2QQYA

Crystal structure of ferritin like, diiron-carboxylate proteins from bacillus anthracis str. ames
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
139
structure length
139
Chain Sequence
MSHDVKELIEGLNEDLAGEYSAIIMYNHNAATVSGIYRQVLKPFFESEISDEQGHALYLAEKIKTLGGTPTTIPLRVKQAEDVREMLEYARQSEYETIKRYEKRKEQAANLNMTELVVKLEDMIADETNHMEELDRLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Sigma B operon
publication title Crystal Structure of Ferritin like, Diiron-carboxylate Proteins from Bacillus anthracis str. Ames.
rcsb
source organism Bacillus anthracis str.
total genus 55
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2qqyA00
2ZG7X 4YKHA 3AJOA 1JTSA 4M33A 3QHCA 4LQJA 3ISEA 1DPSA 3R2SA 1BCFA 4TOGA 2YJJA 3O7SA 2JD70 5FFAA 2V2NA 2FFXJ 3KA6A 5HJFA 5HQOA 3RGDA 1S30A 5D8SA 4Z3BA 4QUWA 3E1LA 4ZL5A 3ES3A 3NP0X 5AXSA 2CN7A 4ZJKA 4DYUA 2IB0A 4CMYA 4LYXA 2CLBA 3F32A 3GHQA 5D8PA 1JI4A 3TA8A 4XGSA 2D5KA 3R2MA 5JKMA 3A68A 2UX1A 4TW3A 3BT5A 1LB3A 5K53A 1YUZA 2BK6A 5J9VA 5GU3X 1VEIA 3F34A 4ERUA 2ZA7A 3R2LA 2CIHA 2FG8A 4CMYV 2OC5A 1YUXA 2XGWA 4RC7A 1Z4AA 2V2JA 3AF7X 2V2OA 4EVEA 4TO9A 3O7RA 2V2LA 2VXIA 1HRSA 3T9JA 2ZA6A 2FKZA 1QGHA 1VELA 4IWJA 2G4HA 3PWQA 1MOJA 3AF9X 4ZKWA 5LBHA 1KRQA 5JKLG 3NP2X 4LYUA 1XZ1A 3WVUA 4XKUA 5ERKA 1JREA 2CEIA 3AF8X 1JGCA 2HR5A 4ITWA 2CHPA 3KXUA 2YW6A 3PVTA 4AM5A 4P18A 4CVSA 3PVTB 2BW1A 4REUA 1TJOA 5FFEA 4M32A 4RC5A 3F37A 3Q4OA 1B71A 1VJXA 4Z5SA 4RC5B 4CVPA 4RC8A 3PWFA 2OH3A 4ISPA 4LPJA 1SQ3A 4PG1A 3BKNA 2CF7A 4E6KA 3PVYB 4CY9A 1JI5A 3OGHA 2JD60 1VLGA 5D8XA 3FVBA 1RCEA 3BVFA 5J93A 1O9RA 3BVKA 2JD80 3Q4NA 1O9IA 1OTKA 1RYTA 3KX9A 2YW7A 2Z90A 3PW8A 5LG2A 1NNQA 1R03A 4ZTTA 3QD8A 4DZ0A 3E1QA 4MUDA 4MN9A 1LKPA 3FSEA 1JIGA 5D8RA 1NFVA 3KWOA 2ZA8A 4EVDA 1MFRA 3AJPA 4II4A 4DASA 1RCGA 1ZUJA 2YJKA 4IWKA 3RAVA 1TK6A 3E6SA 3AK8A 1S2ZA 3F33A 4II4B 1ZS3A 2XJNA 1IESA 5JKMG 5GN8A 3U90A 3PVRB 2VXXA 5GN8B 3HL1A 3GVYA 3E1JA 4OYNA 5ERJA 2FJCA 1AEWA 3PWQC 1EUMA 3F36A 4TOFA 4TOBA 3RE7A 4DYXA 1S3QA 1GWGA 4TOHA 1L8IA 5D8QA 1NF4A 4IXKA 3HIUA 5CMRA 4XKTA 2FL0A 5CMQA 3UOIA 2F7NA 2C2UA 3BVIA 3H7GA 4A25A 3ISFA 4RC6A 3IS7A 3RBCA 1QYBA 2X170 2WLAA 3F35A 1XZ3A 2ZG8X 3E2CA 4RC6B 2IU2A 4TOCA 4LQHA 4ZKHA 5J8WA 5LS9A 1H96A 4ZLWA 2C2FA 5D8OA 2ZURX 4CYBA 2C41A 1SOFA 4LPMA 4DI0A 3AK9A 2VZBA 3UNOA 3R2HA 1RCIA 1DVBA 2XJMA 3KA3A 1F30A 3AJQA 1LKOA 3QVDA 1L8HA 5FFCA 2ZG9X 4ML5A 3PVYA 2QF9A 1J30A 2BJYA 1NF6A 2W0OA 5K52A 4CVTA 3FI6A 4TOEA 3Q4RA 5CZUA 4KVRA 3IS8A 2V2RA 1TKOA 1YV1A 1TKPA 3BVLA 1IERA 3RD0A 1F33A 3ERZA 1FHAA 4AM2A 5C6FA 5I4JA 3WVWA 1BG7A 3EZUA 3R2KA 2V2PA 4LQNA 3QB9A 2WLUA 4ZMCA 2FG4A 1N1QA 4CYAA 5JACA 1JKVA 3EGMA 2V2SA 4AM4A 1VEQA 3E1MA 4PG0A 2V15A 2GYQA 4ITTA 3SE1A 4R42A 3KA8A 5GU1X 5E1UA 2PYBA 5LG8A 3PVRA 2C6RA 2V2IA 4M34A 3SIDA 3PW1A 1JKUA 3VNXA 4ZL6A 2Y3QA 2XJOA 3IQ1A 4DYZA 3KA4A 3PW1B 2CN6A 3MPSA 5E2DA 4ISMA 5FEJA 2WTLA 4MY7A 