1OTKA

Structural genomics, protein paac
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
244
structure length
244
Chain Sequence
HGNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Phenylacetic acid degradation protein paaC
publication title The 2 A crystal structure of protein paaC from E. Coli
rcsb
source organism Escherichia coli
total genus 103
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1otkA00
4TOBA 2Y3QA 3PVRA 2V2OA 2CF7A 2YW6A 3PW1A 2JD70 5GU3X 3E1PA 5IX6A 1BG7A 3E1LA 3AK9A 3F36A 1NF6A 1VEQA 2ZA7A 4AM5A 3SH6A 1L8IA 2VXXA 2CHIA 4II4B 2HTNA 4M32A 4RC5A 2W0OA 3BVKA 3E1JA 2BK6A 2C2UA 1IERA 4LQNA 2QF9A 3UOIA 3R2KA 5E2DA 1BFRA 1AEWA 3MPSA 4TOFA 4EVEA 2OH3A 1JREA 2XKQA 3TA8A 4DASA 3ISEA 1O9IA 5LG2A 2F7NA 3WVVA 1TJOA 1HRSA 5GN8A 3QHCA 2JD80 3ERZA 4EVDA 4KVRA 5FFAA 3PWQA 5CMQA 3EGMA 2X170 4M34A 4RC6B 2FL0A 1RCEA 4CVSA 3BKNA 2UX1A 2V2LA 4RC7A 4EVBA 5FEJA 5FFBA 1MFRA 5AXSA 5J8SA 2IU2A 2V2JA 3Q4OA 3QHBA 4LPNA 4DYYA 1ZS3A 1ZUJA 2RBDA 1NFVA 1RYTA 4DYZA 5LS9A 4QUWA 1SQ3A 4LYUA 4A25A 4KVSA 4REUA 4XKUA 2Z5RA 1L8HA 4ZKXA 3E1MA 3SE1A 2FG8A 4CVTA 3F38A 4IWJA 3AJPA 2IY4A 4DYUA 5FFCA 2BKCA 2Z5QA 3QVDA 3OGHA 4LPJA 3KX9A 3R2HA 1VJXA 2V2IA 2XJMA 3EZUA 4LPMA 5J8WA 1FHAA 1QGHA 1JTSA 4ZJKA 4ISMA 3RD0A 3E1NA 3WVUA 1OTKA 3PW1B 4PG0A 4OYNA 4ISPA 2FZFA 5K53A 3F39A 3NOZX 4DI0A 3A68A 4R42A 3HIUA 1S3QA 3AJQA 1TKPA 4KVQA 2Z6MA 2YW7A 4RC5B 2ITBA 4AM2A 1IESA 3EZ0A 2QQYA 4LYXA 5JACA 3R2SA 2FKZA 4MY7A 3SIDA 3NP0X 3FVBA 2XJOA 3RBCA 3UOFA 3PVYA 4CVPA 2BJYA 5GU2X 5E1UA 3E1QA 3BVFA 2CHPA 3R2MA 3PW8A 3H7GA 4M33A 3R2LA 1Z6OA 1NF4A 4RC8A 5K52A 1YV1A 3U90A 4Z5SA 3F37A 3BVEA 4Z3BA 3Q4NA 2XGWA 3KA4A 5GN8B 1O9RA 2D5KA 3KA6A 3O7SA 1JI4A 2YJKA 3T9JA 4MJYA 4LQHA 1JIGA 5FFDA 2FJCA 4RC7B 4ITTA 2FFXJ 3IS7A 1RCIA 3UNOA 5JKMA 2ZA6A 5D8PA 4ZL5A 1S30A 3F33A 2C41A 2V2PA 3KA8A 2ZG9X 3E1OA 5CZUA 5JKLA 1YUXA 2OC5A 4CY9A 2ZG8X 1LKPA 3PVTA 5CMRA 2GYQA 4ZTTA 1DPSA 4ZKWA 1KRQA 2CIHA 3AF8X 1JGCA 3HL1A 1QYBA 4EVCA 4P18A 1JKVA 4CMYV 2Z90A 3E6SA 3WVWA 4CMYA 2CN7A 1BCFA 4DZ0A 4ZLWA 4ITWA 3SHXA 5ERKA 2IB0A 3OJ5A 1SOFA 1TK6A 3AF7X 5J9VA 1XZ1A 1VELA 2V2MA 3RGDA 1RCDA 3R2OA 5JKMG 2ZA8A 1J30A 4LQJA 2CLBA 4XKSA 4MN9A 2C2JA 2C6RA 3KWOA 5JKLG 3IQ1A 4PGIA 2WLUA 5GOUA 4ETRA 4TOHA 3AK8A 4CYBA 3PVYB 2YJJA 3AJOA 4IWKA 1F33A 1F30A 4PG1A 3PWQC 5LBHA 4PGKA 2C2FA 1EUMA 2VXIA 5C6FA 5D8XA 2CN6A 2CLUA 3GE4A 3ES3A 3Q4RA 1UMNA 1UVHA 5D8RA 3F32A 5I4JA 4M35A 4ZL6A 4TW3A 3AF9X 1R03A 1YUZA 2GYDA 1LKOA 1XZ3A 1RCGA 4ERUA 3GVYA 3E6RA 2PYBA 3A9QA 4ZKHA 3RE7A 4MKUA 3F34A 4II4A 3R2RA 4DE6A 4IXKA 3IS8A 3FSEA 2ZG7X 4YKHA 4U3GA 3KXUA 1JKUA 3WNWA 1NNQA 3BT5A 2GS4A 2ZURX 1DATA 2BW1A 1RCCA 3PVTB 3BVIA 2WLAA 3PWFA 3E2CA 3KA9A 2Z5PA 4TOEA 2V15A 5HQOA 5D8OA 2JD60 4RC6A 1LB3A 3BVLA 4TOGA 2FHAA 3FI6A 1H96A 5D8YA 4TO9A 4LQVA 4XGSA 5D8SA 1Z4AA 5GU1X 1VEIA 1JI5A 3QB9A 1LKMA 1N1QA 1S2ZA 3F35A 5HJHA 2WTLA 4DYXA 2V2NA 1MOJA 3PZAA 4CYAA 5ERJA 3NP2X 1DVBA 3Q4QA 3PW8C 2HR5A 4XKTA 4Y08A 5LG8A 4TODA 3GHQA 5HJFA 2VZBA 2G4HA 2V2RA 4TOCA 2V2SA 4ZMCA 4AM4A 5J93A 1Z6OM 4E6KA 1JYBA 3VNXA 2FG4A 3RAVA 2XJNA 5FFEA 4ML5A 1TKOA 2CEIA 3KA3A 3ISFA 3PVRB 3O7RA 4TOAA 1VLGA 1B71A 3QZ3A 5GU0X 4MUDA 1GWGA 5D8QA 3QD8A 4CVRA
