3HVEB

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: gigaxoninbtb/3-box
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
195
Chain Sequence
DPQHAARLLRALSSFRERFCDAHLVEPVQKNILAAASPYIRTKLYKIELEGISVMVMREILDYIFSGQIRLEDIQDVVQAADLLLLTDLKTLCCEFLEGCIANCIGIRDFALHYCLHVHYLATEYLETHFRDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVHMKDVMSALWVSGSSYLREQMLNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, ligase
molecule keywords Gigaxonin
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 195
sequence length 231
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00651 BTB BTB/POZ domain
B PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hveB02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 3hveB01
3HVEA 3L2OA 4JTAB 1R29A 3ZUNB 5BXBA 4I6JC 3M8VA 3HTMA 4B95B 2NZ0B 2Q81A 4U2MA 2YY9A 4BKTB 3LBZA 1NEXA 1CS3A 3ZTCB 3OGMA 3MKSA 3DCGB 5HYWB 4W9KB 5H7GA 3ZRCB 1LQBB 1NN7A 1DSXA 3ZRFB 1R2BA 5BXDA 3HQIA 5JH5B 2ASTA 4W9DB 2P1OA 5DAFA 2OVPA 2VPKA 2ASSA 3V7DA 4CRHA 1A68A 3FKCA 5BXHA 5A6RA 4W9JB 2IHCA 5IBKA 4ZOUA 1R28A 3C6PA 3LNMB 2E31B 3OGKA 2MA9C 1EODA 4APFA 1QDVA 4AJYC 4B9KE 4W9HH 3I3NA 3B84A 3BIMA 3M5BA 4W9CB 4W9HB 2C9WC 4W9GB 2IZVC 2Z8HA 1P22B 1T1DA 5FTAA 2VKPA 4EOZA 1FQVB 4B9KB 3HVEB 5LLIB 3ZKJB 4W9LB 1QDWA 2OVRA 4UIJA 5DADA 3LUTB 4JGHC 2R9RB 3M52A 3OHVA 4W9EB 2E32B 5HZGC 4BGCA 4J8ZA 4W9IB 1S1GA 2I2RA 4W9FB 2JZ3C 1EXBE 3C6NA 4AWJB 3DRZA 3ZNGB 4HS2A 5A15A 1LM8C 4JTDB 3HU6A 3KVTA 4BKSB 5EUPA 4CXJA 2PPIA 5BO4C 1EOEA 4JTCB 4UYIA 3M4TA 4WQOC 3WSOB 1VCBB 4U2NA 3C6OA 2IF5A 2OVQA 2P1PA 3OHUA 3GA1A 5H7HA 4N9F5 4AP2A 2EQXA 4CXIA 4CP3A 1LDKD 1FS2B 2P1NA 4HXIA 3OGLA 3ZTDB 2A79B 3E4UA 2P1MA 1EOFA 4CXTA 4U77A 1HV2A 1BUOA 2NN2A 2P1QA 1FS1B 2FNJC
chains in the Genus database with same CATH superfamily
3L2OA 3NOGD 3EU9A 2Q7FA 3SHFA 5ENRD 3LVQE 2WXJA 5H7GA 3DWLG 4L1BA 1N0QA 4APOA 5A6CA 1OUVA 3T8MA 2AWIA 2P1OA 3ZNGA 5H7PA 4HORA 3Q7FA 2IHCA 1JWFA 3MGBA 3URZA 3MCXA 1HG5A 4LNUD 4AJYC 2CHXA 5AJLA 3U9WA 1S64A 4DX7D 5FQ8A 3UKRG 3LVRE 4W9HB 4W9GB 2V8SE 3FUHA 4JXTA 5FQ7A 2VKPA 5D0OD 5D2MC 2JEKA 4OVUA 3RAUA 1MX2A 2VGXA 2LSUA 3LUTB 5CHEE 5FZSA 2P9IG 2LAHA 2KCKA 2EIME 3O48A 2KC7A 3TWSA 1U3CA 2BKGA 1KT0A 3PEVB 5CEAA 4GU5A 5ANRA 2GRQB 4XKBA 4B8CB 5IY5E 4YVQC 5CECB 2OOEA 2C0MA 2XCBA 2XPIA 3TAXA 1KLXA 1V55E 1LD7A 2X6JA 1DC2A 1NL4A 2Y69E 1TNBA 4JTCB 1X81A 3RSEG 3IBEA 3JQ1A 2CG3A 2HO1A 2ZU6B 1E7UA 4DPRA 4JA9A 3UKUG 4CDMA 4V3IA 5ARGA 1P5QA 3UT7A 4RSYA 5M72A 4XI0A 1IQRA 4KZCA 4LG6A 1YYHA 5HYWB 2HYZA 4OAVB 3T5VA 3G2SA 4FLBA 4JPSA 5AQ7A 4XIFA 3C72A 4PS8A 5ARFA 4XKCA 1KZOA 4U95D 4J6IA 3AG3E 4KXKB 4I6EA 5JMND 3CQGB 1H0AA 3RU0A 3EUVA 1ELRA 2XCCA 1UJKA 2XS8A 2J07A 5T8IA 4B93B 3I3NA 5B1BE 3B84A 5JJTA 1TN6A 2QC9A 2IONA 4I9EA 5D0QD 3C3QA 3PZDA 1YCSB 5LP0A 4KVOA 4JGHC 3OHVA 1UN9A 1XNFA 4J8ZA 1E8XA 2WXRA 5ENSD 3MV3B 5EYPF 3HRAA 3UM1A 4Y6WA 2Y0BG 1LD8A 3JUIA 2WXKA 2VTBB 5G04C 2XPYA 3PUKA 3TXMA 3BEEA 1HF8A 4CGWA 2WB2A 4F7AA 3Q9NC 3L6AA 1HE8A 3PH0C 5BO4C 2IY0C 2VGYA 1U3DA 4F3VA 3J5QB 4L9PA 4G8LA 2EIJE 2LAIA 1TYQG 5H7HA 4PDXA 2XEHA 4DX6D 3JXIA 1IKND 1TJFA 1QNFA 4OYSA 4FLHA 4JVSA 4HFGA 3ULEG 3FY4A 5BXBA 2IF4A 4TUUA 2P2CP 5AQBA 4I1OB 4A3VA 4GZCA 1PAQA 4J8SA 5ENTD 1OWPA 2PM6A 4GPMA 4IULA 2XGSA 2OVPA 5J08A 4L2LA 3T9KA 2LO6A 4AXHA 2GRNB 3ZHEA 1BU9A 3EDTB 3TWTA 4GZDA 3B7UX 3SD5A 3DEPA 3DPYA 3CVQA 2Z8HA 1O1RA 5AARA 4W9LB 1UW4B 5CEDB 1N4PA 2J9QA 3D9IA 3ZEFA 1N11A 3RRNB 5AN8A 3OXFA 2WXOA 4J8YA 4OAUC 1NA0A 4I43A 3V30A 1HG2A 3ISMC 3DEOA 3ZNGB 4B94A 2WXGA 3E30A 1HZ4A 4N3AA 2PQRA 1LF8A 4DJAA 2ETAA 1UG3A 3LPZA 2IO3C 5FQ4A 3R9MA 2P9SG 2ZIRA 3RRUA 4YDOA 3FTSA 2JABA 3PZ2A 3GZ1A 4TXRA 4ATGA 4P29A 2VYIA 2XGMA 3UTMA 4UQXA 2P1MA 4FADA 4Q69A 3ZKJA 3Q47B 1IHGA 2VGXB 4CT0A 4LUNU 2FO1E 5G04J 1NEXA 2IU1A 5DBKA 4JA7A 4GYWA 2XGOA 1YA0A 2XRZA 1R2BA 4ANWA 3CLJA 3PZ1A 4F1PA 4HNAD 3CQCB 3NBNB 1VDYA 3Q79A 2LUHA 5HRYA 4LERA 2A5EA 3SBTB 3L16A 1K3ZD 1G3NB 3UI2A 3CVWA 2X38A 3D9MA 4LSZE 1IYGA 3CK9A 3KSLA 1JWGA 3FTXA 2P9NG 2WQHA 4B9KB 4Q94A 3NB2A 1ZBPA 3KEZA 3AAAC 3K9IA 3DXMG 2R2LA 3DSSA 3PRZA 4A1SA 1LTXA 4GTVA 3UUXA 4C0EA 2DZOA 4LNGA 1KT1A 3B7TA 3V2OA 3HXDA 1HS6A 1N95A 4U7EB 4HOUA 1O1SA 5FZRA 2LXLA 1OWOA 3TL5A 4DI4A 1OT8A 4UWFA 4AEZC 2OEVA 1DCQA 3EU5A 3FU0A 2WQ7A 4B89A 4ME2A 4AP2A 4O1OA 4CYMD 1HH8A 3L9TA 3R7RA 3ZTDB 2WXNA 4N2QA 1Y8MA 4GTSA 4GZ6A 4DX5D 4CXTA 1EF1C 3IXEA 3JXJA 4U2MA 3LBZA 1FVHA 3DCGB 3PS6A 3SFZA 3TWUA 1FPPA 4I9CA 3FTYA 4AIFA 4E6HA 1NN7A 3G2WA 3RJVA 4W9DB 3EIJA 3MX3A 3UQ3A 5BT1A 1E8WA 2Y1LE 4B8AA 4CRHA 2WXHA 3ZPJA 3BUAA 4I2ZA 1AWCB 4WWNA 3HG0D 3AG4E 5CERB 3QK0A 4EBAG 3M5BA 4M7CA 2C9WC 5ENQD 1XGWA 4AVXA 3PE3A 3PZ4A 3RO2A 3ZRHA 4JHKA 2BF0X 3MZLB 4N2SA 4R7LA 4BETA 3VLDA 1DNPA 1K8KG 3CVNA 2VSXE 3LY8A 4DX1A 4WNDA 5BPPA 2XPZA 1N94A 3LEWA 2X6FA 3NOCD 4UI9K 2UY1A 2L9BA 4HLLA 4CEMA 3OXLA 2ZGDA 1WDYA 2WMNA 3QOUA 2Y4TA 2H6FA 3FDHA 3CEQA 4F1SA 3F6QA 1NFIE 1LDKD 3S7DA 4GA1A 1HO8A 3HDXA 1ELWA 3EJNA 3P2BA 1TJCA 3D9PA 3ZUNB 3UT8A 1Q2ZA 4HI8A 2UWJG 3OGMA 4WWPA 3AU4A 3FUJA 2R5SA 1INZA 4KT6B 4CT4A 1PC2A 2CFUA 1A68A 5G05J 3LS8A 5EDSA 3ASDA 2PNNA 4ILIA 4WNGA 3CKCA 1MHQA 3X2QE 4B0ZA 3LDZA 1EODA 3PZ3A 5BXUA 2PZIA 5B3SE 5KJKA 5G2NA 4GA2A 2A4ZA 3DSWA 2KM4A 5ITZF 4O6FA 2X6IA 3MYVA 1P22B 2P9LG 3DSUA 4EZKA 1Z6TA 3ZKJB 4HBDA 2L6BA 4JEUA 2R17C 1BD8A 3ZUVB 2LXMA 3QWVA 4AJWA 4CRWA 5JJ7A 3GW4A 2WXIA 2CFZA 4AOFA 3TG4A 4HS2A 1E8YA 2VGEA 3JYSA 4IYPA 3S2AA 5JJ6A 2BEDA 2KXPC 1H6OA 3FEXA 2AXZA 3FTVA 4FHJA 3C6OA 4G11A 3FUMA 4BERA 3OHUA 3CK8A 2EQXA 4G24A 4NIKA 3ZFWA 3E34A 2H6IA 2V4HC 4EQFA 3D9NA 3AS5A 2BTDA 3HTMA 3W9GA 3R9AB 3B7SA 2DCPA 2Y3AA 3VLFA 1HU3A 3CVXA 2F37A 3CKBA 3FUEA 2NSZA 3TGOA 4J8EA 3R7QA 4M3OA 1SZAA 4UWKA 2F8YA 4JD2G 4BT9A 3Q7AA 3FU6A 3Q15A 5IBKA 3TG5A 5HS0A 3HXCA 4AV7A 2WXFA 4DX2A 3SBSA 4W9HH 3UM3A 2XHEA 4KVMA 4W9CB 3MKRA 2X6KA 2ZGGA 2DYRE 1OWLA 3ZXSA 5KJMA 4UIJA 4UI9J 4ANVA 5KCMA 4JW1A 1WG0A 4RQIA 3IKOB 4TRQA 2J4DA 2KCLA 2MHKA 3JUEA 1S1GA 2RFMA 1H2TC 3ASFA 5AJDA 2JZ3C 3SQVA 1EPUA 4BEPA 4G2VA 4N39A 2FF4A 4URKA 2XRYA 1OXJA 3KD7A 3C3RA 3KVTA 2WM9A 3TWRA 2WXPA 2PPIA 2WQ6A 2WMOA 4UYIA 3QB2A 4UQYA 3PEUB 2OVQA 3TWXA 3ASGA 1N9AA 4WNEA 4YY8A 5EN5D 4U0ZA 1HV2A 3FTWA 2P1QA 1ZB1A 2GRMA 4I1AA 4CDRA 4HLEA 3APCA 3LY7A 4FA6A 4N5CA 3T5XA 2PQNA 1GW6A 3ZRFB 3LCAA 1N4RA 3L22A 3UIPC 2IEJA 3Q75A 1KZPA 3UX4A 4JEHA 5C1DA 5CBNA 4PS3A 2UY1B 3ASNE 3WXXA 3Q73A 1D8EA 1E7VA 4JZYA 4PUCA 3LNMB 3I5PA 1MX6A 4B9KE 2HR2A 1BI7B 3L13A 3FEYA 3BIMA 2DZNA 2A5UA 2KATA 2MRIA 2OV8A 4U0UA 4GPKA 2CG2A 2J8SD 3E32A 5KWDA 3FUIA 1YMPA 4HOSA 2FI7A 2I1KA 3PNTB 3QJZA 3NQPA 4JB8P 3ESKA 1QDWA 1IQUA 1TNUA 1JUQA 4RLYA 3EHMA 2MYOA 4JHRA 3CVLA 1FT1A 2V0PA 3CHQA 4K5BA 5E75A 4MS6A 3J5PA 1DCEA 1SQMA 5LCWC 1S0PA 3ULQA 3UXGA 3V2XA 3ASHA 1WAO1 3CVVA 3NAWA 3DRXA 3DPDA 5JHBA 1Y6IA 2YHCA 4JHJA 1Z3XA 2YNQA 2I2OA 1N0RA 4BX8A 3L17A 4GZ5A 4CP3A 3GZSA 5EKQD 2A79B 1BUOA 2NN2A 1R29A 5G55A 2AJAA 5CMWA 2WXLA 2AW6A 1OY3D 3RK6A 3FTZA 3ZTCB 4U07A 4LRZA 3ENEA 4ANXA 3AG2E 1LQBB 2J49A 3HQIA 1HXIA 4HRLA 1BPOA 1MYOA 2FULA 3RIBA 4UUCA 4XI9A 5AYWD 3S7JA 1ZU2A 2WXQA 3MA5A 1TNOA 1EDUA 5EIDA 3TWQA 2FBNA 3DRAA 1FQVB 2MOWA 2KBXA 1JCQA 4G26A 1TR4A 4NURA 1JCRA 4KBQA 3G2TA 1PY1A 2XENA 5KBAA 4EZJA 2AVPA 1E8ZA 4U8HA 4TXPA 3G2UA 1FCHA 1E96B 3Q78A 2I2RA 4J8FA 4G25A 4AWJB 3AJIA 2IQCA 2Y4UA 3ZU7B 3D9JA 5KJNA 2WVIA 1TNYA 3NZUA 1OWNA 3FUFA 3M4TA 2F0YA 3DXKG 2H6HA 4UWGA 3MKQA 3OAWA 4FC8A 1FS2B 3Q5MA 3NZSA 4U8VD 5E76A 2QYUA 4FJYA 4XX5A 3ZW3A 5CCMA 3HVEA 1Z3YA 3ABLE 4I6GA 3LKUA 2NZ0B 3FUKA 5LCWJ 3PDNA 4GTTA 4J8DA 3LJ3A 2OVFA 3FUDA 4L23A 1H19A 2ASTA 2QYJA 3SI5A 3SGHA 3UM2A 4A63B 2YINA 4W9JB 4ZOUA 4GTPA 1IHBA 2LSVA 3KEAA 1K1BA 1SZ9A 3EHQA 1JPLA 3RKVA 2NXPA 2GGFA 2V5FA 4WNFA 4FP7A 3I4GA 5BXOA 2X6HA 3C3OA 3ZGQA 4W9EB 4BFRA 4CCAA 3Q49B 3APDA 1Z5SC 1SA5A 3ZXPA 5KNGA 2XS1A 1KPSB 4W9IB 3S7BA 4BTBA 2IO2C 4FHKA 3KS2A 1RZ4A 3PUJA 2B6CA 4KZ0A 3UMVA 3L54A 3U4TA 4YDWA 2R02A 3QNKA 4UWHA 4LCTA 3D9HA 3U66A 2P1PA 1NZNA 3HXFA 4ACLA 4C9BB 2P1NA 5EYLA 3E4UA 3B13A 3ZYQA 4W9RA 5HQ8A 1S70B 4PS7A 4G8KA 2ONDA 3AU5A 4H7YA 4O60A 4BKTB 2L0IA 3ZHEB 3CR3A 3MKSA 4QQIA 5J90A 4NQ0A 4I6JA 4JC8A 3TXNA 2DWZA 1S63A 4EECA 2CHZA 2E0IA 4UWLA 4PH4B 5KJLA 4UQZA 4CZ2D 3FKCA 5A6RA 3N71A 3QC1A 2FO7A 3V31A 1R28A 3IHVA 1OWMA 3FH7A 2XEVA 4HB5A 1QDVA 2VSYA 5ENNA 5FQ6A 2GRPB 3GZ2A 4GAAA 1DVPA 2IZVC 3UM0A 5EILA 1O1TA 2P9UG 2OVRA 4NRHB 2XZTG 2AXUA 3EIQC 1MZCA 1E90A 2QY7A 2E32B 2XEEA 5HZGC 2P9PG 3CIAA 3E4BA 5FWQA 2NC9A 4GCOA 3TWWA 3ML8A 5A23A 2ETBA 3SZ7A 3SO8A 2PM7A 4BTAA 1OCOE 5CRUA 3CVUA 4FU3A 3SFXA 4DLQA 1SA4A 2H6GA 2XQ0A 4BKSB 4K5CA 2DIWA 2I9CA 4RG6A 5FT9A 1BI8B 4OVVA 4EHMA 1VCBB 3GA1A 3WG7E 4CXIA 4MBGA 2PL2A 3OTNA 2F8XK 2WPVA 1D8DA 4BSXA 3ML9A 2J4BA 4HQDA 2R05A 3HXEA 1N4SA 5FINA 3FH8A 4JTAB 3D9LA 2Q81A 2VSNA 4XZ4A 3AG1E 4HOTA 2GROB 1TN7A 4W9KB 3ZRCB 4GMLA 3E37A 2QFCA 1MX4A 4A55A 4DLOA 4C0MA 3QAQA 3ZYLA 3EHRA 3DSXA 3LJNA 4YVOA 1X5BA 3MV2B 3C6PA 3LXUX 4ATZD 3SFYA 3OGKA 1FT2A 4H7XA 4GTOA 1D9SA 3D3MA 3MKQB 3ULYA 3LY9A 4N3BA 3ASOE 4L2YA 1HX8A 4K5AB 1MQSA 3SNXA 3HVEB 3BQOA 4LEUA 2R59A 1OCCE 4E85A 4JL0A 1TN8A 4BSZB 3CK7A 2RFAA 3CHRA 3HHMA 1H2VC 1WY6A 4U96D 2ETCA 3OXGA 2GRLA 3W9FA 4BWRA 3DRZA 2L6JA 5T3RA 2IOLA 3CHSA 4ZGCA 3KSQA 1LM8C 2V5QC 2J09A 3FWVA 3L08A 3UPVA 2EINE 4IRUA 4DRXE 2OVBA 1EOEA 2IOSA 2X3MA 2KCVA 2KZTA 3C98A 4U2NA 1A5EA 3DSTA 1K1AA 4O1PA 3C5RA 1O5MA 4HXIA 3OGLA 2GRRB 4CDNA 2DVWA 3O4ZA 4I6JC 4YDYA 3APFA 2YHEA 3PVLA 3S7FA 4HI9A 4LNBA 5BXDA 5EX3A 5JH5B 3D9KA 2DBAA 3FFLA 4BX9A 4K03A 3RRMB 5BXHA 5AAOA 1QZ2A 4HOQA 1HFAA 5JA4D 1UJJA 4Z68A 4U04A 1T1DA 5FTAA 4TUMA 4EOZA 3B95A 5LLIB 3ZVVA 2R9RB 3VTYA 4CGVA 3BG0B 3E33A 5D66A 3DSVA 1B89A 5LOZA 3CHPA 2XZDG 4DUIA 5A15A 5HI7A 3DRYA 4K0RA 4GCNA 3AS4A 4GTRA 5C2YA 1BLXB 4GTMA 2IFUA 4WQOC 1JCSA 2HM8A 3CVYA 3ESLA 3HIZA 4GZ3A 1V54E 1NI1A 2YQ8A 5BNWA 4DI3A 2FNJC 5B1AE 3HXBA 3CV0A 4YNDA 3IHYA 3VTXA 3CHMA 2I1JA 2RD0A 2V4LA 2DYSE 5ANLA 2P9KG 4MKTA 3PREA 4HRNA 1FVFA 4GMRA 1N52A 1EYHA 2IJGX 3TWVA 3CVPA 4G1TA 4FULA 3CSTA 3PE4A 2P58C 3U64A 1N54A 2CHWA 3KAEA 4HRMB 4J0UA 1H2UA 5JHAA 4N3CA 4GTQA 5AIJA 1UN8A 2M63A 3M52A 3DBSA 5CCLA 3UT4A 3RO3A 1TNZA 3FHEA 4ANUA 4BGCA 4KYOB 1NP7A 4QFVA 3NF1A 4WWOA 3T8KA 1EXBE 2ZISA 3CHOA 1ELKA 1MJ0A 2QZAA 4JTDB 3HU6A 3Q9UC 3BG1B 2VJ8A 4ILHB 5CMYA 5DIZA 3WSOB 5BW8C 2IF5A 4RVBA 2OCCE 2WXMA 3L82A 4ABNA 1AP7A 5CRVA 5AQAA 4U8YD 3JCKC 1FS1B 1SVXA 2RKKA 2RG8A 3ZYMA 3M8VA 2ILRA 4I2WA 2JLBA 5ENPD 2BUGA 3TJPA 1DSXA 3FU3A 4EBAA 4Y6CA 3G2VA 3MJWA 3U3WA 2FEZA 2LNIA 4G23A 4DK5A 4I1MA 5BV0A 2VPKA 3V7DA 2ZXWE 3FU5A 4ACKA 2J08A 3QWPA 1L5JA 2E31B 2KZTB 4APFA 5AQ9A 4GYOA 3ABKE 4D10C 4EPZA 4WUYA 5A7DB 4AM9A 1UOHA 4I17A 4IN3B 2GW1A 5LFAA 2EILE 1NA3A 4RG9A 4MRUA 4BY6A 3SF4A 3UINC 4GA0A 4AY5A 4BESA 2R03A 3QDNA 5BUZA 3D9OA 2C0LA 3Q4AB 5G05C 5AENA 3FP3A 3V79K 2I6HA 3C6NA 5HKPA 3CSFA 3UIOC 3FTUA 5EUPA 4CXJA 2C2LA 4KMOA 2NYJA 4GMJA 1SW6A 3BU8A 4F53A 3FUNA 3FULA 4ILGA 3MEKA 2L0TB 4ZHBA 1OCRE 4X8QA 4L7TA 4EZLA 3GYZA 4FJZA 4YDEA 5FZQA 5BV1A 4B95B 4J7WA 2YY9A 3LYAA 4C48B 3ZYKA 1CS3A 3CGHA 5FIOA 1H6KA 3JQ0A 3HYMB 5CBOA 1RW2A 3ABME 1QYMA 2E2EA 2HE0A 4U0SA 4XE0A 4F6RD 4MLPA 1QBQA 3QARA 5DAFA 2VTBA 2ASSA 3ONLA 4NACA 5T4YA 1W3BA 1TEZA 5FTPA 3P1UA 2MA9C 2B0OE 2BKKB 4TV3A 4BT8A 4HVBA 4XEIG 5EIBE 1A17A 3ZIMA 2EIKE 5LX8A 3B7RL 4AY6A 1QQEA 3QKYA 5DADA 3SY2A 1OCZE 4GB9A 2AXVA 3ZN3A 1U2VG 3EHNA 1H6PA 3IV0A 4U63A 3FH5A 4W9FB 4GYYA 5KNHD 3I4RB 2VSOE 3VLEA 4TXQA 5ENOD 3PNLB 4A1GA 5EX0A 3QWWA 2OEWA 4N9F5 5FJYA 4N5QA 1N4QA 4UI9C 4Q96A 4WAFA 2VQ2A 4ZFHA 3ONKA 1EOFA 1WM5A 3B7BA 4U77A 4A3TA 3IEGA 1IXVA 3AS8A
