1BFRA

Iron storage and electron transport
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords BACTERIOFERRITIN
publication title Structure of a monoclinic crystal from of cyctochrome b1 (Bacterioferritin) from E. coli.
pubmed doi rcsb
total genus 71
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 1994-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1bfrA00
3WVVA 4TO9A 4RC5A 5FFDA 2HR5A 1NF6A 2RBDA 4LQNA 3FVBA 1S30A 3SHXA 4EVEA 4LQHA 3F33A 3OGHA 1XZ1A 2C2UA 3F39A 4CVSA 3AJPA 4LYXA 4REUA 3SH6A 4RC5B 2CEIA 5D8XA 3RGDA 4ISMA 1LB3A 4E6KA 3E1NA 3SE1A 2GYDA 4MJYA 3T9JA 5JKLA 3HIUA 5HJHA 2Y3QA 1VJXA 2XJMA 4TOAA 1L8IA 1R03A 3R2RA 2FFXJ 3E1MA 3RE7A 4ZKWA 1O9IA 3R2MA 5GU2X 4AM4A 1BG7A 5CMRA 2ZA8A 2CN7A 2V2OA 4MN9A 1AEWA 1BFRA 4U3GA 1OTKA 2FHAA 5ERKA 4EVCA 4DYYA 1VLGA 2V2IA 2QF9A 3PVYA 3AK8A 3PWQA 4ERUA 3WVUA 5ERJA 1QYBA 2CIHA 3PWFA 1JKUA 3FI6A 3AJQA 5JKMA 4LPJA 4DYZA 2FZFA 3EZUA 1NF4A 2FKZA 5LBHA 2HTNA 1RCIA 3AJOA 3IQ1A 4PGIA 3PVYB 5CMQA 1F30A 4TOBA 5C6FA 1JKVA 2CLUA 5J93A 1N1QA 4XKUA 3BVEA 4RC8A 3VNXA 3E1PA 4M34A 2V2NA 1VEQA 5LG8A 2ZA6A 4KVQA 5JACA 5D8RA 3ERZA 2ZG9X 2F7NA 4DZ0A 5AXSA 2FG4A 5FFAA 2Z90A 1QGHA 3F37A 3EGMA 5FFEA 4P18A 4ETRA 5D8PA 3E1LA 2C41A 2JD70 3PW8C 3NOZX 3E1OA 2W0OA 3ISFA 4LPNA 2YW6A 2CHPA 5FFCA 5K53A 1S2ZA 2V2SA 3F34A 4ZTTA 3H7GA 3KA6A 3U90A 4IWKA 1SOFA 2JD80 4CYAA 1UVHA 3HL1A 1GWGA 5D8OA 5GU0X 1DATA 2D5KA 3RAVA 2V2LA 3E1JA 3R2KA 4LPMA 4ZKXA 2VZBA 3KWOA 1J30A 5E2DA 4ISPA 2VXXA 1Z4AA 5GN8B 4M33A 4MKUA 5GOUA 3WNWA 2ITBA 2FL0A 2JD60 2WTLA 4ZLWA 4ZMCA 3NP2X 3RBCA 1JIGA 3AF7X 4Z3BA 1LKOA 3NP0X 3F35A 4TOFA 1XZ3A 2IU2A 3O7RA 2WLAA 2ZG7X 3GHQA 5I4JA 1ZUJA 4AM5A 1YUXA 2C2JA 1JREA 1VELA 3GVYA 3KA4A 3PW8A 2IB0A 4KVRA 1JYBA 1B71A 3A9QA 1JI4A 1NNQA 3UNOA 2UX1A 3E6SA 3F38A 3PVTA 3TA8A 2XKQA 4LQVA 5D8QA 2ZURX 4RC6A 4EVDA 1MFRA 4TOHA 1TJOA 3UOIA 2G4HA 4CVPA 1H96A 2Z5PA 4LYUA 3BKNA 3ISEA 2V2MA 2FJCA 4PG1A 3AK9A 3PVTB 3E2CA 5E1UA 3R2LA 1RCGA 1ZS3A 4TW3A 5HJFA 4RC6B 4MUDA 1O9RA 3KA9A 3KX9A 4TODA 1YUZA 2XJOA 5K52A 3A68A 4CVRA 4ZL5A 2VXIA 2GS4A 3BVIA 3E1QA 4ZJKA 5J8SA 2BJYA 2QQYA 2YW7A 4TOEA 3AF9X 5D8SA 3Q4OA 1KRQA 1RCDA 5GU1X 5CZUA 2CLBA 5J8WA 3RD0A 1L8HA 1MOJA 4A25A 2ZG8X 3QZ3A 2C6RA 5GN8A 4CVTA 1Z6OM 4M32A 3PW1A 2BK6A 3QHBA 3Q4QA 1Z6OA 2CHIA 3AF8X 1DVBA 5HQOA 4ITTA 3R2SA 5FEJA 1FHAA 1EUMA 1S3QA 3SIDA 3KA8A 4EVBA 4TOCA 3F36A 1JGCA 3PW1B 4Y08A 2GYQA 5GU3X 1HRSA 4AM2A 2IY4A 2XGWA 4RC7A 1LKPA 4KVSA 2BW1A 5IX6A 1F33A 4R42A 1TKPA 4XGSA 3KA3A 5FFBA 5JKLG 4DYUA 1YV1A 4CMYV 3UOFA 3E6RA 2WLUA 5D8YA 4RC7B 1RCCA 2C2FA 3IS8A 2CN6A 3QVDA 2BKCA 3F32A 3QB9A 2YJKA 4ZL6A 3MPSA 4QUWA 1IERA 1NFVA 4LQJA 4II4A 4DE6A 3PZAA 3BVLA 1RYTA 4PGKA 4ZKHA 3QHCA 2Z5RA 5JKMG 2V2PA 1LKMA 1JTSA 4DI0A 4II4B 4M35A 2V15A 3FSEA 4MY7A 2ZA7A 2V2JA 1VEIA 4YKHA 3GE4A 3R2HA 1BCFA 2Z5QA 3OJ5A 3R2OA 3Q4NA 4CYBA 3WVWA 4XKTA 1DPSA 2OC5A 3IS7A 1IESA 3BVKA 2YJJA 3BVFA 4DYXA 4XKSA 4DASA 3BT5A 1TK6A 4ITWA 2Z6MA 4TOGA 5LG2A 4Z5SA 4IWJA 4IXKA 2V2RA 3O7SA 1RCEA 3PVRA 1UMNA 3PWQC 2PYBA 4CY9A 4PG0A 1SQ3A 3ES3A 5J9VA 3EZ0A 2X170 4CMYA 2FG8A 2OH3A 1TKOA 2CF7A 3KXUA 1JI5A 3Q4RA 3QD8A 4OYNA 3PVRB 2XJNA 5LS9A 4ML5A