chains in the Genus database with same CATH superfamily
4TOBA 2Y3QA 3PVRA 4E40A 2V2OA 2CF7A 2YW6A 3PW1A 2JD70 5GU3X 3E1PA 5IX6A 1BG7A 3E1LA 3AK9A 3F36A 1NF6A 1VEQA 2ZA7A 4AM5A 3SH6A 1L8IA 2VXXA 2CHIA 4II4B 2HTNA 4M32A 4RC5A 2W0OA 3BVKA 3E1JA 2BK6A 2V8UA 5HU6D 2C2UA 1IERA 4LQNA 2QF9A 3UOIA 3R2KA 2OKCA 5E2DA 2G38B 1BFRA 1AEWA 3MPSA 4TOFA 4EVEA 2OH3A 1JREA 2XKQA 3TA8A 3V3KB 4DASA 3ISEA 1O9IA 5LG2A 2F7NA 3WVVA 1TJOA 1HRSA 5GN8A 3QHCA 2JD80 3ERZA 4EVDA 4KVRA 5FFAA 3PWQA 5CMQA 3EGMA 2X170 4M34A 4RC6B 2FL0A 1RCEA 4CVSA 3BKNA 2UX1A 2V2LA 4RC7A 4EVBA 5FEJA 5FFBA 1MFRA 5AXSA 5J8SA 2IU2A 2V2JA 3Q4OA 3QHBA 4LPNA 4DYYA 1ZS3A 3W54A 1ZUJA 2RBDA 1NFVA 1RYTA 4DYZA 5LS9A 4QUWA 3C23A 3M6JA 1SQ3A 4LYUA 4A25A 4KVSA 4REUA 4XKUA 2Z5RA 1L8HA 4ZKXA 3E1MA 3SE1A 2FG8A 4CVTA 3F38A 4IWJA 3AJPA 2IY4A 4DYUA 5FFCA 2BKCA 2Z5QA 3N6OA 3QVDA 3OGHA 3KHKA 4LPJA 3KX9A 3R2HA 1VJXA 2V2IA 2XJMA 3EZUA 4LPMA 5J8WA 1FHAA 1QGHA 2V8TA 1JTSA 4ZJKA 4ISMA 3RD0A 3E1NA 2MGYA 3WVUA 1OTKA 3PW1B 4PG0A 4OYNA 4ISPA 2FZFA 5K53A 3C21A 3F39A 4W4LB 3NOZX 4DI0A 3A68A 5JDOB 4R42A 3HIUA 1S3QA 3AJQA 1TKPA 4KVQA 2Z6MA 3FRSA 2YW7A 4RC5B 2ITBA 4AM2A 1IESA 5JDOA 3EZ0A 2QQYA 4LYXA 5JACA 3R2SA 2FKZA 4MY7A 3SIDA 3KDQA 3NP0X 3FVBA 2XJOA 3FRRA 3RBCA 3UOFA 3PVYA 4CVPA 2BJYA 5GU2X 5E1UA 3E1QA 3BVFA 2CHPA 3R2MA 3PW8A 3H7GA 4M33A 3R2LA 1Z6OA 1NF4A 4RC8A 5K52A 1YV1A 3U90A 4WJG4 4Z5SA 3F37A 2Y44A 2N02A 3BVEA 4Z3BA 3Q4NA 2XGWA 3KA4A 5GN8B 1O9RA 2D5KA 3KA6A 3O7SA 1JI4A 2YJKA 3T9JA 4MJYA 4LQHA 3LKDA 1JIGA 5FFDA 4W4KB 2FJCA 3JZAB 4RC7B 2WWXB 4ITTA 2FFXJ 4X0JA 3IS7A 1RCIA 3UNOA 5JKMA 2ZA6A 5D8PA 4ZL5A 1S30A 3F33A 2C41A 2V2PA 3KA8A 2AR0A 2ZG9X 3E1OA 5CZUA 3VV9A 5JKLA 1YUXA 2OC5A 4CY9A 2ZG8X 1LKPA 3PVTA 5CMRA 2GYQA 4ZTTA 1DPSA 4ZKWA 1KRQA 2CIHA 3AF8X 1JGCA 3HL1A 3UFBA 1QYBA 4EVCA 4P18A 1JKVA 4CMYV 2Z90A 3GGYA 3E6SA 3WVWA 4CMYA 3L0MA 2CN7A 1BCFA 4DZ0A 4ZLWA 4ITWA 3SHXA 5ERKA 2IB0A 3OJ5A 1SOFA 1TK6A 3AF7X 5J9VA 1XZ1A 1VELA 2V2MA 3RGDA 1RCDA 3R2OA 5JKMG 2ZA8A 1J30A 3C1YA 4LQJA 2CLBA 4XKSA 4MN9A 2C2JA 2C6RA 3KWOA 4MXPA 5JKLG 3IQ1A 4PGIA 2WLUA 5GOUA 4ETRA 4YXJA 4TOHA 3AK8A 3GGZA 4CYBA 3PVYB 2YJJA 3AJOA 4IWKA 1F33A 1F30A 4PG1A 3PWQC 5LBHA 4PGKA 2C2FA 1EUMA 2VXIA 5C6FA 5D8XA 2CN6A 2CLUA 3GE4A 3ES3A 3Q4RA 1UMNA 1UVHA 5D8RA 3F32A 5I4JA 4M35A 4KXRB 4ZL6A 4TW3A 3AF9X 1R03A 1YUZA 2GYDA 1LKOA 1XZ3A 1RCGA 4ERUA 3GVYA 3E6RA 2PYBA 3A9QA 4ZKHA 3RE7A 4MKUA 3F34A 4II4A 3R2RA 4YXMA 4DE6A 4IXKA 3IS8A 3FSEA 2ZG7X 4YKHA 4U3GA 3KXUA 1JKUA 3WNWA 1NNQA 3BT5A 2GS4A 2ZURX 1DATA 2BW1A 1RCCA 