA 1W3BA 4Q94A 5AARA 4DX7D 2XS1A 3ESKA 4DI4A 4GCNA 5AIJA 3L54A 3Q5MA 1LDKD 4DX1A 2ZGDA 1E7UA 4MS6A 3ZRFB 2FEZA 1D8EA 1KT1A 2J4BA 4GTPA 2E0IA 2ILRA 5HS0A 4W9KB 1NA3A 4WNEA 4MKTA 4BKTB 3LBZA 2WXQA 3NOGD 4RSYA 2FI7A 5EKQD 5EN5D 1D8DA 3FUFA 3DSXA 4ATGA 1MX6A 2LO6A 4U0ZA 1UJJA 3D9OA 2GRMA 3ABLE 1DC2A 3LJ3A 2GRPB 3B7RL 5B1BE 5FQ6A 1N0QA 3LY7A 2VSYA 4A3VA 5LP0A 2P58C 3E34A 3EUVA 4A1GA 3C6OA 3VLFA 4CCAA 4K5CA 1H6OA 2XEEA 5BW8C 2ETAA 3SF4A 1DVPA 1YCSB 4FA6A 4O60A 4L9PA 3KS2A 3TWUA 1E8ZA 3B7TA 4WNGA 5H7PA 1E90A 1BPOA 4MRUA 3R9MA 2XHEA 3D9PA 3HRAA 4J8EA 1HS6A 1FQVB 3DSSA 3CKCA 4L7TA 3L16A 4E6HA 4W9FB 5HYWB 5BT1A 3DSTA 3TWRA 3V7DA 3FUHA 4DUIA 2PQRA 3CK9A 2XRZA 5BNWA 3QK0A 2E32B 2OVPA 3BU8A 3LPZA 2OVQA 1HG5A 4LSZE 2VPKA 3I5PA 2QYUA 1Z3XA
chains in the Genus database with same CATH topology
3CEQA 3FH8A 5D0QD 3D9IA 2DBAA 3KAEA 1EYHA 2OV8A 4G24A 4JTCB 2XEVA 3B13A 3KD7A 2J09A 3OHVA 2NC9A 3PREA 1E7VA 3E4BA 4I6GA 3FTZA 2PM7A 2Q7FA 3FUJA 3ZPJA 1N52A 3OGMA 3FTSA 2X3MA 1QDVA 3M52A 2Y4TA 2VJ8A 3JQ0A 4U63A 1FCHA 3CVUA 4UWHA 1R2BA 4J8ZA 4ZGCA 3FUIA 5G04C 1NP7A 1E8XA 5FTPA 1IYGA 3IKOB 4I2ZA 4JTDB 4JHRA 3UX4A 3CVXA 3SGHA 3SZ7A 2WQ6A 3OHUA 4YY8A 1LQBB 4BX8A 4I6JC 3ASGA 4FHKA 1IQRA 2FULA 4XKCA 5ARFA 4C0EA 2OVRA 4JPSA 3TAXA 2Y4UA 3FUNA 3FY4A 2I6HA 3PEVB 5JJ6A 2WXGA 4B9KB 2UY1A 1E96B 3ENEA 3FUEA 2KCKA 3QNKA 3OTNA 3SD5A 4F3VA 4F53A 3FTVA 4GYYA 2XRYA 2LNIA 1EDUA 4UQXA 4UI9J 4CT4A 2Z8HA 5BXBA 3CGHA 2VGXA 2HR2A 4DLOA 3R9AB 2VQ2A 4N39A 1Y8MA 4AEZC 1P22B 5BXDA 2XPIA 4GAAA 1YA0A 4AOFA 5C1DA 1H6KA 3TXMA 4FLBA 1A17A 2QY7A 4CXJA 4B89A 4RVBA 2IFUA 2KZTA 3B7UX 5IBKA 3PRZA 2EQXA 2V8SE 3O48A 4XKBA 3ZN3A 2GGFA 3RJVA 2WMOA 4KZCA 4ACKA 3ZKJB 4APFA 2WVIA 4U07A 3PUKA 3QC1A 4DPRA 3BG0B 4LERA 4GYOA 4BX9A 3N71A 3CHQA 1INZA 1TJFA 3MKRA 5D0OD 2JEKA 3ZW3A 5BXHA 3T8MA 3FH7A 3LY8A 3EIJA 3S7DA 1EOEA 5FQ4A 3PE3A 4FLHA 4YVQC 4EECA 3U66A 2WQ7A 2AXVA 2L0TB 4XI9A 4HVBA 1UJKA 5ANLA 3NF1A 3D9JA 4N2SA 4BY6A 1R28A 1UW4B 3G2WA 5G55A 4BT9A 2IU1A 4ME2A 1FS1B 4EPZA 4PS8A 3M8VA 3RIBA 2ASTA 4WNFA 3PEUB 4GPKA 1LDKD 4U2MA 3EIQC 3FFLA 1E8YA 3ML9A 3G2SA 5J08A 3D9KA 4PS3A 5JHAA 2X6HA 4GYWA 3FUDA 4CEMA 5KJMA 4W9LB 2CG2A 4AY5A 3TG4A 2XGMA 1HFAA 1MQSA 4NQ0A 3TG5A 1TEZA 3AU4A 4FULA 2X6KA 1HV2A 1OUVA 5T4YA 4UQZA 3RKVA 2XCCA 3MV2B 4AM9A 3WSOB 5A15A 4GZ6A 2J4DA 3U4TA 5DIZA 1UN9A 3GZ1A 3QKYA 3C98A 2WXNA 4G11A 1QQEA 2I9CA 3HDXA 5KJLA 5AJLA 4UIJA 5CCLA 4JHKA 3QB2A 4BFRA 1H2TC 4TUUA 1DNPA 4W9HH 3BG1B 3MJWA 3HVEB 3URZA 4EZKA 3MZLB 3GYZA 4B0ZA 4FJZA 5G05C 3R7QA 1GW6A 4Y6CA 5E75A 3HU6A 4JGHC 1OWLA 3CLJA 4GZ5A 4IULA 2AXUA 2GRLA 3CVLA 3VLEA 4ANWA 2IF5A 4XZ4A 3FU3A 4EBAG 4GZ3A 2VGYA 1OWNA 2MOWA 3PDNA 3IHVA 1H0AA 1HO8A 1OWOA 4B8AA 1JPLA 1DSXA 3ZRHA 3Q4AB 4E85A 4C0MA 4ZOUA 5AENA 1B89A 4BWRA 1SQMA 1VCBB 2R5SA 3ZNGB 4UWKA 2PZIA 2KC7A 5JJ7A 3UPVA 4DK5A 4HLEA 2LAIA 1QNFA 4U0SA 3FTYA 2JLBA 3G2VA 5JH5B 5T3RA 4ANUA 4B95B 3VTYA 4OVVA 4JZYA 2PM6A 1ELRA 4G23A 4PUCA 4BTAA 2IOSA 4I6JA 3ZEFA 5FT9A 4I6EA 3MKSA 1WAO1 2CFUA 2CHZA 1FVHA 3QWPA 4KMOA 3S7BA 2IHCA 2L6JA 3JCKC 3LDZA 3ASHA 4H7YA 2RD0A 2WPVA 2WXLA 2R17C 3CQGB 3HQIA 4MLPA 2CHXA 3QDNA 4FU3A 5EX0A 4W9IB 3WXXA 5FZQA 3DPDA 4L23A 2VKPA 4EQFA 4AV7A 4I2WA 2C0MA 1L5JA 1P5QA 4C9BB 2P1PA 3HIZA 2L9BA 1BUOA 2NN2A 1NEXA 4BTBA 2CFZA 4ILGA 2R59A 1PC2A 2J07A 4I1AA 3OAWA 4XX5A 3TL5A 4EZLA 2KZTB 5EDSA 3CVWA 3B7SA 5DADA 4D10C 2J08A 4L2LA 4Q96A 4AXHA 4FJYA 1UG3A 3Q15A 4XIFA 4K0RA 3SFZA 4JXTA 1FVFA 4ACLA 4W9GB 4WQOC 4JA7A 4ILIA 2XCBA 4EBAA 3DRZA 2DCPA 1WY6A 2YHEA 4HOQA 4FADA 4OVUA 3APCA 2P1NA 3CR3A 4UI9C 2KCVA 3GZSA 1A68A 4W9HB 2LSVA 2YHCA 3VLDA 2BUGA 4CDNA 5DBKA 3GZ2A 3PS6A 5KJKA 4N5CA 2QFCA 2P1QA 2WXHA 3L6AA 1EF1C 2L0IA 3ONLA 4FC8A 4HXIA 1QZ2A 4J6IA 2DIWA 3QWWA 4YNDA 5FZSA 3Q47B 4AWJB 2NXPA 2XGSA 1JUQA 3FULA 3MX3A 4GMJA 3CVYA 4IRUA 5J90A 3D9MA 1U3DA 2FNJC 3BIMA 1SZAA 2IOLA 4G2VA 4AY6A 3RO3A 2WXPA 2KM4A 4JA9A 4AVXA 2XGOA 3ESLA 1XNFA 2WXFA 3CVNA 2YNQA 3LVQE 3MGBA 4NURA 3PNTB 3L13A 4IYPA 4I1OB 1HE8A 5CMYA 3EDTB 2CG3A 3PUJA 3D9LA 2Q81A 2OVFA 3LXUX 3QWVA 2GW1A 3OXGA 3FWVA 2KATA 1PY1A 1HF8A 4LUNU 2VSNA 5A6CA 5HZGC 4UWGA 3OXLA 2VTBA 3FDHA 2WXRA 2WXIA 3CK8A 3RRMB 2I1KA 4F1SA 1FS2B 3KEZA 3CVPA 3U3WA 1Z6TA 4I9CA 3KVTA 4I9EA 3TXNA 3MEKA 3T5VA 3UT7A 3P1UA 4KT6B 3CVQA 2NSZA 3PZDA 4GA1A 