chains in the Genus database with same CATH topology
3L2OA 1R29A 1EF1C 5G55A 3O4ZA 4I6JC 4U2MA 5CMWA 2WXLA 2AW6A 2Q7FA 3RK6A 3LBZA 3SHFA 1FVHA 3FTZA 3ZTCB 3DCGB 3PS6A 4LRZA 3APFA 2YHEA 3ENEA 3LVQE 2WXJA 3PVLA 4I9CA 4U07A 3S7FA 4ANXA 3FTYA 4AIFA 1LQBB 4L1BA 4E6HA 1NN7A 3G2WA 4APOA 5A6CA 5BXDA 2J49A 1OUVA 5EX3A 3RJVA 3HQIA 3T8MA 1HXIA 5JH5B 4W9DB 3EIJA 3MX3A 1BPOA 3UQ3A 2AWIA 2P1OA 3D9KA 2DBAA 5BT1A 3FFLA 4BX9A 4K03A 1E8WA 4B8AA 4CRHA 3RRMB 5BXHA 2WXHA 3ZPJA 4HORA 2IHCA 1JWFA 1QZ2A 2FULA 3MGBA 4HOQA 4I2ZA 3RIBA 4WWNA 3URZA 3MCXA 1HG5A 4XI9A 5AYWD 1HFAA 3QK0A 3S7JA 4EBAG 1ZU2A 4AJYC 2CHXA 2WXQA 5AJLA 3U9WA 3MA5A 3M5BA 5FQ8A 1EDUA 3LVRE 4W9HB 1UJJA 2C9WC 4W9GB 4U04A 2V8SE 1T1DA 5FTAA 2FBNA 3FUHA 4JXTA 1XGWA 5FQ7A 2VKPA 4EOZA 5D0OD 4AVXA 3PE3A 1FQVB 3RO2A 2JEKA 2MOWA 3ZRHA 4OVUA 4JHKA 5LLIB 4G26A 4NURA 3ZVVA 2VGXA 2LSUA 2BF0X 3MZLB 2R9RB 3LUTB 4KBQA 5CHEE 5FZSA 3G2TA 3VTYA 4N2SA 2LAHA 4R7LA 2KCKA 3VLDA 1PY1A 3O48A 1DNPA 4CGVA 2KC7A 3BG0B 4EZJA 1U3CA 2AVPA 3CVNA 1E8ZA 4U8HA 1KT0A 1B89A 2VSXE 3PEVB 3LY8A 3G2UA 1FCHA 1E96B 4GU5A 5ANRA 2I2RA 4J8FA 4G25A 4XKBA 5LOZA 4B8CB 4AWJB 3CHPA 4WNDA 4YVQC 5BPPA 2OOEA 2XPZA 2C0MA 3LEWA 2XCBA 5A15A 5HI7A 3DRYA 2XPIA 4GCNA 2X6FA 4K0RA 2IQCA 2Y4UA 3TAXA 4UI9K 1KLXA 2UY1A 2L9BA 3AS4A 2X6JA 3D9JA 4CEMA 3OXLA 5C2YA 5KJNA 2WVIA 2WMNA 3NZUA 1OWNA 3FUFA 4JTCB 2IFUA 3QOUA 3M4TA 3CVYA 2HM8A 3IBEA 4WQOC 3JQ1A 3ESLA 2CG3A 2Y4TA 4UWGA 2HO1A 2ZU6B 1E7UA 3HIZA 3FDHA 3CEQA 4DPRA 4JA9A 3MKQA 3OAWA 4FC8A 4GZ3A 4F1SA 1LDKD 4CDMA 1FS2B 3Q5MA 3NZSA 2YQ8A 3S7DA 4GA1A 4V3IA 5E76A 1HO8A 5ARGA 3HDXA 5BNWA 1ELWA 1P5QA 3UT7A 4DI3A 3EJNA 4FJYA 4XX5A 3ZW3A 5CCMA 3P2BA 1TJCA 2FNJC 3D9PA 3HVEA 1Z3YA 3CV0A 3ZUNB 4RSYA 4YNDA 3UT8A 4I6GA 3LKUA 2NZ0B 5M72A 3FUKA 4XI0A 1IQRA 3IHYA 4KZCA 5LCWJ 2UWJG 3OGMA 3PDNA 4WWPA 5HYWB 3VTXA 3CHMA 2HYZA 4J8DA 3T5VA 3G2SA 2I1JA 2OVFA 3AU4A 3LJ3A 2RD0A 3FUJA 4FLBA 4JPSA 3FUDA 4XIFA 4L23A 2V4LA 4PS8A 5ARFA 2R5SA 1H19A 5ANLA 4XKCA 2ASTA 1INZA 4KT6B 4MKTA 3PREA 1FVFA 4CT4A 1PC2A 2CFUA 4J6IA 1N52A 3SI5A 3SGHA 1A68A 1EYHA 2IJGX 5G05J 2YINA 3LS8A 4KXKB 5EDSA 4I6EA 4W9JB 4ZOUA 3CQGB 3ASDA 1H0AA 3RU0A 3CVPA 4ILIA 1ELRA 4G1TA 2XCCA 4WNGA 1UJKA 4FULA 2LSVA 3CKCA 1MHQA 4B0ZA 3LDZA 1EODA 3CSTA 2J07A 3PE4A 5T8IA 2P58C 3U64A 2PZIA 1N54A 5KJKA 5G2NA 2CHWA 3KAEA 3I3NA 3B84A 4GA2A 2A4ZA 5JJTA 1SZ9A 1JPLA 2KM4A 4J0UA 4O6FA 1H2UA 2X6IA 3MYVA 3RKVA 5JHAA 1P22B 2NXPA 4N3CA 2IONA 4I9EA 5AIJA 5D0QD 4EZKA 1Z6TA 1UN8A 2GGFA 2V5FA 3PZDA 2M63A 3ZKJB 4WNFA 4FP7A 5LP0A 4KVOA 3I4GA 4JGHC 3M52A 4JEUA 3DBSA 2R17C 2X6HA 5CCLA 3UT4A 1UN9A 1XNFA 3ZGQA 3OHVA 4W9EB 4BFRA 3RO3A 4CCAA 3Q49B 3APDA 3FHEA 4ANUA 1E8XA 3QWVA 4AJWA 4KYOB 4J8ZA 4BGCA 1NP7A 2WXRA 4CRWA 4W9IB 3MV3B 5JJ7A 3GW4A 4QFVA 3NF1A 2WXIA 2CFZA 3S7BA 4WWOA 4Y6WA 1EXBE 4AOFA 3JUIA 3TG4A 3CHOA 2WXKA 4HS2A 5G04C 2VTBB 2XPYA 3PUKA 4BTBA 3TXMA 3BEEA 1HF8A 1ELKA 1E8YA 3JYSA 3KS2A 4FHKA 4CGWA 2WB2A 4IYPA 3HU6A 4F7AA 3S2AA 4JTDB 3PUJA 3BG1B 5JJ6A 4KZ0A 3L6AA 3UMVA 3L54A 1HE8A 3PH0C 3FEXA 2AXZA 5BO4C 2VJ8A 3U4TA 2VGYA 1U3DA 4F3VA 3FTVA 4ILHB 5CMYA 4FHJA 3QNKA 5DIZA 3WSOB 5BW8C 4UWHA 2LAIA 2IF5A 4G11A 3C6OA 4LCTA 3FUMA 4RVBA 3U66A 1NZNA 2WXMA 4PDXA 2P1PA 3OHUA 3CK8A 4ABNA 5H7HA 2EQXA 4ACLA 4G24A 1TJFA 4C9BB 2P1NA 3ZFWA 1QNFA 3E4UA 3JCKC 3B13A 4OYSA 3ZYQA 4W9RA 4EQFA 3D9NA 5HQ8A 1FS1B 4FLHA 4JVSA 3AS5A 2BTDA 2RG8A 4PS7A 3ZYMA 4HFGA 5BXBA 3FY4A 3M8VA 3HTMA 2ONDA 3R9AB 3AU5A 2ILRA 3B7SA 2DCPA 2Y3AA 4H7YA 3VLFA 4BKTB 1HU3A 2L0IA 2IF4A 4I2WA 2JLBA 3CR3A 2BUGA 3CKBA 4TUUA 3ZHEB 3TJPA 3FUEA 3MKSA 2NSZA 4I1OB 4J8EA 3TGOA 4A3VA 5J90A 1DSXA 3FU3A 4GZCA 4EBAA 1PAQA 3R7QA 4J8SA 4I6JA 1SZAA 4JC8A 4M3OA 4NQ0A 4Y6CA 3TXNA 1OWPA 2PM6A 3G2VA 3MJWA 3U3WA 4EECA 2FEZA 2CHZA 2LNIA 4UWKA 4G23A 4IULA 2E0IA 2XGSA 4UWLA 2OVPA 4DK5A 4BT9A 5J08A 4I1MA 4PH4B 5BV0A 5KJLA 2VPKA 3V7DA 4UQZA 4L2LA 3FU5A 3FKCA 2LO6A 4ACKA 5A6RA 3FU6A 3Q15A 5IBKA 2J08A 3N71A 3QC1A 3TG5A 2FO7A 1R28A 4AXHA 3QWPA 3ZHEA 3IHVA 1L5JA 1OWMA 3FH7A 2E31B 3EDTB 2KZTB 2XEVA 4APFA 4AV7A 2VSYA 2WXFA 4GYOA 1QDVA 4D10C 3SBSA 4W9HH 4GZDA 4EPZA 4WUYA 3B7UX 5ENNA 5FQ6A 5A7DB 4AM9A 3GZ2A 2XHEA 4GAAA 4KVMA 3SD5A 4W9CB 3MKRA 3CVQA 4I17A 4IN3B 1DVPA 2IZVC 2Z8HA 2X6KA 2GW1A 3CVXA 5LFAA 5H7GA 1NA3A 1OWLA 4W9LB 4RG9A 4MRUA 1UW4B 3ZXSA 4BY6A 5KJMA 4NRHB 2OVRA 4UIJA 2AXUA 3EIQC 4UI9J 3SF4A 4ANVA 2J9QA 4GA0A 4AY5A 3D9IA 5KCMA 3ZEFA 1E90A 2QY7A 2E32B 4JW1A 5HZGC 5BUZA 3QDNA 3IKOB 3D9OA 2C0LA 3Q4AB 4TRQA 3RRNB 5G05C 2J4DA 3OXFA 2WXOA 3CIAA 2KCLA 2MHKA 3E4BA 3FP3A 1NA0A 5AENA 5FWQA 2NC9A 4GCOA 1S1GA 3ML8A 4I43A 5A23A 1H2TC 3ASFA 5AJDA 3SZ7A 2JZ3C 1EPUA 2I6HA 2PM7A 4BTAA 3C6NA 1HG2A 4G2VA 3CVUA 3ZNGB 4N39A 4FU3A 4B94A 2FF4A 3CSFA 4DLQA 4URKA 2WXGA 2XRYA 1HZ4A 3KD7A 4N3AA 3KVTA 2PQRA 1LF8A 2WM9A 2XQ0A 4DJAA 3FTUA 1UG3A 2WXPA 3LPZA 5EUPA 4BKSB 5FQ4A 4CXJA 2PPIA 2WQ6A 2C2LA 2DIWA 2WMOA 4KMOA 4UYIA 2I9CA 4RG6A 3RRUA 4GMJA 5FT9A 3QB2A 3FTSA 4OVVA 1VCBB 3GZ1A 3PEUB 4UQYA 4ATGA 2OVQA 4F53A 3GA1A 3FUNA 4P29A 3FULA 4ILGA 3MEKA 4CXIA 2VYIA 3ASGA 2PL2A 2L0TB 3OTNA 2WPVA 4WNEA 4YY8A 2XGMA 4BSXA 4UQXA 2P1MA 3ML9A 2J4BA 4L7TA 4U0ZA 4EZLA 1HV2A 3FTWA 2P1QA 4FADA 3GYZA 3FH8A 4FJZA 2GRMA 4I1AA 5FZQA 3D9LA 4CDRA 4Q69A 3Q47B 4HLEA 5BV1A 4JTAB 1IHGA 2VGXB 3APCA 4CT0A 2Q81A 2VSNA 4B95B 4LUNU 2YY9A 4XZ4A 3LY7A 4FA6A 3LYAA 4HOTA 3ZYKA 5G04J 1NEXA 1CS3A 