2C2JA 2GYDA 1Z6OA 3F39A 2XKQA 3QHBA 2FZFA 3A9QA 5GOUA 5IX6A 4MJYA 4ZKXA 2IY4A 2Z5PA 4DE6A 4ETRA 4DYYA 5J8SA 1DATA 1LKMA 2ITBA 2FHAA 1RCCA 4CVRA 3NOZX 2QQYA 5HJHA 4MKUA 4RC7B 2HTNA 5JKLA 3R2OA 1JYBA 4XKSA 5FFBA 2Z6MA 3Q4QA 3QZ3A 3SH6A 5GU2X 3E1NA 3E1PA 4TOAA 3EZ0A 3F38A 3WNWA 3E1OA 4U3GA 3R2RA 4PGIA 2CLUA 3E6RA 3BVEA 2V2MA 4LQVA 4Y08A 1BFRA 3WVVA 4KVSA 2CHIA 2RBDA 3PZAA 2Z5RA 4EVCA 4KVQA 4EVBA 1Z6OM 4LPNA 5D8YA 3SHXA 5FFDA 1RCDA 1UVHA 2Z5QA 5GU0X 3PW8C 1UMNA 4TODA 4M35A 4PGKA 3UOFA 3GE4A 2GS4A 3OJ5A 3KA9A 2BKCA
chains in the Genus database with same CATH superfamily
2ZG7X 4YKHA 3AJOA 1JTSA 4MXPA 4M33A 3QHCA 4LQJA 2OKCA 3ISEA 1DPSA 3R2SA 1BCFA 4TOGA 2YJJA 3O7SA 2JD70 5FFAA 2V2NA 2FFXJ 3KA6A 5HJFA 5HQOA 3RGDA 1S30A 5D8SA 4YXJA 4Z3BA 4QUWA 3E1LA 4ZL5A 3ES3A 3NP0X 5AXSA 2CN7A 4ZJKA 4DYUA 2IB0A 4CMYA 4LYXA 2CLBA 3F32A 3GHQA 5D8PA 2V8UA 1JI4A 3TA8A 4XGSA 2D5KA 3R2MA 5JKMA 3A68A 2UX1A 4TW3A 2N02A 3BT5A 1LB3A 5K53A 1YUZA 2BK6A 5J9VA 2AR0A 5GU3X 1VEIA 3KHKA 3F34A 4ERUA 2ZA7A 3R2LA 2CIHA 2FG8A 4CMYV 2OC5A 1YUXA 2XGWA 4RC7A 4YVZA 1Z4AA 2V2JA 3AF7X 2V2OA 4EVEA 4TO9A 3O7RA 2V2LA 2VXIA 1HRSA 3T9JA 2ZA6A 2FKZA 1QGHA 1VELA 4IWJA 2G4HA 3PWQA 1MOJA 4W4KB 3AF9X 4ZKWA 5LBHA 1KRQA 5JKLG 3NP2X 4LYUA 1XZ1A 3WVUA 4XKUA 5ERKA 1JREA 2CEIA 3AF8X 1JGCA 2HR5A 4ITWA 2CHPA 4E40A 3KXUA 2YW6A 3PVTA 4AM5A 4P18A 4CVSA 3PVTB 2BW1A 4REUA 1TJOA 5FFEA 4M32A 4RC5A 3F37A 3Q4OA 1B71A 1VJXA 4Z5SA 4RC5B 5JDOA 3C1YA 4CVPA 4RC8A 3PWFA 2OH3A 4ISPA 4LPJA 5JDOB 1SQ3A 4PG1A 3BKNA 2CF7A 4E6KA 3PVYB 4CY9A 1JI5A 3OGHA 2JD60 1VLGA 5D8XA 3FVBA 1RCEA 3BVFA 2V8TA 5J93A 1O9RA 3BVKA 2JD80 3Q4NA 2CWLA 1O9IA 1OTKA 1RYTA 3UFBA 3KX9A 2YW7A 3FRSA 2Z90A 3PW8A 5LG2A 1NNQA 1R03A 4ZTTA 3QD8A 4DZ0A 3E1QA 4MUDA 4MN9A 1LKPA 3C23A 3FSEA 1JIGA 5D8RA 1NFVA 3KWOA 2ZA8A 4EVDA 1MFRA 3AJPA 4II4A 4DASA 1RCGA 1ZUJA 2YJKA 4IWKA 3RAVA 1TK6A 3E6SA 3AK8A 1S2ZA 3F33A 4II4B 1ZS3A 2XJNA 1IESA 5JKMG 2WWXB 5GN8A 3U90A 3PVRB 2VXXA 3GGYA 5GN8B 3HL1A 3GVYA 3E1JA 3KDQA 4OYNA 5ERJA 2FJCA 1AEWA 3PWQC 1EUMA 4W4LB 3F36A 4TOFA 4TOBA 3RE7A 4DYXA 1S3QA 1GWGA 4TOHA 1L8IA 5D8QA 1NF4A 4IXKA 3HIUA 5CMRA 4XKTA 2FL0A 5CMQA 3UOIA 2F7NA 2C2UA 3BVIA 3H7GA 4A25A 3ISFA 4RC6A 3IS7A 3RBCA 1QYBA 2X170 2WLAA 3F35A 2Y44A 1XZ3A 2ZG8X 3E2CA 4RC6B 2IU2A 4TOCA 4LQHA 4ZKHA 5J8WA 5LS9A 1H96A 4ZLWA 2C2FA 5D8OA 2ZURX 4CYBA 2C41A 1SOFA 4LPMA 4DI0A 3AK9A 3VV9A 2VZBA 3UNOA 3R2HA 1RCIA 3DBYA 4YXMA 1DVBA 2XJMA 3KA3A 1F30A 3AJQA 1LKOA 3QVDA 1L8HA 5FFCA 3JZ9A 2ZG9X 4ML5A 3PVYA 2QF9A 1J30A 2BJYA 1NF6A 2W0OA 5K52A 3N6OA 4CVTA 3FI6A 3D19A 4TOEA 3Q4RA 5CZUA 4KVRA 3IS8A 2V2RA 1TKOA 1YV1A 1TKPA 3BVLA 1IERA 3RD0A 1F33A 3ERZA 1FHAA 3W54A 4AM2A 5C6FA 5I4JA 3WVWA 1BG7A 4WJG4 3EZUA 3R2KA 5HU6D 2V2PA 4LQNA 3QB9A 2WLUA 4ZMCA 2FG4A 1N1QA 4CYAA 3LKDA 5JACA 1JKVA 3EGMA 2V2SA 4AM4A 1VEQA 3E1MA 4PG0A 2V15A 2GYQA 2G38B 4ITTA 3SE1A 4R42A 3KA8A 5GU1X 5E1UA 2PYBA 5LG8A 