chains in the Genus database with same CATH superfamily
3WVVA 4TO9A 4RC5A 5FFDA 2HR5A 1NF6A 2RBDA 4LQNA 3FVBA 1S30A 3SHXA 4EVEA 4LQHA 3F33A 3OGHA 1XZ1A 4YXJA 2C2UA 3C23A 3F39A 4CVSA 3AJPA 4LYXA 4REUA 3VVAA 3C1ZA 3SH6A 4RC5B 2CEIA 5D8XA 3RGDA 4ISMA 1LB3A 4E6KA 3E1NA 3SE1A 2GYDA 4MJYA 3T9JA 5JKLA 3HIUA 2V8TA 5HJHA 2Y3QA 1VJXA 2XJMA 4TOAA 1L8IA 1R03A 3R2RA 2FFXJ 3E1MA 3RE7A 4ZKWA 3FRRA 1O9IA 3R2MA 4X0JA 5GU2X 4AM4A 1BG7A 5CMRA 2ZA8A 2CN7A 2V2OA 4MN9A 1AEWA 1BFRA 4U3GA 1OTKA 2FHAA 5ERKA 4EVCA 3L0MA 4DYYA 1VLGA 2V2IA 2QF9A 3C1YA 3PVYA 3AK8A 3PWQA 4ERUA 2N02A 3WVUA 5ERJA 1QYBA 2CIHA 3PWFA 1JKUA 3FI6A 3AJQA 5JKMA 4LPJA 4W4KB 4DYZA 2G38B 2FZFA 3EZUA 1NF4A 2FKZA 5LBHA 2HTNA 1RCIA 3AJOA 3IQ1A 4PGIA 3PVYB 5CMQA 1F30A 4TOBA 5C6FA 1JKVA 2CLUA 5J93A 3D19A 1N1QA 4XKUA 3BVEA 4RC8A 3VNXA 3E1PA 4M34A 2V2NA 1VEQA 2AR0A 5LG8A 2ZA6A 4KVQA 5JACA 5D8RA 3ERZA 2ZG9X 2F7NA 4DZ0A 5AXSA 2FG4A 5FFAA 4W4LB 2Z90A 1QGHA 3F37A 3EGMA 5FFEA 4YVZA 4P18A 4ETRA 5D8PA 3E1LA 2C41A 2JD70 3PW8C 4WJG4 3NOZX 3E1OA 3KDQA 2W0OA 3ISFA 4LPNA 2YW6A 2CHPA 5FFCA 5K53A 1S2ZA 2V2SA 3F34A 4ZTTA 3H7GA 3KA6A 3U90A 4IWKA 1SOFA 2JD80 4CYAA 1UVHA 3HL1A 1GWGA 5D8OA 5GU0X 1DATA 2D5KA 3RAVA 2V2LA 3E1JA 3R2KA 4LPMA 4ZKXA 2VZBA 3KWOA 1J30A 5E2DA 4ISPA 2VXXA 1Z4AA 5GN8B 4M33A 4MKUA 5GOUA 3WNWA 2ITBA 2FL0A 2JD60 2WTLA 4ZLWA 4ZMCA 3NP2X 3RBCA 1JIGA 3UFBA 3AF7X 4Z3BA 3N6OA 1LKOA 3NP0X 3F35A 4TOFA 1XZ3A 2IU2A 3O7RA 2WLAA 2ZG7X 4KXRB 3GHQA 5I4JA 1ZUJA 4AM5A 1YUXA 2C2JA 1JREA 1VELA 3GVYA 3KA4A 3PW8A 2IB0A 4KVRA 1JYBA 1B71A 3A9QA 1JI4A 1NNQA 3UNOA 2UX1A 3E6SA 3F38A 3PVTA 3TA8A 2XKQA 4LQVA 5D8QA 3M6JA 2ZURX 4RC6A 4EVDA 1MFRA 4TOHA 1TJOA 3UOIA 2G4HA 4CVPA 1H96A 2Z5PA 4LYUA 3BKNA 3ISEA 2V2MA 3W54A 2FJCA 4PG1A 3AK9A 3PVTB 3E2CA 2Y44A 5E1UA 3R2LA 1RCGA 1ZS3A 4TW3A 5HJFA 4RC6B 4MUDA 1O9RA 3KA9A 4MXPA 3KX9A 4TODA 1YUZA 2XJOA 3GGYA 5K52A 3A68A 2OKCA 4CVRA 4ZL5A 2VXIA 2GS4A 3BVIA 3E1QA 4ZJKA 5J8SA 2BJYA 2QQYA 2YW7A 4E40A 3AF9X 4TOEA 5D8SA 3Q4OA 1KRQA 1RCDA 5GU1X 3DBYA 5CZUA 2CLBA 5J8WA 3RD0A 1L8HA 1MOJA 4A25A 2ZG8X 3QZ3A 2C6RA 5GN8A 4CVTA 1Z6OM 4M32A 3PW1A 2BK6A 3QHBA 3Q4QA 1Z6OA 2CHIA 3AF8X 1DVBA 5HQOA 4ITTA 3R2SA 5FEJA 1FHAA 1EUMA 1S3QA 3SIDA 2WWXB 3KA8A 4EVBA 4TOCA 3F36A 1JGCA 3PW1B 4Y08A 2GYQA 5GU3X 1HRSA 4AM2A 2IY4A 2XGWA 4RC7A 1LKPA 4KVSA 2BW1A 5IX6A 1F33A 4R42A 1TKPA 4XGSA 2MGYA 3KA3A 3LKDA 5FFBA 5JKLG 4DYUA 1YV1A 4CMYV 3UOFA 3E6RA 2WLUA 5D8YA 4RC7B 1RCCA 2C2FA 3IS8A 2CN6A 3QVDA 2BKCA 3F32A 3QB9A 2YJKA 4ZL6A 3MPSA 4QUWA 1IERA 1NFVA 4LQJA 4II4A 3KHKA 4DE6A 3PZAA 3BVLA 5HU6D 1RYTA 