4N5CA 2IU1A 3CGHA 4JA7A 5DBKA 3T5XA 3SFZA 2PQNA 1H6KA 4W9KB 3JQ0A 3HYMB 1GW6A 3ZRCB 4GYWA 3ZRFB 3LCAA 4GMLA 2XGOA 1YA0A 2XRZA 2E2EA 4U0SA 1R2BA 4XE0A 4ANWA 4MLPA 3L22A 2QFCA 3QARA 4A55A 3CLJA 4DLOA 3UX4A 4C0MA 5DAFA 3QAQA 3ZYLA 2VTBA 4JEHA 5C1DA 2ASSA 3CQCB 3ONLA 4PS3A 2UY1B 4NACA 1VDYA 5T4YA 3WXXA 4YVOA 1W3BA 4LERA 1X5BA 3MV2B 1TEZA 5FTPA 1E7VA 3P1UA 4JZYA 3C6PA 3LXUX 4PUCA 3L16A 3SBTB 3LNMB 3OGKA 2MA9C 3I5PA 4B9KE 2HR2A 4H7XA 3L13A 4TV3A 3FEYA 3BIMA 3CVWA 3D3MA 2A5UA 2KATA 2MRIA 2OV8A 3MKQB 4U0UA 4GPKA 4BT8A 4HVBA 3LY9A 2CG2A 4N3BA 2X38A 4L2YA 3D9MA 1HX8A 1A17A 3FUIA 1MQSA 3SNXA 3ZIMA 1IYGA 3CK9A 5LX8A 4HOSA 1JWGA 2FI7A 2I1KA 3FTXA 3PNTB 2WQHA 3QJZA 4B9KB 3B7RL 3HVEB 3NQPA 4LEUA 4Q94A 3ESKA 4AY6A 2R59A 1QDWA 1IQUA 1QQEA 3QKYA 4E85A 1ZBPA 5DADA 4JL0A 1JUQA 3KEZA 3K9IA 4GB9A 2AXVA 3ZN3A 3PRZA 3EHMA 3CK7A 4A1SA 3EHNA 3CHRA 3HHMA 1H2VC 1WY6A 3IV0A 3UUXA 4JHRA 4C0EA 3CVLA 1KT1A 3B7TA 3OXGA 4U63A 3FH5A 4W9FB 2V0PA 3CHQA 1HS6A 5E75A 4MS6A 2GRLA 4GYYA 4BWRA 3DRZA 1SQMA 2L6JA 4HOUA 5T3RA 1S0PA 2IOLA 3CHSA 5LCWC 4ZGCA 3ULQA 3I4RB 1LM8C 2VSOE 5FZRA 2J09A 3ASHA 3FWVA 3L08A 1WAO1 1OWOA 4IRUA 3TL5A 3VLEA 3PNLB 4DI4A 3UPVA 4UWFA 4AEZC 3CVVA 4A1GA 2OVBA 5EX0A 3QWWA 1EOEA 2IOSA 3DRXA 2X3MA 3DPDA 2KCVA 5JHBA 1Y6IA 2KZTA 2YHCA 3C98A 4U2NA 3FU0A 2WQ7A 4JHJA 1Z3XA 4B89A 2YNQA 4ME2A 2I2OA 4N9F5 4BX8A 4AP2A 5FJYA 3L17A 4GZ5A 1HH8A 4CP3A 3GZSA 4UI9C 4HXIA 4Q96A 4WAFA 3R7RA 3OGLA 2VQ2A 5EKQD 2WXNA 4N2QA 2A79B 1Y8MA 3ZTDB 3ONKA 4GZ6A 1WM5A 1EOFA 4CXTA 4U77A 4CDNA 4A3TA 1BUOA 3IEGA 2NN2A 3AS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVE A;  3L2O A;  4JTA B;  1R29 A;  3ZUN B;  5BXB A;  4I6J C;  3M8V A;  3HTM A;  4B95 B;  2NZ0 B;  2Q81 A;  4U2M A;  2YY9 A;  4BKT B;  3LBZ A;  1NEX A;  1CS3 A;  3ZTC B;  3OGM A;  3MKS A;  3DCG B;  5HYW B;  4W9K B;  5H7G A;  3ZRC B;  1LQB B;  1NN7 A;  1DSX A;  3ZRF B;  1R2B A;  5BXD A;  3HQI A;  5JH5 B;  2AST A;  4W9D B;  2P1O A;  5DAF A;  2OVP A;  2VPK A;  2ASS A;  3V7D A;  4CRH A;  1A68 A;  3FKC A;  5BXH A;  5A6R A;  4W9J B;  2IHC A;  5IBK A;  4ZOU A;  1R28 A;  3C6P A;  3LNM B;  2E31 B;  3OGK A;  2MA9 C;  1EOD A;  4APF A;  1QDV A;  4AJY C;  4B9K E;  4W9H H;  3I3N A;  3B84 A;  3BIM A;  3M5B A;  4W9C B;  4W9H B;  2C9W C;  4W9G B;  2IZV C;  2Z8H A;  1P22 B;  1T1D A;  5FTA A;  2VKP A;  4EOZ A;  1FQV B;  4B9K B;  3HVE B;  5LLI B;  3ZKJ B;  4W9L B;  1QDW A;  2OVR A;  4UIJ A;  5DAD A;  3LUT B;  4JGH C;  2R9R B;  3M52 A;  3OHV A;  4W9E B;  2E32 B;  5HZG C;  4BGC A;  4J8Z A;  4W9I B;  1S1G A;  2I2R A;  4W9F B;  2JZ3 C;  1EXB E;  3C6N A;  4AWJ B;  3DRZ A;  3ZNG B;  4HS2 A;  5A15 A;  1LM8 C;  4JTD B;  3HU6 A;  3KVT A;  4BKS B;  5EUP A;  4CXJ A;  2PPI A;  5BO4 C;  1EOE A;  4JTC B;  4UYI A;  3M4T A;  4WQO C;  3WSO B;  1VCB B;  4U2N A;  3C6O A;  2IF5 A;  2OVQ A;  2P1P A;  3OHU A;  3GA1 A;  5H7H A;  4N9F 5;  4AP2 A;  2EQX A;  4CXI A;  4CP3 A;  1LDK D;  1FS2 B;  2P1N A;  4HXI A;  3OGL A;  3ZTD B;  2A79 B;  3E4U A;  2P1M A;  1EOF A;  4CXT A;  4U77 A;  1HV2 A;  1BUO A;  2NN2 A;  2P1Q A;  1FS1 B;  2FNJ C; 
#chains in the Genus database with same CATH topology
 3L2O A;  3NOG D;  3EU9 A;  2Q7F A;  3SHF A;  5ENR D;  3LVQ E;  2WXJ A;  5H7G A;  3DWL G;  4L1B A;  1N0Q A;  4APO A;  5A6C A;  1OUV A;  3T8M A;  2AWI A;  2P1O A;  3ZNG A;  5H7P A;  4HOR A;  3Q7F A;  2IHC A;  1JWF A;  3MGB A;  3URZ A;  3MCX A;  1HG5 A;  4LNU D;  4AJY C;  2CHX A;  5AJL A;  3U9W A;  1S64 A;  4DX7 D;  5FQ8 A;  3UKR G;  3LVR E;  4W9H B;  4W9G B;  2V8S E;  3FUH A;  4JXT A;  5FQ7 A;  2VKP A;  5D0O D;  5D2M C;  2JEK A;  4OVU A;  3RAU A;  1MX2 A;  2VGX A;  2LSU A;  3LUT B;  5CHE E;  5FZS A;  2P9I G;  2LAH A;  2KCK A;  2EIM E;  3O48 A;  2KC7 A;  3TWS A;  1U3C A;  2BKG A;  1KT0 A;  3PEV B;  5CEA A;  4GU5 A;  5ANR A;  2GRQ B;  4XKB A;  4B8C B;  5IY5 E;  4YVQ C;  5CEC B;  2OOE A;  2C0M A;  2XCB A;  2XPI A;  3TAX A;  1KLX A;  1V55 E;  1LD7 A;  2X6J A;  1DC2 A;  1NL4 A;  2Y69 E;  1TNB A;  4JTC B;  1X81 A;  3RSE G;  3IBE A;  3JQ1 A;  2CG3 A;  2HO1 A;  2ZU6 B;  1E7U A;  4DPR A;  4JA9 A;  3UKU G;  4CDM A;  4V3I A;  5ARG A;  1P5Q A;  3UT7 A;  4RSY A;  5M72 A;  4XI0 A;  1IQR A;  4KZC A;  4LG6 A;  1YYH A;  5HYW B;  2HYZ A;  4OAV B;  3T5V A;  3G2S A;  4FLB A;  4JPS A;  5AQ7 A;  4XIF A;  3C72 A;  4PS8 A;  5ARF A;  4XKC A;  1KZO A;  4U95 D;  4J6I A;  3AG3 E;  4KXK B;  4I6E A;  5JMN D;  3CQG B;  1H0A A;  3RU0 A;  3EUV A;  1ELR A;  2XCC A;  1UJK A;  2XS8 A;  2J07 A;  5T8I A;  4B93 B;  3I3N A;  5B1B E;  3B84 A;  5JJT A;  1TN6 A;  2QC9 A;  2ION A;  4I9E A;  5D0Q D;  3C3Q A;  3PZD A;  1YCS B;  5LP0 A;  4KVO A;  4JGH C;  3OHV A;  1UN9 A;  1XNF A;  4J8Z A;  1E8X A;  2WXR A;  5ENS D;  3MV3 B;  5EYP F;  3HRA A;  3UM1 A;  4Y6W A;  2Y0B G;  1LD8 A;  3JUI A;  2WXK A;  2VTB B;  5G04 C;  2XPY A;  3PUK A;  3TXM A;  3BEE A;  1HF8 A;  4CGW A;  2WB2 A;  4F7A A;  3Q9N C;  3L6A A;  1HE8 A;  3PH0 C;  5BO4 C;  2IY0 C;  2VGY A;  1U3D A;  4F3V A;  3J5Q B;  4L9P A;  4G8L A;  2EIJ E;  2LAI A;  1TYQ G;  5H7H A;  4PDX A;  2XEH A;  4DX6 D;  3JXI A;  1IKN D;  1TJF A;  1QNF A;  4OYS A;  4FLH A;  4JVS A;  4HFG A;  3ULE G;  3FY4 A;  5BXB A;  2IF4 A;  4TUU A;  2P2C P;  5AQB A;  4I1O B;  4A3V A;  4GZC A;  1PAQ A;  4J8S A;  5ENT D;  1OWP A;  2PM6 A;  4GPM A;  4IUL A;  2XGS A;  2OVP A;  5J08 A;  4L2L A;  3T9K A;  2LO6 A;  4AXH A;  2GRN B;  3ZHE A;  1BU9 A;  3EDT B;  3TWT A;  4GZD A;  3B7U X;  3SD5 A;  3DEP A;  3DPY A;  3CVQ A;  2Z8H A;  1O1R A;  5AAR A;  4W9L B;  1UW4 B;  5CED B;  1N4P A;  2J9Q A;  3D9I A;  3ZEF A;  1N11 A;  3RRN B;  5AN8 A;  3OXF A;  