3PVRA 2C6RA 2V2IA 4M34A 3SIDA 3PW1A 1JKUA 3VNXA 4ZL6A 2Y3QA 2XJOA 3IQ1A 4DYZA 3KA4A 3PW1B 2CN6A 3MPSA 5E2DA 4ISMA 5FEJA 2WTLA 4MY7A 2C2JA 2GYDA 1Z6OA 3F39A 2XKQA 3QHBA 2FZFA 3A9QA 5GOUA 5IX6A 3L0MA 4MJYA 4ZKXA 3C1ZA 2IY4A 2Z5PA 4DE6A 4ETRA 4DYYA 5J8SA 1DATA 1LKMA 2ITBA 2FHAA 1RCCA 4CVRA 3NOZX 2QQYA 5HJHA 4MKUA 4RC7B 2HTNA 5JKLA 3R2OA 1JYBA 3FRRA 4XKSA 5FFBA 2Z6MA 3Q4QA 3QZ3A 3SH6A 5GU2X 3JZAB 3E1NA 3E1PA 2MGYA 4TOAA 3EZ0A 3F38A 3WNWA 3E1OA 4U3GA 3R2RA 4PGIA 2CLUA 3E6RA 3BVEA 4KXRB 3V3KB 2V2MA 4LQVA 4Y08A 1BFRA 3M6JA 3WVVA 4KVSA 2CHIA 2RBDA 3PZAA 2Z5RA 3C21A 4EVCA 4KVQA 4EVBA 1Z6OM 4LPNA 5D8YA 3SHXA 5FFDA 3VVAA 1RCDA 4X0JA 1UVHA 2Z5QA 5GU0X 3PW8C 1UMNA 4TODA 3GGZA 4M35A 4PGKA 3UOFA 3GE4A 2GS4A 3OJ5A 3KA9A 2BKCA
chains in the Genus database with same CATH topology
2ZG7X 4YKHA 3AJOA 1JTSA 4MXPA 4M33A 3QHCA 4LQJA 2OKCA 3ISEA 1DPSA 3R2SA 1BCFA 4TOGA 2YJJA 3O7SA 2JD70 5FFAA 2V2NA 2FFXJ 3KA6A 5HJFA 5HQOA 3RGDA 1S30A 5D8SA 4YXJA 4Z3BA 4QUWA 3E1LA 4ZL5A 3ES3A 3NP0X 5AXSA 2CN7A 4ZJKA 4DYUA 2IB0A 4CMYA 4LYXA 2CLBA 3F32A 3GHQA 5D8PA 2V8UA 1JI4A 3TA8A 4XGSA 2D5KA 3R2MA 5JKMA 3A68A 2UX1A 4TW3A 2N02A 3BT5A 1LB3A 5K53A 1YUZA 2BK6A 5J9VA 2AR0A 5GU3X 1VEIA 3KHKA 3F34A 4ERUA 2ZA7A 3R2LA 2CIHA 2FG8A 4CMYV 2OC5A 1YUXA 2XGWA 4RC7A 4YVZA 1Z4AA 2V2JA 3AF7X 2V2OA 4EVEA 4TO9A 3O7RA 2V2LA 2VXIA 1HRSA 3T9JA 2ZA6A 2FKZA 1QGHA 1VELA 4IWJA 2G4HA 3PWQA 1MOJA 4W4KB 3AF9X 4ZKWA 5LBHA 1KRQA 5JKLG 3NP2X 4LYUA 1XZ1A 3WVUA 4XKUA 5ERKA 1JREA 2CEIA 3AF8X 1JGCA 2HR5A 4ITWA 2CHPA 4E40A 3KXUA 2YW6A 3PVTA 4AM5A 4P18A 4CVSA 3PVTB 2BW1A 4REUA 1TJOA 5FFEA 4M32A 4RC5A 3F37A 3Q4OA 1B71A 1VJXA 4Z5SA 4RC5B 5JDOA 3C1YA 4CVPA 4RC8A 3PWFA 2OH3A 4ISPA 4LPJA 5JDOB 1SQ3A 4PG1A 3BKNA 2CF7A 4E6KA 3PVYB 4CY9A 1JI5A 3OGHA 2JD60 1VLGA 5D8XA 3FVBA 1RCEA 3BVFA 2V8TA 5J93A 1O9RA 3BVKA 2JD80 3Q4NA 2CWLA 1O9IA 1OTKA 1RYTA 3UFBA 3KX9A 2YW7A 3FRSA 2Z90A 3PW8A 5LG2A 1NNQA 1R03A 4ZTTA 3QD8A 4DZ0A 3E1QA 4MUDA 4MN9A 1LKPA 3C23A 3FSEA 1JIGA 5D8RA 1NFVA 3KWOA 2ZA8A 4EVDA 1MFRA 3AJPA 4II4A 4DASA 1RCGA 1ZUJA 2YJKA 4IWKA 3RAVA 1TK6A 3E6SA 3AK8A 1S2ZA 3F33A 4II4B 1ZS3A 2XJNA 1IESA 5JKMG 2WWXB 5GN8A 3U90A 3PVRB 2VXXA 3GGYA 5GN8B 3HL1A 3GVYA 3E1JA 3KDQA 4OYNA 5ERJA 2FJCA 1AEWA 3PWQC 1EUMA 4W4LB 3F36A 4TOFA 4TOBA 3RE7A 4DYXA 1S3QA 1GWGA 4TOHA 1L8IA 5D8QA 1NF4A 4IXKA 3HIUA 5CMRA 4XKTA 2FL0A 5CMQA 3UOIA 2F7NA 2C2UA 3BVIA 3H7GA 4A25A 3ISFA 4RC6A 3IS7A 3RBCA 1QYBA 2X170 2WLAA 3F35A 2Y44A 1XZ3A 2ZG8X 3E2CA 4RC6B 2IU2A 4TOCA 4LQHA 4ZKHA 5J8WA 5LS9A 1H96A 4ZLWA 2C2FA 5D8OA 2ZURX 4CYBA 2C41A 1SOFA 4LPMA 4DI0A 3AK9A 3VV9A 2VZBA 3UNOA 3R2HA 1RCIA 3DBYA 4YXMA 1DVBA 2XJMA 3KA3A 1F30A 3AJQA 1LKOA 3QVDA 1L8HA 5FFCA 3JZ9A 2ZG9X 4ML5A 3PVYA 2QF9A 1J30A 2BJYA 1NF6A 2W0OA 5K52A 3N6OA 4CVTA 3FI6A 3D19A 4TOEA 3Q4RA 5CZUA 4KVRA 3IS8A 2V2RA 1TKOA 1YV1A 1TKPA 3BVLA 1IERA 3RD0A 1F33A 3ERZA 1FHAA 3W54A 4AM2A 5C6FA 5I4JA 3WVWA 