4PGKA 3JZ9A 4ZKHA 3QHCA 2Z5RA 5JKMG 5JDOA 2V2PA 1LKMA 1JTSA 4DI0A 4II4B 4YXMA 4M35A 2V15A 3FSEA 4MY7A 2ZA7A 2V2JA 1VEIA 2CWLA 4YKHA 3GE4A 3R2HA 5JDOB 1BCFA 2Z5QA 3OJ5A 3R2OA 3Q4NA 4CYBA 3WVWA 3V3KB 4XKTA 1DPSA 3C21A 2OC5A 3IS7A 1IESA 3GGZA 3BVKA 2YJJA 3BVFA 4DYXA 4XKSA 4DASA 3BT5A 1TK6A 4ITWA 2Z6MA 4TOGA 5LG2A 4Z5SA 4IWJA 4IXKA 2V2RA 3O7SA 1RCEA 3PVRA 1UMNA 3PWQC 2PYBA 4CY9A 2V8UA 3FRSA 4PG0A 3VV9A 1SQ3A 3ES3A 5J9VA 3EZ0A 2X170 4CMYA 3JZAB 2FG8A 2OH3A 1TKOA 2CF7A 3KXUA 1JI5A 3Q4RA 3QD8A 4OYNA 3PVRB 2XJNA 5LS9A 4ML5A
chains in the Genus database with same CATH topology
3WVVA 4TO9A 4RC5A 5FFDA 2HR5A 1NF6A 2RBDA 4LQNA 3FVBA 1S30A 3SHXA 4EVEA 4LQHA 3F33A 3OGHA 1XZ1A 4YXJA 2C2UA 3C23A 3F39A 4CVSA 3AJPA 4LYXA 4REUA 3VVAA 3C1ZA 3SH6A 4RC5B 2CEIA 5D8XA 3RGDA 4ISMA 1LB3A 4E6KA 3E1NA 3SE1A 2GYDA 4MJYA 3T9JA 5JKLA 3HIUA 2V8TA 5HJHA 2Y3QA 1VJXA 2XJMA 4TOAA 1L8IA 1R03A 3R2RA 2FFXJ 3E1MA 3RE7A 4ZKWA 3FRRA 1O9IA 3R2MA 4X0JA 5GU2X 4AM4A 1BG7A 5CMRA 2ZA8A 2CN7A 2V2OA 4MN9A 1AEWA 1BFRA 4U3GA 1OTKA 2FHAA 5ERKA 4EVCA 3L0MA 4DYYA 1VLGA 2V2IA 2QF9A 3C1YA 3PVYA 3AK8A 3PWQA 4ERUA 2N02A 3WVUA 5ERJA 1QYBA 2CIHA 3PWFA 1JKUA 3FI6A 3AJQA 5JKMA 4LPJA 4W4KB 4DYZA 2G38B 2FZFA 3EZUA 1NF4A 2FKZA 5LBHA 2HTNA 1RCIA 3AJOA 3IQ1A 4PGIA 3PVYB 5CMQA 1F30A 4TOBA 5C6FA 1JKVA 2CLUA 5J93A 3D19A 1N1QA 4XKUA 3BVEA 4RC8A 3VNXA 3E1PA 4M34A 2V2NA 1VEQA 2AR0A 5LG8A 2ZA6A 4KVQA 5JACA 5D8RA 3ERZA 2ZG9X 2F7NA 4DZ0A 5AXSA 2FG4A 5FFAA 4W4LB 2Z90A 1QGHA 3F37A 3EGMA 5FFEA 4YVZA 4P18A 4ETRA 5D8PA 3E1LA 2C41A 2JD70 3PW8C 4WJG4 3NOZX 3E1OA 3KDQA 2W0OA 3ISFA 4LPNA 2YW6A 2CHPA 5FFCA 5K53A 1S2ZA 2V2SA 3F34A 4ZTTA 3H7GA 3KA6A 3U90A 4IWKA 1SOFA 2JD80 4CYAA 1UVHA 3HL1A 1GWGA 5D8OA 5GU0X 1DATA 2D5KA 3RAVA 2V2LA 3E1JA 3R2KA 4LPMA 4ZKXA 2VZBA 3KWOA 1J30A 5E2DA 4ISPA 2VXXA 1Z4AA 5GN8B 4M33A 4MKUA 5GOUA 3WNWA 2ITBA 2FL0A 2JD60 2WTLA 4ZLWA 4ZMCA 3NP2X 3RBCA 1JIGA 3UFBA 3AF7X 4Z3BA 3N6OA 1LKOA 3NP0X 3F35A 4TOFA 1XZ3A 2IU2A 3O7RA 2WLAA 2ZG7X 4KXRB 3GHQA 5I4JA 1ZUJA 4AM5A 1YUXA 2C2JA 1JREA 1VELA 3GVYA 3KA4A 3PW8A 2IB0A 4KVRA 1JYBA 1B71A 3A9QA 1JI4A 1NNQA 3UNOA 2UX1A 3E6SA 3F38A 3PVTA 3TA8A 2XKQA 4LQVA 5D8QA 3M6JA 2ZURX 4RC6A 4EVDA 1MFRA 4TOHA 1TJOA 3UOIA 2G4HA 4CVPA 1H96A 2Z5PA 4LYUA 3BKNA 3ISEA 2V2MA 3W54A 2FJCA 4PG1A 3AK9A 3PVTB 3E2CA 2Y44A 5E1UA 3R2LA 1RCGA 1ZS3A 4TW3A 5HJFA 4RC6B 4MUDA 1O9RA 3KA9A 4MXPA 3KX9A 4TODA 1YUZA 2XJOA 3GGYA 5K52A 3A68A 2OKCA 4CVRA 4ZL5A 2VXIA 2GS4A 3BVIA 3E1QA 4ZJKA 5J8SA 2BJYA 2QQYA 2YW7A 4E40A 3AF9X 4TOEA 5D8SA 3Q4OA 1KRQA 1RCDA 5GU1X 3DBYA 5CZUA 2CLBA 5J8WA 3RD0A 1L8HA 1MOJA 4A25A 2ZG8X 3QZ3A 2C6RA 5GN8A 4CVTA 1Z6OM 4M32A 3PW1A 2BK6A 3QHBA 3Q4QA 1Z6OA 2CHIA 3AF8X 1DVBA 5HQOA 4ITTA 3R2SA 5FEJA 1FHAA 1EUMA 1S3QA 3SIDA 2WWXB 3KA8A 4EVBA 4TOCA 3F36A 1JGCA 3PW1B 4Y08A 2GYQA 5GU3X 1HRSA 4AM2A 2IY4A 2XGWA 4RC7A 1LKPA 4KVSA 2BW1A 5IX6A 