4PH4B 3CSFA 5FZRA 5H7GA 3FU5A 4ILHB 2LSUA 4I17A 3APDA 4P29A 3AS5A 2CHWA 3HVEA 4KVMA 4QFVA 3RK6A 4O6FA 4CXTA 3ZFWA 3FUKA 4HFGA 4GU5A 4DJAA 4J8DA 1NA0A 5LCWC 3ZIMA 3M4TA 2HYZA 1JWGA 1X5BA 4I43A 4WNDA 4DI3A 3MCXA 3SBSA 3UQ3A 4AP2A 2KCLA 4AJYC 5HQ8A 1MHQA 3DRXA 5DAFA 3QOUA 2WB2A 2PL2A 4RG6A 4U04A 3GW4A 4AIFA 3NZUA 1LF8A 3FU6A 3E4UA 2MHKA 3NZSA 2Y3AA 4BKSB 3BEEA 4AJWA 2MRIA 5LFAA 4LEUA 1Z3YA 5BV0A 4N9F5 3CHSA 3CVVA 2I2OA 2AWIA 3CSTA 1IQUA 1ZU2A 4W9DB 5H7HA 4UI9K 2R9RB 3S2AA 4L2YA 4JHJA 4NACA 3LNMB 3GA1A 5A7DB 2A79B 3I4RB 3MKQB 4G26A 4A3TA 3R7RA 4CGVA 2IZVC 2J9QA 3OGLA 3OXFA 1OWPA 1EOFA 3ML8A 2X38A 3FHEA 3L17A 3CHMA 5A23A 2JZ3C 5CHEE 2V0PA 4GA2A 3ZHEA 5T8IA 1PAQA 2BF0X 3ZGQA 3ZYLA 3L22A 3LVRE 5JHBA 3CV0A 3B84A 3TGOA 1KLXA 3UT8A 4U2NA 3C6NA 3ASFA 1NZNA 3LY9A 3I3NA 5FQ8A 4UWLA 4A1SA 4UYIA 2X6JA 5FTAA 2X6IA 3FEXA 4FP7A 4KYOB 1W3BA 3IEGA 4Q94A 2IF4A 2WXMA 4G25A 4JEHA 4F7AA 4JW1A 3IBEA 3IV0A 3NQPA 4GMLA 5KJNA 5E76A 3ESKA 4PS7A 4DI4A 3RO2A 2HM8A 4GCNA 5LOZA 5AIJA 5AYWD 3L54A 3Q5MA 4KBQA 5ANRA 4GA0A 4U0UA 1HG2A 3ULQA 4JC8A 3S7JA 4GB9A 1ELKA 2RG8A 2J49A 5JJTA 5LCWJ 1EODA 3AU5A 4BGCA 3CK7A 2X6FA 3I4GA 3JUIA 4KVOA 2E31B 3PH0C 3AS8A 2C9WC 5HI7A 1E7UA 5ARGA 3QARA 4MS6A 3ZRFB 2FEZA 3FTXA 4LCTA 3CKBA 3SNXA 1KT0A 2VSXE 2WXKA 1KT1A 1LM8C 3T5XA 5BV1A 3RU0A 4ABNA 2MA9C 3CHPA 2J4BA 1S1GA 5C2YA 4CT0A 5CMWA 2A5UA 2BTDA 2E0IA 2ILRA 4J8FA 4UWFA 3DCGB 3ZYKA 4TV3A 3MV3B 2ASSA 4W9KB 1NA3A 4WNEA 3RRUA 4OYSA 3FTWA 1U3CA 1WM5A 2WM9A 4CDRA 3L2OA 3PE4A 1HX8A 4JL0A 4KXKB 4MKTA 3P2BA 2WXQA 4A55A 3LBZA 4BKTB 4J0UA 3CQCB 3OGKA 1HZ4A 4I1MA 4RSYA 3TJPA 3LKUA 2FI7A 5EKQD 4FHJA 1T1DA 4Y6WA 3EHNA 3ZYQA 2AXZA 3IHYA 4BT8A 4CXIA 3FUFA 3ZRCB 4B9KE 4ATGA 3O4ZA 1HXIA 1SZ9A 3QAQA 4L1BA 4W9RA 2LO6A 4U0ZA 1UJJA 4HOTA 1S0PA 4WWNA 1OWMA 2VTBB 3HYMB 3LYAA 3D9OA 2I2RA 2GRMA 2HO1A 3FEYA 1VDYA 4XE0A 4YVOA 5KCMA 3S7FA 4GCOA 4CP3A 4HOSA 2M63A 3SBTB 2ZU6B 3FU0A 3LJ3A 3UUXA 4LRZA 2IONA 2IQCA 3B7RL 3FKCA 5FQ6A 4BSXA 3LEWA 4XI0A 2PQNA 1CS3A 2UY1B 1NN7A 3MA5A 3LY7A 5G04J 3G2UA 3FTUA 2VSYA 3DRYA 2YY9A 4N3CA 4H7XA 2AW6A 4G1TA 3UT4A 4A3VA 5LP0A 4EZJA 2VGXB 4JTAB 2P58C 1TJCA 3MYVA 5M72A 4HS2A 2A4ZA 4PDXA 2AVPA 3FP3A 4B8CB 5EUPA 5FWQA 3JYSA 3U9WA 3ZTCB 2WXOA 4WWOA 3RRNB 4A1GA 5ENNA 4WAFA 2FO7A 3C6OA 4W9CB 3ZYMA 3LS8A 2WMNA 2C0LA 3VLFA 1UN8A 4CCAA 1HH8A 5FJYA 3K9IA 4U8HA 3LUTB 4HORA 5BW8C 3CHRA 3ONKA 2XPZA 4GZCA 1XGWA 2WQHA 3D3MA 2ONDA 5G2NA 3SF4A 1DVPA 1H19A 4ANVA 4CGWA 2XPYA 3ZVVA 4FA6A 4ANXA 3C6PA 3AS4A 4IN3B 5BO4C 3KS2A 4CDMA 4K03A 3MKQA 1H2UA 1E8ZA 3PVLA 4J8SA 4N2QA 2VSOE 1IHGA 3B7TA 3HTMA 3SHFA 4DLQA 5A6RA 2OOEA 3EJNA 4W9EB 4N3BA 4WNGA 4N3AA 1E90A 1H2VC 4CRWA 1N54A 3ZHEB 1BPOA 4MRUA 5LLIB 4U77A 3UMVA 1QDWA 4EOZA 2XHEA 2YQ8A 1EXBE 3QJZA 3D9PA 3FUMA 3HHMA 2OVBA 2UWJG 3SI5A 3ZXSA 5EX3A 1E8WA 1JWFA 3PNLB 4J8EA 4W9JB 3L08A 4JVSA 5FQ7A 1HS6A 1FQVB 3ZTDB 3D9NA 3JQ1A 4WUYA 4APOA 5BPPA 2P1MA 3CIAA 3CKCA 4WWPA 4V3IA 4L7TA 5LX8A 3L16A 4E6HA 4R7LA 4W9FB 4HOUA 3EHMA 3LCAA 5HYWB 5BT1A 2LAHA 3V7DA 2VYIA 4Q69A 2C2LA 2I1JA 3G2TA 5G05J 3FUHA 3U64A 2P1OA 2PQRA 3CK9A 4RG9A 2V4LA 1ELWA 2PPIA 5CCMA 2XRZA 2WXJA 3QK0A 4UQYA 2FF4A 4M3OA 5BNWA 2E32B 2XQ0A 2OVPA 3LPZA 2V5FA 1HG5A 4TRQA 2FBNA 2YINA 2OVQA 3DBSA 2E2EA 4B94A 1HU3A 3Q49B 2VPKA 4CRHA 1Y6IA 4JEUA 4GZDA 1ZBPA 5BUZA 2IJGX 3CHOA 3M5BA 4KZ0A 3ZUNB 5AJDA 1R29A 4NRHB 3VTXA 4URKA 3ASDA 1EPUA 3I5PA 2NZ0B 3APFA 1Z3XA 3FH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HU6 A;  4JGH C;  4JTC B;  5H7G A;  2IF5 A;  3HVE A;  2I2R A;  3OHV A;  4UYI A;  4CXT A;  4CP3 A;  1DSX A;  3OGM A;  1QDV A;  3M4T A;  3M52 A;  4ZOU A;  3FKC A;  4AP2 A;  1R2B A;  4J8Z A;  1VCB B;  3ZNG B;  4AJY C;  5DAF A;  4JTD B;  1CS3 A;  1NN7 A;  3OHU A;  1LQB B;  2YY9 A;  4I6J C;  3E4U A;  5JH5 B;  2OVR A;  4B95 B;  4BKS B;  4JTA B;  4N9F 5;  4HS2 A;  4B9K B;  3MKS A;  5EUP A;  3ZTC B;  4W9D B;  5H7H A;  2Z8H A;  5BXB A;  2IHC A;  2R9R B;  3C6O A;  4W9C B;  3LNM B;  3HQI A;  3GA1 A;  2A79 B;  3LUT B;  1P22 B;  5BXD A;  4W9I B;  2IZV C;  3OGL A;  2VKP A;  4CXJ A;  1EOF A;  2JZ3 C;  2P1P A;  5IBK A;  2EQX A;  5LLI B;  3C6P A;  5BO4 C;  3ZKJ B;  1BUO A;  2NN2 A;  4APF A;  1NEX A;  3B84 A;  4U2N A;  3C6N A;  3HTM A;  3I3N A;  5A6R A;  5FTA A;  4W9E B;  5DAD A;  5BXH A;  1EOE