1BG7A 4WJG4 3EZUA 3R2KA 5HU6D 2V2PA 4LQNA 3QB9A 2WLUA 4ZMCA 2FG4A 1N1QA 4CYAA 3LKDA 5JACA 1JKVA 3EGMA 2V2SA 4AM4A 1VEQA 3E1MA 4PG0A 2V15A 2GYQA 2G38B 4ITTA 3SE1A 4R42A 3KA8A 5GU1X 5E1UA 2PYBA 5LG8A 3PVRA 2C6RA 2V2IA 4M34A 3SIDA 3PW1A 1JKUA 3VNXA 4ZL6A 2Y3QA 2XJOA 3IQ1A 4DYZA 3KA4A 3PW1B 2CN6A 3MPSA 5E2DA 4ISMA 5FEJA 2WTLA 4MY7A 2C2JA 2GYDA 1Z6OA 3F39A 2XKQA 3QHBA 2FZFA 3A9QA 5GOUA 5IX6A 3L0MA 4MJYA 4ZKXA 3C1ZA 2IY4A 2Z5PA 4DE6A 4ETRA 4DYYA 5J8SA 1DATA 1LKMA 2ITBA 2FHAA 1RCCA 4CVRA 3NOZX 2QQYA 5HJHA 4MKUA 4RC7B 2HTNA 5JKLA 3R2OA 1JYBA 3FRRA 4XKSA 5FFBA 2Z6MA 3Q4QA 3QZ3A 3SH6A 5GU2X 3JZAB 3E1NA 3E1PA 2MGYA 4TOAA 3EZ0A 3F38A 3WNWA 3E1OA 4U3GA 3R2RA 4PGIA 2CLUA 3E6RA 3BVEA 4KXRB 3V3KB 2V2MA 4LQVA 4Y08A 1BFRA 3M6JA 3WVVA 4KVSA 2CHIA 2RBDA 3PZAA 2Z5RA 3C21A 4EVCA 4KVQA 4EVBA 1Z6OM 4LPNA 5D8YA 3SHXA 5FFDA 3VVAA 1RCDA 4X0JA 1UVHA 2Z5QA 5GU0X 3PW8C 1UMNA 4TODA 3GGZA 4M35A 4PGKA 3UOFA 3GE4A 2GS4A 3OJ5A 3KA9A 2BKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZG7 X;  4YKH A;  3AJO A;  1JTS A;  4M33 A;  3QHC A;  4LQJ A;  3ISE A;  1DPS A;  3R2S A;  1BCF A;  4TOG A;  2YJJ A;  3O7S A;  2JD7 0;  5FFA A;  2V2N A;  2FFX J;  3KA6 A;  5HJF A;  5HQO A;  3RGD A;  1S30 A;  5D8S A;  4Z3B A;  4QUW A;  3E1L A;  4ZL5 A;  3ES3 A;  3NP0 X;  5AXS A;  2CN7 A;  4ZJK A;  4DYU A;  2IB0 A;  4CMY A;  4LYX A;  2CLB A;  3F32 A;  3GHQ A;  5D8P A;  1JI4 A;  3TA8 A;  4XGS A;  2D5K A;  3R2M A;  5JKM A;  3A68 A;  2UX1 A;  4TW3 A;  3BT5 A;  1LB3 A;  5K53 A;  1YUZ A;  2BK6 A;  5J9V A;  5GU3 X;  1VEI A;  3F34 A;  4ERU A;  2ZA7 A;  3R2L A;  2CIH A;  2FG8 A;  4CMY V;  2OC5 A;  1YUX A;  2XGW A;  4RC7 A;  1Z4A A;  2V2J A;  3AF7 X;  2V2O A;  4EVE A;  4TO9 A;  3O7R A;  2V2L A;  2VXI A;  1HRS A;  3T9J A;  2ZA6 A;  2FKZ A;  1QGH A;  1VEL A;  4IWJ A;  2G4H A;  3PWQ A;  1MOJ A;  3AF9 X;  4ZKW A;  5LBH A;  1KRQ A;  5JKL G;  3NP2 X;  4LYU A;  1XZ1 A;  3WVU A;  4XKU A;  5ERK A;  1JRE A;  2CEI A;  3AF8 X;  1JGC A;  2HR5 A;  4ITW A;  2CHP A;  3KXU A;  2YW6 A;  3PVT A;  4AM5 A;  4P18 A;  4CVS A;  3PVT B;  2BW1 A;  4REU A;  1TJO A;  5FFE A;  4M32 A;  4RC5 A;  3F37 A;  3Q4O A;  1B71 A;  1VJX A;  4Z5S A;  4RC5 B;  4CVP A;  4RC8 A;  3PWF A;  2OH3 A;  4ISP A;  4LPJ A;  1SQ3 A;  4PG1 A;  3BKN A;  2CF7 A;  4E6K A;  3PVY B;  4CY9 A;  1JI5 A;  3OGH A;  2JD6 0;  1VLG A;  5D8X A;  3FVB A;  1RCE A;  3BVF A;  5J93 A;  1O9R A;  3BVK A;  2JD8 0;  3Q4N A;  1O9I A;  1OTK A;  1RYT A;  3KX9 A;  2YW7 A;  2Z90 A;  3PW8 A;  5LG2 A;  1NNQ A;  1R03 A;  4ZTT A;  3QD8 A;  4DZ0 A;  3E1Q A;  4MUD A;  4MN9 A;  1LKP A;  3FSE A;  1JIG A;  5D8R A;  1NFV A;  3KWO A;  2ZA8 A;  4EVD A;  1MFR A;  3AJP A;  4II4 A;  4DAS A;  1RCG A;  1ZUJ A;  2YJK A;  4IWK A;  3RAV A;  1TK6 A;  3E6S A;  3AK8 A;  1S2Z A;  3F33 A;  4II4 B;  1ZS3 A;  2XJN A;  1IES A;  5JKM G;  5GN8 A;  3U90 A;  3PVR B;  2VXX A;  5GN8 B;  3HL1 