2WXO A;  4J8Y A;  4OAU C;  1NA0 A;  4I43 A;  3V30 A;  1HG2 A;  3ISM C;  3DEO A;  3ZNG B;  4B94 A;  2WXG A;  3E30 A;  1HZ4 A;  4N3A A;  2PQR A;  1LF8 A;  4DJA A;  2ETA A;  1UG3 A;  3LPZ A;  2IO3 C;  5FQ4 A;  3R9M A;  2P9S G;  2ZIR A;  3RRU A;  4YDO A;  3FTS A;  2JAB A;  3PZ2 A;  3GZ1 A;  4TXR A;  4ATG A;  4P29 A;  2VYI A;  2XGM A;  3UTM A;  4UQX A;  2P1M A;  4FAD A;  4Q69 A;  3ZKJ A;  3Q47 B;  1IHG A;  2VGX B;  4CT0 A;  4LUN U;  2FO1 E;  5G04 J;  1NEX A;  2IU1 A;  5DBK A;  4JA7 A;  4GYW A;  2XGO A;  1YA0 A;  2XRZ A;  1R2B A;  4ANW A;  3CLJ A;  3PZ1 A;  4F1P A;  4HNA D;  3CQC B;  3NBN B;  1VDY A;  3Q79 A;  2LUH A;  5HRY A;  4LER A;  2A5E A;  3SBT B;  3L16 A;  1K3Z D;  1G3N B;  3UI2 A;  3CVW A;  2X38 A;  3D9M A;  4LSZ E;  1IYG A;  3CK9 A;  3KSL A;  1JWG A;  3FTX A;  2P9N G;  2WQH A;  4B9K B;  4Q94 A;  3NB2 A;  1ZBP A;  3KEZ A;  3AAA C;  3K9I A;  3DXM G;  2R2L A;  3DSS A;  3PRZ A;  4A1S A;  1LTX A;  4GTV A;  3UUX A;  4C0E A;  2DZO A;  4LNG A;  1KT1 A;  3B7T A;  3V2O A;  3HXD A;  1HS6 A;  1N95 A;  4U7E B;  4HOU A;  1O1S A;  5FZR A;  2LXL A;  1OWO A;  3TL5 A;  4DI4 A;  1OT8 A;  4UWF A;  4AEZ C;  2OEV A;  1DCQ A;  3EU5 A;  3FU0 A;  2WQ7 A;  4B89 A;  4ME2 A;  4AP2 A;  4O1O A;  4CYM D;  1HH8 A;  3L9T A;  3R7R A;  3ZTD B;  2WXN A;  4N2Q A;  1Y8M A;  4GTS A;  4GZ6 A;  4DX5 D;  4CXT A;  1EF1 C;  3IXE A;  3JXJ A;  4U2M A;  3LBZ A;  1FVH A;  3DCG B;  3PS6 A;  3SFZ A;  3TWU A;  1FPP A;  4I9C A;  3FTY A;  4AIF A;  4E6H A;  1NN7 A;  3G2W A;  3RJV A;  4W9D B;  3EIJ A;  3MX3 A;  3UQ3 A;  5BT1 A;  1E8W A;  2Y1L E;  4B8A A;  4CRH A;  2WXH A;  3ZPJ A;  3BUA A;  4I2Z A;  1AWC B;  4WWN A;  3HG0 D;  3AG4 E;  5CER B;  3QK0 A;  4EBA G;  3M5B A;  4M7C A;  2C9W C;  5ENQ D;  1XGW A;  4AVX A;  3PE3 A;  3PZ4 A;  3RO2 A;  3ZRH A;  4JHK A;  2BF0 X;  3MZL B;  4N2S A;  4R7L A;  4BET A;  3VLD A;  1DNP A;  1K8K G;  3CVN A;  2VSX E;  3LY8 A;  4DX1 A;  4WND A;  5BPP A;  2XPZ A;  1N94 A;  3LEW A;  2X6F A;  3NOC D;  4UI9 K;  2UY1 A;  2L9B A;  4HLL A;  4CEM A;  3OXL A;  2ZGD A;  1WDY A;  2WMN A;  3QOU A;  2Y4T A;  2H6F A;  3FDH A;  3CEQ A;  4F1S A;  3F6Q A;  1NFI E;  1LDK D;  3S7D A;  4GA1 A;  1HO8 A;  3HDX A;  1ELW A;  3EJN A;  3P2B A;  1TJC A;  3D9P A;  3ZUN B;  3UT8 A;  1Q2Z A;  4HI8 A;  2UWJ G;  3OGM A;  4WWP A;  3AU4 A;  3FUJ A;  2R5S A;  1INZ A;  4KT6 B;  4CT4 A;  1PC2 A;  2CFU A;  1A68 A;  5G05 J;  3LS8 A;  5EDS A;  3ASD A;  2PNN A;  4ILI A;  4WNG A;  3CKC A;  1MHQ A;  3X2Q E;  4B0Z A;  3LDZ A;  1EOD A;  3PZ3 A;  5BXU A;  2PZI A;  5B3S E;  5KJK A;  5G2N A;  4GA2 A;  2A4Z A;  3DSW A;  2KM4 A;  5ITZ F;  4O6F A;  2X6I A;  3MYV A;  1P22 B;  2P9L G;  3DSU A;  4EZK A;  1Z6T A;  3ZKJ B;  4HBD A;  2L6B A;  4JEU A;  2R17 C;  1BD8 A;  3ZUV B;  2LXM A;  3QWV A;  4AJW A;  4CRW A;  5JJ7 A;  3GW4 A;  2WXI A;  2CFZ A;  4AOF A;  3TG4 A;  4HS2 A;  1E8Y A;  2VGE A;  3JYS A;  4IYP A;  3S2A A;  5JJ6 A;  2BED A;  2KXP C;  1H6O A;  3FEX A;  2AXZ A;  3FTV A;  4FHJ A;  3C6O A;  4G11 A;  3FUM A;  4BER A;  3OHU A;  3CK8 A;  2EQX A;  4G24 A;  4NIK A;  3ZFW A;  3E34 A;  2H6I A;  2V4H C;  4EQF A;  3D9N A;  3AS5 A;  2BTD A;  3HTM A;  3W9G A;  3R9A B;  3B7S A;  2DCP A;  2Y3A A;  3VLF A;  1HU3 A;  3CVX A;  2F37 A;  3CKB A;  3FUE A;  2NSZ A;  3TGO A;  4J8E A;  3R7Q A;  4M3O A;  1SZA A;  4UWK A;  2F8Y A;  4JD2 G;  4BT9 A;  3Q7A A;  3FU6 A;  3Q15 A;  5IBK A;  3TG5 A;  5HS0 A;  3HXC A;  4AV7 A;  2WXF A;  4DX2 A;  3SBS A;  4W9H H;  3UM3 A;  2XHE A;  4KVM A;  4W9C B;  3MKR A;  2X6K A;  2ZGG A;  2DYR E;  1OWL A;  3ZXS A;  5KJM A;  4UIJ A;  4UI9 J;  4ANV A;  5KCM A;  4JW1 A;  1WG0 A;  4RQI A;  3IKO B;  4TRQ A;  2J4D A;  2KCL A;  2MHK A;  3JUE A;  1S1G A;  2RFM A;  1H2T C;  3ASF A;  5AJD A;  2JZ3 C;  3SQV A;  1EPU A;  4BEP A;  4G2V A;  4N39 A;  2FF4 A;  4URK A;  2XRY A;  1OXJ A;  3KD7 A;  3C3R A;  3KVT A;  2WM9 A;  3TWR A;  2WXP A;  2PPI A;  2WQ6 A;  2WMO A;  4UYI A;  3QB2 A;  4UQY A;  3PEU B;  2OVQ A;  3TWX A;  3ASG A;  1N9A A;  4WNE A;  4YY8 A;  5EN5 D;  4U0Z A;  1HV2 A;  3FTW A;  2P1Q A;  1ZB1 A;  2GRM A;  4I1A A;  4CDR A;  4HLE A;  3APC A;  3LY7 A;  4FA6 A;  4N5C A;  3T5X A;  2PQN A;  1GW6 A;  3ZRF B;  3LCA A;  1N4R A;  3L22 A;  3UIP C;  2IEJ A;  3Q75 A;  1KZP A;  3UX4 A;  4JEH A;  5C1D A;  5CBN A;  4PS3 A;  2UY1 B;  3ASN E;  3WXX A;  3Q73 A;  1D8E A;  1E7V A;  4JZY A;  4PUC A;  3LNM B;  3I5P A;  1MX6 A;  4B9K E;  2HR2 A;  1BI7 B;  3L13 A;  3FEY A;  3BIM A;  2DZN A;  2A5U A;  2KAT A;  2MRI A;  2OV8 A;  4U0U A;  4GPK A;  2CG2 A;  2J8S D;  3E32 A;  5KWD A;  3FUI A;  1YMP A;  4HOS A;  2FI7 A;  2I1K A;  3PNT B;  3QJZ A;  3NQP A;  4JB8 P;  3ESK A;  1QDW A;  1IQU A;  1TNU A;  1JUQ A;  4RLY A;  3EHM A;  2MYO A;  4JHR A;  3CVL A;  1FT1 A;  2V0P A;  3CHQ A;  4K5B A;  5E75 A;  4MS6 A;  3J5P A;  1DCE A;  1SQM A;  5LCW C;  1S0P A;  3ULQ A;  3UXG A;  3V2X A;  3ASH A;  1WAO 1;  3CVV A;  3NAW A;  3DRX A;  3DPD A;  5JHB A;  1Y6I A;  2YHC A;  4JHJ A;  1Z3X A;  2YNQ A;  2I2O A;  1N0R A;  4BX8 A;  3L17 A;  4GZ5 A;  4CP3 A;  3GZS A;  5EKQ D;  2A79 B;  1BUO A;  2NN2 A;  1R29 A;  5G55 A;  2AJA A;  5CMW A;  2WXL A;  2AW6 A;  1OY3 D;  3RK6 A;  3FTZ A;  3ZTC B;  4U07 A;  4LRZ A;  3ENE A;  4ANX A;  3AG2 E;  1LQB B;  2J49 A;  3HQI A;  1HXI A;  4HRL A;  1BPO A;  1MYO A;  2FUL A;  3RIB A;  4UUC A;  4XI9 A;  5AYW D;  3S7J A;  1ZU2 A;  2WXQ A;  3MA5 A;  1TNO A;  1EDU A;  5EID A;  3TWQ A;  2FBN A;  3DRA A;  1FQV B;  2MOW A;  2KBX A;  1JCQ A;  4G26 A;  1TR4 A;  4NUR A;  1JCR A;  4KBQ A;  3G2T A;  1PY1 A;  2XEN A;  5KBA A;  4EZJ A;  2AVP A;  1E8Z A;  4U8H A;  4TXP