3PVTB 3BVIA 2WLAA 3PWFA 3E2CA 3KA9A 4YVZA 3DBYA 2Z5PA 3D19A 4TOEA 2CWLA 2V15A 5HQOA 5D8OA 2JD60 4RC6A 1LB3A 3JZ9A 3BVLA 4TOGA 2FHAA 3FI6A 1H96A 5D8YA 4TO9A 4LQVA 4XGSA 5D8SA 1Z4AA 5GU1X 1VEIA 1JI5A 3QB9A 1LKMA 1N1QA 1S2ZA 3F35A 5HJHA 2WTLA 4DYXA 2V2NA 1MOJA 3PZAA 4CYAA 5ERJA 3NP2X 1DVBA 3Q4QA 3PW8C 2HR5A 4XKTA 4Y08A 3C1ZA 5LG8A 4TODA 3GHQA 5HJFA 3VVAA 2VZBA 2G4HA 2V2RA 4TOCA 2V2SA 4ZMCA 4AM4A 5J93A 1Z6OM 4E6KA 1JYBA 3VNXA 2FG4A 3RAVA 2XJNA 5FFEA 4ML5A 1TKOA 2CEIA 3KA3A 3ISFA 3PVRB 3O7RA 4TOAA 1VLGA 1B71A 3QZ3A 5GU0X 4MUDA 1GWGA 5D8QA 3QD8A 4CVRA
chains in the Genus database with same CATH topology
4TOBA 2Y3QA 3PVRA 4E40A 2V2OA 2CF7A 2YW6A 3PW1A 2JD70 5GU3X 3E1PA 5IX6A 1BG7A 3E1LA 3AK9A 3F36A 1NF6A 1VEQA 2ZA7A 4AM5A 3SH6A 1L8IA 2VXXA 2CHIA 4II4B 2HTNA 4M32A 4RC5A 2W0OA 3BVKA 3E1JA 2BK6A 2V8UA 5HU6D 2C2UA 1IERA 4LQNA 2QF9A 3UOIA 3R2KA 2OKCA 5E2DA 2G38B 1BFRA 1AEWA 3MPSA 4TOFA 4EVEA 2OH3A 1JREA 2XKQA 3TA8A 3V3KB 4DASA 3ISEA 1O9IA 5LG2A 2F7NA 3WVVA 1TJOA 1HRSA 5GN8A 3QHCA 2JD80 3ERZA 4EVDA 4KVRA 5FFAA 3PWQA 5CMQA 3EGMA 2X170 4M34A 4RC6B 2FL0A 1RCEA 4CVSA 3BKNA 2UX1A 2V2LA 4RC7A 4EVBA 5FEJA 5FFBA 1MFRA 5AXSA 5J8SA 2IU2A 2V2JA 3Q4OA 3QHBA 4LPNA 4DYYA 1ZS3A 3W54A 1ZUJA 2RBDA 1NFVA 1RYTA 4DYZA 5LS9A 4QUWA 3C23A 3M6JA 1SQ3A 4LYUA 4A25A 4KVSA 4REUA 4XKUA 2Z5RA 1L8HA 4ZKXA 3E1MA 3SE1A 2FG8A 4CVTA 3F38A 4IWJA 3AJPA 2IY4A 4DYUA 5FFCA 2BKCA 2Z5QA 3N6OA 3QVDA 3OGHA 3KHKA 4LPJA 3KX9A 3R2HA 1VJXA 2V2IA 2XJMA 3EZUA 4LPMA 5J8WA 1FHAA 1QGHA 2V8TA 1JTSA 4ZJKA 4ISMA 3RD0A 3E1NA 2MGYA 3WVUA 1OTKA 3PW1B 4PG0A 4OYNA 4ISPA 2FZFA 5K53A 3C21A 3F39A 4W4LB 3NOZX 4DI0A 3A68A 5JDOB 4R42A 3HIUA 1S3QA 3AJQA 1TKPA 4KVQA 2Z6MA 3FRSA 2YW7A 4RC5B 2ITBA 4AM2A 1IESA 5JDOA 3EZ0A 2QQYA 4LYXA 5JACA 3R2SA 2FKZA 4MY7A 3SIDA 3KDQA 3NP0X 3FVBA 2XJOA 3FRRA 3RBCA 3UOFA 3PVYA 4CVPA 2BJYA 5GU2X 5E1UA 3E1QA 3BVFA 2CHPA 3R2MA 3PW8A 3H7GA 4M33A 3R2LA 1Z6OA 1NF4A 4RC8A 5K52A 1YV1A 3U90A 4WJG4 4Z5SA 3F37A 2Y44A 2N02A 3BVEA 4Z3BA 3Q4NA 2XGWA 3KA4A 5GN8B 1O9RA 2D5KA 3KA6A 3O7SA 1JI4A 2YJKA 3T9JA 4MJYA 4LQHA 3LKDA 1JIGA 5FFDA 4W4KB 2FJCA 3JZAB 4RC7B 2WWXB 4ITTA 2FFXJ 4X0JA 3IS7A 1RCIA 3UNOA 5JKMA 2ZA6A 5D8PA 4ZL5A 1S30A 3F33A 2C41A 2V2PA 3KA8A 2AR0A 2ZG9X 3E1OA 5CZUA 3VV9A 5JKLA 1YUXA 2OC5A 4CY9A 2ZG8X 1LKPA 3PVTA 5CMRA 2GYQA 4ZTTA 1DPSA 4ZKWA 1KRQA 2CIHA 3AF8X 1JGCA 3HL1A 3UFBA 1QYBA 4EVCA 4P18A 1JKVA 4CMYV 2Z90A 3GGYA 3E6SA 3WVWA 4CMYA 3L0MA 2CN7A 1BCFA 4DZ0A 4ZLWA 4ITWA 3SHXA 5ERKA 2IB0A 3OJ5A 1SOFA 1TK6A 3AF7X 5J9VA 1XZ1A 1VELA 2V2MA 3RGDA 1RCDA 3R2OA 5JKMG 2ZA8A 1J30A 3C1YA 4LQJA 2CLBA 4XKSA 4MN9A 2C2JA 2C6RA 3KWOA 4MXPA 5JKLG 3IQ1A 4PGIA 2WLUA 5GOUA 4ETRA 4YXJA 4TOHA 3AK8A 3GGZA 4CYBA 3PVYB 2YJJA 3AJOA 4IWKA 1F33A 1F30A 4PG1A 3PWQC 5LBHA 4PGKA 2C2FA 1EUMA 2VXIA 5C6FA 5D8XA 2CN6A 2CLUA 3GE4A 3ES3A 3Q4RA 1UMNA 1UVHA 5D8RA 3F32A 5I4JA 4M35A 