1F33A 4R42A 1TKPA 4XGSA 2MGYA 3KA3A 3LKDA 5FFBA 5JKLG 4DYUA 1YV1A 4CMYV 3UOFA 3E6RA 2WLUA 5D8YA 4RC7B 1RCCA 2C2FA 3IS8A 2CN6A 3QVDA 2BKCA 3F32A 3QB9A 2YJKA 4ZL6A 3MPSA 4QUWA 1IERA 1NFVA 4LQJA 4II4A 3KHKA 4DE6A 3PZAA 3BVLA 5HU6D 1RYTA 4PGKA 3JZ9A 4ZKHA 3QHCA 2Z5RA 5JKMG 5JDOA 2V2PA 1LKMA 1JTSA 4DI0A 4II4B 4YXMA 4M35A 2V15A 3FSEA 4MY7A 2ZA7A 2V2JA 1VEIA 2CWLA 4YKHA 3GE4A 3R2HA 5JDOB 1BCFA 2Z5QA 3OJ5A 3R2OA 3Q4NA 4CYBA 3WVWA 3V3KB 4XKTA 1DPSA 3C21A 2OC5A 3IS7A 1IESA 3GGZA 3BVKA 2YJJA 3BVFA 4DYXA 4XKSA 4DASA 3BT5A 1TK6A 4ITWA 2Z6MA 4TOGA 5LG2A 4Z5SA 4IWJA 4IXKA 2V2RA 3O7SA 1RCEA 3PVRA 1UMNA 3PWQC 2PYBA 4CY9A 2V8UA 3FRSA 4PG0A 3VV9A 1SQ3A 3ES3A 5J9VA 3EZ0A 2X170 4CMYA 3JZAB 2FG8A 2OH3A 1TKOA 2CF7A 3KXUA 1JI5A 3Q4RA 3QD8A 4OYNA 3PVRB 2XJNA 5LS9A 4ML5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVV A;  4TO9 A;  4RC5 A;  5FFD A;  2HR5 A;  1NF6 A;  2RBD A;  4LQN A;  3FVB A;  1S30 A;  3SHX A;  4EVE A;  4LQH A;  3F33 A;  3OGH A;  1XZ1 A;  2C2U A;  3F39 A;  4CVS A;  3AJP A;  4LYX A;  4REU A;  3SH6 A;  4RC5 B;  2CEI A;  5D8X A;  3RGD A;  4ISM A;  1LB3 A;  4E6K A;  3E1N A;  3SE1 A;  2GYD A;  4MJY A;  3T9J A;  5JKL A;  3HIU A;  5HJH A;  2Y3Q A;  1VJX A;  2XJM A;  4TOA A;  1L8I A;  1R03 A;  3R2R A;  2FFX J;  3E1M A;  3RE7 A;  4ZKW A;  1O9I A;  3R2M A;  5GU2 X;  4AM4 A;  1BG7 A;  5CMR A;  2ZA8 A;  2CN7 A;  2V2O A;  4MN9 A;  1AEW A;  1BFR A;  4U3G A;  1OTK A;  2FHA A;  5ERK A;  4EVC A;  4DYY A;  1VLG A;  2V2I A;  2QF9 A;  3PVY A;  3AK8 A;  3PWQ A;  4ERU A;  3WVU A;  5ERJ A;  1QYB A;  2CIH A;  3PWF A;  1JKU A;  3FI6 A;  3AJQ A;  5JKM A;  4LPJ A;  4DYZ A;  2FZF A;  3EZU A;  1NF4 A;  2FKZ A;  5LBH A;  2HTN A;  1RCI A;  3AJO A;  3IQ1 A;  4PGI A;  3PVY B;  5CMQ A;  1F30 A;  4TOB A;  5C6F A;  1JKV A;  2CLU A;  5J93 A;  1N1Q A;  4XKU A;  3BVE A;  4RC8 A;  3VNX A;  3E1P A;  4M34 A;  2V2N A;  1VEQ A;  5LG8 A;  2ZA6 A;  4KVQ A;  5JAC A;  5D8R A;  3ERZ A;  2ZG9 X;  2F7N A;  4DZ0 A;  5AXS A;  2FG4 A;  5FFA A;  2Z90 A;  1QGH A;  3F37 A;  3EGM A;  5FFE A;  4P18 A;  4ETR A;  5D8P A;  3E1L A;  2C41 A;  2JD7 0;  3PW8 C;  3NOZ X;  3E1O A;  2W0O A;  3ISF A;  4LPN A;  2YW6 A;  2CHP A;  5FFC A;  5K53 A;  1S2Z A;  2V2S A;  3F34 A;  4ZTT A;  3H7G A;  3KA6 A;  3U90 A;  4IWK A;  1SOF A;  2JD8 0;  4CYA A;  1UVH A;  3HL1 A;  1GWG A;  5D8O A;  5GU0 X;  1DAT A;  2D5K A;  3RAV A;  2V2L A;  3E1J A;  3R2K A;  4LPM A;  4ZKX A;  2VZB A;  3KWO A;  1J30 A;  5E2D A;  4ISP A;  2VXX A;  1Z4A A;  5GN8 B;  4M33 A;  4MKU A;  5GOU A;  3WNW A;  2ITB A;  2FL0 A;  2JD6 0;  2WTL A;  4ZLW A;  4ZMC A;  3NP2 X;  3RBC A;  1JIG A;  3AF7 X;  4Z3B A;  1LKO A;  3NP0 X;  3F35 A;  4TOF A;  1XZ3 A;  2IU2 A;  3O7R A;  2WLA A;  2ZG7 X;  3GHQ A;  5I4J A;  1ZUJ A;  4AM5 A;  1YUX A;  2C2J A;  1JRE A;  1VEL A;  3GVY A;  3KA4 A;  3PW8 A;  2IB0 A;  4KVR A;  1JYB