A;  3G2U A;  1FCH A;  1E96 B;  3Q78 A;  2I2R A;  4J8F A;  4G25 A;  4AWJ B;  3AJI A;  2IQC A;  2Y4U A;  3ZU7 B;  3D9J A;  5KJN A;  2WVI A;  1TNY A;  3NZU A;  1OWN A;  3FUF A;  3M4T A;  2F0Y A;  3DXK G;  2H6H A;  4UWG A;  3MKQ A;  3OAW A;  4FC8 A;  1FS2 B;  3Q5M A;  3NZS A;  4U8V D;  5E76 A;  2QYU A;  4FJY A;  4XX5 A;  3ZW3 A;  5CCM A;  3HVE A;  1Z3Y A;  3ABL E;  4I6G A;  3LKU A;  2NZ0 B;  3FUK A;  5LCW J;  3PDN A;  4GTT A;  4J8D A;  3LJ3 A;  2OVF A;  3FUD A;  4L23 A;  1H19 A;  2AST A;  2QYJ A;  3SI5 A;  3SGH A;  3UM2 A;  4A63 B;  2YIN A;  4W9J B;  4ZOU A;  4GTP A;  1IHB A;  2LSV A;  3KEA A;  1K1B A;  1SZ9 A;  3EHQ A;  1JPL A;  3RKV A;  2NXP A;  2GGF A;  2V5F A;  4WNF A;  4FP7 A;  3I4G A;  5BXO A;  2X6H A;  3C3O A;  3ZGQ A;  4W9E B;  4BFR A;  4CCA A;  3Q49 B;  3APD A;  1Z5S C;  1SA5 A;  3ZXP A;  5KNG A;  2XS1 A;  1KPS B;  4W9I B;  3S7B A;  4BTB A;  2IO2 C;  4FHK A;  3KS2 A;  1RZ4 A;  3PUJ A;  2B6C A;  4KZ0 A;  3UMV A;  3L54 A;  3U4T A;  4YDW A;  2R02 A;  3QNK A;  4UWH A;  4LCT A;  3D9H A;  3U66 A;  2P1P A;  1NZN A;  3HXF A;  4ACL A;  4C9B B;  2P1N A;  5EYL A;  3E4U A;  3B13 A;  3ZYQ A;  4W9R A;  5HQ8 A;  1S70 B;  4PS7 A;  4G8K A;  2OND A;  3AU5 A;  4H7Y A;  4O60 A;  4BKT B;  2L0I A;  3ZHE B;  3CR3 A;  3MKS A;  4QQI A;  5J90 A;  4NQ0 A;  4I6J A;  4JC8 A;  3TXN A;  2DWZ A;  1S63 A;  4EEC A;  2CHZ A;  2E0I A;  4UWL A;  4PH4 B;  5KJL A;  4UQZ A;  4CZ2 D;  3FKC A;  5A6R A;  3N71 A;  3QC1 A;  2FO7 A;  3V31 A;  1R28 A;  3IHV A;  1OWM A;  3FH7 A;  2XEV A;  4HB5 A;  1QDV A;  2VSY A;  5ENN A;  5FQ6 A;  2GRP B;  3GZ2 A;  4GAA A;  1DVP A;  2IZV C;  3UM0 A;  5EIL A;  1O1T A;  2P9U G;  2OVR A;  4NRH B;  2XZT G;  2AXU A;  3EIQ C;  1MZC A;  1E90 A;  2QY7 A;  2E32 B;  2XEE A;  5HZG C;  2P9P G;  3CIA A;  3E4B A;  5FWQ A;  2NC9 A;  4GCO A;  3TWW A;  3ML8 A;  5A23 A;  2ETB A;  3SZ7 A;  3SO8 A;  2PM7 A;  4BTA A;  1OCO E;  5CRU A;  3CVU A;  4FU3 A;  3SFX A;  4DLQ A;  1SA4 A;  2H6G A;  2XQ0 A;  4BKS B;  4K5C A;  2DIW A;  2I9C A;  4RG6 A;  5FT9 A;  1BI8 B;  4OVV A;  4EHM A;  1VCB B;  3GA1 A;  3WG7 E;  4CXI A;  4MBG A;  2PL2 A;  3OTN A;  2F8X K;  2WPV A;  1D8D A;  4BSX A;  3ML9 A;  2J4B A;  4HQD A;  2R05 A;  3HXE A;  1N4S A;  5FIN A;  3FH8 A;  4JTA B;  3D9L A;  2Q81 A;  2VSN A;  4XZ4 A;  3AG1 E;  4HOT A;  2GRO B;  1TN7 A;  4W9K B;  3ZRC B;  4GML A;  3E37 A;  2QFC A;  1MX4 A;  4A55 A;  4DLO A;  4C0M A;  3QAQ A;  3ZYL A;  3EHR A;  3DSX A;  3LJN A;  4YVO A;  1X5B A;  3MV2 B;  3C6P A;  3LXU X;  4ATZ D;  3SFY A;  3OGK A;  1FT2 A;  4H7X A;  4GTO A;  1D9S A;  3D3M A;  3MKQ B;  3ULY A;  3LY9 A;  4N3B A;  3ASO E;  4L2Y A;  1HX8 A;  4K5A B;  1MQS A;  3SNX A;  3HVE B;  3BQO A;  4LEU A;  2R59 A;  1OCC E;  4E85 A;  4JL0 A;  1TN8 A;  4BSZ B;  3CK7 A;  2RFA A;  3CHR A;  3HHM A;  1H2V C;  1WY6 A;  4U96 D;  2ETC A;  3OXG A;  2GRL A;  3W9F A;  4BWR A;  3DRZ A;  2L6J A;  5T3R A;  2IOL A;  3CHS A;  4ZGC A;  3KSQ A;  1LM8 C;  2V5Q C;  2J09 A;  3FWV A;  3L08 A;  3UPV A;  2EIN E;  4IRU A;  4DRX E;  2OVB A;  1EOE A;  2IOS A;  2X3M A;  2KCV A;  2KZT A;  3C98 A;  4U2N A;  1A5E A;  3DST A;  1K1A A;  4O1P A;  3C5R A;  1O5M A;  4HXI A;  3OGL A;  2GRR B;  4CDN A;  2DVW A;  3O4Z A;  4I6J C;  4YDY A;  3APF A;  2YHE A;  3PVL A;  3S7F A;  4HI9 A;  4LNB A;  5BXD A;  5EX3 A;  5JH5 B;  3D9K A;  2DBA A;  3FFL A;  4BX9 A;  4K03 A;  3RRM B;  5BXH A;  5AAO A;  1QZ2 A;  4HOQ A;  1HFA A;  5JA4 D;  1UJJ A;  4Z68 A;  4U04 A;  1T1D A;  5FTA A;  4TUM A;  4EOZ A;  3B95 A;  5LLI B;  3ZVV A;  2R9R B;  3VTY A;  4CGV A;  3BG0 B;  3E33 A;  5D66 A;  3DSV A;  1B89 A;  5LOZ A;  3CHP A;  2XZD G;  4DUI A;  5A15 A;  5HI7 A;  3DRY A;  4K0R A;  4GCN A;  3AS4 A;  4GTR A;  5C2Y A;  1BLX B;  4GTM A;  2IFU A;  4WQO C;  1JCS A;  2HM8 A;  3CVY A;  3ESL A;  3HIZ A;  4GZ3 A;  1V54 E;  1NI1 A;  2YQ8 A;  5BNW A;  4DI3 A;  2FNJ C;  5B1A E;  3HXB A;  3CV0 A;  4YND A;  3IHY A;  3VTX A;  3CHM A;  2I1J A;  2RD0 A;  2V4L A;  2DYS E;  5ANL A;  2P9K G;  4MKT A;  3PRE A;  4HRN A;  1FVF A;  4GMR A;  1N52 A;  1EYH A;  2IJG X;  3TWV A;  3CVP A;  4G1T A;  4FUL A;  3CST A;  3PE4 A;  2P58 C;  3U64 A;  1N54 A;  2CHW A;  3KAE A;  4HRM B;  4J0U A;  1H2U A;  5JHA A;  4N3C A;  4GTQ A;  5AIJ A;  1UN8 A;  2M63 A;  3M52 A;  3DBS A;  5CCL A;  3UT4 A;  3RO3 A;  1TNZ A;  3FHE A;  4ANU A;  4BGC A;  4KYO B;  1NP7 A;  4QFV A;  3NF1 A;  4WWO A;  3T8K A;  1EXB E;  2ZIS A;  3CHO A;  1ELK A;  1MJ0 A;  2QZA A;  4JTD B;  3HU6 A;  3Q9U C;  3BG1 B;  2VJ8 A;  4ILH B;  5CMY A;  5DIZ A;  3WSO B;  5BW8 C;  2IF5 A;  4RVB A;  2OCC E;  2WXM A;  3L82 A;  4ABN A;  1AP7 A;  5CRV A;  5AQA A;  4U8Y D;  3JCK C;  1FS1 B;  1SVX A;  2RKK A;  2RG8 A;  3ZYM A;  3M8V A;  2ILR A;  4I2W A;  2JLB A;  5ENP D;  2BUG A;  3TJP A;  1DSX A;  3FU3 A;  4EBA A;  4Y6C A;  3G2V A;  3MJW A;  3U3W A;  2FEZ A;  2LNI A;  4G23 A;  4DK5 A;  4I1M A;  5BV0 A;  2VPK A;  3V7D A;  2ZXW E;  3FU5 A;  4ACK A;  2J08 A;  3QWP A;  1L5J A;  2E31 B;  2KZT B;  4APF A;  5AQ9 A;  4GYO A;  3ABK E;  4D10 C;  4EPZ A;  4WUY A;  5A7D B;  4AM9 A;  1UOH A;  4I17 A;  4IN3 B;  2GW1 A;  5LFA A;  2EIL E;  1NA3 A;  4RG9 A;  4MRU A;  4BY6 A;  3SF4 A;  3UIN C;  4GA0 A;  4AY5 A;  4BES A;  2R03 A;  3QDN A;  5BUZ A;  3D9O A;  2C0L A;  3Q4A B;  5G05 C;  5AEN A;  3FP3 A;  3V79 K;  2I6H A;  3C6N A;  5HKP A;  3CSF A;  3UIO C;  3FTU A;  5EUP A;  4CXJ A;  2C2L A;  4KMO A;  2NYJ A;  4GMJ A;  1SW6 A;  3BU8 A;  4F53 A;  3FUN A;  3FUL A;  4ILG A;  3MEK A;  2L0T B;  4ZHB A;  1OCR E;  4X8Q A;  4L7T A;  4EZL A;  3GYZ A;  4FJZ A;  4YDE A;  5FZQ A;  5BV1 A;  4B95 B;  4J7W A;  