A;  3GVY A;  3E1J A;  4OYN A;  5ERJ A;  2FJC A;  1AEW A;  3PWQ C;  1EUM A;  3F36 A;  4TOF A;  4TOB A;  3RE7 A;  4DYX A;  1S3Q A;  1GWG A;  4TOH A;  1L8I A;  5D8Q A;  1NF4 A;  4IXK A;  3HIU A;  5CMR A;  4XKT A;  2FL0 A;  5CMQ A;  3UOI A;  2F7N A;  2C2U A;  3BVI A;  3H7G A;  4A25 A;  3ISF A;  4RC6 A;  3IS7 A;  3RBC A;  1QYB A;  2X17 0;  2WLA A;  3F35 A;  1XZ3 A;  2ZG8 X;  3E2C A;  4RC6 B;  2IU2 A;  4TOC A;  4LQH A;  4ZKH A;  5J8W A;  5LS9 A;  1H96 A;  4ZLW A;  2C2F A;  5D8O A;  2ZUR X;  4CYB A;  2C41 A;  1SOF A;  4LPM A;  4DI0 A;  3AK9 A;  2VZB A;  3UNO A;  3R2H A;  1RCI A;  1DVB A;  2XJM A;  3KA3 A;  1F30 A;  3AJQ A;  1LKO A;  3QVD A;  1L8H A;  5FFC A;  2ZG9 X;  4ML5 A;  3PVY A;  2QF9 A;  1J30 A;  2BJY A;  1NF6 A;  2W0O A;  5K52 A;  4CVT A;  3FI6 A;  4TOE A;  3Q4R A;  5CZU A;  4KVR A;  3IS8 A;  2V2R A;  1TKO A;  1YV1 A;  1TKP A;  3BVL A;  1IER A;  3RD0 A;  1F33 A;  3ERZ A;  1FHA A;  4AM2 A;  5C6F A;  5I4J A;  3WVW A;  1BG7 A;  3EZU A;  3R2K A;  2V2P A;  4LQN A;  3QB9 A;  2WLU A;  4ZMC A;  2FG4 A;  1N1Q A;  4CYA A;  5JAC A;  1JKV A;  3EGM A;  2V2S A;  4AM4 A;  1VEQ A;  3E1M A;  4PG0 A;  2V15 A;  2GYQ A;  4ITT A;  3SE1 A;  4R42 A;  3KA8 A;  5GU1 X;  5E1U A;  2PYB A;  5LG8 A;  3PVR A;  2C6R A;  2V2I A;  4M34 A;  3SID A;  3PW1 A;  1JKU A;  3VNX A;  4ZL6 A;  2Y3Q A;  2XJO A;  3IQ1 A;  4DYZ A;  3KA4 A;  3PW1 B;  2CN6 A;  3MPS A;  5E2D A;  4ISM A;  5FEJ A;  2WTL A;  4MY7 A;  2C2J A;  2GYD A;  1Z6O A;  3F39 A;  2XKQ A;  3QHB A;  2FZF A;  3A9Q A;  5GOU A;  5IX6 A;  4MJY A;  4ZKX A;  2IY4 A;  2Z5P A;  4DE6 A;  4ETR A;  4DYY A;  5J8S A;  1DAT A;  1LKM A;  2ITB A;  2FHA A;  1RCC A;  4CVR A;  3NOZ X;  2QQY A;  5HJH A;  4MKU A;  4RC7 B;  2HTN A;  5JKL A;  3R2O A;  1JYB A;  4XKS A;  5FFB A;  2Z6M A;  3Q4Q A;  3QZ3 A;  3SH6 A;  5GU2 X;  3E1N A;  3E1P A;  4TOA A;  3EZ0 A;  3F38 A;  3WNW A;  3E1O A;  4U3G A;  3R2R A;  4PGI A;  2CLU A;  3E6R A;  3BVE A;  2V2M A;  4LQV A;  4Y08 A;  1BFR A;  3WVV A;  4KVS A;  2CHI A;  2RBD A;  3PZA A;  2Z5R A;  4EVC A;  4KVQ A;  4EVB A;  1Z6O M;  4LPN A;  5D8Y A;  3SHX A;  5FFD A;  1RCD A;  1UVH A;  2Z5Q A;  5GU0 X;  3PW8 C;  1UMN A;  4TOD A;  4M35 A;  4PGK A;  3UOF A;  3GE4 A;  2GS4 A;  3OJ5 A;  3KA9 A;  2BKC A; 
#chains in the Genus database with same CATH topology
 2ZG7 X;  4YKH A;  3AJO A;  1JTS A;  4MXP A;  4M33 A;  3QHC A;  4LQJ A;  2OKC A;  3ISE A;  1DPS A;  3R2S A;  1BCF A;  4TOG A;  2YJJ A;  3O7S A;  2JD7 0;  5FFA A;  2V2N A;  2FFX J;  3KA6 A;  5HJF A;  5HQO A;  3RGD A;  1S30 A;  5D8S A;  4YXJ A;  4Z3B A;  4QUW A;  3E1L A;  4ZL5 A;  3ES3 A;  3NP0 X;  5AXS A;  2CN7 A;  4ZJK A;  4DYU A;  2IB0 A;  4CMY A;  4LYX A;  2CLB A;  3F32 A;  3GHQ A;  5D8P A;  2V8U A;  1JI4 A;  3TA8 A;  4XGS A;  2D5K A;  3R2M A;  5JKM A;  3A68 A;  2UX1 A;  4TW3 A;  2N02 A;  3BT5 A;  1LB3 A;  5K53 A;  1YUZ A;  2BK6 A;  5J9V A;  