4KXRB 4ZL6A 4TW3A 3AF9X 1R03A 1YUZA 2GYDA 1LKOA 1XZ3A 1RCGA 4ERUA 3GVYA 3E6RA 2PYBA 3A9QA 4ZKHA 3RE7A 4MKUA 3F34A 4II4A 3R2RA 4YXMA 4DE6A 4IXKA 3IS8A 3FSEA 2ZG7X 4YKHA 4U3GA 3KXUA 1JKUA 3WNWA 1NNQA 3BT5A 2GS4A 2ZURX 1DATA 2BW1A 1RCCA 3PVTB 3BVIA 2WLAA 3PWFA 3E2CA 3KA9A 4YVZA 3DBYA 2Z5PA 3D19A 4TOEA 2CWLA 2V15A 5HQOA 5D8OA 2JD60 4RC6A 1LB3A 3JZ9A 3BVLA 4TOGA 2FHAA 3FI6A 1H96A 5D8YA 4TO9A 4LQVA 4XGSA 5D8SA 1Z4AA 5GU1X 1VEIA 1JI5A 3QB9A 1LKMA 1N1QA 1S2ZA 3F35A 5HJHA 2WTLA 4DYXA 2V2NA 1MOJA 3PZAA 4CYAA 5ERJA 3NP2X 1DVBA 3Q4QA 3PW8C 2HR5A 4XKTA 4Y08A 3C1ZA 5LG8A 4TODA 3GHQA 5HJFA 3VVAA 2VZBA 2G4HA 2V2RA 4TOCA 2V2SA 4ZMCA 4AM4A 5J93A 1Z6OM 4E6KA 1JYBA 3VNXA 2FG4A 3RAVA 2XJNA 5FFEA 4ML5A 1TKOA 2CEIA 3KA3A 3ISFA 3PVRB 3O7RA 4TOAA 1VLGA 1B71A 3QZ3A 5GU0X 4MUDA 1GWGA 5D8QA 3QD8A 4CVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TOB A;  2Y3Q A;  3PVR A;  2V2O A;  2CF7 A;  2YW6 A;  3PW1 A;  2JD7 0;  5GU3 X;  3E1P A;  5IX6 A;  1BG7 A;  3E1L A;  3AK9 A;  3F36 A;  1NF6 A;  1VEQ A;  2ZA7 A;  4AM5 A;  3SH6 A;  1L8I A;  2VXX A;  2CHI A;  4II4 B;  2HTN A;  4M32 A;  4RC5 A;  2W0O A;  3BVK A;  3E1J A;  2BK6 A;  2C2U A;  1IER A;  4LQN A;  2QF9 A;  3UOI A;  3R2K A;  5E2D A;  1BFR A;  1AEW A;  3MPS A;  4TOF A;  4EVE A;  2OH3 A;  1JRE A;  2XKQ A;  3TA8 A;  4DAS A;  3ISE A;  1O9I A;  5LG2 A;  2F7N A;  3WVV A;  1TJO A;  1HRS A;  5GN8 A;  3QHC A;  2JD8 0;  3ERZ A;  4EVD A;  4KVR A;  5FFA A;  3PWQ A;  5CMQ A;  3EGM A;  2X17 0;  4M34 A;  4RC6 B;  2FL0 A;  1RCE A;  4CVS A;  3BKN A;  2UX1 A;  2V2L A;  4RC7 A;  4EVB A;  5FEJ A;  5FFB A;  1MFR A;  5AXS A;  5J8S A;  2IU2 A;  2V2J A;  3Q4O A;  3QHB A;  4LPN A;  4DYY A;  1ZS3 A;  1ZUJ A;  2RBD A;  1NFV A;  1RYT A;  4DYZ A;  5LS9 A;  4QUW A;  1SQ3 A;  4LYU A;  4A25 A;  4KVS A;  4REU A;  4XKU A;  2Z5R A;  1L8H A;  4ZKX A;  3E1M A;  3SE1 A;  2FG8 A;  4CVT A;  3F38 A;  4IWJ A;  3AJP A;  2IY4 A;  4DYU A;  5FFC A;  2BKC A;  2Z5Q A;  3QVD A;  3OGH A;  4LPJ A;  3KX9 A;  3R2H A;  1VJX A;  2V2I A;  2XJM A;  3EZU A;  4LPM A;  5J8W A;  1FHA A;  1QGH A;  1JTS A;  4ZJK A;  4ISM A;  3RD0 A;  3E1N A;  3WVU A;  1OTK A;  3PW1 B;  4PG0 A;  4OYN A;  4ISP A;  2FZF A;  5K53 A;  3F39 A;  3NOZ X;  4DI0 A;  3A68 A;  4R42 A;  3HIU A;  1S3Q A;  3AJQ A;  1TKP A;  4KVQ A;  2Z6M A;  2YW7 A;  4RC5 B;  2ITB A;  4AM2 A;  1IES A;  3EZ0 A;  2QQY A;  4LYX A;  5JAC A;  3R2S A;  2FKZ A;  4MY7 A;  3SID A;  3NP0 X;  3FVB A;  2XJO A;  3RBC A;  3UOF A;  3PVY A;  4CVP A;  2BJY A;  5GU2 X;  5E1U A;  3E1Q A;  3BVF A;  2CHP A;  3R2M A;  3PW8 A;  3H7G A;  4M33 A;  3R2L A;  1Z6O A;  1NF4 A;  4RC8 A;  5K52 A;  1YV1 A;  3U90 A;  4Z5S A;  3F37 A;  3BVE A;  4Z3B A;  3Q4N A;  2XGW A;  3KA4 A;  5GN8 B;  1O9R A;  2D5K A;  3KA6 A;  3O7S A;  1JI4 A;  2YJK A;  3T9J A;  4MJY A;  4LQH A;  1JIG A;  5FFD A;  2FJC A;  4RC7 B;  4ITT A;  