A;  1B71 A;  3A9Q A;  1JI4 A;  1NNQ A;  3UNO A;  2UX1 A;  3E6S A;  3F38 A;  3PVT A;  3TA8 A;  2XKQ A;  4LQV A;  5D8Q A;  2ZUR X;  4RC6 A;  4EVD A;  1MFR A;  4TOH A;  1TJO A;  3UOI A;  2G4H A;  4CVP A;  1H96 A;  2Z5P A;  4LYU A;  3BKN A;  3ISE A;  2V2M A;  2FJC A;  4PG1 A;  3AK9 A;  3PVT B;  3E2C A;  5E1U A;  3R2L A;  1RCG A;  1ZS3 A;  4TW3 A;  5HJF A;  4RC6 B;  4MUD A;  1O9R A;  3KA9 A;  3KX9 A;  4TOD A;  1YUZ A;  2XJO A;  5K52 A;  3A68 A;  4CVR A;  4ZL5 A;  2VXI A;  2GS4 A;  3BVI A;  3E1Q A;  4ZJK A;  5J8S A;  2BJY A;  2QQY A;  2YW7 A;  4TOE A;  3AF9 X;  5D8S A;  3Q4O A;  1KRQ A;  1RCD A;  5GU1 X;  5CZU A;  2CLB A;  5J8W A;  3RD0 A;  1L8H A;  1MOJ A;  4A25 A;  2ZG8 X;  3QZ3 A;  2C6R A;  5GN8 A;  4CVT A;  1Z6O M;  4M32 A;  3PW1 A;  2BK6 A;  3QHB A;  3Q4Q A;  1Z6O A;  2CHI A;  3AF8 X;  1DVB A;  5HQO A;  4ITT A;  3R2S A;  5FEJ A;  1FHA A;  1EUM A;  1S3Q A;  3SID A;  3KA8 A;  4EVB A;  4TOC A;  3F36 A;  1JGC A;  3PW1 B;  4Y08 A;  2GYQ A;  5GU3 X;  1HRS A;  4AM2 A;  2IY4 A;  2XGW A;  4RC7 A;  1LKP A;  4KVS A;  2BW1 A;  5IX6 A;  1F33 A;  4R42 A;  1TKP A;  4XGS A;  3KA3 A;  5FFB A;  5JKL G;  4DYU A;  1YV1 A;  4CMY V;  3UOF A;  3E6R A;  2WLU A;  5D8Y A;  4RC7 B;  1RCC A;  2C2F A;  3IS8 A;  2CN6 A;  3QVD A;  2BKC A;  3F32 A;  3QB9 A;  2YJK A;  4ZL6 A;  3MPS A;  4QUW A;  1IER A;  1NFV A;  4LQJ A;  4II4 A;  4DE6 A;  3PZA A;  3BVL A;  1RYT A;  4PGK A;  4ZKH A;  3QHC A;  2Z5R A;  5JKM G;  2V2P A;  1LKM A;  1JTS A;  4DI0 A;  4II4 B;  4M35 A;  2V15 A;  3FSE A;  4MY7 A;  2ZA7 A;  2V2J A;  1VEI A;  4YKH A;  3GE4 A;  3R2H A;  1BCF A;  2Z5Q A;  3OJ5 A;  3R2O A;  3Q4N A;  4CYB A;  3WVW A;  4XKT A;  1DPS A;  2OC5 A;  3IS7 A;  1IES A;  3BVK A;  2YJJ A;  3BVF A;  4DYX A;  4XKS A;  4DAS A;  3BT5 A;  1TK6 A;  4ITW A;  2Z6M A;  4TOG A;  5LG2 A;  4Z5S A;  4IWJ A;  4IXK A;  2V2R A;  3O7S A;  1RCE A;  3PVR A;  1UMN A;  3PWQ C;  2PYB A;  4CY9 A;  4PG0 A;  1SQ3 A;  3ES3 A;  5J9V A;  3EZ0 A;  2X17 0;  4CMY A;  2FG8 A;  2OH3 A;  1TKO A;  2CF7 A;  3KXU A;  1JI5 A;  3Q4R A;  3QD8 A;  4OYN A;  3PVR B;  2XJN A;  5LS9 A;  4ML5 A; 
#chains in the Genus database with same CATH topology
 3WVV A;  4TO9 A;  4RC5 A;  5FFD A;  2HR5 A;  1NF6 A;  2RBD A;  4LQN A;  3FVB A;  1S30 A;  3SHX A;  4EVE A;  4LQH A;  3F33 A;  3OGH A;  1XZ1 A;  4YXJ A;  2C2U A;  3C23 A;  3F39 A;  4CVS A;  3AJP A;  4LYX A;  4REU A;  3VVA A;  3C1Z A;  3SH6 A;  4RC5 B;  2CEI A;  5D8X A;  3RGD A;  4ISM A;  1LB3 A;  4E6K A;  3E1N A;  3SE1 A;  2GYD A;  4MJY A;  3T9J A;  5JKL A;  3HIU A;  2V8T A;  5HJH A;  2Y3Q A;  1VJX A;  2XJM A;  4TOA A;  1L8I A;  1R03 A;  3R2R A;  2FFX J;  3E1M A;  3RE7 A;  4ZKW A;  3FRR A;  1O9I A;  3R2M A;  4X0J A;  5GU2 X;  4AM4 A;  1BG7 A;  5CMR A;  2ZA8 A;  2CN7 A;  2V2O A;  4MN9 A;  1AEW A;  1BFR A;  4U3G A;  1OTK A;  2FHA A;  5ERK A;  