2AR0 A;  5GU3 X;  1VEI A;  3KHK A;  3F34 A;  4ERU A;  2ZA7 A;  3R2L A;  2CIH A;  2FG8 A;  4CMY V;  2OC5 A;  1YUX A;  2XGW A;  4RC7 A;  4YVZ A;  1Z4A A;  2V2J A;  3AF7 X;  2V2O A;  4EVE A;  4TO9 A;  3O7R A;  2V2L A;  2VXI A;  1HRS A;  3T9J A;  2ZA6 A;  2FKZ A;  1QGH A;  1VEL A;  4IWJ A;  2G4H A;  3PWQ A;  1MOJ A;  4W4K B;  3AF9 X;  4ZKW A;  5LBH A;  1KRQ A;  5JKL G;  3NP2 X;  4LYU A;  1XZ1 A;  3WVU A;  4XKU A;  5ERK A;  1JRE A;  2CEI A;  3AF8 X;  1JGC A;  2HR5 A;  4ITW A;  2CHP A;  4E40 A;  3KXU A;  2YW6 A;  3PVT A;  4AM5 A;  4P18 A;  4CVS A;  3PVT B;  2BW1 A;  4REU A;  1TJO A;  5FFE A;  4M32 A;  4RC5 A;  3F37 A;  3Q4O A;  1B71 A;  1VJX A;  4Z5S A;  4RC5 B;  5JDO A;  3C1Y A;  4CVP A;  4RC8 A;  3PWF A;  2OH3 A;  4ISP A;  4LPJ A;  5JDO B;  1SQ3 A;  4PG1 A;  3BKN A;  2CF7 A;  4E6K A;  3PVY B;  4CY9 A;  1JI5 A;  3OGH A;  2JD6 0;  1VLG A;  5D8X A;  3FVB A;  1RCE A;  3BVF A;  2V8T A;  5J93 A;  1O9R A;  3BVK A;  2JD8 0;  3Q4N A;  2CWL A;  1O9I A;  1OTK A;  1RYT A;  3UFB A;  3KX9 A;  2YW7 A;  3FRS A;  2Z90 A;  3PW8 A;  5LG2 A;  1NNQ A;  1R03 A;  4ZTT A;  3QD8 A;  4DZ0 A;  3E1Q A;  4MUD A;  4MN9 A;  1LKP A;  3C23 A;  3FSE A;  1JIG A;  5D8R A;  1NFV A;  3KWO A;  2ZA8 A;  4EVD A;  1MFR A;  3AJP A;  4II4 A;  4DAS A;  1RCG A;  1ZUJ A;  2YJK A;  4IWK A;  3RAV A;  1TK6 A;  3E6S A;  3AK8 A;  1S2Z A;  3F33 A;  4II4 B;  1ZS3 A;  2XJN A;  1IES A;  5JKM G;  2WWX B;  5GN8 A;  3U90 A;  3PVR B;  2VXX A;  3GGY A;  5GN8 B;  3HL1 A;  3GVY A;  3E1J A;  3KDQ A;  4OYN A;  5ERJ A;  2FJC A;  1AEW A;  3PWQ C;  1EUM A;  4W4L B;  3F36 A;  4TOF A;  4TOB A;  3RE7 A;  4DYX A;  1S3Q A;  1GWG A;  4TOH A;  1L8I A;  5D8Q A;  1NF4 A;  4IXK A;  3HIU A;  5CMR A;  4XKT A;  2FL0 A;  5CMQ A;  3UOI A;  2F7N A;  2C2U A;  3BVI A;  3H7G A;  4A25 A;  3ISF A;  4RC6 A;  3IS7 A;  3RBC A;  1QYB A;  2X17 0;  2WLA A;  3F35 A;  2Y44 A;  1XZ3 A;  2ZG8 X;  3E2C A;  4RC6 B;  2IU2 A;  4TOC A;  4LQH A;  4ZKH A;  5J8W A;  5LS9 A;  1H96 A;  4ZLW A;  2C2F A;  5D8O A;  2ZUR X;  4CYB A;  2C41 A;  1SOF A;  4LPM A;  4DI0 A;  3AK9 A;  3VV9 A;  2VZB A;  3UNO A;  3R2H A;  1RCI A;  3DBY A;  4YXM A;  1DVB A;  2XJM A;  3KA3 A;  1F30 A;  3AJQ A;  1LKO A;  3QVD A;  1L8H A;  5FFC A;  3JZ9 A;  2ZG9 X;  4ML5 A;  3PVY A;  2QF9 A;  1J30 A;  2BJY A;  1NF6 A;  2W0O A;  5K52 A;  3N6O A;  4CVT A;  3FI6 A;  3D19 A;  4TOE A;  3Q4R A;  5CZU A;  4KVR A;  3IS8 A;  2V2R A;  1TKO A;  1YV1 A;  1TKP A;  3BVL A;  1IER A;  3RD0 A;  1F33 A;  3ERZ A;  1FHA A;  3W54 A;  4AM2 A;  5C6F A;  5I4J A;  3WVW A;  1BG7 A;  4WJG 4;  3EZU A;  3R2K A;  5HU6 D;  2V2P A;  4LQN A;  3QB9 A;  2WLU A;  4ZMC A;  2FG4 A;  1N1Q A;  4CYA A;  3LKD A;  5JAC A;  1JKV A;  3EGM A;  2V2S A;  4AM4 A;  1VEQ A;  3E1M A;  4PG0 A;  2V15 A;  2GYQ A;  2G38 B;  4ITT A;  3SE1 A;  4R42 A;  3KA8 A;  5GU1 X;  5E1U A;  2PYB A;  5LG8 A;  3PVR A;  2C6R A;  2V2I