2FFX J;  3IS7 A;  1RCI A;  3UNO A;  5JKM A;  2ZA6 A;  5D8P A;  4ZL5 A;  1S30 A;  3F33 A;  2C41 A;  2V2P A;  3KA8 A;  2ZG9 X;  3E1O A;  5CZU A;  5JKL A;  1YUX A;  2OC5 A;  4CY9 A;  2ZG8 X;  1LKP A;  3PVT A;  5CMR A;  2GYQ A;  4ZTT A;  1DPS A;  4ZKW A;  1KRQ A;  2CIH A;  3AF8 X;  1JGC A;  3HL1 A;  1QYB A;  4EVC A;  4P18 A;  1JKV A;  4CMY V;  2Z90 A;  3E6S A;  3WVW A;  4CMY A;  2CN7 A;  1BCF A;  4DZ0 A;  4ZLW A;  4ITW A;  3SHX A;  5ERK A;  2IB0 A;  3OJ5 A;  1SOF A;  1TK6 A;  3AF7 X;  5J9V A;  1XZ1 A;  1VEL A;  2V2M A;  3RGD A;  1RCD A;  3R2O A;  5JKM G;  2ZA8 A;  1J30 A;  4LQJ A;  2CLB A;  4XKS A;  4MN9 A;  2C2J A;  2C6R A;  3KWO A;  5JKL G;  3IQ1 A;  4PGI A;  2WLU A;  5GOU A;  4ETR A;  4TOH A;  3AK8 A;  4CYB A;  3PVY B;  2YJJ A;  3AJO A;  4IWK A;  1F33 A;  1F30 A;  4PG1 A;  3PWQ C;  5LBH A;  4PGK A;  2C2F A;  1EUM A;  2VXI A;  5C6F A;  5D8X A;  2CN6 A;  2CLU A;  3GE4 A;  3ES3 A;  3Q4R A;  1UMN A;  1UVH A;  5D8R A;  3F32 A;  5I4J A;  4M35 A;  4ZL6 A;  4TW3 A;  3AF9 X;  1R03 A;  1YUZ A;  2GYD A;  1LKO A;  1XZ3 A;  1RCG A;  4ERU A;  3GVY A;  3E6R A;  2PYB A;  3A9Q A;  4ZKH A;  3RE7 A;  4MKU A;  3F34 A;  4II4 A;  3R2R A;  4DE6 A;  4IXK A;  3IS8 A;  3FSE A;  2ZG7 X;  4YKH A;  4U3G A;  3KXU A;  1JKU A;  3WNW A;  1NNQ A;  3BT5 A;  2GS4 A;  2ZUR X;  1DAT A;  2BW1 A;  1RCC A;  3PVT B;  3BVI A;  2WLA A;  3PWF A;  3E2C A;  3KA9 A;  2Z5P A;  4TOE A;  2V15 A;  5HQO A;  5D8O A;  2JD6 0;  4RC6 A;  1LB3 A;  3BVL A;  4TOG A;  2FHA A;  3FI6 A;  1H96 A;  5D8Y A;  4TO9 A;  4LQV A;  4XGS A;  5D8S A;  1Z4A A;  5GU1 X;  1VEI A;  1JI5 A;  3QB9 A;  1LKM A;  1N1Q A;  1S2Z A;  3F35 A;  5HJH A;  2WTL A;  4DYX A;  2V2N A;  1MOJ A;  3PZA A;  4CYA A;  5ERJ A;  3NP2 X;  1DVB A;  3Q4Q A;  3PW8 C;  2HR5 A;  4XKT A;  4Y08 A;  5LG8 A;  4TOD A;  3GHQ A;  5HJF A;  2VZB A;  2G4H A;  2V2R A;  4TOC A;  2V2S A;  4ZMC A;  4AM4 A;  5J93 A;  1Z6O M;  4E6K A;  1JYB A;  3VNX A;  2FG4 A;  3RAV A;  2XJN A;  5FFE A;  4ML5 A;  1TKO A;  2CEI A;  3KA3 A;  3ISF A;  3PVR B;  3O7R A;  4TOA A;  1VLG A;  1B71 A;  3QZ3 A;  5GU0 X;  4MUD A;  1GWG A;  5D8Q A;  3QD8 A;  4CVR A; 
#chains in the Genus database with same CATH topology
 4TOB A;  2Y3Q A;  3PVR A;  4E40 A;  2V2O A;  2CF7 A;  2YW6 A;  3PW1 A;  2JD7 0;  5GU3 X;  3E1P A;  5IX6 A;  1BG7 A;  3E1L A;  3AK9 A;  3F36 A;  1NF6 A;  1VEQ A;  2ZA7 A;  4AM5 A;  3SH6 A;  1L8I A;  2VXX A;  2CHI A;  4II4 B;  2HTN A;  4M32 A;  4RC5 A;  2W0O A;  3BVK A;  3E1J A;  2BK6 A;  2V8U A;  5HU6 D;  2C2U A;  1IER A;  4LQN A;  2QF9 A;  3UOI A;  3R2K A;  2OKC A;  5E2D A;  2G38 B;  1BFR A;  1AEW A;  3MPS A;  4TOF A;  4EVE A;  2OH3 A;  1JRE A;  2XKQ A;  3TA8 A;  3V3K B;  4DAS A;  3ISE A;  1O9I A;  5LG2 A;  2F7N A;  3WVV A;  1TJO A;  1HRS A;  5GN8 A;  3QHC A;  2JD8 0;  3ERZ A;  4EVD A;  4KVR A;  5FFA A;  3PWQ A;  5CMQ A;  3EGM