A;  4U77 A;  1QDW A;  4W9G B;  4WQO C;  4EOZ A;  1EXB E;  3DRZ A;  1R28 A;  1LDK D;  4W9J B;  1FS1 B;  3ZTD B;  1EOD A;  1FQV B;  4BGC A;  2P1N A;  3M8V A;  4W9H B;  2AST A;  1A68 A;  2P1M A;  4U2M A;  4W9F B;  5HYW B;  2E31 B;  2C9W C;  2P1Q A;  3V7D A;  4W9L B;  4HXI A;  3ZRF B;  4AWJ B;  1LM8 C;  2P1O A;  2MA9 C;  1HV2 A;  1S1G A;  2FNJ C;  2PPI A;  3BIM A;  3WSO B;  3ZRC B;  2E32 B;  3DCG B;  5A15 A;  2OVP A;  2OVQ A;  2ASS A;  4W9K B;  3L2O A;  2VPK A;  4BKT B;  4CRH A;  2Q81 A;  3LBZ A;  4UIJ A;  3OGK A;  3M5B A;  3ZUN B;  5HZG C;  4W9H H;  3HVE B;  1R29 A;  1T1D A;  1FS2 B;  2NZ0 B;  4CXI A;  3KVT A;  4B9K E; 
#chains in the Genus database with same CATH topology
 3CEQ A;  2P9U G;  4G24 A;  3FUJ A;  3ZPJ A;  2XS8 A;  3ULE G;  4N5Q A;  1FCH A;  1SW6 A;  1R2B A;  3FUI A;  4U95 D;  3CVX A;  3SGH A;  3SZ7 A;  4I6J C;  1IQR A;  4C0E A;  3PZ4 A;  4JPS A;  2P9P G;  3FUE A;  2P9L G;  2KCK A;  3SD5 A;  3OTN A;  4F53 A;  4UQX A;  4UI9 J;  2HR2 A;  4DLO A;  3E37 A;  1P22 B;  2XPI A;  1YA0 A;  4AOF A;  1IHB A;  4FLB A;  4RVB A;  5IBK A;  2EQX A;  2OEV A;  3RJV A;  2WMO A;  2GRO B;  2H6F A;  4APF A;  4HRN A;  3QC1 A;  4DPR A;  4LER A;  3Q78 A;  3CHQ A;  5D0O D;  2BED A;  2JEK A;  5BXH A;  3FH7 A;  3LY8 A;  4EEC A;  2ZIR A;  4N2S A;  3NF1 A;  4BY6 A;  2QC9 A;  4EPZ A;  3RIB A;  3PEU B;  3EIQ C;  3ML9 A;  2X6H A;  3FUD A;  1KZO A;  1MQS A;  1HV2 A;  3AU4 A;  1OUV A;  3RKV A;  1O5M A;  5ENO D;  4U8Y D;  3GZ1 A;  5AQA A;  4G11 A;  3C72 A;  3V30 A;  3QB2 A;  1H2T C;  1DNP A;  3HVE B;  1V55 E;  3GYZ A;  4FJZ A;  4U96 D;  1OWL A;  4GZ5 A;  2GRL A;  3CVL A;  4EBA G;  4GZ3 A;  5JA4 D;  1OWN A;  1H0A A;  1HO8 A;  1OWO A;  4B8A A;  1MX2 A;  3Q4A B;  4E85 A;  4ZOU A;  4BWR A;  4A63 B;  2JLB A;  4HQD A;  4O1P A;  3ZEF A;  5FT9 A;  3TWV A;  4JB8 P;  1FVH A;  3QWP A;  3JCK C;  3ASH A;  4H7Y A;  2R17 C;  5EX0 A;  2ETC A;  1G3N B;  4C9B B;  1L5J A;  2Y1L E;  3Q79 A;  4ILG A;  4I1A A;  3OAW A;  4XX5 A;  3TL5 A;  3CVW A;  3B7S A;  4XIF A;  3SFZ A;  4ACL A;  4W9G B;  4JA7 A;  2QZA A;  2XCB A;  1U2V G;  1TN6 A;  2YHE A;  3CR3 A;  4UI9 C;  2YHC A;  2LXL A;  2BUG A;  4B93 B;  4N5C A;  3ONL A;  4FC8 A;  4YND A;  4AWJ B;  2DIW A;  2NXP A;  3Q75 A;  1K3Z D;  2IOL A;  4G2V A;  3RO3 A;  2WXP A;  4AVX A;  2WXF A;  4NUR A;  3L13 A;  1HE8 A;  3PUJ A;  3B95 A;  2Q81 A;  2OVF A;  3LXU X;  2KAT A;  5EYL A;  4O1O A;  5EYP F;  3CK8 A;  2I1K A;  3CVP A;  3U3W A;  3UT7 A;  4KT6 B;  4PH4 B;  5H7G A;  3FU5 A;  4I17 A;  2CHW A;  4QFV A;  3FUK A;  1NA0 A;  2XEH A;  3UQ3 A;  4OAV B;  3DRX A;  5EIB E;  4BEP A;  2OCC E;  4DX5 D;  3FU6 A;  3E4U A;  5LFA A;  1Z3Y A;  3CHS A;  1IQU A;  5H7H A;  4UI9 K;  3S2A A;  3LNM B;  3GA1 A;  1IXV A;  2J9Q A;  3OXF A;  1EOF A;  4GA2 A;  2B6C A;  3ZYL A;  3L22 A;  3LVR E;  3CV0 A;  3UT8 A;  4HBD A;  3LY9 A;  5FQ8 A;  3W9G A;  2X6J A;  3UIO C;  3DWL G;  4JW1 A;  3IBE A;  1TNY A;  3NQP A;  2F0Y A;  4PS7 A;  3RO2 A;  5KNH D;  5ANR A;  4GA0 A;  3ULQ A;  5LCW J;  2J49 A;  5B1A E;  2X6F A;  3I4G A;  1LTX A;  2E31 B;  3AS8 A;  5ARG A;  5KBA A;  1KT0 A;  2VSX E;  1NL4 A;  3T5X A;  5ENS D;  4CT0 A;  5CMW A;  3ZXP A;  3RRU A;  4OYS A;  3FTW A;  2WM9 A;  3PE4 A;  4A55 A;  3CQC B;  3DPY A;  1HZ4 A;  1SA5 A;  3DEP A;  3LKU A;  3NB2 A;  2AXZ A;  3IHY A;  3Q9N C;  3O4Z A;  3AAA C;  4GPM A;  3QAQ A;  4W9R A;  1S0P A;  4WWN A;  2HO1 A;  4XE0 A;  1VDY A;  4YVO A;  5KCM A;  4CP3 A;  4GCO A;  2M63 A;  3SBT B;  3FU0 A;  4LRZ A;  1OCZ E;  4GMR A;  3C5R A;  2IQC A;  3FKC A;  2F8X K;  3C3R A;  2DWZ A;  1CS3 A;  1NN7 A;  3ULY A;  5ENT D;  3DRY A;  5KWD A;  4H7X A;  4JTA B;  1YYH A;  3MYV A;  1JCR A;  4HS2 A;  4B8C B;  4GTO A;  2WXO A;  4WWO A;  3V2X A;  4TXR A;  3K9I A;  4U8H A;  1BD8 A;  2DVW A;  2DZO A;  2XPZ A;  4GZC A;  5G2N A;  3BUA A;  3JXJ A;  1H19 A;  1Q2Z A;  4IN3 B;  1H2U A;  3TWQ A;  2VSO E;  1IHG A;  4OAU C;  3SHF A;  5A6R A;  4W9E B;  4CRW A;  2AJA A;  1OCO E;  3QJZ A;  4GTT A;  3HHM A;  2UWJ G;  3PNL B;  1JWF A;  4W9J B;  2IEJ A;  3L08 A;  4JVS A;  3ZTD B;  4WUY A;  2P1M A;  3CIA A;  1O1T A;  4HOU A;  3EHM A;  2EIK E;  2VYI A;  2NYJ A;  2I1J A;  2C2L A;  5D2M C;  3UIN C;  3HXF A;  3U64 A;  2V4L A;  1ELW A;  2PPI A;  5CCM A;  2WXJ A;  4TXP A;  4UQY A;  2FF4 A;  4M3O A;  3V79 K;  2FBN A;  2EIN E;  3Q49 B;  4GZD A;  3CHO A;  4NIK A;  3ZUN B;  4NRH B;  5CER B;  4ILH B;  1UJK A;  3V31 A;  2OV8 A;  2XEV A;  3KD7 A;  3OHV A;  2NC9 A;  3PRE A;  2PM7 A;  5ITZ F;  3CVU A;  4J8Z A;  1IYG A;  1E8X A;  4JHR A;  4YY8 A;  1LQB B;  4XEI G;  3TAX A;  2I6H A;  2F8Y A;  4B9K B;  3ENE A;  1AWC B;  4F3V A;  2RFA A;  3FTV A;  2XRY A;  2LNI A;  4CT4 A;  2Z8H A;  4LNG A;  5BXB A;  3DXK G;  3R9A B;  5BXD A;  5C1D A;  1H6K A;  2R02 A;  1A17 A;  1K1B A;  3ZU7 B;  3PRZ A;  3ZKJ B;  3UXG A;  3RAU A;  3EIJ A;  5FQ4 A;  3PE3 A;  2AXV A;  2F37 A;  2L0T B;  4HVB A;  5ANL A;  1R28 A;  3G2W A;  3M8V A;  2AST A;  3FFL A;  4PS3 A;  4CEM A;  4DX6 D;  4AY5 A;  3TG4 A;  4JD2 G;  3TG5 A;  2X6K A;  3W9F A;  2XCC A;  4ZHB A;  3C98 A;  1RW2 A;  2I9C A;  3HDX A;  5AJL A;  4BFR A;  1S63 A;  4TUU A;  3MJW A;  3MZL B;  1LD8 A;  4JGH C;  3CLJ A;  4XZ4 A;  2MOW A;  4GTV A;  1V54 E;  1JPL A;  3ZRH A;  1B89 A;  3ISM C;  1SQM A;  2EIM E;  2R5S A;  1VCB B;  2OEW A;  4DK5 A;  4HLE A;  3G2V A;  5JH5 B;  3PZ3 A;  3VTY A;  1ELR A;  1QYM A;  4G23 A;  1NI1 A;  4HI9 A;  4I6E A;  2CHZ A;  1BU9 A;  3LDZ A;  2WPV A;  2WXL A;  3CQG B;  3HQI A;  4MLP A;  2CHX A;  2GRR B;  4FU3 A;  4BSZ B;  4W9I B;  3WXX A;  5FZQ A;  3DPD A;  2VKP A;  4I2W A;  1FPP A;  1BUO A;  2R59 A;  3UM3 A;  3HXC A;  4D10 C;  1UG3 A;  4K0R A;  2KXP C;  3UM2 A;  4EBA A;  3DRZ A;  2DCP A;  3V2O A;  4FAD A;  4HOQ A;  3SY2 A;  3ABM E;  2P1N A;  3GZS A;  2LSV A;  4CDN A;  3WG7 E;  3PS6 A;  2WXH A;  3L6A A;  4U8V D;  5AAO A;  3Q47 B;  2B0O E;  1JUQ A;  3FUL A;  5J90 A;  1U3D A;  3BIM A;  3IXE A;  4AY6 A;  1S64 A;  2KM4 A;  3DEO A;  3ESL A;  5AQ9 A;  2IO3 C;  3EDT B;  5AQ7 A;  3D9L A;  3PZ2 A;  1PY1 A;  1HF8 A;  2VSN A;  5HZG C;  4LNB A;  4HNA D;  3RRM B;  4F1S A;  3KEZ A;  4I9C A;  3TXN A;  3CSF A;  4HOR A;  2GRN B;  3HVE A;  1FT2 A;  4O6F A;  3ZFW A;  4GU5 A;  4DJA A;  5LCW C;  3M4T A;  2HYZ A;  1X5B A;  4DI3 A;  2KCL A;  2WB2 A;  4RG6 A;  4U7E B;  3UI2 A;  4ZFH A;  1LF8 A;  2MHK A;  4BKS B;  3BEE A;  4N9F 5;  3DSV A;  1TNB A;  3UKU G;  3CST A;  2R9R B;  3ASN E;  2FO1 E;  4DRX E;  5A7D B;  3I4R B;  1NFI E;  4CGV A;  3ML8 A;  2ETB A;  3HXD A;  5IY5 E;  2JZ3 C;  1K8K G;  3ZHE A;  5JHB A;  3DRA A;  3B84 A;  1KLX A;  4U2N A;  3I3N A;  3ASO E;  5FTA A;  2X6I A;  4FP7 A;  3IEG A;  2IF4 A;  2WXM A;  5BXU A;  4F7A A;  3JXI A;  3IV0 A;  4GML A;  5KJN A;  2HM8 A;  4KBQ A;  1HG2 A;  5JJT A;  4JC8 A;  3S7J A;  1EOD A;  2RG8 A;  3CK7 A;  2J8S D;  3JUI A;  2C9W C;  2H6I A;  3QAR A;  3FTX A;  3SNX A;  3CKB A;  2PNN A;  1WG0 A;  1LM8 C;  3RU0 A;  2MA9 C;  3CHP A;  2A5E A;  5C2Y A;  2DZN A;  3DCG B;  2BTD A;  4UWF A;  4J8F A;  1IKN D;  5KNG A;  4TV3 A;  3MV3 B;  3EU9 A;  2DYS E;  1HX8 A;  4JL0 A;  4KXK B;  5ENP D;  4J0U A;  2ZXW E;  3OGK A;  1H6P A;  1T1D A;  3EHN A;  4CXI A;  4B9K E;  1FT1 A;  4HOT A;  1O1R A;  1OWM A;  4UYI A;  3LYA A;  5CEC B;  3FEY A;  4HOS A;  2XZT G;  2ZU6 B;  4BSX A;  5AQB A;  3LEW A;  4XI0 A;  2PQN A;  2UY1 B;  5G04 J;  3G2U A;  3UM0 A;  3FTU A;  2YY9 A;  2AW6 A;  4G1T A;  4EZJ A;  4ATZ D;  1TJC A;  2A4Z A;  4PDX A;  2AVP A;  5FWQ A;  3JYS A;  2FO7 A;  3LS8 A;  2C0L A;  5FJY A;  3ONK A;  1XGW A;  2OND A;  3E32 A;  2BKG A;  4ANX A;  5BO4 C;  4K03 A;  4J8S A;  3PVL A;  4N2Q A;  3HTM A;  4DLQ A;  2OOE A;  4N3A A;  1H2V C;  3ZHE B;  3KSL A;  4MBG A;  4TUM A;  3SI5 A;  5EIL A;  1TNU A;  5EX3 A;  5FQ7 A;  4C48 B;  5ENQ D;  2VGE A;  3JQ1 A;  5BPP A;  4F6R D;  4WWP A;  4V3I A;  3LCA A;  1KZP A;  4Q69 A;  1RZ4 A;  3G2T A;  2P1O A;  2LUH A;  4TRQ A;  2IO2 C;  3DBS A;  4DX2 A;  4B94 A;  1HU3 A;  1Y6I A;  2LXM A;  4HB5 A;  3M5B A;  1R29 A;  3VTX A;  4URK A;  3ASD A;  1EPU A;  5D0Q D;  2DBA A;  4CYM D;  1EYH A;  1MZC A;  3ZNG A;  1E7V A;  3E4B A;  5ENR D;  3FTZ A;  2Q7F A;  1N52 A;  4K5B A;  2X3M A;  3TWT A;  1BI8 B;  1QDV A;  2Y4T A;  4U63 A;  4UWH A;  4RLY A;  1NP7 A;  3IKO B;  2WQ6 A;  3ASG A;  3ABK E;  4FHK A;  5ARF A;  4XKC A;  3FUN A;  3FY4 A;  3PEV B;  5JJ6 A;  2H6H A;  1AP7 A;  2UY1 A;  3DSU A;  1EDU A;  3CGH A;  1TNZ A;  1Y8M A;  2JAB A;  1N4S A;  4AEZ C;  5CRU A;  5EID A;  3TXM A;  2QY7 A;  2IFU A;  2KZT A;  4XKB A;  3ZN3 