A;  4M34 A;  3SID A;  3PW1 A;  1JKU A;  3VNX A;  4ZL6 A;  2Y3Q A;  2XJO A;  3IQ1 A;  4DYZ A;  3KA4 A;  3PW1 B;  2CN6 A;  3MPS A;  5E2D A;  4ISM A;  5FEJ A;  2WTL A;  4MY7 A;  2C2J A;  2GYD A;  1Z6O A;  3F39 A;  2XKQ A;  3QHB A;  2FZF A;  3A9Q A;  5GOU A;  5IX6 A;  3L0M A;  4MJY A;  4ZKX A;  3C1Z A;  2IY4 A;  2Z5P A;  4DE6 A;  4ETR A;  4DYY A;  5J8S A;  1DAT A;  1LKM A;  2ITB A;  2FHA A;  1RCC A;  4CVR A;  3NOZ X;  2QQY A;  5HJH A;  4MKU A;  4RC7 B;  2HTN A;  5JKL A;  3R2O A;  1JYB A;  3FRR A;  4XKS A;  5FFB A;  2Z6M A;  3Q4Q A;  3QZ3 A;  3SH6 A;  5GU2 X;  3JZA B;  3E1N A;  3E1P A;  2MGY A;  4TOA A;  3EZ0 A;  3F38 A;  3WNW A;  3E1O A;  4U3G A;  3R2R A;  4PGI A;  2CLU A;  3E6R A;  3BVE A;  4KXR B;  3V3K B;  2V2M A;  4LQV A;  4Y08 A;  1BFR A;  3M6J A;  3WVV A;  4KVS A;  2CHI A;  2RBD A;  3PZA A;  2Z5R A;  3C21 A;  4EVC A;  4KVQ A;  4EVB A;  1Z6O M;  4LPN A;  5D8Y A;  3SHX A;  5FFD A;  3VVA A;  1RCD A;  4X0J A;  1UVH A;  2Z5Q A;  5GU0 X;  3PW8 C;  1UMN A;  4TOD A;  3GGZ A;  4M35 A;  4PGK A;  3UOF A;  3GE4 A;  2GS4 A;  3OJ5 A;  3KA9 A;  2BKC A; 
#chains in the Genus database with same CATH homology
 2ZG7 X;  4YKH A;  3AJO A;  1JTS A;  4MXP A;  4M33 A;  3QHC A;  4LQJ A;  2OKC A;  3ISE A;  1DPS A;  3R2S A;  1BCF A;  4TOG A;  2YJJ A;  3O7S A;  2JD7 0;  5FFA A;  2V2N A;  2FFX J;  3KA6 A;  5HJF A;  5HQO A;  3RGD A;  1S30 A;  5D8S A;  4YXJ A;  4Z3B A;  4QUW A;  3E1L A;  4ZL5 A;  3ES3 A;  3NP0 X;  5AXS A;  2CN7 A;  4ZJK A;  4DYU A;  2IB0 A;  4CMY A;  4LYX A;  2CLB A;  3F32 A;  3GHQ A;  5D8P A;  2V8U A;  1JI4 A;  3TA8 A;  4XGS A;  2D5K A;  3R2M A;  5JKM A;  3A68 A;  2UX1 A;  4TW3 A;  2N02 A;  3BT5 A;  1LB3 A;  5K53 A;  1YUZ A;  2BK6 A;  5J9V A;  2AR0 A;  5GU3 X;  1VEI A;  3KHK A;  3F34 A;  4ERU A;  2ZA7 A;  3R2L A;  2CIH A;  2FG8 A;  4CMY V;  2OC5 A;  1YUX A;  2XGW A;  4RC7 A;  4YVZ A;  1Z4A A;  2V2J A;  3AF7 X;  2V2O A;  4EVE A;  4TO9 A;  3O7R A;  2V2L A;  2VXI A;  1HRS A;  3T9J A;  2ZA6 A;  2FKZ A;  1QGH A;  1VEL A;  4IWJ A;  2G4H A;  3PWQ A;  1MOJ A;  4W4K B;  3AF9 X;  4ZKW A;  5LBH A;  1KRQ A;  5JKL G;  3NP2 X;  4LYU A;  1XZ1 A;  3WVU A;  4XKU A;  5ERK A;  1JRE A;  2CEI A;  3AF8 X;  1JGC A;  2HR5 A;  4ITW A;  2CHP A;  4E40 A;  3KXU A;  2YW6 A;  3PVT A;  4AM5 A;  4P18 A;  4CVS A;  3PVT B;  2BW1 A;  4REU A;  1TJO A;  5FFE A;  4M32 A;  4RC5 A;  3F37 A;  3Q4O A;  1B71 A;  1VJX A;  4Z5S A;  4RC5 B;  5JDO A;  3C1Y A;  4CVP A;  4RC8 A;  3PWF A;  2OH3 A;  4ISP A;  4LPJ A;  5JDO B;  1SQ3 A;  4PG1 A;  3BKN A;  2CF7 A;  4E6K A;  3PVY B;  4CY9 A;  1JI5 A;  3OGH A;  2JD6 0;  1VLG A;  5D8X A;  3FVB A;  1RCE A;  3BVF A;  2V8T A;  5J93 A;  1O9R A;  3BVK A;  2JD8 0;  3Q4N A;  2CWL A;  1O9I A;  1OTK A;  1RYT A;  3UFB A;  3KX9 A;  2YW7 A;  3FRS A;  2Z90 A;  3PW8 A;  5LG2 A;  1NNQ A;  1R03 A;  4ZTT A;  3QD8 A;  4DZ0 A;  3E1Q A;  4MUD A;  4MN9 A;  