A;  2X17 0;  4M34 A;  4RC6 B;  2FL0 A;  1RCE A;  4CVS A;  3BKN A;  2UX1 A;  2V2L A;  4RC7 A;  4EVB A;  5FEJ A;  5FFB A;  1MFR A;  5AXS A;  5J8S A;  2IU2 A;  2V2J A;  3Q4O A;  3QHB A;  4LPN A;  4DYY A;  1ZS3 A;  3W54 A;  1ZUJ A;  2RBD A;  1NFV A;  1RYT A;  4DYZ A;  5LS9 A;  4QUW A;  3C23 A;  3M6J A;  1SQ3 A;  4LYU A;  4A25 A;  4KVS A;  4REU A;  4XKU A;  2Z5R A;  1L8H A;  4ZKX A;  3E1M A;  3SE1 A;  2FG8 A;  4CVT A;  3F38 A;  4IWJ A;  3AJP A;  2IY4 A;  4DYU A;  5FFC A;  2BKC A;  2Z5Q A;  3N6O A;  3QVD A;  3OGH A;  3KHK A;  4LPJ A;  3KX9 A;  3R2H A;  1VJX A;  2V2I A;  2XJM A;  3EZU A;  4LPM A;  5J8W A;  1FHA A;  1QGH A;  2V8T A;  1JTS A;  4ZJK A;  4ISM A;  3RD0 A;  3E1N A;  2MGY A;  3WVU A;  1OTK A;  3PW1 B;  4PG0 A;  4OYN A;  4ISP A;  2FZF A;  5K53 A;  3C21 A;  3F39 A;  4W4L B;  3NOZ X;  4DI0 A;  3A68 A;  5JDO B;  4R42 A;  3HIU A;  1S3Q A;  3AJQ A;  1TKP A;  4KVQ A;  2Z6M A;  3FRS A;  2YW7 A;  4RC5 B;  2ITB A;  4AM2 A;  1IES A;  5JDO A;  3EZ0 A;  2QQY A;  4LYX A;  5JAC A;  3R2S A;  2FKZ A;  4MY7 A;  3SID A;  3KDQ A;  3NP0 X;  3FVB A;  2XJO A;  3FRR A;  3RBC A;  3UOF A;  3PVY A;  4CVP A;  2BJY A;  5GU2 X;  5E1U A;  3E1Q A;  3BVF A;  2CHP A;  3R2M A;  3PW8 A;  3H7G A;  4M33 A;  3R2L A;  1Z6O A;  1NF4 A;  4RC8 A;  5K52 A;  1YV1 A;  3U90 A;  4WJG 4;  4Z5S A;  3F37 A;  2Y44 A;  2N02 A;  3BVE A;  4Z3B A;  3Q4N A;  2XGW A;  3KA4 A;  5GN8 B;  1O9R A;  2D5K A;  3KA6 A;  3O7S A;  1JI4 A;  2YJK A;  3T9J A;  4MJY A;  4LQH A;  3LKD A;  1JIG A;  5FFD A;  4W4K B;  2FJC A;  3JZA B;  4RC7 B;  2WWX B;  4ITT A;  2FFX J;  4X0J A;  3IS7 A;  1RCI A;  3UNO A;  5JKM A;  2ZA6 A;  5D8P A;  4ZL5 A;  1S30 A;  3F33 A;  2C41 A;  2V2P A;  3KA8 A;  2AR0 A;  2ZG9 X;  3E1O A;  5CZU A;  3VV9 A;  5JKL A;  1YUX A;  2OC5 A;  4CY9 A;  2ZG8 X;  1LKP A;  3PVT A;  5CMR A;  2GYQ A;  4ZTT A;  1DPS A;  4ZKW A;  1KRQ A;  2CIH A;  3AF8 X;  1JGC A;  3HL1 A;  3UFB A;  1QYB A;  4EVC A;  4P18 A;  1JKV A;  4CMY V;  2Z90 A;  3GGY A;  3E6S A;  3WVW A;  4CMY A;  3L0M A;  2CN7 A;  1BCF A;  4DZ0 A;  4ZLW A;  4ITW A;  3SHX A;  5ERK A;  2IB0 A;  3OJ5 A;  1SOF A;  1TK6 A;  3AF7 X;  5J9V A;  1XZ1 A;  1VEL A;  2V2M A;  3RGD A;  1RCD A;  3R2O A;  5JKM G;  2ZA8 A;  1J30 A;  3C1Y A;  4LQJ A;  2CLB A;  4XKS A;  4MN9 A;  2C2J A;  2C6R A;  3KWO A;  4MXP A;  5JKL G;  3IQ1 A;  4PGI A;  2WLU A;  5GOU A;  4ETR A;  4YXJ A;  4TOH A;  3AK8 A;  3GGZ A;  4CYB A;  3PVY B;  2YJJ A;  3AJO A;  4IWK A;  1F33 A;  1F30 A;  4PG1 A;  3PWQ C;  5LBH A;  4PGK A;  2C2F A;  1EUM A;  2VXI A;  5C6F A;  5D8X A;  2CN6 A;  2CLU A;  3GE4 A;  3ES3 A;  3Q4R A;  1UMN A;  1UVH A;  5D8R A;  3F32 A;  5I4J A;  4M35 A;  4KXR B;  4ZL6 A;  4TW3 A;  3AF9 X;  1R03 A;  1YUZ A;  2GYD A;  1LKO A;  1XZ3 A;  1RCG A;  4ERU A;  3GVY A;  3E6R A;  2PYB A;  3A9Q A;  4ZKH A;  3RE7 A;  4MKU A;  3F34 A;  4II4 