2YY9 A;  3LYA A;  4C48 B;  3ZYK A;  1CS3 A;  3CGH A;  5FIO A;  1H6K A;  3JQ0 A;  3HYM B;  5CBO A;  1RW2 A;  3ABM E;  1QYM A;  2E2E A;  2HE0 A;  4U0S A;  4XE0 A;  4F6R D;  4MLP A;  1QBQ A;  3QAR A;  5DAF A;  2VTB A;  2ASS A;  3ONL A;  4NAC A;  5T4Y A;  1W3B A;  1TEZ A;  5FTP A;  3P1U A;  2MA9 C;  2B0O E;  2BKK B;  4TV3 A;  4BT8 A;  4HVB A;  4XEI G;  5EIB E;  1A17 A;  3ZIM A;  2EIK E;  5LX8 A;  3B7R L;  4AY6 A;  1QQE A;  3QKY A;  5DAD A;  3SY2 A;  1OCZ E;  4GB9 A;  2AXV A;  3ZN3 A;  1U2V G;  3EHN A;  1H6P A;  3IV0 A;  4U63 A;  3FH5 A;  4W9F B;  4GYY A;  5KNH D;  3I4R B;  2VSO E;  3VLE A;  4TXQ A;  5ENO D;  3PNL B;  4A1G A;  5EX0 A;  3QWW A;  2OEW A;  4N9F 5;  5FJY A;  4N5Q A;  1N4Q A;  4UI9 C;  4Q96 A;  4WAF A;  2VQ2 A;  4ZFH A;  3ONK A;  1EOF A;  1WM5 A;  3B7B A;  4U77 A;  4A3T A;  3IEG A;  1IXV A;  3AS8 A; 
#chains in the Genus database with same CATH homology
 3L2O A;  1R29 A;  1EF1 C;  5G55 A;  3O4Z A;  4I6J C;  4U2M A;  5CMW A;  2WXL A;  2AW6 A;  2Q7F A;  3RK6 A;  3LBZ A;  3SHF A;  1FVH A;  3FTZ A;  3ZTC B;  3DCG B;  3PS6 A;  4LRZ A;  3APF A;  2YHE A;  3ENE A;  3LVQ E;  2WXJ A;  3PVL A;  4I9C A;  4U07 A;  3S7F A;  4ANX A;  3FTY A;  4AIF A;  1LQB B;  4L1B A;  4E6H A;  1NN7 A;  3G2W A;  4APO A;  5A6C A;  5BXD A;  2J49 A;  1OUV A;  5EX3 A;  3RJV A;  3HQI A;  3T8M A;  1HXI A;  5JH5 B;  4W9D B;  3EIJ A;  3MX3 A;  1BPO A;  3UQ3 A;  2AWI A;  2P1O A;  3D9K A;  2DBA A;  5BT1 A;  3FFL A;  4BX9 A;  4K03 A;  1E8W A;  4B8A A;  4CRH A;  3RRM B;  5BXH A;  2WXH A;  3ZPJ A;  4HOR A;  2IHC A;  1JWF A;  1QZ2 A;  2FUL A;  3MGB A;  4HOQ A;  4I2Z A;  3RIB A;  4WWN A;  3URZ A;  3MCX A;  1HG5 A;  4XI9 A;  5AYW D;  1HFA A;  3QK0 A;  3S7J A;  4EBA G;  1ZU2 A;  4AJY C;  2CHX A;  2WXQ A;  5AJL A;  3U9W A;  3MA5 A;  3M5B A;  5FQ8 A;  1EDU A;  3LVR E;  4W9H B;  1UJJ A;  2C9W C;  4W9G B;  4U04 A;  2V8S E;  1T1D A;  5FTA A;  2FBN A;  3FUH A;  4JXT A;  1XGW A;  5FQ7 A;  2VKP A;  4EOZ A;  5D0O D;  4AVX A;  3PE3 A;  1FQV B;  3RO2 A;  2JEK A;  2MOW A;  3ZRH A;  4OVU A;  4JHK A;  5LLI B;  4G26 A;  4NUR A;  3ZVV A;  2VGX A;  2LSU A;  2BF0 X;  3MZL B;  2R9R B;  3LUT B;  4KBQ A;  5CHE E;  5FZS A;  3G2T A;  3VTY A;  4N2S A;  2LAH A;  4R7L A;  2KCK A;  3VLD A;  1PY1 A;  3O48 A;  1DNP A;  4CGV A;  2KC7 A;  3BG0 B;  4EZJ A;  1U3C A;  2AVP A;  3CVN A;  1E8Z A;  4U8H A;  1KT0 A;  1B89 A;  2VSX E;  3PEV B;  3LY8 A;  3G2U A;  1FCH A;  1E96 B;  4GU5 A;  5ANR A;  2I2R A;  4J8F A;  4G25 A;  4XKB A;  5LOZ A;  4B8C B;  4AWJ B;  3CHP A;  4WND A;  4YVQ C;  5BPP A;  2OOE A;  2XPZ A;  2C0M A;  3LEW A;  2XCB A;  5A15 A;  5HI7 A;  3DRY A;  2XPI A;  4GCN A;  2X6F A;  4K0R A;  2IQC A;  2Y4U A;  3TAX A;  4UI9 K;  1KLX A;  2UY1 A;  2L9B A;  3AS4 A;  2X6J A;  3D9J A;  4CEM A;  3OXL A;  5C2Y A;  5KJN A;  2WVI A;  2WMN A;  3NZU A;  1OWN A;  3FUF A;  4JTC B;  2IFU A;  3QOU A;  3M4T A;  3CVY A;  2HM8 A;  3IBE A;  4WQO C;  3JQ1 A;  3ESL A;  2CG3 A;  2Y4T A;  4UWG A;  2HO1 A;  2ZU6 B;  1E7U A;  3HIZ A;  3FDH A;  3CEQ A;  4DPR A;  4JA9 A;  3MKQ A;  3OAW A;  4FC8 A;  4GZ3 A;  4F1S A;  1LDK D;  4CDM A;  1FS2 B;  3Q5M A;  3NZS A;  2YQ8 A;  3S7D A;  4GA1 A;  4V3I A;  5E76 A;  1HO8 A;  5ARG A;  3HDX A;  5BNW A;  1ELW A;  1P5Q A;  3UT7 A;  4DI3 A;  3EJN A;  4FJY A;  4XX5 A;  3ZW3 A;  5CCM A;  3P2B A;  1TJC A;  2FNJ C;  3D9P A;  3HVE A;  1Z3Y A;  3CV0 A;  3ZUN B;  4RSY A;  4YND A;  3UT8 A;  4I6G A;  3LKU A;  2NZ0 B;  5M72 A;  3FUK A;  4XI0 A;  1IQR A;  3IHY A;  4KZC A;  5LCW J;  2UWJ G;  3OGM A;  3PDN A;  4WWP A;  5HYW B;  3VTX A;  3CHM A;  2HYZ A;  4J8D A;  3T5V A;  3G2S A;  2I1J A;  2OVF A;  3AU4 A;  3LJ3 A;  2RD0 A;  3FUJ A;  4FLB A;  4JPS A;  3FUD A;  4XIF A;  4L23 A;  2V4L A;  4PS8 A;  5ARF A;  2R5S A;  1H19 A;  5ANL A;  4XKC A;  2AST A;  1INZ A;  4KT6 B;  4MKT A;  3PRE A;  1FVF A;  4CT4 A;  1PC2 A;  2CFU A;  4J6I A;  1N52 A;  3SI5 A;  3SGH A;  1A68 A;  1EYH A;  2IJG X;  5G05 J;  2YIN A;  3LS8 A;  4KXK B;  5EDS A;  4I6E A;  4W9J B;  4ZOU A;  3CQG B;  3ASD A;  1H0A A;  3RU0 A;  3CVP A;  4ILI A;  1ELR A;  4G1T A;  2XCC A;  4WNG A;  1UJK A;  4FUL A;  2LSV A;  3CKC A;  1MHQ A;  4B0Z A;  3LDZ A;  1EOD A;  3CST A;  2J07 A;  3PE4 A;  5T8I A;  2P58 C;  3U64 A;  2PZI A;  1N54 A;  5KJK A;  5G2N A;  2CHW A;  3KAE A;  3I3N A;  3B84 A;  4GA2 A;  2A4Z A;  5JJT A;  1SZ9 A;  1JPL A;  2KM4 A;  4J0U A;  4O6F A;  1H2U A;  2X6I A;  3MYV A;  3RKV A;  5JHA A;  1P22 B;  2NXP A;  4N3C A;  2ION A;  4I9E A;  5AIJ A;  5D0Q D;  4EZK A;  1Z6T A;  1UN8 A;  2GGF A;  2V5F A;  3PZD A;  2M63 A;  3ZKJ B;  4WNF A;  4FP7 A;  5LP0 A;  4KVO A;  3I4G A;  4JGH C;  3M52 A;  4JEU A;  3DBS A;  2R17 C;  2X6H A;  5CCL A;  3UT4 A;  1UN9 A;  1XNF A;  3ZGQ A;  3OHV A;  4W9E B;  4BFR A;  3RO3 A;  4CCA A;  3Q49 B;  3APD A;  3FHE A;  4ANU A;  1E8X A;  3QWV A;  4AJW A;  4KYO B;  4J8Z A;  4BGC A;  1NP7 A;  2WXR A;  4CRW A;  4W9I B;  3MV3 B;  5JJ7 A;  3GW4 A;  4QFV A;  3NF1 A;  2WXI A;  2CFZ A;  3S7B A;  4WWO A;  4Y6W A;  1EXB E;  4AOF A;  3JUI A;  3TG4 A;  3CHO A;  2WXK A;  4HS2 A;  5G04 C;  2VTB B;  2XPY A;  3PUK A;  4BTB A;  3TXM A;  3BEE A;  1HF8 A;  1ELK A;  1E8Y A;  3JYS A;  3KS2 A;  4FHK A;  4CGW A;  2WB2 A;  4IYP A;  3HU6 A;  4F7A A;  3S2A A;  4JTD B;  3PUJ A;  3BG1 B;  5JJ6 A;  4KZ0 A;  3L6A A;  3UMV A;  3L54 A;  1HE8 A;  3PH0 C;  3FEX A;  2AXZ A;  5BO4 C;  2VJ8 A;  3U4T A;  2VGY A;  1U3D A;  4F3V A;  3FTV A;  4ILH B;  5CMY A;  4FHJ A;  3QNK A;  5DIZ A;  3WSO B;  5BW8 C;  4UWH A;  2LAI A;  2IF5 A;  4G11 A;  3C6O A;  4LCT A;  3FUM A;  4RVB A;  3U66 A;  1NZN A;  2WXM A;  