A;  2GGF A;  4KZC A;  4ACK A;  3PUK A;  1INZ A;  4GYO A;  3N71 A;  1TJF A;  3ZW3 A;  3S7D A;  1EOE A;  3U66 A;  4GTS A;  4XI9 A;  2IU1 A;  1FS1 B;  3L82 A;  4PS8 A;  4GPK A;  4U2M A;  2RFM A;  5J08 A;  3G2S A;  5JMN D;  2CG2 A;  3JUE A;  1HFA A;  1TEZ A;  4FUL A;  4UQZ A;  3Q9U C;  4GZ6 A;  5DIZ A;  2XZD G;  3QKY A;  1QQE A;  3KEA A;  4UIJ A;  4JHK A;  4W9H H;  2V5Q C;  1SA4 A;  3URZ A;  2V4H C;  4EZK A;  1A5E A;  4B0Z A;  3NAW A;  5E75 A;  3HU6 A;  4IUL A;  3NOC D;  3FU3 A;  4QQI A;  1OXJ A;  1DSX A;  3TWS A;  3ZNG B;  4UWK A;  3UM1 A;  2IY0 C;  2KC7 A;  2LAI A;  4U0S A;  3FTY A;  4ANU A;  4B95 B;  1O1S A;  4JZY A;  2PM6 A;  4PUC A;  5HRY A;  2IOS A;  1WAO 1;  2CFU A;  3S7B A;  2L6J A;  3TWW A;  1UOH A;  4EQF A;  1P5Q A;  3DSW A;  2P1P A;  3HIZ A;  1ZB1 A;  2L9B A;  3Q73 A;  1NEX A;  1PC2 A;  1TN7 A;  4EZL A;  4YDY A;  5EDS A;  4YDW A;  5DAD A;  4FJY A;  3Q15 A;  3ZKJ A;  4JXT A;  1FVF A;  4ILI A;  3EU5 A;  3E33 A;  3J5P A;  4W9H B;  2KCV A;  1A68 A;  3VLD A;  3GZ2 A;  2QFC A;  2P1Q A;  2L0I A;  4HXI A;  5FZS A;  1QZ2 A;  2XGS A;  4IRU A;  3D9M A;  2FNJ C;  1SZA A;  2XGO A;  1S70 B;  3LVQ E;  3MGB A;  3PNT B;  4IYP A;  5CMY A;  4BET A;  1DCQ A;  3SO8 A;  2GW1 A;  3FWV A;  1MYO A;  4LUN U;  5A6C A;  4UWG A;  3OXL A;  2VTB A;  1FS2 B;  1Z6T A;  3KVT A;  1OT8 A;  1N95 A;  3CVQ A;  4P29 A;  3APD A;  3AS5 A;  4KVM A;  1N0R A;  1DCE A;  4CXT A;  2Y69 E;  4HFG A;  3ZIM A;  4I43 A;  1JWG A;  3MCX A;  3SBS A;  4AP2 A;  3AG1 E;  4AJY C;  5HQ8 A;  5HKP A;  1MHQ A;  5DAF A;  3KSQ A;  3GW4 A;  3NZU A;  3T9K A;  5FIN A;  4LEU A;  1N4R A;  3CVV A;  2I2O A;  2AWI A;  1ZU2 A;  4L2Y A;  4YDO A;  4NAC A;  3MKQ B;  4G26 A;  3R7R A;  2IZV C;  3HXB A;  2QYJ A;  3L17 A;  5A23 A;  2V0P A;  5LLI B;  5T8I A;  3Q7F A;  3TGO A;  5CRV A;  3C6N A;  2P9K G;  4KYO B;  4G25 A;  4JEH A;  5E76 A;  2R05 A;  5LOZ A;  5AYW D;  4U0U A;  4BGC A;  4GB9 A;  1ELK A;  3AU5 A;  2H6G A;  4KVO A;  3AG4 E;  3PH0 C;  5HI7 A;  4LCT A;  1QBQ A;  2WXK A;  3DXM G;  4LNU D;  4J7W A;  5BV1 A;  4ABN A;  1S1G A;  1TYQ G;  2A5U A;  3ZYK A;  2ASS A;  1U3C A;  1WM5 A;  2EIL E;  4CDR A;  3L2O A;  3P2B A;  2ZGG A;  4I1M A;  3TJP A;  4FHJ A;  4Y6W A;  3ZYQ A;  4BT8 A;  3ZRC B;  1HXI A;  1SZ9 A;  4L1B A;  3AG3 E;  2VTB B;  2I2R A;  3HYM B;  1N4Q A;  3S7F A;  3UUX A;  5BXO A;  2ION A;  1TN8 A;  3MA5 A;  4N3C A;  3UT4 A;  2VGX B;  5M72 A;  3FP3 A;  5EUP A;  3ZTC B;  3U9W A;  3RRN B;  1MX4 A;  5ENN A;  4WAF A;  1N94 A;  4CZ2 D;  4W9C B;  3ZYM A;  2WMN A;  1UN8 A;  1HH8 A;  3LUT B;  3CHR A;  2P2C P;  3PZ1 A;  1K1A A;  2WQH A;  3D3M A;  3C3Q A;  4CGW A;  4ANV A;  2XPY A;  3ZVV A;  3C6P A;  1JCS A;  3AS4 A;  1LD7 A;  4CDM A;  4TXQ A;  3MKQ A;  2P9I G;  2R03 A;  1N11 A;  3EJN A;  3NBN B;  4N3B A;  1N54 A;  4U77 A;  3UMV A;  1QDW A;  3UKR G;  4EOZ A;  2YQ8 A;  1EXB E;  3FUM A;  2OVB A;  3ZXS A;  4HRL A;  1E8W A;  3AJI A;  3D9N A;  2DYR E;  4APO A;  3F6Q A;  5AN8 A;  5LX8 A;  4R7L A;  1BLX B;  2LAH A;  4M7C A;  3ZUV B;  5G05 J;  5FIO A;  5CEA A;  2R2L A;  4RG9 A;  4HI8 A;  2XQ0 A;  2V5F A;  2YIN A;  2E2E A;  3EHQ A;  4CRH A;  4JEU A;  1ZBP A;  5BUZ A;  2IJG X;  4KZ0 A;  5AJD A;  3LJN A;  2NZ0 B;  3APF A;  3FH5 A;  3FH8 A;  3D9I A;  3KAE A;  4JTC B;  3B13 A;  2J09 A;  3B7B A;  2GRQ B;  4I6G A;  5B3S E;  4G8L A;  3OGM A;  3FTS A;  2BKK B;  3M52 A;  1WDY A;  3SFX A;  2VJ8 A;  3JQ0 A;  4ZGC A;  1KPS B;  3Q7A A;  5G04 C;  1Z5S C;  4JTD B;  5FTP A;  4I2Z A;  3UX4 A;  3OHU A;  4BX8 A;  2FUL A;  2OVR A;  1JCQ A;  2Y4U A;  2WXG A;  3SFY A;  1E96 B;  3QNK A;  4GYY A;  2VGX A;  3C3O A;  2VQ2 A;  4N39 A;  1TNO A;  4GAA A;  2HE0 A;  4CXJ A;  4B89 A;  3B7U X;  2V8S E;  1SVX A;  3O48 A;  2WVI A;  4U07 A;  3BG0 B;  5CBO A;  4BX9 A;  3MKR A;  3T8M A;  4FLH A;  4GTR A;  4YVQ C;  2WQ7 A;  4BES A;  3D9J A;  1UW4 B;  5CBN A;  5G55 A;  4BT9 A;  4ME2 A;  4HRM B;  4WNF A;  1E8Y A;  3D9K A;  3E30 A;  5JHA A;  4GYW A;  5KJM A;  2EIJ E;  2P9S G;  4W9L B;  2XGM A;  4NQ0 A;  4RQI A;  5T4Y A;  3MV2 B;  4AM9 A;  3WSO B;  5A15 A;  2J4D A;  2P9N G;  3U4T A;  3HG0 D;  1UN9 A;  2WXN A;  1MJ0 A;  4UUC A;  5KJL A;  5CCL A;  3BG1 B;  3UIP C;  5G05 C;  3R7Q A;  1GW6 A;  4Y6C A;  2AXU A;  3VLE A;  4ANW A;  2IF5 