4EVC A;  3L0M A;  4DYY A;  1VLG A;  2V2I A;  2QF9 A;  3C1Y A;  3PVY A;  3AK8 A;  3PWQ A;  4ERU A;  2N02 A;  3WVU A;  5ERJ A;  1QYB A;  2CIH A;  3PWF A;  1JKU A;  3FI6 A;  3AJQ A;  5JKM A;  4LPJ A;  4W4K B;  4DYZ A;  2G38 B;  2FZF A;  3EZU A;  1NF4 A;  2FKZ A;  5LBH A;  2HTN A;  1RCI A;  3AJO A;  3IQ1 A;  4PGI A;  3PVY B;  5CMQ A;  1F30 A;  4TOB A;  5C6F A;  1JKV A;  2CLU A;  5J93 A;  3D19 A;  1N1Q A;  4XKU A;  3BVE A;  4RC8 A;  3VNX A;  3E1P A;  4M34 A;  2V2N A;  1VEQ A;  2AR0 A;  5LG8 A;  2ZA6 A;  4KVQ A;  5JAC A;  5D8R A;  3ERZ A;  2ZG9 X;  2F7N A;  4DZ0 A;  5AXS A;  2FG4 A;  5FFA A;  4W4L B;  2Z90 A;  1QGH A;  3F37 A;  3EGM A;  5FFE A;  4YVZ A;  4P18 A;  4ETR A;  5D8P A;  3E1L A;  2C41 A;  2JD7 0;  3PW8 C;  4WJG 4;  3NOZ X;  3E1O A;  3KDQ A;  2W0O A;  3ISF A;  4LPN A;  2YW6 A;  2CHP A;  5FFC A;  5K53 A;  1S2Z A;  2V2S A;  3F34 A;  4ZTT A;  3H7G A;  3KA6 A;  3U90 A;  4IWK A;  1SOF A;  2JD8 0;  4CYA A;  1UVH A;  3HL1 A;  1GWG A;  5D8O A;  5GU0 X;  1DAT A;  2D5K A;  3RAV A;  2V2L A;  3E1J A;  3R2K A;  4LPM A;  4ZKX A;  2VZB A;  3KWO A;  1J30 A;  5E2D A;  4ISP A;  2VXX A;  1Z4A A;  5GN8 B;  4M33 A;  4MKU A;  5GOU A;  3WNW A;  2ITB A;  2FL0 A;  2JD6 0;  2WTL A;  4ZLW A;  4ZMC A;  3NP2 X;  3RBC A;  1JIG A;  3UFB A;  3AF7 X;  4Z3B A;  3N6O A;  1LKO A;  3NP0 X;  3F35 A;  4TOF A;  1XZ3 A;  2IU2 A;  3O7R A;  2WLA A;  2ZG7 X;  4KXR B;  3GHQ A;  5I4J A;  1ZUJ A;  4AM5 A;  1YUX A;  2C2J A;  1JRE A;  1VEL A;  3GVY A;  3KA4 A;  3PW8 A;  2IB0 A;  4KVR A;  1JYB A;  1B71 A;  3A9Q A;  1JI4 A;  1NNQ A;  3UNO A;  2UX1 A;  3E6S A;  3F38 A;  3PVT A;  3TA8 A;  2XKQ A;  4LQV A;  5D8Q A;  3M6J A;  2ZUR X;  4RC6 A;  4EVD A;  1MFR A;  4TOH A;  1TJO A;  3UOI A;  2G4H A;  4CVP A;  1H96 A;  2Z5P A;  4LYU A;  3BKN A;  3ISE A;  2V2M A;  3W54 A;  2FJC A;  4PG1 A;  3AK9 A;  3PVT B;  3E2C A;  2Y44 A;  5E1U A;  3R2L A;  1RCG A;  1ZS3 A;  4TW3 A;  5HJF A;  4RC6 B;  4MUD A;  1O9R A;  3KA9 A;  4MXP A;  3KX9 A;  4TOD A;  1YUZ A;  2XJO A;  3GGY A;  5K52 A;  3A68 A;  2OKC A;  4CVR A;  4ZL5 A;  2VXI A;  2GS4 A;  3BVI A;  3E1Q A;  4ZJK A;  5J8S A;  2BJY A;  2QQY A;  2YW7 A;  4E40 A;  3AF9 X;  4TOE A;  5D8S A;  3Q4O A;  1KRQ A;  1RCD A;  5GU1 X;  3DBY A;  5CZU A;  2CLB A;  5J8W A;  3RD0 A;  1L8H A;  1MOJ A;  4A25 A;  2ZG8 X;  3QZ3 A;  2C6R A;  5GN8 A;  4CVT A;  1Z6O M;  4M32 A;  3PW1 A;  2BK6 A;  3QHB A;  3Q4Q A;  1Z6O A;  2CHI A;  3AF8 X;  1DVB A;  5HQO A;  4ITT A;  3R2S A;  5FEJ A;  1FHA A;  1EUM A;  1S3Q A;  3SID A;  2WWX B;  3KA8 A;  4EVB A;  4TOC A;  3F36 A;  1JGC A;  3PW1 B;  4Y08 A;  2GYQ A;  5GU3 X;  1HRS A;  4AM2 A;  2IY4 A;  2XGW A;  4RC7 A;  1LKP A;  4KVS A;  2BW1 A;  5IX6 A;  1F33 A;  4R42 A;  1TKP A;  4XGS A;  2MGY A;  3KA3 A;  3LKD A;  5FFB A;  5JKL G;  4DYU A;  1YV1 A;  4CMY V;  3UOF A;  3E6R A;  2WLU A;  5D8Y A;  