4PDX A;  2P1P A;  3OHU A;  3CK8 A;  4ABN A;  5H7H A;  2EQX A;  4ACL A;  4G24 A;  1TJF A;  4C9B B;  2P1N A;  3ZFW A;  1QNF A;  3E4U A;  3JCK C;  3B13 A;  4OYS A;  3ZYQ A;  4W9R A;  4EQF A;  3D9N A;  5HQ8 A;  1FS1 B;  4FLH A;  4JVS A;  3AS5 A;  2BTD A;  2RG8 A;  4PS7 A;  3ZYM A;  4HFG A;  5BXB A;  3FY4 A;  3M8V A;  3HTM A;  2OND A;  3R9A B;  3AU5 A;  2ILR A;  3B7S A;  2DCP A;  2Y3A A;  4H7Y A;  3VLF A;  4BKT B;  1HU3 A;  2L0I A;  2IF4 A;  4I2W A;  2JLB A;  3CR3 A;  2BUG A;  3CKB A;  4TUU A;  3ZHE B;  3TJP A;  3FUE A;  3MKS A;  2NSZ A;  4I1O B;  4J8E A;  3TGO A;  4A3V A;  5J90 A;  1DSX A;  3FU3 A;  4GZC A;  4EBA A;  1PAQ A;  3R7Q A;  4J8S A;  4I6J A;  1SZA A;  4JC8 A;  4M3O A;  4NQ0 A;  4Y6C A;  3TXN A;  1OWP A;  2PM6 A;  3G2V A;  3MJW A;  3U3W A;  4EEC A;  2FEZ A;  2CHZ A;  2LNI A;  4UWK A;  4G23 A;  4IUL A;  2E0I A;  2XGS A;  4UWL A;  2OVP A;  4DK5 A;  4BT9 A;  5J08 A;  4I1M A;  4PH4 B;  5BV0 A;  5KJL A;  2VPK A;  3V7D A;  4UQZ A;  4L2L A;  3FU5 A;  3FKC A;  2LO6 A;  4ACK A;  5A6R A;  3FU6 A;  3Q15 A;  5IBK A;  2J08 A;  3N71 A;  3QC1 A;  3TG5 A;  2FO7 A;  1R28 A;  4AXH A;  3QWP A;  3ZHE A;  3IHV A;  1L5J A;  1OWM A;  3FH7 A;  2E31 B;  3EDT B;  2KZT B;  2XEV A;  4APF A;  4AV7 A;  2VSY A;  2WXF A;  4GYO A;  1QDV A;  4D10 C;  3SBS A;  4W9H H;  4GZD A;  4EPZ A;  4WUY A;  3B7U X;  5ENN A;  5FQ6 A;  5A7D B;  4AM9 A;  3GZ2 A;  2XHE A;  4GAA A;  4KVM A;  3SD5 A;  4W9C B;  3MKR A;  3CVQ A;  4I17 A;  4IN3 B;  1DVP A;  2IZV C;  2Z8H A;  2X6K A;  2GW1 A;  3CVX A;  5LFA A;  5H7G A;  1NA3 A;  1OWL A;  4W9L B;  4RG9 A;  4MRU A;  1UW4 B;  3ZXS A;  4BY6 A;  5KJM A;  4NRH B;  2OVR A;  4UIJ A;  2AXU A;  3EIQ C;  4UI9 J;  3SF4 A;  4ANV A;  2J9Q A;  4GA0 A;  4AY5 A;  3D9I A;  5KCM A;  3ZEF A;  1E90 A;  2QY7 A;  2E32 B;  4JW1 A;  5HZG C;  5BUZ A;  3QDN A;  3IKO B;  3D9O A;  2C0L A;  3Q4A B;  4TRQ A;  3RRN B;  5G05 C;  2J4D A;  3OXF A;  2WXO A;  3CIA A;  2KCL A;  2MHK A;  3E4B A;  3FP3 A;  1NA0 A;  5AEN A;  5FWQ A;  2NC9 A;  4GCO A;  1S1G A;  3ML8 A;  4I43 A;  5A23 A;  1H2T C;  3ASF A;  5AJD A;  3SZ7 A;  2JZ3 C;  1EPU A;  2I6H A;  2PM7 A;  4BTA A;  3C6N A;  1HG2 A;  4G2V A;  3CVU A;  3ZNG B;  4N39 A;  4FU3 A;  4B94 A;  2FF4 A;  3CSF A;  4DLQ A;  4URK A;  2WXG A;  2XRY A;  1HZ4 A;  3KD7 A;  4N3A A;  3KVT A;  2PQR A;  1LF8 A;  2WM9 A;  2XQ0 A;  4DJA A;  3FTU A;  1UG3 A;  2WXP A;  3LPZ A;  5EUP A;  4BKS B;  5FQ4 A;  4CXJ A;  2PPI A;  2WQ6 A;  2C2L A;  2DIW A;  2WMO A;  4KMO A;  4UYI A;  2I9C A;  4RG6 A;  3RRU A;  4GMJ A;  5FT9 A;  3QB2 A;  3FTS A;  4OVV A;  1VCB B;  3GZ1 A;  3PEU B;  4UQY A;  4ATG A;  2OVQ A;  4F53 A;  3GA1 A;  3FUN A;  4P29 A;  3FUL A;  4ILG A;  3MEK A;  4CXI A;  2VYI A;  3ASG A;  2PL2 A;  2L0T B;  3OTN A;  2WPV A;  4WNE A;  4YY8 A;  2XGM A;  4BSX A;  4UQX A;  2P1M A;  3ML9 A;  2J4B A;  4L7T A;  4U0Z A;  4EZL A;  1HV2 A;  3FTW A;  2P1Q A;  4FAD A;  3GYZ A;  3FH8 A;  4FJZ A;  2GRM A;  4I1A A;  5FZQ A;  3D9L A;  4CDR A;  4Q69 A;  3Q47 B;  4HLE A;  5BV1 A;  4JTA B;  1IHG A;  2VGX B;  3APC A;  4CT0 A;  2Q81 A;  2VSN A;  4B95 B;  4LUN U;  2YY9 A;  4XZ4 A;  3LY7 A;  4FA6 A;  3LYA A;  4HOT A;  3ZYK A;  5G04 J;  1NEX A;  1CS3 A;  4N5C A;  2IU1 A;  3CGH A;  4JA7 A;  5DBK A;  3T5X A;  3SFZ A;  2PQN A;  1H6K A;  4W9K B;  3JQ0 A;  3HYM B;  1GW6 A;  3ZRC B;  4GYW A;  3ZRF B;  3LCA A;  4GML A;  2XGO A;  1YA0 A;  2XRZ A;  2E2E A;  4U0S A;  1R2B A;  4XE0 A;  4ANW A;  4MLP A;  3L22 A;  2QFC A;  3QAR A;  4A55 A;  3CLJ A;  4DLO A;  3UX4 A;  4C0M A;  5DAF A;  3QAQ A;  3ZYL A;  2VTB A;  4JEH A;  5C1D A;  2ASS A;  3CQC B;  3ONL A;  4PS3 A;  2UY1 B;  4NAC A;  1VDY A;  5T4Y A;  3WXX A;  4YVO A;  1W3B A;  4LER A;  1X5B A;  3MV2 B;  1TEZ A;  5FTP A;  1E7V A;  3P1U A;  4JZY A;  3C6P A;  3LXU X;  4PUC A;  3L16 A;  3SBT B;  3LNM B;  3OGK A;  2MA9 C;  3I5P A;  4B9K E;  2HR2 A;  4H7X A;  3L13 A;  4TV3 A;  3FEY A;  3BIM A;  3CVW A;  3D3M A;  2A5U A;  2KAT A;  2MRI A;  2OV8 A;  3MKQ B;  4U0U A;  4GPK A;  4BT8 A;  4HVB A;  3LY9 A;  2CG2 A;  4N3B A;  2X38 A;  4L2Y A;  3D9M A;  1HX8 A;  1A17 A;  3FUI A;  1MQS A;  3SNX A;  3ZIM A;  1IYG A;  3CK9 A;  5LX8 A;  4HOS A;  1JWG A;  2FI7 A;  2I1K A;  3FTX A;  3PNT B;  2WQH A;  3QJZ A;  4B9K B;  3B7R L;  3HVE B;  3NQP A;  4LEU A;  4Q94 A;  3ESK A;  4AY6 A;  2R59 A;  1QDW A;  1IQU A;  1QQE A;  3QKY A;  4E85 A;  1ZBP A;  5DAD A;  4JL0 A;  1JUQ A;  3KEZ A;  3K9I A;  4GB9 A;  2AXV A;  3ZN3 A;  3PRZ A;  3EHM A;  3CK7 A;  4A1S A;  3EHN A;  3CHR A;  3HHM A;  1H2V C;  1WY6 A;  3IV0 A;  3UUX A;  4JHR A;  4C0E A;  3CVL A;  1KT1 A;  3B7T A;  3OXG A;  4U63 A;  3FH5 A;  4W9F B;  2V0P A;  3CHQ A;  1HS6 A;  5E75 A;  4MS6 A;  2GRL A;  4GYY A;  4BWR A;  3DRZ A;  1SQM A;  2L6J A;  4HOU A;  5T3R A;  1S0P A;  2IOL A;  3CHS A;  5LCW C;  4ZGC A;  3ULQ A;  3I4R B;  1LM8 C;  2VSO E;  5FZR A;  2J09 A;  3ASH A;  3FWV A;  3L08 A;  1WAO 1;  1OWO A;  4IRU A;  3TL5 A;  3VLE A;  3PNL B;  4DI4 A;  3UPV A;  4UWF A;  4AEZ C;  3CVV A;  4A1G A;  2OVB A;  5EX0 A;  3QWW A;  1EOE A;  2IOS A;  3DRX A;  2X3M A;  3DPD A;  2KCV A;  5JHB A;  1Y6I A;  2KZT A;  2YHC A;  3C98 A;  4U2N A;  3FU0 A;  2WQ7 A;  4JHJ A;  1Z3X A;  4B89 A;  2YNQ A;  4ME2 A;  2I2O A;  4N9F 5;  4BX8 A;  4AP2 A;  5FJY A;  3L17 A;  4GZ5 A;  1HH8 A;  4CP3 A;  3GZS A;  4UI9 C;  4HXI A;  4Q96 A;  4WAF A;  3R7R A;  3OGL A;  2VQ2 A;  5EKQ D;  2WXN A;  4N2Q A;  2A79 B;  1Y8M A;  3ZTD B;  3ONK A;  4GZ6 A;  1WM5 A;  1EOF A;  4CXT A;  4U77 A;  4CDN A;  4A3T A;  1BUO A;  3IEG A;  2NN2 A;  3AS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...