A;  4GTM A;  2VGY A;  2ZIS A;  3PDN A;  3IHV A;  4C0M A;  5AEN A;  1N9A A;  2L6B A;  2PZI A;  3HXE A;  4YDE A;  5JJ7 A;  3UPV A;  1QNF A;  4J8Y A;  5T3R A;  4OVV A;  4BTA A;  4I6J A;  1D9S A;  3MKS A;  4GTQ A;  4KMO A;  3UTM A;  2IHC A;  2RD0 A;  1BI7 B;  1TR4 A;  3J5Q B;  4F1P A;  3QDN A;  5CED B;  3TWX A;  4L23 A;  4AV7 A;  2C0M A;  3EHR A;  2NN2 A;  2XEN A;  4BTB A;  2CFZ A;  1OY3 D;  2J07 A;  2KZT B;  3AG2 E;  2J08 A;  4L2L A;  4Q96 A;  4AXH A;  2MYO A;  4WQO C;  3L9T A;  1WY6 A;  4OVU A;  3APC A;  4K5A B;  5DBK A;  5KJK A;  4J6I A;  1EF1 C;  1N4P A;  3QWW A;  4GMJ A;  3CVY A;  3MX3 A;  4X8Q A;  4EHM A;  4LG6 A;  1X81 A;  3SQV A;  4JA9 A;  4BER A;  1XNF A;  3CVN A;  2YNQ A;  4Z68 A;  4I1O B;  2CG3 A;  3QWV A;  3OXG A;  2KBX A;  3FDH A;  1OCC E;  2WXI A;  2WXR A;  4I9E A;  3T5V A;  3MEK A;  3P1U A;  3PZD A;  2NSZ A;  5FZR A;  4GA1 A;  4WND A;  2LSU A;  3RK6 A;  4J8D A;  1YMP A;  3QOU A;  2PL2 A;  4U04 A;  3T8K A;  4AIF A;  3NZS A;  2Y3A A;  4AJW A;  2MRI A;  5BV0 A;  3D9H A;  4W9D B;  3RSE G;  3BQO A;  4JHJ A;  2A79 B;  4A3T A;  1OCR E;  3OGL A;  1OWP A;  2RKK A;  2Y0B G;  2X38 A;  3FHE A;  3CHM A;  5CHE E;  3ZGQ A;  1PAQ A;  2BF0 X;  4HLL A;  4G8K A;  3ASF A;  1NZN A;  4A1S A;  4UWL A;  3X2Q E;  5D66 A;  3FEX A;  1W3B A;  4Q94 A;  5AAR A;  4DX7 D;  2XS1 A;  3ESK A;  4DI4 A;  4GCN A;  5AIJ A;  3L54 A;  3Q5M A;  1LDK D;  4DX1 A;  2ZGD A;  1E7U A;  4MS6 A;  3ZRF B;  2FEZ A;  1D8E A;  1KT1 A;  2J4B A;  4GTP A;  2E0I A;  2ILR A;  5HS0 A;  4W9K B;  1NA3 A;  4WNE A;  4MKT A;  4BKT B;  3LBZ A;  2WXQ A;  3NOG D;  4RSY A;  2FI7 A;  5EKQ D;  5EN5 D;  1D8D A;  3FUF A;  3DSX A;  4ATG A;  1MX6 A;  2LO6 A;  4U0Z A;  1UJJ A;  3D9O A;  2GRM A;  3ABL E;  1DC2 A;  3LJ3 A;  2GRP B;  3B7R L;  5B1B E;  5FQ6 A;  1N0Q A;  3LY7 A;  2VSY A;  4A3V A;  5LP0 A;  2P58 C;  3E34 A;  3EUV A;  4A1G A;  3C6O A;  3VLF A;  4CCA A;  4K5C A;  1H6O A;  2XEE A;  5BW8 C;  2ETA A;  3SF4 A;  1DVP A;  1YCS B;  4FA6 A;  4O60 A;  4L9P A;  3KS2 A;  3TWU A;  1E8Z A;  3B7T A;  4WNG A;  5H7P A;  1E90 A;  1BPO A;  4MRU A;  3R9M A;  2XHE A;  3D9P A;  3HRA A;  4J8E A;  1HS6 A;  1FQV B;  3DSS A;  3CKC A;  4L7T A;  3L16 A;  4E6H A;  4W9F B;  5HYW B;  5BT1 A;  3DST A;  3TWR A;  3V7D A;  3FUH A;  4DUI A;  2PQR A;  3CK9 A;  2XRZ A;  5BNW A;  3QK0 A;  2E32 B;  2OVP A;  3BU8 A;  3LPZ A;  2OVQ A;  1HG5 A;  4LSZ E;  2VPK A;  3I5P A;  2QYU A;  1Z3X A; 
#chains in the Genus database with same CATH homology
 3CEQ A;  3FH8 A;  5D0Q D;  3D9I A;  2DBA A;  3KAE A;  1EYH A;  2OV8 A;  4G24 A;  4JTC B;  2XEV A;  3B13 A;  3KD7 A;  2J09 A;  3OHV A;  2NC9 A;  3PRE A;  1E7V A;  3E4B A;  4I6G A;  3FTZ A;  2PM7 A;  2Q7F A;  3FUJ A;  3ZPJ A;  1N52 A;  3OGM A;  3FTS A;  2X3M A;  1QDV A;  3M52 A;  2Y4T A;  2VJ8 A;  3JQ0 A;  4U63 A;  1FCH A;  3CVU A;  4UWH A;  1R2B A;  4J8Z A;  4ZGC A;  3FUI A;  5G04 C;  1NP7 A;  1E8X A;  5FTP A;  1IYG A;  3IKO B;  4I2Z A;  4JTD B;  4JHR A;  3UX4 A;  3CVX A;  3SGH A;  3SZ7 A;  2WQ6 A;  3OHU A;  4YY8 A;  1LQB B;  4BX8 A;  4I6J C;  3ASG A;  4FHK A;  1IQR A;  2FUL A;  4XKC A;  5ARF A;  4C0E A;  2OVR A;  4JPS A;  3TAX A;  2Y4U A;  3FUN A;  3FY4 A;  2I6H A;  3PEV B;  5JJ6 A;  2WXG A;  4B9K B;  2UY1 A;  1E96 B;  3ENE A;  3FUE A;  2KCK A;  3QNK A;  3OTN A;  3SD5 A;  4F3V A;  4F53 A;  3FTV A;  4GYY A;  2XRY A;  2LNI A;  1EDU A;  4UQX A;  4UI9 J;  4CT4 A;  2Z8H A;  5BXB A;  3CGH A;  2VGX A;  2HR2 A;  4DLO A;  3R9A B;  2VQ2 A;  4N39 A;  1Y8M A;  4AEZ C;  1P22 B;  5BXD A;  2XPI A;  4GAA A;  1YA0 A;  4AOF A;  5C1D A;  1H6K A;  3TXM A;  4FLB A;  1A17 A;  2QY7 A;  4CXJ A;  4B89 A;  4RVB A;  2IFU A;  2KZT A;  3B7U X;  5IBK A;  3PRZ A;  2EQX A;  2V8S E;  3O48 A;  4XKB A;  3ZN3 A;  2GGF A;  3RJV A;  2WMO A;  4KZC A;  4ACK A;  3ZKJ B;  4APF A;  2WVI A;  4U07 A;  3PUK A;  3QC1 A;  4DPR A;  3BG0 B;  4LER A;  4GYO A;  4BX9 A;  3N71 A;  3CHQ A;  1INZ A;  1TJF A;  3MKR A;  5D0O D;  2JEK A;  3ZW3 A;  5BXH A;  3T8M A;  3FH7 A;  3LY8 A;  3EIJ A;  3S7D A;  1EOE A;  5FQ4 A;  3PE3 A;  4FLH A;  4YVQ C;  4EEC A;  3U66 A;  2WQ7 A;  2AXV A;  2L0T B;  4XI9 A;  4HVB A;  1UJK A;  5ANL A;  3NF1 A;  3D9J A;  4N2S A;  4BY6 A;  1R28 A;  1UW4 B;  3G2W A;  5G55 A;  4BT9 A;  2IU1 A;  4ME2 