4RC7 B;  1RCC A;  2C2F A;  3IS8 A;  2CN6 A;  3QVD A;  2BKC A;  3F32 A;  3QB9 A;  2YJK A;  4ZL6 A;  3MPS A;  4QUW A;  1IER A;  1NFV A;  4LQJ A;  4II4 A;  3KHK A;  4DE6 A;  3PZA A;  3BVL A;  5HU6 D;  1RYT A;  4PGK A;  3JZ9 A;  4ZKH A;  3QHC A;  2Z5R A;  5JKM G;  5JDO A;  2V2P A;  1LKM A;  1JTS A;  4DI0 A;  4II4 B;  4YXM A;  4M35 A;  2V15 A;  3FSE A;  4MY7 A;  2ZA7 A;  2V2J A;  1VEI A;  2CWL A;  4YKH A;  3GE4 A;  3R2H A;  5JDO B;  1BCF A;  2Z5Q A;  3OJ5 A;  3R2O A;  3Q4N A;  4CYB A;  3WVW A;  3V3K B;  4XKT A;  1DPS A;  3C21 A;  2OC5 A;  3IS7 A;  1IES A;  3GGZ A;  3BVK A;  2YJJ A;  3BVF A;  4DYX A;  4XKS A;  4DAS A;  3BT5 A;  1TK6 A;  4ITW A;  2Z6M A;  4TOG A;  5LG2 A;  4Z5S A;  4IWJ A;  4IXK A;  2V2R A;  3O7S A;  1RCE A;  3PVR A;  1UMN A;  3PWQ C;  2PYB A;  4CY9 A;  2V8U A;  3FRS A;  4PG0 A;  3VV9 A;  1SQ3 A;  3ES3 A;  5J9V A;  3EZ0 A;  2X17 0;  4CMY A;  3JZA B;  2FG8 A;  2OH3 A;  1TKO A;  2CF7 A;  3KXU A;  1JI5 A;  3Q4R A;  3QD8 A;  4OYN A;  3PVR B;  2XJN A;  5LS9 A;  4ML5 A; 
#chains in the Genus database with same CATH homology
 3WVV A;  4TO9 A;  4RC5 A;  5FFD A;  2HR5 A;  1NF6 A;  2RBD A;  4LQN A;  3FVB A;  1S30 A;  3SHX A;  4EVE A;  4LQH A;  3F33 A;  3OGH A;  1XZ1 A;  4YXJ A;  2C2U A;  3C23 A;  3F39 A;  4CVS A;  3AJP A;  4LYX A;  4REU A;  3VVA A;  3C1Z A;  3SH6 A;  4RC5 B;  2CEI A;  5D8X A;  3RGD A;  4ISM A;  1LB3 A;  4E6K A;  3E1N A;  3SE1 A;  2GYD A;  4MJY A;  3T9J A;  5JKL A;  3HIU A;  2V8T A;  5HJH A;  2Y3Q A;  1VJX A;  2XJM A;  4TOA A;  1L8I A;  1R03 A;  3R2R A;  2FFX J;  3E1M A;  3RE7 A;  4ZKW A;  3FRR A;  1O9I A;  3R2M A;  4X0J A;  5GU2 X;  4AM4 A;  1BG7 A;  5CMR A;  2ZA8 A;  2CN7 A;  2V2O A;  4MN9 A;  1AEW A;  1BFR A;  4U3G A;  1OTK A;  2FHA A;  5ERK A;  4EVC A;  3L0M A;  4DYY A;  1VLG A;  2V2I A;  2QF9 A;  3C1Y A;  3PVY A;  3AK8 A;  3PWQ A;  4ERU A;  2N02 A;  3WVU A;  5ERJ A;  1QYB A;  2CIH A;  3PWF A;  1JKU A;  3FI6 A;  3AJQ A;  5JKM A;  4LPJ A;  4W4K B;  4DYZ A;  2G38 B;  2FZF A;  3EZU A;  1NF4 A;  2FKZ A;  5LBH A;  2HTN A;  1RCI A;  3AJO A;  3IQ1 A;  4PGI A;  3PVY B;  5CMQ A;  1F30 A;  4TOB A;  5C6F A;  1JKV A;  2CLU A;  5J93 A;  3D19 A;  1N1Q A;  4XKU A;  3BVE A;  4RC8 A;  3VNX A;  3E1P A;  4M34 A;  2V2N A;  1VEQ A;  2AR0 A;  5LG8 A;  2ZA6 A;  4KVQ A;  5JAC A;  5D8R A;  3ERZ A;  2ZG9 X;  2F7N A;  4DZ0 A;  5AXS A;  2FG4 A;  5FFA A;  4W4L B;  2Z90 A;  1QGH A;  3F37 A;  3EGM A;  5FFE A;  4YVZ A;  4P18 A;  4ETR A;  5D8P A;  3E1L A;  2C41 A;  2JD7 0;  3PW8 C;  4WJG 4;  3NOZ X;  3E1O A;  3KDQ A;  2W0O A;  3ISF A;  4LPN A;  2YW6 A;  2CHP A;  5FFC A;  5K53 A;  1S2Z A;  2V2S A;  3F34 A;  4ZTT A;  3H7G A;  3KA6 A;  3U90 A;  4IWK A;  1SOF A;  2JD8 0;  4CYA A;  1UVH A;  3HL1 A;  1GWG A;  5D8O A;  5GU0 X;  1DAT A;  2D5K A;  3RAV A;  2V2L A;  3E1J A;  3R2K A;  4LPM A;  4ZKX A;  2VZB A;  