A;  3R2R A;  4YXM A;  4DE6 A;  4IXK A;  3IS8 A;  3FSE A;  2ZG7 X;  4YKH A;  4U3G A;  3KXU A;  1JKU A;  3WNW A;  1NNQ A;  3BT5 A;  2GS4 A;  2ZUR X;  1DAT A;  2BW1 A;  1RCC A;  3PVT B;  3BVI A;  2WLA A;  3PWF A;  3E2C A;  3KA9 A;  4YVZ A;  3DBY A;  2Z5P A;  3D19 A;  4TOE A;  2CWL A;  2V15 A;  5HQO A;  5D8O A;  2JD6 0;  4RC6 A;  1LB3 A;  3JZ9 A;  3BVL A;  4TOG A;  2FHA A;  3FI6 A;  1H96 A;  5D8Y A;  4TO9 A;  4LQV A;  4XGS A;  5D8S A;  1Z4A A;  5GU1 X;  1VEI A;  1JI5 A;  3QB9 A;  1LKM A;  1N1Q A;  1S2Z A;  3F35 A;  5HJH A;  2WTL A;  4DYX A;  2V2N A;  1MOJ A;  3PZA A;  4CYA A;  5ERJ A;  3NP2 X;  1DVB A;  3Q4Q A;  3PW8 C;  2HR5 A;  4XKT A;  4Y08 A;  3C1Z A;  5LG8 A;  4TOD A;  3GHQ A;  5HJF A;  3VVA A;  2VZB A;  2G4H A;  2V2R A;  4TOC A;  2V2S A;  4ZMC A;  4AM4 A;  5J93 A;  1Z6O M;  4E6K A;  1JYB A;  3VNX A;  2FG4 A;  3RAV A;  2XJN A;  5FFE A;  4ML5 A;  1TKO A;  2CEI A;  3KA3 A;  3ISF A;  3PVR B;  3O7R A;  4TOA A;  1VLG A;  1B71 A;  3QZ3 A;  5GU0 X;  4MUD A;  1GWG A;  5D8Q A;  3QD8 A;  4CVR A; 
#chains in the Genus database with same CATH homology
 4TOB A;  2Y3Q A;  3PVR A;  4E40 A;  2V2O A;  2CF7 A;  2YW6 A;  3PW1 A;  2JD7 0;  5GU3 X;  3E1P A;  5IX6 A;  1BG7 A;  3E1L A;  3AK9 A;  3F36 A;  1NF6 A;  1VEQ A;  2ZA7 A;  4AM5 A;  3SH6 A;  1L8I A;  2VXX A;  2CHI A;  4II4 B;  2HTN A;  4M32 A;  4RC5 A;  2W0O A;  3BVK A;  3E1J A;  2BK6 A;  2V8U A;  5HU6 D;  2C2U A;  1IER A;  4LQN A;  2QF9 A;  3UOI A;  3R2K A;  2OKC A;  5E2D A;  2G38 B;  1BFR A;  1AEW A;  3MPS A;  4TOF A;  4EVE A;  2OH3 A;  1JRE A;  2XKQ A;  3TA8 A;  3V3K B;  4DAS A;  3ISE A;  1O9I A;  5LG2 A;  2F7N A;  3WVV A;  1TJO A;  1HRS A;  5GN8 A;  3QHC A;  2JD8 0;  3ERZ A;  4EVD A;  4KVR A;  5FFA A;  3PWQ A;  5CMQ A;  3EGM A;  2X17 0;  4M34 A;  4RC6 B;  2FL0 A;  1RCE A;  4CVS A;  3BKN A;  2UX1 A;  2V2L A;  4RC7 A;  4EVB A;  5FEJ A;  5FFB A;  1MFR A;  5AXS A;  5J8S A;  2IU2 A;  2V2J A;  3Q4O A;  3QHB A;  4LPN A;  4DYY A;  1ZS3 A;  3W54 A;  1ZUJ A;  2RBD A;  1NFV A;  1RYT A;  4DYZ A;  5LS9 A;  4QUW A;  3C23 A;  3M6J A;  1SQ3 A;  4LYU A;  4A25 A;  4KVS A;  4REU A;  4XKU A;  2Z5R A;  1L8H A;  4ZKX A;  3E1M A;  3SE1 A;  2FG8 A;  4CVT A;  3F38 A;  4IWJ A;  3AJP A;  2IY4 A;  4DYU A;  5FFC A;  2BKC A;  2Z5Q A;  3N6O A;  3QVD A;  3OGH A;  3KHK A;  4LPJ A;  3KX9 A;  3R2H A;  1VJX A;  2V2I A;  2XJM A;  3EZU A;  4LPM A;  5J8W A;  1FHA A;  1QGH A;  2V8T A;  1JTS A;  4ZJK A;  4ISM A;  3RD0 A;  3E1N A;  2MGY A;  3WVU A;  1OTK A;  3PW1 B;  4PG0 A;  4OYN A;  4ISP A;  2FZF A;  5K53 A;  3C21 A;  3F39 A;  4W4L B;  3NOZ X;  4DI0 A;  3A68 A;  5JDO B;  4R42 A;  3HIU A;  1S3Q A;  3AJQ A;  1TKP A;  4KVQ A;  2Z6M A;  3FRS A;  2YW7 A;  4RC5 B;  2ITB A;  4AM2 A;  1IES A;  5JDO A;  3EZ0 A;  2QQY A;  4LYX A;  5JAC A;  3R2S A;  2FKZ A;  4MY7 A;  3SID A;  3KDQ A;  3NP0 X;  3FVB A;  