A;  1FS1 B;  4EPZ A;  4PS8 A;  3M8V A;  3RIB A;  2AST A;  4WNF A;  3PEU B;  4GPK A;  1LDK D;  4U2M A;  3EIQ C;  3FFL A;  1E8Y A;  3ML9 A;  3G2S A;  5J08 A;  3D9K A;  4PS3 A;  5JHA A;  2X6H A;  4GYW A;  3FUD A;  4CEM A;  5KJM A;  4W9L B;  2CG2 A;  4AY5 A;  3TG4 A;  2XGM A;  1HFA A;  1MQS A;  4NQ0 A;  3TG5 A;  1TEZ A;  3AU4 A;  4FUL A;  2X6K A;  1HV2 A;  1OUV A;  5T4Y A;  4UQZ A;  3RKV A;  2XCC A;  3MV2 B;  4AM9 A;  3WSO B;  5A15 A;  4GZ6 A;  2J4D A;  3U4T A;  5DIZ A;  1UN9 A;  3GZ1 A;  3QKY A;  3C98 A;  2WXN A;  4G11 A;  1QQE A;  2I9C A;  3HDX A;  5KJL A;  5AJL A;  4UIJ A;  5CCL A;  4JHK A;  3QB2 A;  4BFR A;  1H2T C;  4TUU A;  1DNP A;  4W9H H;  3BG1 B;  3MJW A;  3HVE B;  3URZ A;  4EZK A;  3MZL B;  3GYZ A;  4B0Z A;  4FJZ A;  5G05 C;  3R7Q A;  1GW6 A;  4Y6C A;  5E75 A;  3HU6 A;  4JGH C;  1OWL A;  3CLJ A;  4GZ5 A;  4IUL A;  2AXU A;  2GRL A;  3CVL A;  3VLE A;  4ANW A;  2IF5 A;  4XZ4 A;  3FU3 A;  4EBA G;  4GZ3 A;  2VGY A;  1OWN A;  2MOW A;  3PDN A;  3IHV A;  1H0A A;  1HO8 A;  1OWO A;  4B8A A;  1JPL A;  1DSX A;  3ZRH A;  3Q4A B;  4E85 A;  4C0M A;  4ZOU A;  5AEN A;  1B89 A;  4BWR A;  1SQM A;  1VCB B;  2R5S A;  3ZNG B;  4UWK A;  2PZI A;  2KC7 A;  5JJ7 A;  3UPV A;  4DK5 A;  4HLE A;  2LAI A;  1QNF A;  4U0S A;  3FTY A;  2JLB A;  3G2V A;  5JH5 B;  5T3R A;  4ANU A;  4B95 B;  3VTY A;  4OVV A;  4JZY A;  2PM6 A;  1ELR A;  4G23 A;  4PUC A;  4BTA A;  2IOS A;  4I6J A;  3ZEF A;  5FT9 A;  4I6E A;  3MKS A;  1WAO 1;  2CFU A;  2CHZ A;  1FVH A;  3QWP A;  4KMO A;  3S7B A;  2IHC A;  2L6J A;  3JCK C;  3LDZ A;  3ASH A;  4H7Y A;  2RD0 A;  2WPV A;  2WXL A;  2R17 C;  3CQG B;  3HQI A;  4MLP A;  2CHX A;  3QDN A;  4FU3 A;  5EX0 A;  4W9I B;  3WXX A;  5FZQ A;  3DPD A;  4L23 A;  2VKP A;  4EQF A;  4AV7 A;  4I2W A;  2C0M A;  1L5J A;  1P5Q A;  4C9B B;  2P1P A;  3HIZ A;  2L9B A;  1BUO A;  2NN2 A;  1NEX A;  4BTB A;  2CFZ A;  4ILG A;  2R59 A;  1PC2 A;  2J07 A;  4I1A A;  3OAW A;  4XX5 A;  3TL5 A;  4EZL A;  2KZT B;  5EDS A;  3CVW A;  3B7S A;  5DAD A;  4D10 C;  2J08 A;  4L2L A;  4Q96 A;  4AXH A;  4FJY A;  1UG3 A;  3Q15 A;  4XIF A;  4K0R A;  3SFZ A;  4JXT A;  1FVF A;  4ACL A;  4W9G B;  4WQO C;  4JA7 A;  4ILI A;  2XCB A;  4EBA A;  3DRZ A;  2DCP A;  1WY6 A;  2YHE A;  4HOQ A;  4FAD A;  4OVU A;  3APC A;  2P1N A;  3CR3 A;  4UI9 C;  2KCV A;  3GZS A;  1A68 A;  4W9H B;  2LSV A;  2YHC A;  3VLD A;  2BUG A;  4CDN A;  5DBK A;  3GZ2 A;  3PS6 A;  5KJK A;  4N5C A;  2QFC A;  2P1Q A;  2WXH A;  3L6A A;  1EF1 C;  2L0I A;  3ONL A;  4FC8 A;  4HXI A;  1QZ2 A;  4J6I A;  2DIW A;  3QWW A;  4YND A;  5FZS A;  3Q47 B;  4AWJ B;  2NXP A;  2XGS A;  1JUQ A;  3FUL A;  3MX3 A;  4GMJ A;  3CVY A;  4IRU A;  5J90 A;  3D9M A;  1U3D A;  2FNJ C;  3BIM A;  1SZA A;  2IOL A;  4G2V A;  4AY6 A;  3RO3 A;  2WXP A;  2KM4 A;  4JA9 A;  4AVX A;  2XGO A;  3ESL A;  1XNF A;  2WXF A;  3CVN A;  2YNQ A;  3LVQ E;  3MGB A;  4NUR A;  3PNT B;  3L13 A;  4IYP A;  4I1O B;  1HE8 A;  5CMY A;  3EDT B;  2CG3 A;  3PUJ A;  3D9L A;  2Q81 A;  2OVF A;  3LXU X;  3QWV A;  2GW1 A;  3OXG A;  3FWV A;  2KAT A;  1PY1 A;  1HF8 A;  4LUN U;  2VSN A;  5A6C A;  5HZG C;  4UWG A;  3OXL A;  2VTB A;  3FDH A;  2WXR A;  2WXI A;  3CK8 A;  3RRM B;  2I1K A;  4F1S A;  1FS2 B;  3KEZ A;  3CVP A;  3U3W A;  1Z6T A;  4I9C A;  3KVT A;  4I9E A;  3TXN A;  3MEK A;  3T5V A;  3UT7 A;  3P1U A;  4KT6 B;  3CVQ A;  2NSZ A;  3PZD A;  4GA1 A;  4PH4 B;  3CSF A;  5FZR A;  5H7G A;  3FU5 A;  4ILH B;  2LSU A;  4I17 A;  3APD A;  4P29 A;  3AS5 A;  2CHW A;  3HVE A;  4KVM A;  4QFV A;  3RK6 A;  4O6F A;  4CXT A;  3ZFW A;  3FUK A;  4HFG A;  4GU5 A;  4DJA A;  4J8D A;  1NA0 A;  5LCW C;  3ZIM A;  3M4T A;  2HYZ A;  1JWG A;  1X5B A;  4I43 A;  4WND A;  4DI3 A;  3MCX A;  3SBS A;  3UQ3 A;  4AP2 A;  2KCL A;  4AJY C;  5HQ8 A;  1MHQ A;  3DRX A;  5DAF A;  3QOU A;  2WB2 A;  2PL2 A;  4RG6 A;  4U04 A;  3GW4 A;  4AIF A;  3NZU A;  1LF8 A;  3FU6 A;  3E4U A;  2MHK A;  3NZS A;  2Y3A A;  4BKS B;  3BEE A;  4AJW A;  2MRI A;  5LFA A;  4LEU A;  1Z3Y A;  5BV0 A;  4N9F 5;  3CHS A;  3CVV A;  2I2O A;  2AWI A;  3CST A;  1IQU A;  1ZU2 A;  4W9D B;  5H7H A;  4UI9 K;  2R9R B;  3S2A A;  4L2Y A;  4JHJ A;  4NAC A;  3LNM B;  3GA1 A;  5A7D B;  2A79 B;  3I4R B;  3MKQ B;  4G26 A;  4A3T A;  3R7R A;  4CGV A;  2IZV