3KWO A;  1J30 A;  5E2D A;  4ISP A;  2VXX A;  1Z4A A;  5GN8 B;  4M33 A;  4MKU A;  5GOU A;  3WNW A;  2ITB A;  2FL0 A;  2JD6 0;  2WTL A;  4ZLW A;  4ZMC A;  3NP2 X;  3RBC A;  1JIG A;  3UFB A;  3AF7 X;  4Z3B A;  3N6O A;  1LKO A;  3NP0 X;  3F35 A;  4TOF A;  1XZ3 A;  2IU2 A;  3O7R A;  2WLA A;  2ZG7 X;  4KXR B;  3GHQ A;  5I4J A;  1ZUJ A;  4AM5 A;  1YUX A;  2C2J A;  1JRE A;  1VEL A;  3GVY A;  3KA4 A;  3PW8 A;  2IB0 A;  4KVR A;  1JYB A;  1B71 A;  3A9Q A;  1JI4 A;  1NNQ A;  3UNO A;  2UX1 A;  3E6S A;  3F38 A;  3PVT A;  3TA8 A;  2XKQ A;  4LQV A;  5D8Q A;  3M6J A;  2ZUR X;  4RC6 A;  4EVD A;  1MFR A;  4TOH A;  1TJO A;  3UOI A;  2G4H A;  4CVP A;  1H96 A;  2Z5P A;  4LYU A;  3BKN A;  3ISE A;  2V2M A;  3W54 A;  2FJC A;  4PG1 A;  3AK9 A;  3PVT B;  3E2C A;  2Y44 A;  5E1U A;  3R2L A;  1RCG A;  1ZS3 A;  4TW3 A;  5HJF A;  4RC6 B;  4MUD A;  1O9R A;  3KA9 A;  4MXP A;  3KX9 A;  4TOD A;  1YUZ A;  2XJO A;  3GGY A;  5K52 A;  3A68 A;  2OKC A;  4CVR A;  4ZL5 A;  2VXI A;  2GS4 A;  3BVI A;  3E1Q A;  4ZJK A;  5J8S A;  2BJY A;  2QQY A;  2YW7 A;  4E40 A;  3AF9 X;  4TOE A;  5D8S A;  3Q4O A;  1KRQ A;  1RCD A;  5GU1 X;  3DBY A;  5CZU A;  2CLB A;  5J8W A;  3RD0 A;  1L8H A;  1MOJ A;  4A25 A;  2ZG8 X;  3QZ3 A;  2C6R A;  5GN8 A;  4CVT A;  1Z6O M;  4M32 A;  3PW1 A;  2BK6 A;  3QHB A;  3Q4Q A;  1Z6O A;  2CHI A;  3AF8 X;  1DVB A;  5HQO A;  4ITT A;  3R2S A;  5FEJ A;  1FHA A;  1EUM A;  1S3Q A;  3SID A;  2WWX B;  3KA8 A;  4EVB A;  4TOC A;  3F36 A;  1JGC A;  3PW1 B;  4Y08 A;  2GYQ A;  5GU3 X;  1HRS A;  4AM2 A;  2IY4 A;  2XGW A;  4RC7 A;  1LKP A;  4KVS A;  2BW1 A;  5IX6 A;  1F33 A;  4R42 A;  1TKP A;  4XGS A;  2MGY A;  3KA3 A;  3LKD A;  5FFB A;  5JKL G;  4DYU A;  1YV1 A;  4CMY V;  3UOF A;  3E6R A;  2WLU A;  5D8Y A;  4RC7 B;  1RCC A;  2C2F A;  3IS8 A;  2CN6 A;  3QVD A;  2BKC A;  3F32 A;  3QB9 A;  2YJK A;  4ZL6 A;  3MPS A;  4QUW A;  1IER A;  1NFV A;  4LQJ A;  4II4 A;  3KHK A;  4DE6 A;  3PZA A;  3BVL A;  5HU6 D;  1RYT A;  4PGK A;  3JZ9 A;  4ZKH A;  3QHC A;  2Z5R A;  5JKM G;  5JDO A;  2V2P A;  1LKM A;  1JTS A;  4DI0 A;  4II4 B;  4YXM A;  4M35 A;  2V15 A;  3FSE A;  4MY7 A;  2ZA7 A;  2V2J A;  1VEI A;  2CWL A;  4YKH A;  3GE4 A;  3R2H A;  5JDO B;  1BCF A;  2Z5Q A;  3OJ5 A;  3R2O A;  3Q4N A;  4CYB A;  3WVW A;  3V3K B;  4XKT A;  1DPS A;  3C21 A;  2OC5 A;  3IS7 A;  1IES A;  3GGZ A;  3BVK A;  2YJJ A;  3BVF A;  4DYX A;  4XKS A;  4DAS A;  3BT5 A;  1TK6 A;  4ITW A;  2Z6M A;  4TOG A;  5LG2 A;  4Z5S A;  4IWJ A;  4IXK A;  2V2R A;  3O7S A;  1RCE A;  3PVR A;  1UMN A;  3PWQ C;  2PYB A;  4CY9 A;  2V8U A;  3FRS A;  4PG0 A;  3VV9 A;  1SQ3 A;  3ES3 A;  5J9V A;  3EZ0 A;  2X17 0;  4CMY A;  3JZA B;  2FG8 A;  2OH3 A;  1TKO A;  2CF7 A;  3KXU A;  1JI5 A;  3Q4R A;  3QD8 A;  4OYN A;  3PVR B;  2XJN A;  5LS9 A;  4ML5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...