1LKP A;  3C23 A;  3FSE A;  1JIG A;  5D8R A;  1NFV A;  3KWO A;  2ZA8 A;  4EVD A;  1MFR A;  3AJP A;  4II4 A;  4DAS A;  1RCG A;  1ZUJ A;  2YJK A;  4IWK A;  3RAV A;  1TK6 A;  3E6S A;  3AK8 A;  1S2Z A;  3F33 A;  4II4 B;  1ZS3 A;  2XJN A;  1IES A;  5JKM G;  2WWX B;  5GN8 A;  3U90 A;  3PVR B;  2VXX A;  3GGY A;  5GN8 B;  3HL1 A;  3GVY A;  3E1J A;  3KDQ A;  4OYN A;  5ERJ A;  2FJC A;  1AEW A;  3PWQ C;  1EUM A;  4W4L B;  3F36 A;  4TOF A;  4TOB A;  3RE7 A;  4DYX A;  1S3Q A;  1GWG A;  4TOH A;  1L8I A;  5D8Q A;  1NF4 A;  4IXK A;  3HIU A;  5CMR A;  4XKT A;  2FL0 A;  5CMQ A;  3UOI A;  2F7N A;  2C2U A;  3BVI A;  3H7G A;  4A25 A;  3ISF A;  4RC6 A;  3IS7 A;  3RBC A;  1QYB A;  2X17 0;  2WLA A;  3F35 A;  2Y44 A;  1XZ3 A;  2ZG8 X;  3E2C A;  4RC6 B;  2IU2 A;  4TOC A;  4LQH A;  4ZKH A;  5J8W A;  5LS9 A;  1H96 A;  4ZLW A;  2C2F A;  5D8O A;  2ZUR X;  4CYB A;  2C41 A;  1SOF A;  4LPM A;  4DI0 A;  3AK9 A;  3VV9 A;  2VZB A;  3UNO A;  3R2H A;  1RCI A;  3DBY A;  4YXM A;  1DVB A;  2XJM A;  3KA3 A;  1F30 A;  3AJQ A;  1LKO A;  3QVD A;  1L8H A;  5FFC A;  3JZ9 A;  2ZG9 X;  4ML5 A;  3PVY A;  2QF9 A;  1J30 A;  2BJY A;  1NF6 A;  2W0O A;  5K52 A;  3N6O A;  4CVT A;  3FI6 A;  3D19 A;  4TOE A;  3Q4R A;  5CZU A;  4KVR A;  3IS8 A;  2V2R A;  1TKO A;  1YV1 A;  1TKP A;  3BVL A;  1IER A;  3RD0 A;  1F33 A;  3ERZ A;  1FHA A;  3W54 A;  4AM2 A;  5C6F A;  5I4J A;  3WVW A;  1BG7 A;  4WJG 4;  3EZU A;  3R2K A;  5HU6 D;  2V2P A;  4LQN A;  3QB9 A;  2WLU A;  4ZMC A;  2FG4 A;  1N1Q A;  4CYA A;  3LKD A;  5JAC A;  1JKV A;  3EGM A;  2V2S A;  4AM4 A;  1VEQ A;  3E1M A;  4PG0 A;  2V15 A;  2GYQ A;  2G38 B;  4ITT A;  3SE1 A;  4R42 A;  3KA8 A;  5GU1 X;  5E1U A;  2PYB A;  5LG8 A;  3PVR A;  2C6R A;  2V2I A;  4M34 A;  3SID A;  3PW1 A;  1JKU A;  3VNX A;  4ZL6 A;  2Y3Q A;  2XJO A;  3IQ1 A;  4DYZ A;  3KA4 A;  3PW1 B;  2CN6 A;  3MPS A;  5E2D A;  4ISM A;  5FEJ A;  2WTL A;  4MY7 A;  2C2J A;  2GYD A;  1Z6O A;  3F39 A;  2XKQ A;  3QHB A;  2FZF A;  3A9Q A;  5GOU A;  5IX6 A;  3L0M A;  4MJY A;  4ZKX A;  3C1Z A;  2IY4 A;  2Z5P A;  4DE6 A;  4ETR A;  4DYY A;  5J8S A;  1DAT A;  1LKM A;  2ITB A;  2FHA A;  1RCC A;  4CVR A;  3NOZ X;  2QQY A;  5HJH A;  4MKU A;  4RC7 B;  2HTN A;  5JKL A;  3R2O A;  1JYB A;  3FRR A;  4XKS A;  5FFB A;  2Z6M A;  3Q4Q A;  3QZ3 A;  3SH6 A;  5GU2 X;  3JZA B;  3E1N A;  3E1P A;  2MGY A;  4TOA A;  3EZ0 A;  3F38 A;  3WNW A;  3E1O A;  4U3G A;  3R2R A;  4PGI A;  2CLU A;  3E6R A;  3BVE A;  4KXR B;  3V3K B;  2V2M A;  4LQV A;  4Y08 A;  1BFR A;  3M6J A;  3WVV A;  4KVS A;  2CHI A;  2RBD A;  3PZA A;  2Z5R A;  3C21 A;  4EVC A;  4KVQ A;  4EVB A;  1Z6O M;  4LPN A;  5D8Y A;  3SHX A;  5FFD A;  3VVA A;  1RCD A;  4X0J A;  1UVH A;  2Z5Q A;  5GU0 X;  3PW8 C;  1UMN A;  4TOD A;  3GGZ A;  4M35 A;  4PGK A;  3UOF A;  3GE4 A;  2GS4 A;  3OJ5 A;  3KA9 A;  2BKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...