C;  2J9Q A;  3OGL A;  3OXF A;  1OWP A;  1EOF A;  3ML8 A;  2X38 A;  3FHE A;  3L17 A;  3CHM A;  5A23 A;  2JZ3 C;  5CHE E;  2V0P A;  4GA2 A;  3ZHE A;  5T8I A;  1PAQ A;  2BF0 X;  3ZGQ A;  3ZYL A;  3L22 A;  3LVR E;  5JHB A;  3CV0 A;  3B84 A;  3TGO A;  1KLX A;  3UT8 A;  4U2N A;  3C6N A;  3ASF A;  1NZN A;  3LY9 A;  3I3N A;  5FQ8 A;  4UWL A;  4A1S A;  4UYI A;  2X6J A;  5FTA A;  2X6I A;  3FEX A;  4FP7 A;  4KYO B;  1W3B A;  3IEG A;  4Q94 A;  2IF4 A;  2WXM A;  4G25 A;  4JEH A;  4F7A A;  4JW1 A;  3IBE A;  3IV0 A;  3NQP A;  4GML A;  5KJN A;  5E76 A;  3ESK A;  4PS7 A;  4DI4 A;  3RO2 A;  2HM8 A;  4GCN A;  5LOZ A;  5AIJ A;  5AYW D;  3L54 A;  3Q5M A;  4KBQ A;  5ANR A;  4GA0 A;  4U0U A;  1HG2 A;  3ULQ A;  4JC8 A;  3S7J A;  4GB9 A;  1ELK A;  2RG8 A;  2J49 A;  5JJT A;  5LCW J;  1EOD A;  3AU5 A;  4BGC A;  3CK7 A;  2X6F A;  3I4G A;  3JUI A;  4KVO A;  2E31 B;  3PH0 C;  3AS8 A;  2C9W C;  5HI7 A;  1E7U A;  5ARG A;  3QAR A;  4MS6 A;  3ZRF B;  2FEZ A;  3FTX A;  4LCT A;  3CKB A;  3SNX A;  1KT0 A;  2VSX E;  2WXK A;  1KT1 A;  1LM8 C;  3T5X A;  5BV1 A;  3RU0 A;  4ABN A;  2MA9 C;  3CHP A;  2J4B A;  1S1G A;  5C2Y A;  4CT0 A;  5CMW A;  2A5U A;  2BTD A;  2E0I A;  2ILR A;  4J8F A;  4UWF A;  3DCG B;  3ZYK A;  4TV3 A;  3MV3 B;  2ASS A;  4W9K B;  1NA3 A;  4WNE A;  3RRU A;  4OYS A;  3FTW A;  1U3C A;  1WM5 A;  2WM9 A;  4CDR A;  3L2O A;  3PE4 A;  1HX8 A;  4JL0 A;  4KXK B;  4MKT A;  3P2B A;  2WXQ A;  4A55 A;  3LBZ A;  4BKT B;  4J0U A;  3CQC B;  3OGK A;  1HZ4 A;  4I1M A;  4RSY A;  3TJP A;  3LKU A;  2FI7 A;  5EKQ D;  4FHJ A;  1T1D A;  4Y6W A;  3EHN A;  3ZYQ A;  2AXZ A;  3IHY A;  4BT8 A;  4CXI A;  3FUF A;  3ZRC B;  4B9K E;  4ATG A;  3O4Z A;  1HXI A;  1SZ9 A;  3QAQ A;  4L1B A;  4W9R A;  2LO6 A;  4U0Z A;  1UJJ A;  4HOT A;  1S0P A;  4WWN A;  1OWM A;  2VTB B;  3HYM B;  3LYA A;  3D9O A;  2I2R A;  2GRM A;  2HO1 A;  3FEY A;  1VDY A;  4XE0 A;  4YVO A;  5KCM A;  3S7F A;  4GCO A;  4CP3 A;  4HOS A;  2M63 A;  3SBT B;  2ZU6 B;  3FU0 A;  3LJ3 A;  3UUX A;  4LRZ A;  2ION A;  2IQC A;  3B7R L;  3FKC A;  5FQ6 A;  4BSX A;  3LEW A;  4XI0 A;  2PQN A;  1CS3 A;  2UY1 B;  1NN7 A;  3MA5 A;  3LY7 A;  5G04 J;  3G2U A;  3FTU A;  2VSY A;  3DRY A;  2YY9 A;  4N3C A;  4H7X A;  2AW6 A;  4G1T A;  3UT4 A;  4A3V A;  5LP0 A;  4EZJ A;  2VGX B;  4JTA B;  2P58 C;  1TJC A;  3MYV A;  5M72 A;  4HS2 A;  2A4Z A;  4PDX A;  2AVP A;  3FP3 A;  4B8C B;  5EUP A;  5FWQ A;  3JYS A;  3U9W A;  3ZTC B;  2WXO A;  4WWO A;  3RRN B;  4A1G A;  5ENN A;  4WAF A;  2FO7 A;  3C6O A;  4W9C B;  3ZYM A;  3LS8 A;  2WMN A;  2C0L A;  3VLF A;  1UN8 A;  4CCA A;  1HH8 A;  5FJY A;  3K9I A;  4U8H A;  3LUT B;  4HOR A;  5BW8 C;  3CHR A;  3ONK A;  2XPZ A;  4GZC A;  1XGW A;  2WQH A;  3D3M A;  2OND A;  5G2N A;  3SF4 A;  1DVP A;  1H19 A;  4ANV A;  4CGW A;  2XPY A;  3ZVV A;  4FA6 A;  4ANX A;  3C6P A;  3AS4 A;  4IN3 B;  5BO4 C;  3KS2 A;  4CDM A;  4K03 A;  3MKQ A;  1H2U A;  1E8Z A;  3PVL A;  4J8S A;  4N2Q A;  2VSO E;  1IHG A;  3B7T A;  3HTM A;  3SHF A;  4DLQ A;  5A6R A;  2OOE A;  3EJN A;  4W9E B;  4N3B A;  4WNG A;  4N3A A;  1E90 A;  1H2V C;  4CRW A;  1N54 A;  3ZHE B;  1BPO A;  4MRU A;  5LLI B;  4U77 A;  3UMV A;  1QDW A;  4EOZ A;  2XHE A;  2YQ8 A;  1EXB E;  3QJZ A;  3D9P A;  3FUM A;  3HHM A;  2OVB A;  2UWJ G;  3SI5 A;  3ZXS A;  5EX3 A;  1E8W A;  1JWF A;  3PNL B;  4J8E A;  4W9J B;  3L08 A;  4JVS A;  5FQ7 A;  1HS6 A;  1FQV B;  3ZTD B;  3D9N A;  3JQ1 A;  4WUY A;  4APO A;  5BPP A;  2P1M A;  3CIA A;  3CKC A;  4WWP A;  4V3I A;  4L7T A;  5LX8 A;  3L16 A;  4E6H A;  4R7L A;  4W9F B;  4HOU A;  3EHM A;  3LCA A;  5HYW B;  5BT1 A;  2LAH A;  3V7D A;  2VYI A;  4Q69 A;  2C2L A;  2I1J A;  3G2T A;  5G05 J;  3FUH A;  3U64 A;  2P1O A;  2PQR A;  3CK9 A;  4RG9 A;  2V4L A;  1ELW A;  2PPI A;  5CCM A;  2XRZ A;  2WXJ A;  3QK0 A;  4UQY A;  2FF4 A;  4M3O A;  5BNW A;  2E32 B;  2XQ0 A;  2OVP A;  3LPZ A;  2V5F A;  1HG5 A;  4TRQ A;  2FBN A;  2YIN A;  2OVQ A;  3DBS A;  2E2E A;  4B94 A;  1HU3 A;  3Q49 B;  2VPK A;  4CRH A;  1Y6I A;  4JEU A;  4GZD A;  1ZBP A;  5BUZ A;  2IJG X;  3CHO A;  3M5B A;  4KZ0 A;  3ZUN B;  5AJD A;  1R29 A;  4NRH B;  3VTX A;  4URK A;  3ASD A;  1EPU A;  3I5P A;  2NZ0 B;  3APF A;  1Z3X A;  3FH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...