2XJO A;  3FRR A;  3RBC A;  3UOF A;  3PVY A;  4CVP A;  2BJY A;  5GU2 X;  5E1U A;  3E1Q A;  3BVF A;  2CHP A;  3R2M A;  3PW8 A;  3H7G A;  4M33 A;  3R2L A;  1Z6O A;  1NF4 A;  4RC8 A;  5K52 A;  1YV1 A;  3U90 A;  4WJG 4;  4Z5S A;  3F37 A;  2Y44 A;  2N02 A;  3BVE A;  4Z3B A;  3Q4N A;  2XGW A;  3KA4 A;  5GN8 B;  1O9R A;  2D5K A;  3KA6 A;  3O7S A;  1JI4 A;  2YJK A;  3T9J A;  4MJY A;  4LQH A;  3LKD A;  1JIG A;  5FFD A;  4W4K B;  2FJC A;  3JZA B;  4RC7 B;  2WWX B;  4ITT A;  2FFX J;  4X0J A;  3IS7 A;  1RCI A;  3UNO A;  5JKM A;  2ZA6 A;  5D8P A;  4ZL5 A;  1S30 A;  3F33 A;  2C41 A;  2V2P A;  3KA8 A;  2AR0 A;  2ZG9 X;  3E1O A;  5CZU A;  3VV9 A;  5JKL A;  1YUX A;  2OC5 A;  4CY9 A;  2ZG8 X;  1LKP A;  3PVT A;  5CMR A;  2GYQ A;  4ZTT A;  1DPS A;  4ZKW A;  1KRQ A;  2CIH A;  3AF8 X;  1JGC A;  3HL1 A;  3UFB A;  1QYB A;  4EVC A;  4P18 A;  1JKV A;  4CMY V;  2Z90 A;  3GGY A;  3E6S A;  3WVW A;  4CMY A;  3L0M A;  2CN7 A;  1BCF A;  4DZ0 A;  4ZLW A;  4ITW A;  3SHX A;  5ERK A;  2IB0 A;  3OJ5 A;  1SOF A;  1TK6 A;  3AF7 X;  5J9V A;  1XZ1 A;  1VEL A;  2V2M A;  3RGD A;  1RCD A;  3R2O A;  5JKM G;  2ZA8 A;  1J30 A;  3C1Y A;  4LQJ A;  2CLB A;  4XKS A;  4MN9 A;  2C2J A;  2C6R A;  3KWO A;  4MXP A;  5JKL G;  3IQ1 A;  4PGI A;  2WLU A;  5GOU A;  4ETR A;  4YXJ A;  4TOH A;  3AK8 A;  3GGZ A;  4CYB A;  3PVY B;  2YJJ A;  3AJO A;  4IWK A;  1F33 A;  1F30 A;  4PG1 A;  3PWQ C;  5LBH A;  4PGK A;  2C2F A;  1EUM A;  2VXI A;  5C6F A;  5D8X A;  2CN6 A;  2CLU A;  3GE4 A;  3ES3 A;  3Q4R A;  1UMN A;  1UVH A;  5D8R A;  3F32 A;  5I4J A;  4M35 A;  4KXR B;  4ZL6 A;  4TW3 A;  3AF9 X;  1R03 A;  1YUZ A;  2GYD A;  1LKO A;  1XZ3 A;  1RCG A;  4ERU A;  3GVY A;  3E6R A;  2PYB A;  3A9Q A;  4ZKH A;  3RE7 A;  4MKU A;  3F34 A;  4II4 A;  3R2R A;  4YXM A;  4DE6 A;  4IXK A;  3IS8 A;  3FSE A;  2ZG7 X;  4YKH A;  4U3G A;  3KXU A;  1JKU A;  3WNW A;  1NNQ A;  3BT5 A;  2GS4 A;  2ZUR X;  1DAT A;  2BW1 A;  1RCC A;  3PVT B;  3BVI A;  2WLA A;  3PWF A;  3E2C A;  3KA9 A;  4YVZ A;  3DBY A;  2Z5P A;  3D19 A;  4TOE A;  2CWL A;  2V15 A;  5HQO A;  5D8O A;  2JD6 0;  4RC6 A;  1LB3 A;  3JZ9 A;  3BVL A;  4TOG A;  2FHA A;  3FI6 A;  1H96 A;  5D8Y A;  4TO9 A;  4LQV A;  4XGS A;  5D8S A;  1Z4A A;  5GU1 X;  1VEI A;  1JI5 A;  3QB9 A;  1LKM A;  1N1Q A;  1S2Z A;  3F35 A;  5HJH A;  2WTL A;  4DYX A;  2V2N A;  1MOJ A;  3PZA A;  4CYA A;  5ERJ A;  3NP2 X;  1DVB A;  3Q4Q A;  3PW8 C;  2HR5 A;  4XKT A;  4Y08 A;  3C1Z A;  5LG8 A;  4TOD A;  3GHQ A;  5HJF A;  3VVA A;  2VZB A;  2G4H A;  2V2R A;  4TOC A;  2V2S A;  4ZMC A;  4AM4 A;  5J93 A;  1Z6O M;  4E6K A;  1JYB A;  3VNX A;  2FG4 A;  3RAV A;  2XJN A;  5FFE A;  4ML5 A;  1TKO A;  2CEI A;  3KA3 A;  3ISF A;  3PVR B;  3O7R A;  4TOA A;  1VLG A;  1B71 A;  3QZ3 A;  5GU0 X;  4MUD A;  1GWG A;  5D8Q A;  3QD8 A;  4CVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...